F488813

General Info

Members Datasets Scaffolds Average Seq Length
1040 375 1040 146

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10735610|Ga0105243_107356102
Length 177
Sequence MPRKRAESSRVRAYTVNSIFRREQIVEAPNINRVVITGNLTRDPELRSTPNNGMSICSLRVAVNGRKKDPDSGQWVDKPNYFDVTVFGAQGENCAQYLSKGRPVAVEGRLNWREWEAQDGGKRQSVDIIADTVQFLGSRDAAPQSNGVVESDVPADTSDFQEAGVAGGXXKDDDIPF

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
245 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
326 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 4.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 7.21
Rhizosphere 87.79
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1041288 3300000549 Bacteria 547
2 JGI24738J21930_10003699 3300002075 Bacteria 3827
3 JGI24744J21845_10048405 3300002077 Bacteria 786
4 JGI24034J26672_10000335 3300002239 Bacteria 6050
5 JGI24742J22300_10013846 3300002244 Bacteria 1352
6 JGI25406J46586_10004410 3300003203 Bacteria 6554
7 JGI25407J50210_10064186 3300003373 Bacteria 920
8 Ga0058863_11900107 3300004799 Unclassified 1051
9 Ga0058863_11942618 3300004799 Bacteria 897
10 Ga0058861_10018033 3300004800 Unclassified 595
11 Ga0058861_10095910 3300004800 Bacteria 995
12 Ga0058862_12871359 3300004803 Unclassified 616
13 Ga0070658_10020698 3300005327 Bacteria 5270
14 Ga0070658_10136115 3300005327 Bacteria 2050
15 Ga0070658_10192327 3300005327 Bacteria 1720
16 Ga0070658_10928120 3300005327 Bacteria 757
17 Ga0070683_100023952 3300005329 Bacteria 5464
18 Ga0070683_100027055 3300005329 Bacteria 5169
19 Ga0070683_100055916 3300005329 Bacteria 3663
20 Ga0070683_100197337 3300005329 Bacteria 1911
21 Ga0070683_100361528 3300005329 Bacteria 1382
22 Ga0070683_100381673 3300005329 Bacteria 1343
23 Ga0070683_101217807 3300005329 Bacteria 723
24 Ga0070690_100372389 3300005330 Bacteria 1042
25 Ga0070690_101148090 3300005330 Bacteria 618
26 Ga0070690_101239554 3300005330 Bacteria 596
27 Ga0070670_100011812 3300005331 Bacteria 7467
28 Ga0070670_100224949 3300005331 Bacteria 1633
29 Ga0068869_100101392 3300005334 Bacteria 2177
30 Ga0068869_100779971 3300005334 Bacteria 820
31 Ga0068869_100809000 3300005334 Bacteria 806
32 Ga0068869_101337302 3300005334 Bacteria 633
33 Ga0070680_100013514 3300005336 Bacteria 6359
34 Ga0070680_100417420 3300005336 Bacteria 1145
35 Ga0070680_101561444 3300005336 Bacteria 572
36 Ga0070682_100005793 3300005337 Bacteria 6898
37 Ga0070682_100077760 3300005337 Bacteria 2139
38 Ga0070682_100103473 3300005337 Bacteria 1884
39 Ga0070682_100738657 3300005337 Unclassified 793
40 Ga0068868_100000741 3300005338 Bacteria 22121
41 Ga0068868_100017477 3300005338 Bacteria 5346
42 Ga0068868_100184292 3300005338 Bacteria 1733
43 Ga0068868_100860305 3300005338 Bacteria 822
44 Ga0070660_100003054 3300005339 Bacteria 11522
45 Ga0070660_100008259 3300005339 Bacteria 7277
46 Ga0070660_100027936 3300005339 Bacteria 4216
47 Ga0070660_100853618 3300005339 Unclassified 767
48 Ga0070689_100076737 3300005340 Bacteria 2618
49 Ga0070689_100712527 3300005340 Unclassified 877
50 Ga0070689_101510792 3300005340 Unclassified 608
51 Ga0070691_10134445 3300005341 Bacteria 1255
52 Ga0070691_10252833 3300005341 Bacteria 946
53 Ga0070691_10301873 3300005341 Unclassified 875
54 Ga0070691_10311047 3300005341 Bacteria 864
55 Ga0070687_100348615 3300005343 Bacteria 955
56 Ga0070661_100031733 3300005344 Bacteria 3821
57 Ga0070661_100032298 3300005344 Bacteria 3789
58 Ga0070661_100243727 3300005344 Bacteria 1385
59 Ga0070661_100334113 3300005344 Bacteria 1186
60 Ga0070661_101309255 3300005344 Bacteria 608
61 Ga0070692_10003022 3300005345 Bacteria 6707
62 Ga0070692_10006250 3300005345 Bacteria 5159
63 Ga0070692_10014157 3300005345 Bacteria 3737
64 Ga0070692_10114640 3300005345 Bacteria 1495
65 Ga0070668_100031904 3300005347 Bacteria 4009
66 Ga0070668_100089905 3300005347 Bacteria 2419
67 Ga0070675_100007308 3300005354 Bacteria 8524
68 Ga0070675_100167077 3300005354 Bacteria 1895
69 Ga0070675_101433240 3300005354 Bacteria 637
70 Ga0070671_100671685 3300005355 Unclassified 898
71 Ga0070671_100957844 3300005355 Bacteria 749
72 Ga0070674_100002696 3300005356 Bacteria 9824
73 Ga0070674_100021607 3300005356 Bacteria 4136
74 Ga0070674_100054232 3300005356 Bacteria 2772
75 Ga0070674_100144727 3300005356 Bacteria 1788
76 Ga0070674_101086001 3300005356 Bacteria 706
77 Ga0070673_100043613 3300005364 Bacteria 3467
78 Ga0070673_100432843 3300005364 Bacteria 1181
79 Ga0070688_100000344 3300005365 Bacteria 23634
80 Ga0070688_100101347 3300005365 Bacteria 1899
81 Ga0070659_100001090 3300005366 Bacteria 19781
82 Ga0070659_100002893 3300005366 Bacteria 12221
83 Ga0070659_100041578 3300005366 Bacteria 3594
84 Ga0070659_100115142 3300005366 Bacteria 2173
85 Ga0070659_100296785 3300005366 Bacteria 1347
86 Ga0070659_100325138 3300005366 Bacteria 1286
87 Ga0070659_100596607 3300005366 Bacteria 949
88 Ga0070667_100102662 3300005367 Bacteria 2471
89 Ga0070709_10101666 3300005434 Bacteria 1916
90 Ga0070709_10601253 3300005434 Viruses 847
91 Ga0070714_100368285 3300005435 Bacteria 1352
92 Ga0070714_101362587 3300005435 Bacteria 693
93 Ga0070713_101210501 3300005436 Bacteria 731
94 Ga0070710_10103279 3300005437 Bacteria 1701
95 Ga0070701_10078083 3300005438 Bacteria 1786
96 Ga0070701_10103693 3300005438 Bacteria 1579
97 Ga0070711_100063702 3300005439 Bacteria 2574
98 Ga0070711_100220871 3300005439 Bacteria 1473
99 Ga0070705_100176359 3300005440 Bacteria 1444
100 Ga0070700_100000580 3300005441 Bacteria 18347
101 Ga0070700_100061460 3300005441 Bacteria 2370
102 Ga0070700_100180501 3300005441 Bacteria 1469
103 Ga0070700_100493138 3300005441 Bacteria 941
104 Ga0070700_100713191 3300005441 Bacteria 799
105 Ga0070700_100743171 3300005441 Bacteria 784
106 Ga0070700_100858839 3300005441 Bacteria 736
107 Ga0070700_101045638 3300005441 Bacteria 674
108 Ga0070694_100087803 3300005444 Bacteria 2176
109 Ga0070694_100297455 3300005444 Bacteria 1236
110 Ga0070694_100375921 3300005444 Unclassified 1107
111 Ga0070663_100020403 3300005455 Bacteria 4388
112 Ga0070663_100070278 3300005455 Bacteria 2546
113 Ga0070663_100076662 3300005455 Bacteria 2445
114 Ga0070663_100370573 3300005455 Bacteria 1164
115 Ga0070678_100011039 3300005456 Bacteria 5552
116 Ga0070678_100014808 3300005456 Bacteria 4933
117 Ga0070662_100025726 3300005457 Bacteria 4068
118 Ga0070662_100067437 3300005457 Bacteria 2627
119 Ga0070662_100338927 3300005457 Bacteria 1230
120 Ga0070681_10053595 3300005458 Bacteria 4020
121 Ga0070681_10365242 3300005458 Unclassified 1354
122 Ga0070681_11366302 3300005458 Bacteria 632
123 Ga0068867_100000766 3300005459 Bacteria 21675
124 Ga0068867_100053792 3300005459 Bacteria 2973
125 Ga0068867_100205899 3300005459 Bacteria 1577
126 Ga0068867_100460467 3300005459 Bacteria 1086
127 Ga0070685_10000290 3300005466 Bacteria 31634
128 Ga0070685_10007278 3300005466 Bacteria 5660
129 Ga0070707_100858866 3300005468 Unclassified 872
130 Ga0070698_100983281 3300005471 Bacteria 791
131 Ga0070679_100007731 3300005530 Bacteria 10065
132 Ga0070679_100102311 3300005530 Bacteria 2851
133 Ga0070679_100131322 3300005530 Bacteria 2485
134 Ga0070679_100263399 3300005530 Bacteria 1679
135 Ga0070679_101414840 3300005530 Bacteria 642
136 Ga0070684_100031436 3300005535 Bacteria 4519
137 Ga0070684_100043240 3300005535 Bacteria 3889
138 Ga0070684_100059452 3300005535 Bacteria 3341
139 Ga0070684_100074737 3300005535 Bacteria 2987
140 Ga0070684_100076661 3300005535 Bacteria 2951
141 Ga0070684_100259261 3300005535 Bacteria 1590
142 Ga0070697_100278722 3300005536 Bacteria 1434
143 Ga0068853_100009434 3300005539 Bacteria 7862
144 Ga0068853_100027027 3300005539 Bacteria 4822
145 Ga0068853_100181114 3300005539 Bacteria 1911
146 Ga0068853_100696305 3300005539 Bacteria 969
147 Ga0068853_100961284 3300005539 Bacteria 822
148 Ga0070672_100003359 3300005543 Bacteria 10371
149 Ga0070686_100003109 3300005544 Bacteria 9102
150 Ga0070686_100016247 3300005544 Bacteria 4325
151 Ga0070686_100034256 3300005544 Bacteria 3128
152 Ga0070695_100076484 3300005545 Bacteria 2205
153 Ga0070693_100018587 3300005547 Bacteria 3634
154 Ga0070693_100180463 3300005547 Bacteria 1359
155 Ga0070665_100000120 3300005548 Bacteria 148340
156 Ga0070665_100025513 3300005548 Bacteria 5954
157 Ga0070665_100130912 3300005548 Bacteria 2511
158 Ga0070704_100039805 3300005549 Bacteria 3229
159 Ga0070704_100218694 3300005549 Bacteria 1548
160 Ga0070704_100781742 3300005549 Bacteria 852
161 Ga0068855_101583571 3300005563 Bacteria 671
162 Ga0070664_100055063 3300005564 Bacteria 3375
163 Ga0070664_100181493 3300005564 Bacteria 1871
164 Ga0070664_100231868 3300005564 Bacteria 1655
165 Ga0070664_100328736 3300005564 Bacteria 1386
166 Ga0070664_100412199 3300005564 Bacteria 1236
167 Ga0068857_100095645 3300005577 Bacteria 2662
168 Ga0068857_100106454 3300005577 Bacteria 2519
169 Ga0068857_101070401 3300005577 Bacteria 778
170 Ga0068854_100007097 3300005578 Bacteria 7153
171 Ga0068854_100196899 3300005578 Bacteria 1582
172 Ga0068856_100000057 3300005614 Bacteria 102045
173 Ga0068856_100021501 3300005614 Bacteria 6270
174 Ga0068856_100081262 3300005614 Bacteria 3215
175 Ga0068856_100214288 3300005614 Bacteria 1941
176 Ga0068856_100548895 3300005614 Bacteria 1177
177 Ga0068856_100717900 3300005614 Bacteria 1020
178 Ga0068856_100752202 3300005614 Bacteria 995
179 Ga0070702_100120835 3300005615 Bacteria 1640
180 Ga0070702_100185633 3300005615 Bacteria 1364
181 Ga0070702_100333122 3300005615 Unclassified 1062
182 Ga0068852_100000058 3300005616 Bacteria 75312
183 Ga0068852_100018498 3300005616 Bacteria 5490
184 Ga0068852_100177395 3300005616 Bacteria 2001
185 Ga0068852_100230790 3300005616 Bacteria 1764
186 Ga0068859_100448446 3300005617 Bacteria 1386
187 Ga0068864_100665506 3300005618 Bacteria 1015
188 Ga0068864_102696228 3300005618 Bacteria 503
189 Ga0068866_10015734 3300005718 Bacteria 3367
190 Ga0068866_10255556 3300005718 Bacteria 1074
191 Ga0068866_10262706 3300005718 Bacteria 1062
192 Ga0068861_100135106 3300005719 Bacteria 2006
193 Ga0068861_100523350 3300005719 Bacteria 1076
194 Ga0068861_100529750 3300005719 Bacteria 1070
195 Ga0068861_100599050 3300005719 Bacteria 1011
196 Ga0068861_101713398 3300005719 Bacteria 622
197 Ga0068851_10034140 3300005834 Bacteria 2538
198 Ga0068851_10346341 3300005834 Bacteria 863
199 Ga0068863_100365716 3300005841 Bacteria 1407
200 Ga0068858_100000035 3300005842 Bacteria 140466
201 Ga0068858_100200859 3300005842 Bacteria 1885
202 Ga0068858_100262168 3300005842 Bacteria 1643
203 Ga0068858_100879357 3300005842 Bacteria 876
204 Ga0068858_101140088 3300005842 Bacteria 766
205 Ga0068860_100631960 3300005843 Bacteria 1078
206 Ga0068862_100603407 3300005844 Unclassified 1054
207 Ga0081455_10062003 3300005937 Bacteria 3144
208 Ga0081455_10096425 3300005937 Bacteria 2385
209 Ga0081455_10123476 3300005937 Bacteria 2037
210 Ga0081455_10209326 3300005937 Bacteria 1454
211 Ga0081455_10241399 3300005937 Bacteria 1327
212 Ga0081455_10266880 3300005937 Bacteria 1244
213 Ga0081455_10332764 3300005937 Bacteria 1077
214 Ga0081455_10587474 3300005937 Bacteria 729
215 Ga0081455_10735714 3300005937 Bacteria 625
216 Ga0081538_10000169 3300005981 Bacteria 69684
217 Ga0081538_10006323 3300005981 Bacteria 10454
218 Ga0081538_10010481 3300005981 Bacteria 7602
219 Ga0081538_10020689 3300005981 Bacteria 4831
220 Ga0081538_10029713 3300005981 Bacteria 3728
221 Ga0081538_10079429 3300005981 Bacteria 1755
222 Ga0081538_10109548 3300005981 Bacteria 1360
223 Ga0081538_10201070 3300005981 Bacteria 818
224 Ga0081540_1003253 3300005983 Bacteria 12913
225 Ga0081540_1103668 3300005983 Bacteria 1219
226 Ga0081540_1121390 3300005983 Bacteria 1084
227 Ga0081539_10017263 3300005985 Bacteria 5079
228 Ga0081539_10186475 3300005985 Bacteria 969
229 Ga0075365_10012498 3300006038 Bacteria 5046
230 Ga0075365_10022183 3300006038 Bacteria 3974
231 Ga0075365_10040006 3300006038 Bacteria 3055
232 Ga0075365_10086436 3300006038 Bacteria 2131
233 Ga0075365_10179505 3300006038 Bacteria 1480
234 Ga0075365_10251253 3300006038 Bacteria 1243
235 Ga0075365_10259537 3300006038 Unclassified 1221
236 Ga0075365_10483760 3300006038 Bacteria 875
237 Ga0075365_10596924 3300006038 Bacteria 781
238 Ga0075363_100015254 3300006048 Bacteria 3774
239 Ga0075363_100198398 3300006048 Bacteria 1146
240 Ga0075364_10030019 3300006051 Bacteria 3488
241 Ga0075364_10047086 3300006051 Bacteria 2808
242 Ga0075364_10295271 3300006051 Bacteria 1103
243 Ga0070716_100266038 3300006173 Unclassified 1176
244 Ga0070712_100012995 3300006175 Bacteria 5309
245 Ga0075367_10806620 3300006178 Bacteria 598
246 Ga0075366_10321400 3300006195 Bacteria 948
247 Ga0097621_100426881 3300006237 Bacteria 1191
248 Ga0068871_100109772 3300006358 Bacteria 2320
249 Ga0068871_101915773 3300006358 Bacteria 564
250 Ga0075428_100051023 3300006844 Bacteria 4536
251 Ga0075428_100083896 3300006844 Bacteria 3476
252 Ga0075428_100335854 3300006844 Bacteria 1623
253 Ga0075428_100374456 3300006844 Bacteria 1527
254 Ga0075430_100003262 3300006846 Bacteria 13592
255 Ga0075430_100090709 3300006846 Bacteria 2556
256 Ga0075430_100121169 3300006846 Bacteria 2181
257 Ga0075430_100778405 3300006846 Bacteria 788
258 Ga0075430_101719440 3300006846 Bacteria 515
259 Ga0075431_100000134 3300006847 Bacteria 49630
260 Ga0075431_100055610 3300006847 Bacteria 4082
261 Ga0075431_100146364 3300006847 Bacteria 2435
262 Ga0075431_100302839 3300006847 Bacteria 1614
263 Ga0075431_100308493 3300006847 Bacteria 1598
264 Ga0075431_100314032 3300006847 Bacteria 1581
265 Ga0075431_100563415 3300006847 Bacteria 1126
266 Ga0075431_100938973 3300006847 Bacteria 834
267 Ga0075433_10009707 3300006852 Bacteria 7708
268 Ga0075433_10087408 3300006852 Bacteria 2753
269 Ga0075433_10288372 3300006852 Bacteria 1454
270 Ga0075434_100009612 3300006871 Bacteria 9030
271 Ga0075434_100010868 3300006871 Bacteria 8557
272 Ga0075434_100195933 3300006871 Bacteria 2040
273 Ga0075434_100262629 3300006871 Bacteria 1746
274 Ga0075434_100913602 3300006871 Bacteria 893
275 Ga0075429_100013154 3300006880 Bacteria 7179
276 Ga0075429_100101123 3300006880 Bacteria 2516
277 Ga0075429_100587573 3300006880 Bacteria 976
278 Ga0068865_100000020 3300006881 Bacteria 104487
279 Ga0068865_100015601 3300006881 Bacteria 4847
280 Ga0068865_100187254 3300006881 Bacteria 1598
281 Ga0068865_100503576 3300006881 Unclassified 1010
282 Ga0068865_100912347 3300006881 Bacteria 765
283 Ga0075436_100466669 3300006914 Bacteria 921
284 Ga0097620_100448429 3300006931 Bacteria 1386
285 Ga0075435_100068856 3300007076 Bacteria 2884
286 Ga0075435_100360935 3300007076 Bacteria 1246
287 Ga0075435_100612577 3300007076 Bacteria 944
288 Ga0105240_10008942 3300009093 Bacteria 14243
289 Ga0105240_10578730 3300009093 Bacteria 1239
290 Ga0111539_10016678 3300009094 Bacteria 9103
291 Ga0111539_10109537 3300009094 Bacteria 3241
292 Ga0111539_10113127 3300009094 Bacteria 3184
293 Ga0111539_10283300 3300009094 Bacteria 1928
294 Ga0111539_10345316 3300009094 Bacteria 1732
295 Ga0111539_10576004 3300009094 Bacteria 1311
296 Ga0111539_10757200 3300009094 Unclassified 1130
297 Ga0111539_11408874 3300009094 Bacteria 808
298 Ga0111539_12493335 3300009094 Unclassified 600
299 Ga0105245_10000159 3300009098 Bacteria 63630
300 Ga0105245_10001840 3300009098 Bacteria 19302
301 Ga0105245_10002823 3300009098 Bacteria 15605
302 Ga0105245_10004565 3300009098 Bacteria 12223
303 Ga0105245_10126764 3300009098 Bacteria 2390
304 Ga0105245_11890960 3300009098 Bacteria 650
305 Ga0105245_12403182 3300009098 Bacteria 580
306 Ga0105247_10000838 3300009101 Bacteria 23349
307 Ga0105247_10506042 3300009101 Bacteria 881
308 Ga0114129_10045130 3300009147 Bacteria 6196
309 Ga0114129_10051817 3300009147 Bacteria 5761
310 Ga0114129_10158733 3300009147 Bacteria 3092
311 Ga0114129_10165258 3300009147 Bacteria 3021
312 Ga0114129_10202666 3300009147 Bacteria 2686
313 Ga0114129_10355863 3300009147 Bacteria 1938
314 Ga0114129_10474859 3300009147 Bacteria 1637
315 Ga0114129_10494082 3300009147 Bacteria 1599
316 Ga0114129_10889851 3300009147 Bacteria 1129
317 Ga0114129_11293864 3300009147 Viruses 904
318 Ga0114129_12081929 3300009147 Bacteria 685
319 Ga0114129_12094590 3300009147 Bacteria 682
320 Ga0114129_12321721 3300009147 Bacteria 644
321 Ga0114129_13336210 3300009147 Bacteria 518
322 Ga0105243_10030929 3300009148 Bacteria 4125
323 Ga0105243_10036575 3300009148 Bacteria 3812
324 Ga0105243_10066378 3300009148 Bacteria 2902
325 Ga0105243_10069881 3300009148 Bacteria 2834
326 Ga0105243_10137177 3300009148 Bacteria 2083
327 Ga0105243_10206613 3300009148 Bacteria 1726
328 Ga0105243_10735610 3300009148 Unclassified 965
329 Ga0105241_10175191 3300009174 Bacteria 1775
330 Ga0105242_10001012 3300009176 Bacteria 22084
331 Ga0105242_10081328 3300009176 Bacteria 2709
332 Ga0105242_10120725 3300009176 Bacteria 2249
333 Ga0105242_10557358 3300009176 Bacteria 1100
334 Ga0105248_10000022 3300009177 Bacteria 275935
335 Ga0105248_11066971 3300009177 Bacteria 913
336 Ga0105237_10001106 3300009545 Bacteria 36105
337 Ga0105237_10049038 3300009545 Bacteria 4245
338 Ga0105237_10284469 3300009545 Bacteria 1656
339 Ga0105238_10071517 3300009551 Bacteria 3466
340 Ga0105238_10233208 3300009551 Bacteria 1817
341 Ga0105238_10802758 3300009551 Bacteria 957
342 Ga0105249_10221528 3300009553 Bacteria 1862
343 Ga0105249_10676117 3300009553 Bacteria 1091
344 Ga0105249_10815412 3300009553 Bacteria 998
345 Ga0105249_11201558 3300009553 Bacteria 829
346 Ga0105239_10045921 3300010375 Bacteria 4787
347 Ga0105239_10072996 3300010375 Bacteria 3773
348 Ga0105239_10359881 3300010375 Bacteria 1643
349 Ga0105239_10601666 3300010375 Bacteria 1254
350 Ga0105239_10605418 3300010375 Bacteria 1250
351 Ga0105239_11357800 3300010375 Bacteria 820
352 Ga0105239_12024073 3300010375 Bacteria 669
353 Ga0105239_12111880 3300010375 Unclassified 655
354 Ga0105246_10114148 3300011119 Bacteria 1990
355 Ga0105246_11165939 3300011119 Bacteria 707
356 Ga0157371_10009783 3300013102 Bacteria 7518
357 Ga0157371_10048015 3300013102 Bacteria 3035
358 Ga0157371_10114126 3300013102 Bacteria 1919
359 Ga0157371_10501409 3300013102 Bacteria 896
360 Ga0157371_10711406 3300013102 Unclassified 752
361 Ga0157370_10007123 3300013104 Bacteria 12201
362 Ga0157370_10343265 3300013104 Unclassified 1376
363 Ga0157370_10752564 3300013104 Unclassified 888
364 Ga0157370_10835440 3300013104 Bacteria 837
365 Ga0157370_11272535 3300013104 Bacteria 663
366 Ga0157369_10001902 3300013105 Bacteria 25182
367 Ga0157369_10006254 3300013105 Bacteria 13819
368 Ga0157369_10205232 3300013105 Bacteria 2067
369 Ga0157369_11563459 3300013105 Bacteria 671
370 Ga0157369_11599938 3300013105 Bacteria 662
371 Ga0157374_10427883 3300013296 Bacteria 1323
372 Ga0157378_10012400 3300013297 Bacteria 7462
373 Ga0157378_10185172 3300013297 Bacteria 1961
374 Ga0157378_10866825 3300013297 Bacteria 932
375 Ga0163162_10781478 3300013306 Bacteria 1073
376 Ga0163162_10830624 3300013306 Bacteria 1040
377 Ga0163162_11039566 3300013306 Bacteria 927
378 Ga0163162_11238719 3300013306 Bacteria 847
379 Ga0157372_10023313 3300013307 Bacteria 6708
380 Ga0157372_10061286 3300013307 Bacteria 4212
381 Ga0157372_10181647 3300013307 Bacteria 2435
382 Ga0157372_10385187 3300013307 Unclassified 1634
383 Ga0157372_10533797 3300013307 Bacteria 1368
384 Ga0157372_11174813 3300013307 Bacteria 887
385 Ga0157375_10027026 3300013308 Bacteria 5358
386 Ga0157375_10103896 3300013308 Bacteria 2929
387 Ga0157375_10269222 3300013308 Bacteria 1865
388 Ga0157375_10463748 3300013308 Bacteria 1432
389 Ga0157375_11220304 3300013308 Bacteria 883
390 Ga0157375_12059850 3300013308 Unclassified 679
391 Ga0163163_10786208 3300014325 Bacteria 1015
392 Ga0163163_10951663 3300014325 Bacteria 922
393 Ga0163163_11152471 3300014325 Bacteria 838
394 Ga0157380_10414883 3300014326 Bacteria 1282
395 Ga0157380_10910232 3300014326 Bacteria 906
396 Ga0182008_10028739 3300014497 Bacteria 2812
397 Ga0182008_10127331 3300014497 Bacteria 1268
398 Ga0182008_10365841 3300014497 Bacteria 768
399 Ga0157377_10049399 3300014745 Bacteria 2365
400 Ga0157377_10101152 3300014745 Bacteria 1718
401 Ga0157377_10143378 3300014745 Bacteria 1470
402 Ga0157379_10157217 3300014968 Bacteria 2051
403 Ga0157379_10939036 3300014968 Unclassified 822
404 Ga0157376_10257788 3300014969 Bacteria 1632
405 Ga0157376_10704118 3300014969 Bacteria 1015
406 Ga0197907_10277474 3300020069 Bacteria 1691
407 Ga0197907_10303868 3300020069 Bacteria 1582
408 Ga0197907_10800161 3300020069 Bacteria 1338
409 Ga0197907_11011833 3300020069 Bacteria 1580
410 Ga0197907_11459340 3300020069 Bacteria 562
411 Ga0206356_10218075 3300020070 Bacteria 3317
412 Ga0206356_11205897 3300020070 Unclassified 1104
413 Ga0206356_11759950 3300020070 Bacteria 743
414 Ga0206349_1187371 3300020075 Bacteria 803
415 Ga0206349_1257685 3300020075 Bacteria 1478
416 Ga0206351_10461011 3300020077 Bacteria 856
417 Ga0206352_10008056 3300020078 Bacteria 1018
418 Ga0206352_10433741 3300020078 Bacteria 1063
419 Ga0206352_10659006 3300020078 Bacteria 975
420 Ga0206352_10747119 3300020078 Bacteria 523
421 Ga0206350_10585354 3300020080 Bacteria 882
422 Ga0206350_10773500 3300020080 Bacteria 648
423 Ga0206350_11617956 3300020080 Bacteria 925
424 Ga0206354_10011853 3300020081 Bacteria 1840
425 Ga0206354_10885409 3300020081 Bacteria 572
426 Ga0206354_10989501 3300020081 Unclassified 1893
427 Ga0206354_11028322 3300020081 Bacteria 1123
428 Ga0206353_10752841 3300020082 Unclassified 686
429 Ga0206353_10927289 3300020082 Bacteria 518
430 Ga0206353_11178628 3300020082 Bacteria 1948
431 Ga0206353_11402362 3300020082 Bacteria 1952
432 Ga0154015_1665967 3300020610 Bacteria 1279
433 Ga0213876_10061056 3300021384 Unclassified 1989
434 Ga0213876_10081529 3300021384 Unclassified 1711
435 Ga0213875_10096172 3300021388 Bacteria 1381
436 Ga0224712_10014346 3300022467 Bacteria 2549
437 Ga0224712_10030580 3300022467 Bacteria 1945
438 Ga0224712_10055400 3300022467 Bacteria 1560
439 Ga0224712_10108653 3300022467 Bacteria 1187
440 Ga0224712_10354617 3300022467 Bacteria 694
441 Ga0224712_10402934 3300022467 Bacteria 652
442 Ga0207656_10016418 3300025321 Bacteria 2882
443 Ga0207656_10029861 3300025321 Bacteria 2248
444 Ga0207682_10062188 3300025893 Unclassified 1565
445 Ga0207642_10028406 3300025899 Bacteria 2303
446 Ga0207642_10208162 3300025899 Bacteria 1085
447 Ga0207710_10001786 3300025900 Bacteria 10368
448 Ga0207688_10025229 3300025901 Bacteria 3264
449 Ga0207647_10100983 3300025904 Bacteria 1712
450 Ga0207647_10741282 3300025904 Bacteria 532
451 Ga0207699_10286050 3300025906 Bacteria 1147
452 Ga0207645_10129392 3300025907 Bacteria 1643
453 Ga0207645_10288660 3300025907 Bacteria 1091
454 Ga0207705_10023067 3300025909 Bacteria 4439
455 Ga0207705_10028083 3300025909 Bacteria 4011
456 Ga0207705_10615488 3300025909 Bacteria 844
457 Ga0207705_10636199 3300025909 Bacteria 829
458 Ga0207707_10003121 3300025912 Bacteria 14712
459 Ga0207707_10045352 3300025912 Bacteria 3831
460 Ga0207707_10308264 3300025912 Unclassified 1368
461 Ga0207695_10030945 3300025913 Bacteria 5884
462 Ga0207671_10280151 3300025914 Bacteria 1315
463 Ga0207693_10013895 3300025915 Bacteria 6484
464 Ga0207693_10370815 3300025915 Bacteria 1120
465 Ga0207663_10057775 3300025916 Bacteria 2446
466 Ga0207660_10033479 3300025917 Bacteria 3555
467 Ga0207660_10511571 3300025917 Unclassified 975
468 Ga0207662_10745471 3300025918 Bacteria 688
469 Ga0207657_10008958 3300025919 Bacteria 10111
470 Ga0207657_10009720 3300025919 Bacteria 9645
471 Ga0207657_10021929 3300025919 Bacteria 5997
472 Ga0207657_10483936 3300025919 Bacteria 970
473 Ga0207649_10015628 3300025920 Bacteria 4263
474 Ga0207649_10031433 3300025920 Bacteria 3155
475 Ga0207649_10058099 3300025920 Bacteria 2421
476 Ga0207652_10018700 3300025921 Bacteria 5685
477 Ga0207652_10202063 3300025921 Bacteria 1788
478 Ga0207652_10436960 3300025921 Unclassified 1180
479 Ga0207694_10043711 3300025924 Bacteria 3458
480 Ga0207650_10107664 3300025925 Bacteria 2154
481 Ga0207650_11254361 3300025925 Unclassified 631
482 Ga0207659_10033094 3300025926 Bacteria 3554
483 Ga0207659_10578606 3300025926 Bacteria 956
484 Ga0207659_11542013 3300025926 Bacteria 568
485 Ga0207687_10000011 3300025927 Bacteria 388349
486 Ga0207687_10000785 3300025927 Bacteria 21381
487 Ga0207687_10032650 3300025927 Bacteria 3527
488 Ga0207687_10041108 3300025927 Bacteria 3173
489 Ga0207687_10085822 3300025927 Bacteria 2284
490 Ga0207687_10149363 3300025927 Bacteria 1781
491 Ga0207687_10752592 3300025927 Bacteria 829
492 Ga0207700_10781928 3300025928 Bacteria 853
493 Ga0207700_11580532 3300025928 Bacteria 581
494 Ga0207644_10248387 3300025931 Bacteria 1419
495 Ga0207690_10008222 3300025932 Bacteria 6189
496 Ga0207690_10034867 3300025932 Bacteria 3245
497 Ga0207690_10155403 3300025932 Bacteria 1700
498 Ga0207690_10162618 3300025932 Bacteria 1665
499 Ga0207690_10299541 3300025932 Bacteria 1258
500 Ga0207706_10004968 3300025933 Bacteria 12429
501 Ga0207706_10010365 3300025933 Bacteria 8512
502 Ga0207706_10390981 3300025933 Bacteria 1206
503 Ga0207686_10000414 3300025934 Bacteria 29497
504 Ga0207686_10119805 3300025934 Bacteria 1789
505 Ga0207686_11023422 3300025934 Bacteria 671
506 Ga0207709_10030922 3300025935 Bacteria 3120
507 Ga0207709_10045121 3300025935 Bacteria 2668
508 Ga0207709_10057610 3300025935 Bacteria 2410
509 Ga0207709_10168827 3300025935 Bacteria 1533
510 Ga0207709_10321957 3300025935 Unclassified 1157
511 Ga0207670_10020104 3300025936 Bacteria 4095
512 Ga0207669_10014900 3300025937 Bacteria 3909
513 Ga0207669_10102192 3300025937 Bacteria 1898
514 Ga0207669_10209707 3300025937 Bacteria 1421
515 Ga0207669_10232338 3300025937 Bacteria 1361
516 Ga0207669_10334430 3300025937 Bacteria 1164
517 Ga0207669_10367904 3300025937 Bacteria 1116
518 Ga0207669_10371849 3300025937 Bacteria 1111
519 Ga0207704_10000004 3300025938 Bacteria 239295
520 Ga0207704_10057780 3300025938 Bacteria 2385
521 Ga0207704_10210494 3300025938 Bacteria 1431
522 Ga0207665_10110275 3300025939 Bacteria 1932
523 Ga0207691_10031948 3300025940 Bacteria 4912
524 Ga0207711_10000019 3300025941 Bacteria 412779
525 Ga0207711_10673000 3300025941 Bacteria 965
526 Ga0207689_10069762 3300025942 Bacteria 2888
527 Ga0207661_10000599 3300025944 Bacteria 22999
528 Ga0207661_10012321 3300025944 Bacteria 6212
529 Ga0207661_10107371 3300025944 Bacteria 2355
530 Ga0207661_10183527 3300025944 Bacteria 1829
531 Ga0207661_10242778 3300025944 Bacteria 1599
532 Ga0207661_10351667 3300025944 Bacteria 1330
533 Ga0207661_10419653 3300025944 Bacteria 1215
534 Ga0207661_10491273 3300025944 Bacteria 1121
535 Ga0207661_11092381 3300025944 Bacteria 734
536 Ga0207679_10150819 3300025945 Bacteria 1891
537 Ga0207679_10310795 3300025945 Bacteria 1361
538 Ga0207679_10924592 3300025945 Bacteria 798
539 Ga0207667_10517346 3300025949 Bacteria 1209
540 Ga0207667_11258810 3300025949 Bacteria 717
541 Ga0207651_10020522 3300025960 Bacteria 3990
542 Ga0207712_10252078 3300025961 Bacteria 1427
543 Ga0207712_10693833 3300025961 Unclassified 888
544 Ga0207712_10942185 3300025961 Bacteria 764
545 Ga0207668_10017540 3300025972 Bacteria 4487
546 Ga0207668_10073183 3300025972 Bacteria 2455
547 Ga0207668_11027723 3300025972 Bacteria 737
548 Ga0207640_10058367 3300025981 Bacteria 2542
549 Ga0207640_10069523 3300025981 Bacteria 2365
550 Ga0207640_10886231 3300025981 Bacteria 778
551 Ga0207640_11080523 3300025981 Bacteria 709
552 Ga0207658_10344448 3300025986 Bacteria 1296
553 Ga0207677_10000465 3300026023 Bacteria 27000
554 Ga0207677_10027442 3300026023 Bacteria 3586
555 Ga0207677_10101037 3300026023 Bacteria 2122
556 Ga0207677_11440837 3300026023 Bacteria 635
557 Ga0207703_10009202 3300026035 Bacteria 7768
558 Ga0207703_10108685 3300026035 Bacteria 2362
559 Ga0207703_10335689 3300026035 Bacteria 1388
560 Ga0207703_11330224 3300026035 Bacteria 691
561 Ga0207703_11981674 3300026035 Bacteria 559
562 Ga0207639_10047917 3300026041 Bacteria 3232
563 Ga0207639_10050374 3300026041 Bacteria 3163
564 Ga0207639_10063847 3300026041 Bacteria 2853
565 Ga0207639_10179766 3300026041 Bacteria 1798
566 Ga0207678_10006324 3300026067 Bacteria 10517
567 Ga0207678_10043907 3300026067 Bacteria 3867
568 Ga0207678_10628402 3300026067 Bacteria 943
569 Ga0207708_10004693 3300026075 Bacteria 10052
570 Ga0207708_10008095 3300026075 Bacteria 7790
571 Ga0207708_10129580 3300026075 Bacteria 1972
572 Ga0207708_10614269 3300026075 Bacteria 922
573 Ga0207708_10869133 3300026075 Bacteria 779
574 Ga0207708_10870884 3300026075 Bacteria 778
575 Ga0207702_10000027 3300026078 Bacteria 183792
576 Ga0207702_10059276 3300026078 Bacteria 3260
577 Ga0207702_10488503 3300026078 Bacteria 1199
578 Ga0207702_10552570 3300026078 Bacteria 1126
579 Ga0207702_10597620 3300026078 Bacteria 1082
580 Ga0207641_11764899 3300026088 Bacteria 621
581 Ga0207648_10045428 3300026089 Bacteria 3852
582 Ga0207648_10074950 3300026089 Bacteria 2950
583 Ga0207648_10082193 3300026089 Bacteria 2809
584 Ga0207648_10158331 3300026089 Bacteria 1999
585 Ga0207648_10260681 3300026089 Bacteria 1547
586 Ga0207676_10624897 3300026095 Bacteria 1037
587 Ga0207674_10070583 3300026116 Bacteria 3512
588 Ga0207674_10948824 3300026116 Bacteria 829
589 Ga0207675_100039448 3300026118 Bacteria 4407
590 Ga0207683_10033551 3300026121 Bacteria 4459
591 Ga0207683_10089021 3300026121 Bacteria 2747
592 Ga0207683_10138363 3300026121 Bacteria 2193
593 Ga0207683_10851265 3300026121 Bacteria 846
594 Ga0207698_10000002 3300026142 Bacteria 404991
595 Ga0207698_10258159 3300026142 Bacteria 1599
596 Ga0207698_10286779 3300026142 Bacteria 1525
597 Ga0207698_10330135 3300026142 Bacteria 1432
598 Ga0207698_10543636 3300026142 Bacteria 1137
599 Ga0207698_11669317 3300026142 Bacteria 652
600 Ga0207428_10044132 3300027907 Bacteria 3597
601 Ga0207428_10072004 3300027907 Bacteria 2714
602 Ga0207428_10184362 3300027907 Bacteria 1575
603 Ga0268266_10000023 3300028379 Bacteria 501899
604 Ga0268266_10018170 3300028379 Bacteria 5995
605 Ga0268266_10220856 3300028379 Bacteria 1742
606 Ga0268264_10559911 3300028381 Bacteria 1122
607 Ga0268264_11079816 3300028381 Unclassified 811
608 Ga0265337_1000409 3300028556 Bacteria 22991
609 Ga0265326_10000004 3300028558 Bacteria 283947
610 Ga0265326_10037205 3300028558 Bacteria 1383
611 Ga0265318_10032403 3300028577 Bacteria 2022
612 Ga0265318_10043575 3300028577 Bacteria 1700
613 Ga0265318_10242422 3300028577 Unclassified 658
614 Ga0265336_10000836 3300028666 Bacteria 16045
615 Ga0265338_10000008 3300028800 Bacteria 481542
616 Ga0265338_10001224 3300028800 Bacteria 42394
617 Ga0265338_10001643 3300028800 Bacteria 35770
618 Ga0265338_10464430 3300028800 Bacteria 895
619 Ga0265338_10746194 3300028800 Unclassified 673
620 Ga0265324_10005973 3300029957 Bacteria 5154
621 Ga0265324_10028426 3300029957 Unclassified 1972
622 Ga0265324_10036423 3300029957 Bacteria 1711
623 Ga0265332_10102326 3300031238 Bacteria 1208
624 Ga0265320_10000666 3300031240 Bacteria 26164
625 Ga0265339_10050790 3300031249 Unclassified 2266
626 Ga0265339_10084756 3300031249 Bacteria 1670
627 Ga0265327_10011293 3300031251 Bacteria 6170
628 Ga0265327_10033767 3300031251 Bacteria 2846
629 Ga0307408_100089797 3300031548 Bacteria 2317
630 Ga0307408_100344126 3300031548 Bacteria 1263
631 Ga0307408_101698149 3300031548 Bacteria 602
632 Ga0265342_10052456 3300031712 Unclassified 2431
633 Ga0316576_10542298 3300031727 Bacteria 853
634 Ga0307405_10124261 3300031731 Bacteria 1771
635 Ga0307405_10741164 3300031731 Bacteria 817
636 Ga0307413_10039268 3300031824 Bacteria 2751
637 Ga0307413_10101734 3300031824 Bacteria 1900
638 Ga0307413_10119173 3300031824 Bacteria 1784
639 Ga0307413_10238231 3300031824 Bacteria 1341
640 Ga0307410_10002660 3300031852 Bacteria 8711
641 Ga0307410_10027546 3300031852 Bacteria 3592
642 Ga0307410_10105406 3300031852 Bacteria 2029
643 Ga0307410_10426017 3300031852 Bacteria 1077
644 Ga0307406_10018517 3300031901 Bacteria 4070
645 Ga0307406_10035203 3300031901 Bacteria 3077
646 Ga0307406_10052099 3300031901 Bacteria 2601
647 Ga0307406_10511448 3300031901 Bacteria 975
648 Ga0307406_10773307 3300031901 Bacteria 808
649 Ga0307406_11799910 3300031901 Bacteria 544
650 Ga0307407_10041577 3300031903 Bacteria 2571
651 Ga0307407_10055796 3300031903 Bacteria 2284
652 Ga0307407_10153050 3300031903 Bacteria 1501
653 Ga0307407_10601270 3300031903 Bacteria 819
654 Ga0307407_10673025 3300031903 Bacteria 777
655 Ga0307412_10064994 3300031911 Bacteria 2467
656 Ga0307412_11752890 3300031911 Bacteria 570
657 Ga0307409_100066780 3300031995 Bacteria 2837
658 Ga0307409_100078685 3300031995 Bacteria 2654
659 Ga0307409_100117484 3300031995 Bacteria 2244
660 Ga0307409_100119344 3300031995 Bacteria 2229
661 Ga0307409_100210588 3300031995 Bacteria 1747
662 Ga0307409_100317296 3300031995 Bacteria 1457
663 Ga0307409_100667766 3300031995 Bacteria 1035
664 Ga0307409_100939462 3300031995 Bacteria 880
665 Ga0307416_100306160 3300032002 Bacteria 1582
666 Ga0307416_100326620 3300032002 Bacteria 1539
667 Ga0307416_100330015 3300032002 Bacteria 1532
668 Ga0307416_100540174 3300032002 Bacteria 1237
669 Ga0307416_100854557 3300032002 Bacteria 1008
670 Ga0307416_101706132 3300032002 Bacteria 734
671 Ga0307414_10148518 3300032004 Bacteria 1845
672 Ga0307414_10172025 3300032004 Bacteria 1733
673 Ga0307411_10033789 3300032005 Bacteria 3175
674 Ga0307411_10316353 3300032005 Bacteria 1259
675 Ga0307411_10350869 3300032005 Bacteria 1203
676 Ga0307411_10355804 3300032005 Bacteria 1195
677 Ga0307411_10861001 3300032005 Bacteria 802
678 Ga0307415_100001983 3300032126 Bacteria 10067
679 Ga0307415_100003452 3300032126 Bacteria 8047
680 Ga0307415_100016693 3300032126 Bacteria 4383
681 Ga0307415_100080697 3300032126 Bacteria 2321
682 Ga0307415_100629868 3300032126 Bacteria 959
683 Ga0307415_100696522 3300032126 Bacteria 916
684 Ga0307415_100878998 3300032126 Bacteria 824
685 Ga0307415_101521401 3300032126 Bacteria 641
686 Ga0373948_0042954 3300034817 Bacteria 951
687 Ga0373938_0050720 3300034957 Bacteria 947
688 Ga0373936_0115057 3300035113 Bacteria 1145
689 Ga0373954_0237694 3300035118 Unclassified 897
690 Ga0373956_0581178 3300035119 Bacteria 535
691 Ga0373943_0097273 3300035170 Bacteria 1533
692 Ga0373961_0083554 3300035241 Bacteria 1008
693 Ga0316574_0061749 3300035398 Bacteria 2354
694 Ga0373935_0235002 3300035692 Bacteria 1278
695 Ga0373925_0117282 3300037068 Bacteria 2063
696 Ga0373925_0127391 3300037068 Bacteria 1982
697 Ga0395899_0139547 3300037312 Unclassified 1725
698 Ga0395899_0255730 3300037312 Bacteria 1200
699 Ga0395900_0089562 3300037418 Bacteria 3162
700 Ga0395900_0106773 3300037418 Bacteria 2876
701 Ga0395900_0767161 3300037418 Unclassified 894
702 Ga0395900_1196132 3300037418 Bacteria 676
703 Ga0395898_0005527 3300037466 Bacteria 13639
704 Ga0395898_0015974 3300037466 Bacteria 7691
705 Ga0395898_0226295 3300037466 Bacteria 1784
706 Ga0395898_0587861 3300037466 Unclassified 1056
707 Ga0395898_0674620 3300037466 Bacteria 976
708 Ga0395898_1357451 3300037466 Bacteria 639
709 Ga0395905_0015836 3300037471 Bacteria 7162
710 Ga0395905_0027496 3300037471 Bacteria 5364
711 Ga0395905_0364967 3300037471 Bacteria 1337
712 Ga0395905_0506836 3300037471 Bacteria 1107
713 Ga0436364_0566822 3300037853 Unclassified 1075
714 Ga0436364_0997712 3300037853 Bacteria 1882
715 Ga0395901_0019600 3300038443 Bacteria 6914
716 Ga0395901_0022139 3300038443 Bacteria 6511
717 Ga0395901_0122913 3300038443 Bacteria 2728
718 Ga0395901_0333098 3300038443 Bacteria 1569
719 Ga0395901_0480471 3300038443 Bacteria 1267
720 Ga0395901_0735708 3300038443 Bacteria 981
721 Ga0395901_1341353 3300038443 Bacteria 676
722 Ga0436365_0080349 3300039437 Unclassified 1665
723 Ga0436365_0654443 3300039437 Unclassified 2477
724 Ga0436365_1237803 3300039437 Bacteria 8741
725 Ga0436363_0046650 3300039450 Bacteria 33316
726 Ga0436362_1118531 3300039453 Unclassified 973
727 Ga0436362_1246024 3300039453 Unclassified 889
728 Ga0451789_0914259 3300041443 Unclassified 679
729 Ga0451789_1169276 3300041443 Unclassified 520
730 Ga0451837_1397650 3300041494 Bacteria 582
731 Ga0451847_0146959 3300041503 Bacteria 729
732 Ga0451849_0048515 3300041505 Unclassified 983
733 Ga0451853_0757159 3300041512 Bacteria 1380
734 Ga0451853_0887436 3300041512 Unclassified 633
735 Ga0451853_2670470 3300041512 Bacteria 882
736 Ga0439459_0112160 3300042438 Bacteria 679
737 Ga0451577_0339972 3300042876 Bacteria 1361
738 Ga0466972_0186121 3300044658 Bacteria 973
739 Ga0466972_0583853 3300044658 Bacteria 528
740 Ga0466966_0318307 3300044684 Unclassified 935
741 Ga0466961_0162616 3300044693 Bacteria 1391
742 Ga0466961_0726483 3300044693 Bacteria 594
743 Ga0466961_0794864 3300044693 Bacteria 565
744 Ga0466963_0018752 3300044694 Bacteria 4331
745 Ga0466963_0042130 3300044694 Bacteria 2997
746 Ga0466963_0073369 3300044694 Bacteria 2307
747 Ga0466963_0195320 3300044694 Bacteria 1415
748 Ga0466963_0204414 3300044694 Bacteria 1381
749 Ga0466963_0299612 3300044694 Bacteria 1131
750 Ga0466963_0542154 3300044694 Bacteria 822
751 Ga0466964_0304889 3300044706 Bacteria 804
752 Ga0466964_0353047 3300044706 Bacteria 756
753 Ga0466970_0048058 3300044765 Bacteria 2275
754 Ga0466970_0077917 3300044765 Bacteria 1787
755 Ga0466957_0000697 3300044842 Bacteria 17168
756 Ga0466957_0113200 3300044842 Bacteria 1723
757 Ga0466957_0239355 3300044842 Bacteria 1204
758 Ga0466960_0038448 3300044901 Bacteria 2250
759 Ga0466959_0129570 3300045049 Bacteria 1788
760 Ga0451576_0403540 3300045051 Unclassified 1433
761 Ga0451576_0577870 3300045051 Bacteria 1181
762 Ga0451576_2231118 3300045051 Unclassified 562
763 Ga0466958_0111359 3300045836 Bacteria 1709
764 Ga0466958_0449977 3300045836 Bacteria 834
765 Ga0466967_0030212 3300045976 Bacteria 4545
766 Ga0466967_0031626 3300045976 Bacteria 4458
767 Ga0466967_0032630 3300045976 Bacteria 4399
768 Ga0466967_0058577 3300045976 Bacteria 3405
769 Ga0466967_0276665 3300045976 Bacteria 1610
770 Ga0466967_0280667 3300045976 Bacteria 1598
771 Ga0466967_0304393 3300045976 Bacteria 1534
772 Ga0466967_0485026 3300045976 Bacteria 1211
773 Ga0466967_0502194 3300045976 Bacteria 1190
774 Ga0466967_0685363 3300045976 Bacteria 1014
775 Ga0466967_0751181 3300045976 Bacteria 967
776 Ga0466967_1078248 3300045976 Bacteria 800
777 Ga0466967_1205463 3300045976 Bacteria 754
778 Ga0466967_1467449 3300045976 Bacteria 679
779 Ga0495592_0547305 3300046454 Bacteria 712
780 Ga0495603_0005110 3300046455 Bacteria 7836
781 Ga0495629_0155703 3300046459 Bacteria 1588
782 Ga0495641_0027210 3300046461 Bacteria 2783
783 Ga0495651_0367023 3300046462 Bacteria 947
784 Ga0495651_0547882 3300046462 Bacteria 735
785 Ga0495651_0772084 3300046462 Unclassified 595
786 Ga0495653_0296448 3300046463 Bacteria 1056
787 Ga0495582_0016761 3300046473 Unclassified 4013
788 Ga0495582_0108015 3300046473 Bacteria 1562
789 Ga0495605_0157975 3300046474 Bacteria 1008
790 Ga0495639_0397053 3300046475 Bacteria 696
791 Ga0495662_0000027 3300046476 Bacteria 52057
792 Ga0495662_0025426 3300046476 Unclassified 2859
793 Ga0495584_0482061 3300046491 Bacteria 631
794 Ga0495594_0021711 3300046499 Bacteria 3429
795 Ga0495596_0082383 3300046500 Bacteria 1249
796 Ga0495596_0125313 3300046500 Bacteria 997
797 Ga0495616_0206562 3300046513 Bacteria 861
798 Ga0495630_0000037 3300046517 Bacteria 114404
799 Ga0495630_0000210 3300046517 Bacteria 46241
800 Ga0495630_0012186 3300046517 Bacteria 6238
801 Ga0495631_0156094 3300046518 Bacteria 979
802 Ga0495666_0026986 3300046526 Unclassified 2827
803 Ga0495652_0458499 3300046529 Unclassified 891
804 Ga0495640_0049122 3300046533 Unclassified 2911
805 Ga0495640_0672865 3300046533 Bacteria 622
806 Ga0495586_0000094 3300046535 Bacteria 54446
807 Ga0495645_0007330 3300046543 Bacteria 7672
808 Ga0495656_0340014 3300046615 Bacteria 776
809 Ga0495668_0181270 3300046616 Bacteria 1154
810 Ga0495634_0000982 3300046642 Bacteria 26859
811 Ga0495634_0005363 3300046642 Bacteria 9880
812 Ga0495634_0056022 3300046642 Unclassified 2635
813 Ga0495635_0031266 3300046663 Bacteria 3697
814 Ga0495635_0561848 3300046663 Bacteria 747
815 Ga0495661_0127460 3300046665 Bacteria 1399
816 Ga0495588_0103934 3300046674 Bacteria 1494
817 Ga0495588_0386407 3300046674 Bacteria 735
818 Ga0495657_0248990 3300046675 Bacteria 1070
819 Ga0495599_0158452 3300046678 Unclassified 1400
820 Ga0495623_0401325 3300046679 Bacteria 738
821 Ga0495647_0003378 3300046681 Bacteria 5114
822 Ga0495647_0009441 3300046681 Bacteria 3306
823 Ga0495647_0070427 3300046681 Bacteria 1399
824 Ga0495647_0205198 3300046681 Bacteria 865
825 Ga0495647_0209234 3300046681 Bacteria 858
826 Ga0495613_0000003 3300046689 Bacteria 248826
827 Ga0495624_0342181 3300046690 Bacteria 900
828 Ga0495670_0800172 3300046691 Bacteria 514
829 Ga0495600_0417902 3300046809 Bacteria 832
830 Ga0495674_0000108 3300047319 Bacteria 61101
831 Ga0495674_0002905 3300047319 Bacteria 16677
832 Ga0495674_0168501 3300047319 Bacteria 1829
833 Ga0495672_0006597 3300047320 Bacteria 8934
834 Ga0495676_0071215 3300047321 Unclassified 2673
835 Ga0495676_0092642 3300047321 Bacteria 2255
836 Ga0495676_0386603 3300047321 Bacteria 930
837 Ga0495684_0141756 3300047471 Bacteria 1802
838 Ga0495684_0328752 3300047471 Bacteria 1091
839 Ga0495684_0813084 3300047471 Bacteria 610
840 Ga0495593_0029526 3300047673 Bacteria 3006
841 Ga0495602_0606089 3300048088 Unclassified 753
842 Ga0495614_0074722 3300048089 Bacteria 1464
843 Ga0496100_0016889 3300048903 Bacteria 4294
844 Ga0496100_1210574 3300048903 Bacteria 596
845 Ga0496101_0004260 3300048904 Bacteria 8972
846 Ga0496101_0156775 3300048904 Bacteria 1744
847 Ga0496101_0481305 3300048904 Bacteria 980
848 Ga0496102_0029219 3300048905 Bacteria 4931
849 Ga0496102_0449953 3300048905 Bacteria 1208
850 Ga0496102_0604709 3300048905 Bacteria 1019
851 Ga0496103_0006391 3300048906 Bacteria 7041
852 Ga0496103_0172314 3300048906 Bacteria 1390
853 Ga0496103_0229582 3300048906 Bacteria 1194
854 Ga0496103_0873276 3300048906 Bacteria 565
855 Ga0496104_0000002 3300048907 Bacteria 686017
856 Ga0496104_0000007 3300048907 Bacteria 524804
857 Ga0496104_0026472 3300048907 Bacteria 5356
858 Ga0496104_0043868 3300048907 Bacteria 4200
859 Ga0496105_0000001 3300048908 Bacteria 1328178
860 Ga0496105_0000002 3300048908 Bacteria 753215
861 Ga0496105_0002894 3300048908 Bacteria 12592
862 Ga0496105_0059859 3300048908 Bacteria 3142
863 Ga0496105_0088368 3300048908 Bacteria 2560
864 Ga0496106_0096802 3300048909 Bacteria 2284
865 Ga0496106_0188359 3300048909 Bacteria 1640
866 Ga0496106_0217385 3300048909 Bacteria 1523
867 Ga0496107_0074213 3300048910 Bacteria 2475
868 Ga0496107_0075197 3300048910 Bacteria 2458
869 Ga0496108_0000024 3300048911 Bacteria 183389
870 Ga0496108_0000094 3300048911 Bacteria 93075
871 Ga0496108_0002794 3300048911 Bacteria 13992
872 Ga0496108_0059784 3300048911 Bacteria 3205
873 Ga0496108_0061700 3300048911 Bacteria 3155
874 Ga0496108_0323583 3300048911 Bacteria 1344
875 Ga0496108_0325096 3300048911 Bacteria 1341
876 Ga0496108_0505941 3300048911 Bacteria 1055
877 Ga0496109_0000024 3300048912 Bacteria 174723
878 Ga0496109_0000033 3300048912 Bacteria 160496
879 Ga0496109_0013442 3300048912 Bacteria 7101
880 Ga0496109_0292013 3300048912 Bacteria 1537
881 Ga0496109_0302055 3300048912 Bacteria 1509
882 Ga0496109_0310002 3300048912 Bacteria 1489
883 Ga0496109_0380012 3300048912 Bacteria 1334
884 Ga0496109_0455758 3300048912 Bacteria 1208
885 Ga0496109_0574838 3300048912 Bacteria 1062
886 Ga0496109_0776174 3300048912 Bacteria 896
887 Ga0496109_0914498 3300048912 Bacteria 815
888 Ga0496110_0045483 3300048913 Bacteria 3838
889 Ga0496110_0060815 3300048913 Bacteria 3332
890 Ga0496110_0095026 3300048913 Bacteria 2669
891 Ga0496110_0409563 3300048913 Bacteria 1236
892 Ga0496110_0665562 3300048913 Bacteria 941
893 Ga0496110_0702872 3300048913 Bacteria 912
894 Ga0496110_0821511 3300048913 Bacteria 834
895 Ga0496111_0003563 3300048914 Bacteria 9640
896 Ga0496111_0106027 3300048914 Bacteria 2068
897 Ga0496111_0147022 3300048914 Bacteria 1747
898 Ga0496111_0173409 3300048914 Bacteria 1603
899 Ga0496111_0239221 3300048914 Bacteria 1348
900 Ga0496111_0281146 3300048914 Bacteria 1234
901 Ga0496111_0569738 3300048914 Bacteria 830
902 Ga0496111_0619677 3300048914 Bacteria 791
903 Ga0496111_1057206 3300048914 Bacteria 580
904 Ga0496112_0000293 3300048915 Bacteria 32490
905 Ga0496112_0057563 3300048915 Bacteria 3827
906 Ga0496112_0084664 3300048915 Bacteria 3136
907 Ga0496112_0110816 3300048915 Bacteria 2715
908 Ga0496112_0716029 3300048915 Bacteria 928
909 Ga0496112_0783507 3300048915 Unclassified 879
910 Ga0496113_0038683 3300048916 Bacteria 3508
911 Ga0496113_0060774 3300048916 Bacteria 2849
912 Ga0496114_0009129 3300048917 Bacteria 7861
913 Ga0496114_0435951 3300048917 Bacteria 1161
914 Ga0496114_0677253 3300048917 Bacteria 906
915 Ga0496115_0015903 3300048918 Bacteria 5718
916 Ga0496119_0032546 3300048922 Viruses 3473
917 Ga0496119_0060935 3300048922 Bacteria 2256
918 Ga0496119_0325163 3300048922 Unclassified 752
919 Ga0496120_0086626 3300048923 Bacteria 1683
920 Ga0496120_0403461 3300048923 Bacteria 603
921 Ga0496124_0093327 3300048927 Bacteria 2450
922 Ga0501306_015133 3300049127 Bacteria 1024
923 Ga0501309_035323 3300049129 Bacteria 750
924 Ga0501307_095072 3300049162 Unclassified 501
925 Ga0501291_049642 3300049514 Bacteria 761
926 Ga0501311_036375 3300049527 Bacteria 732
927 Ga0501315_013620 3300049531 Bacteria 1021
928 Ga0501316_021738 3300049532 Bacteria 813
929 Ga0501317_013613 3300049533 Bacteria 1019
930 Ga0501318_027131 3300049534 Bacteria 760
931 Ga0501320_008286 3300049536 Bacteria 1019
932 Ga0501321_026682 3300049537 Bacteria 751
933 Ga0501323_012061 3300049539 Bacteria 1051
934 Ga0501325_027564 3300049541 Bacteria 634
935 Ga0501036_0086481 3300049572 Bacteria 2650
936 Ga0501036_0247847 3300049572 Bacteria 1493
937 Ga0501036_1655586 3300049572 Bacteria 516
938 Ga0501037_0554984 3300049573 Bacteria 775
939 Ga0501039_0061911 3300049575 Bacteria 2899
940 Ga0501039_1273101 3300049575 Bacteria 568
941 Ga0501040_0359911 3300049576 Bacteria 1043
942 Ga0501042_0110441 3300049578 Bacteria 1980
943 Ga0501047_0035747 3300049581 Bacteria 4799
944 Ga0501047_0245491 3300049581 Bacteria 1640
945 Ga0501048_0188785 3300049582 Bacteria 1460
946 Ga0501048_0522952 3300049582 Bacteria 851
947 Ga0501048_0811702 3300049582 Unclassified 672
948 Ga0501067_0490032 3300049583 Bacteria 687
949 Ga0501068_0225721 3300049584 Bacteria 1191
950 Ga0501069_0230232 3300049585 Bacteria 1079
951 Ga0501069_0238862 3300049585 Bacteria 1058
952 Ga0501070_0072814 3300049586 Bacteria 2844
953 Ga0501070_0819531 3300049586 Bacteria 730
954 Ga0501071_0112827 3300049587 Bacteria 2010
955 Ga0501071_0418170 3300049587 Bacteria 1024
956 Ga0501071_0810121 3300049587 Bacteria 722
957 Ga0501072_0252158 3300049588 Bacteria 1405
958 Ga0501074_0024292 3300049590 Bacteria 4405
959 Ga0501074_0654358 3300049590 Unclassified 742
960 Ga0501075_0540490 3300049591 Bacteria 889
961 Ga0501075_0542730 3300049591 Bacteria 887
962 Ga0501075_0727464 3300049591 Bacteria 756
963 Ga0501076_0080998 3300049592 Bacteria 2606
964 Ga0501076_0187133 3300049592 Bacteria 1689
965 Ga0501076_0434851 3300049592 Bacteria 1080
966 Ga0501235_101987 3300049669 Bacteria 702
967 Ga0501079_0081496 3300049741 Bacteria 2502
968 Ga0501079_0404537 3300049741 Bacteria 1071
969 Ga0501079_0934588 3300049741 Unclassified 683
970 Ga0501080_0013630 3300049742 Bacteria 7485
971 Ga0501080_0715963 3300049742 Bacteria 882
972 Ga0501044_0524598 3300049823 Bacteria 1084
973 Ga0501045_0257607 3300049824 Bacteria 1298
974 nmdc:mga03n38_107406_c1 3300050490 Bacteria 1354
975 nmdc:mga03n38_15679_c1 3300050490 Bacteria 2930
976 nmdc:mga03n38_367325_c1 3300050490 Unclassified 786
977 nmdc:mga00v17_28476_c1 3300050491 Bacteria 3272
978 nmdc:mga00v17_39916_c1 3300050491 Bacteria 2813
979 nmdc:mga0yw44_187225_c1 3300050492 Bacteria 1364
980 nmdc:mga0yw44_21221_c1 3300050492 Bacteria 3619
981 nmdc:mga0yw44_316918_c1 3300050492 Bacteria 1047
982 nmdc:mga0yw44_327462_c1 3300050492 Unclassified 1029
983 nmdc:mga0yw44_4200_c1 3300050492 Bacteria 6553
984 nmdc:mga0yw44_77423_c1 3300050492 Bacteria 2077
985 nmdc:mga0yw44_99293_c1 3300050492 Bacteria 1852
986 nmdc:mga06z11_147302_c1 3300050494 Bacteria 1335
987 nmdc:mga06z11_573058_c1 3300050494 Bacteria 686
988 nmdc:mga04h51_55684_c1 3300050495 Unclassified 1340
989 nmdc:mga05p37_1240364_c1 3300050507 Bacteria 766
990 nmdc:mga05p37_135113_c1 3300050507 Bacteria 3025
991 nmdc:mga05p37_1548414_c1 3300050507 Viruses 657
992 nmdc:mga05p37_371224_c1 3300050507 Bacteria 1679
993 nmdc:mga05p37_421060_c1 3300050507 Bacteria 1554
994 nmdc:mga05p37_54356_c1 3300050507 Bacteria 4926
995 nmdc:mga05p37_586484_c1 3300050507 Bacteria 1261
996 nmdc:mga05p37_670336_c1 3300050507 Bacteria 1158
997 nmdc:mga05p37_718193_c1 3300050507 Bacteria 1107
998 nmdc:mga05p37_764306_c1 3300050507 Bacteria 1063
999 nmdc:mga05p37_902306_c1 3300050507 Bacteria 953
1000 nmdc:mga09592_270371_c1 3300050508 Bacteria 1474
1001 nmdc:mga09592_52641_c1 3300050508 Bacteria 3436
1002 nmdc:mga09592_529798_c1 3300050508 Bacteria 1013
1003 nmdc:mga09592_612435_c1 3300050508 Bacteria 932
1004 nmdc:mga0qj67_198569_c1 3300050509 Bacteria 1630
1005 nmdc:mga0qj67_22421_c1 3300050509 Bacteria 4851
1006 nmdc:mga0qj67_774068_c1 3300050509 Bacteria 761
1007 nmdc:mga06r32_1055111_c1 3300050510 Bacteria 763
1008 nmdc:mga06r32_110190_c1 3300050510 Bacteria 2708
1009 nmdc:mga06r32_122626_c1 3300050510 Bacteria 2565
1010 nmdc:mga06r32_1263448_c1 3300050510 Bacteria 683
1011 nmdc:mga06r32_291772_c1 3300050510 Bacteria 1618
1012 nmdc:mga06r32_413186_c1 3300050510 Bacteria 1331
1013 nmdc:mga06r32_624925_c1 3300050510 Bacteria 1047
1014 nmdc:mga08y16_1167048_c1 3300050511 Bacteria 742
1015 nmdc:mga08y16_239741_c1 3300050511 Bacteria 1875
1016 nmdc:mga08y16_280795_c1 3300050511 Bacteria 1718
1017 nmdc:mga0n895_1169236_c1 3300050512 Bacteria 744
1018 nmdc:mga0n895_189723_c1 3300050512 Bacteria 2086
1019 nmdc:mga0n895_55336_c1 3300050512 Bacteria 3905
1020 nmdc:mga0rr50_322551_c1 3300050513 Bacteria 1295
1021 nmdc:mga0a205_20641_c1 3300050515 Bacteria 6221
1022 nmdc:mga0a205_309526_c1 3300050515 Bacteria 1452
1023 Ga0495601_0027950 3300053077 Bacteria 3490
1024 Ga0495655_0004243 3300053083 Bacteria 2436
1025 Ga0495655_0097632 3300053083 Bacteria 865
1026 Ga0495619_0021730 3300053085 Bacteria 4099
1027 Ga0495619_0030777 3300053085 Bacteria 3474
1028 Ga0495619_0173023 3300053085 Bacteria 1493
1029 Ga0495619_0175849 3300053085 Bacteria 1481
1030 Ga0495619_0197205 3300053085 Bacteria 1394
1031 Ga0501084_0053276 3300054114 Bacteria 3384
1032 Ga0501084_0927535 3300054114 Bacteria 732
1033 Ga0587111_0172385 3300060346 Bacteria 596
1034 Ga0501082_0782012 3300060353 Bacteria 835
1035 Ga0501082_0929047 3300060353 Bacteria 761
1036 Ga0501082_0964359 3300060353 Bacteria 746
1037 Ga0530510_0323169 3300061734 Bacteria 1157
1038 Ga0530510_0521974 3300061734 Unclassified 901
1039 Ga0530510_1078794 3300061734 Unclassified 615
1040 Ga0530510_1369944 3300061734 Unclassified 543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_101510792 Ga0070689_1015107921 110
2 3300005841 Ga0068863_100365716 Ga0068863_1003657162 112
3 3300007076 Ga0075435_100612577 Ga0075435_1006125772 112
4 3300013307 Ga0157372_11174813 Ga0157372_111748131 114
5 3300046462 Ga0495651_0367023 Ga0495651_0367023_391_864 114
6 3300046642 Ga0495634_0000982 Ga0495634_0000982_8160_8627 114
7 3300046679 Ga0495623_0401325 Ga0495623_0401325_199_678 114
8 3300005535 Ga0070684_100059452 Ga0070684_1000594523 115
9 3300005539 Ga0068853_100009434 Ga0068853_1000094347 115
10 3300005548 Ga0070665_100000120 Ga0070665_100000120111 115
11 3300005842 Ga0068858_100000035 Ga0068858_100000035109 115
12 3300009098 Ga0105245_10001840 Ga0105245_1000184018 115
13 3300013308 Ga0157375_10463748 Ga0157375_104637482 115
14 3300020078 Ga0206352_10747119 Ga0206352_107471191 115
15 3300025927 Ga0207687_10000785 Ga0207687_100007854 115
16 3300025944 Ga0207661_10012321 Ga0207661_100123214 115
17 3300026035 Ga0207703_10009202 Ga0207703_100092027 115
18 3300026041 Ga0207639_10063847 Ga0207639_100638472 115
19 3300028379 Ga0268266_10000023 Ga0268266_10000023471 115
20 3300028558 Ga0265326_10037205 Ga0265326_100372052 115
21 3300028800 Ga0265338_10464430 Ga0265338_104644302 115
22 3300046809 Ga0495600_0417902 Ga0495600_0417902_18_482 115
23 3300048913 Ga0496110_0045483 Ga0496110_0045483_2678_3139 115
24 3300048914 Ga0496111_0281146 Ga0496111_0281146_119_580 115
25 3300002239 JGI24034J26672_10000335 JGI24034J26672_100003357 116
26 3300002244 JGI24742J22300_10013846 JGI24742J22300_100138463 116
27 3300005441 Ga0070700_100743171 Ga0070700_1007431712 116
28 3300005577 Ga0068857_101070401 Ga0068857_1010704012 116
29 3300028800 Ga0265338_10000008 Ga0265338_1000000876 116
30 3300029957 Ga0265324_10028426 Ga0265324_100284263 116
31 3300031238 Ga0265332_10102326 Ga0265332_101023262 116
32 3300031249 Ga0265339_10050790 Ga0265339_100507902 116
33 3300031712 Ga0265342_10052456 Ga0265342_100524563 116
34 3300035692 Ga0373935_0235002 Ga0373935_0235002_235_711 117
35 3300042876 Ga0451577_0339972 Ga0451577_0339972_816_1286 117
36 3300048911 Ga0496108_0000094 Ga0496108_0000094_34009_34458 117
37 3300048912 Ga0496109_0000024 Ga0496109_0000024_136149_136598 117
38 3300014969 Ga0157376_10257788 Ga0157376_102577883 118
39 3300046529 Ga0495652_0458499 Ga0495652_0458499_88_552 118
40 3300046675 Ga0495657_0248990 Ga0495657_0248990_433_897 118
41 3300047471 Ga0495684_0141756 Ga0495684_0141756_383_859 118
42 3300053085 Ga0495619_0197205 Ga0495619_0197205_179_649 118
43 3300060346 Ga0587111_0172385 Ga0587111_0172385_34_471 118
44 3300014969 Ga0157376_10704118 Ga0157376_107041183 119
45 3300026078 Ga0207702_10552570 Ga0207702_105525703 119
46 3300045051 Ga0451576_2231118 Ga0451576_2231118_78_539 119
47 3300046462 Ga0495651_0772084 Ga0495651_0772084_73_534 119
48 3300046473 Ga0495582_0016761 Ga0495582_0016761_1820_2281 119
49 3300046476 Ga0495662_0025426 Ga0495662_0025426_18_479 119
50 3300046517 Ga0495630_0000210 Ga0495630_0000210_14099_14560 119
51 3300046526 Ga0495666_0026986 Ga0495666_0026986_1642_2103 119
52 3300046535 Ga0495586_0000094 Ga0495586_0000094_14099_14560 119
53 3300046642 Ga0495634_0056022 Ga0495634_0056022_868_1329 119
54 3300046678 Ga0495599_0158452 Ga0495599_0158452_710_1171 119
55 3300046681 Ga0495647_0009441 Ga0495647_0009441_2771_3232 119
56 3300047319 Ga0495674_0002905 Ga0495674_0002905_3043_3504 119
57 3300048089 Ga0495614_0074722 Ga0495614_0074722_90_551 119
58 3300053085 Ga0495619_0175849 Ga0495619_0175849_149_619 119
59 3300028577 Ga0265318_10242422 Ga0265318_102424222 120
60 3300029957 Ga0265324_10005973 Ga0265324_100059733 120
61 3300013102 Ga0157371_10009783 Ga0157371_100097838 121
62 3300028800 Ga0265338_10746194 Ga0265338_107461941 121
63 3300044694 Ga0466963_0542154 Ga0466963_0542154_294_731 121
64 3300044706 Ga0466964_0353047 Ga0466964_0353047_15_380 121
65 3300046462 Ga0495651_0547882 Ga0495651_0547882_126_596 121
66 3300046463 Ga0495653_0296448 Ga0495653_0296448_544_993 121
67 3300046517 Ga0495630_0012186 Ga0495630_0012186_929_1378 121
68 3300046533 Ga0495640_0672865 Ga0495640_0672865_67_516 121
69 3300046663 Ga0495635_0031266 Ga0495635_0031266_1820_2266 121
70 3300046690 Ga0495624_0342181 Ga0495624_0342181_357_806 121
71 3300047319 Ga0495674_0168501 Ga0495674_0168501_68_517 121
72 3300047471 Ga0495684_0813084 Ga0495684_0813084_118_567 121
73 3300053077 Ga0495601_0027950 Ga0495601_0027950_278_727 121
74 3300053085 Ga0495619_0030777 Ga0495619_0030777_766_1215 121
75 3300046454 Ga0495592_0547305 Ga0495592_0547305_226_678 122
76 3300046543 Ga0495645_0007330 Ga0495645_0007330_4547_4996 122
77 3300034817 Ga0373948_0042954 Ga0373948_0042954_402_851 123
78 3300034957 Ga0373938_0050720 Ga0373938_0050720_166_615 123
79 3300035241 Ga0373961_0083554 Ga0373961_0083554_363_812 123
80 3300046491 Ga0495584_0482061 Ga0495584_0482061_133_615 123
81 3300046500 Ga0495596_0082383 Ga0495596_0082383_31_513 123
82 3300049541 Ga0501325_027564 Ga0501325_027564_225_602 123
83 3300041443 Ga0451789_1169276 Ga0451789_1169276_53_472 125
84 3300009177 Ga0105248_11066971 Ga0105248_110669712 126
85 3300014968 Ga0157379_10939036 Ga0157379_109390362 126
86 3300025941 Ga0207711_10673000 Ga0207711_106730002 126
87 3300045051 Ga0451576_0577870 Ga0451576_0577870_555_1019 126
88 3300045976 Ga0466967_0031626 Ga0466967_0031626_3990_4433 126
89 3300049592 Ga0501076_0080998 Ga0501076_0080998_1030_1518 127
90 3300010375 Ga0105239_12024073 Ga0105239_120240731 129
91 3300020069 Ga0197907_11459340 Ga0197907_114593401 129
92 3300045051 Ga0451576_0403540 Ga0451576_0403540_615_1091 129
93 3300053083 Ga0495655_0097632 Ga0495655_0097632_25_453 130
94 3300032126 Ga0307415_100003452 Ga0307415_1000034528 131
95 3300041512 Ga0451853_0887436 Ga0451853_0887436_151_585 131
96 3300045976 Ga0466967_1467449 Ga0466967_1467449_116_577 131
97 3300046642 Ga0495634_0005363 Ga0495634_0005363_6350_6823 131
98 3300046681 Ga0495647_0209234 Ga0495647_0209234_307_774 131
99 3300046689 Ga0495613_0000003 Ga0495613_0000003_59751_60188 131
100 3300005330 Ga0070690_101239554 Ga0070690_1012395541 132
101 3300005544 Ga0070686_100034256 Ga0070686_1000342565 132
102 3300022467 Ga0224712_10354617 Ga0224712_103546171 132
103 3300041443 Ga0451789_0914259 Ga0451789_0914259_193_648 132
104 3300046476 Ga0495662_0000027 Ga0495662_0000027_19133_19570 132
105 3300048088 Ga0495602_0606089 Ga0495602_0606089_125_592 132
106 3300049585 Ga0501069_0238862 Ga0501069_0238862_74_556 132
107 3300002075 JGI24738J21930_10003699 JGI24738J21930_100036996 133
108 3300002077 JGI24744J21845_10048405 JGI24744J21845_100484052 133
109 3300005327 Ga0070658_10020698 Ga0070658_100206984 133
110 3300005329 Ga0070683_100197337 Ga0070683_1001973371 133
111 3300005331 Ga0070670_100224949 Ga0070670_1002249494 133
112 3300005334 Ga0068869_100101392 Ga0068869_1001013924 133
113 3300005336 Ga0070680_100417420 Ga0070680_1004174202 133
114 3300005338 Ga0068868_100184292 Ga0068868_1001842922 133
115 3300005339 Ga0070660_100008259 Ga0070660_1000082594 133
116 3300005341 Ga0070691_10134445 Ga0070691_101344452 133
117 3300005344 Ga0070661_100032298 Ga0070661_1000322986 133
118 3300005345 Ga0070692_10003022 Ga0070692_100030226 133
119 3300005356 Ga0070674_100021607 Ga0070674_1000216075 133
120 3300005366 Ga0070659_100041578 Ga0070659_1000415785 133
121 3300005434 Ga0070709_10601253 Ga0070709_106012532 133
122 3300005438 Ga0070701_10078083 Ga0070701_100780833 133
123 3300005441 Ga0070700_100180501 Ga0070700_1001805011 133
124 3300005456 Ga0070678_100011039 Ga0070678_1000110395 133
125 3300005530 Ga0070679_101414840 Ga0070679_1014148402 133
126 3300005535 Ga0070684_100031436 Ga0070684_1000314364 133
127 3300005543 Ga0070672_100003359 Ga0070672_10000335910 133
128 3300005544 Ga0070686_100016247 Ga0070686_1000162474 133
129 3300005547 Ga0070693_100180463 Ga0070693_1001804633 133
130 3300005578 Ga0068854_100007097 Ga0068854_1000070977 133
131 3300005614 Ga0068856_100081262 Ga0068856_1000812623 133
132 3300005615 Ga0070702_100185633 Ga0070702_1001856333 133
133 3300005618 Ga0068864_102696228 Ga0068864_1026962281 133
134 3300005718 Ga0068866_10262706 Ga0068866_102627062 133
135 3300005719 Ga0068861_100529750 Ga0068861_1005297502 133
136 3300005834 Ga0068851_10346341 Ga0068851_103463411 133
137 3300005842 Ga0068858_100879357 Ga0068858_1008793572 133
138 3300005843 Ga0068860_100631960 Ga0068860_1006319602 133
139 3300006237 Ga0097621_100426881 Ga0097621_1004268812 133
140 3300006358 Ga0068871_100109772 Ga0068871_1001097724 133
141 3300006881 Ga0068865_100000020 Ga0068865_10000002066 133
142 3300006881 Ga0068865_100187254 Ga0068865_1001872542 133
143 3300009148 Ga0105243_10137177 Ga0105243_101371773 133
144 3300009174 Ga0105241_10175191 Ga0105241_101751912 133
145 3300009176 Ga0105242_10081328 Ga0105242_100813282 133
146 3300009545 Ga0105237_10284469 Ga0105237_102844693 133
147 3300009551 Ga0105238_10071517 Ga0105238_100715172 133
148 3300013306 Ga0163162_11039566 Ga0163162_110395662 133
149 3300013307 Ga0157372_10181647 Ga0157372_101816475 133
150 3300013308 Ga0157375_10103896 Ga0157375_101038965 133
151 3300014745 Ga0157377_10049399 Ga0157377_100493995 133
152 3300020078 Ga0206352_10008056 Ga0206352_100080562 133
153 3300025321 Ga0207656_10029861 Ga0207656_100298614 133
154 3300025901 Ga0207688_10025229 Ga0207688_100252293 133
155 3300025919 Ga0207657_10021929 Ga0207657_100219295 133
156 3300025920 Ga0207649_10031433 Ga0207649_100314335 133
157 3300025933 Ga0207706_10010365 Ga0207706_100103657 133
158 3300025934 Ga0207686_10119805 Ga0207686_101198053 133
159 3300025937 Ga0207669_10102192 Ga0207669_101021922 133
160 3300025938 Ga0207704_10000004 Ga0207704_10000004127 133
161 3300025940 Ga0207691_10031948 Ga0207691_100319485 133
162 3300025942 Ga0207689_10069762 Ga0207689_100697624 133
163 3300025949 Ga0207667_10517346 Ga0207667_105173463 133
164 3300025960 Ga0207651_10020522 Ga0207651_100205222 133
165 3300025981 Ga0207640_10058367 Ga0207640_100583674 133
166 3300026023 Ga0207677_10101037 Ga0207677_101010373 133
167 3300026035 Ga0207703_11330224 Ga0207703_113302242 133
168 3300026041 Ga0207639_10179766 Ga0207639_101797664 133
169 3300026075 Ga0207708_10129580 Ga0207708_101295803 133
170 3300026118 Ga0207675_100039448 Ga0207675_1000394484 133
171 3300026121 Ga0207683_10089021 Ga0207683_100890212 133
172 3300028381 Ga0268264_10559911 Ga0268264_105599112 133
173 3300048904 Ga0496101_0156775 Ga0496101_0156775_169_606 133
174 3300048908 Ga0496105_0088368 Ga0496105_0088368_2059_2496 133
175 3300048912 Ga0496109_0380012 Ga0496109_0380012_699_1136 133
176 3300048917 Ga0496114_0435951 Ga0496114_0435951_593_1030 133
177 3300005336 Ga0070680_101561444 Ga0070680_1015614441 134
178 3300005354 Ga0070675_100167077 Ga0070675_1001670774 134
179 3300005364 Ga0070673_100043613 Ga0070673_1000436134 134
180 3300005444 Ga0070694_100297455 Ga0070694_1002974553 134
181 3300005455 Ga0070663_100020403 Ga0070663_1000204033 134
182 3300005457 Ga0070662_100067437 Ga0070662_1000674373 134
183 3300005458 Ga0070681_10365242 Ga0070681_103652422 134
184 3300005530 Ga0070679_100131322 Ga0070679_1001313224 134
185 3300005564 Ga0070664_100181493 Ga0070664_1001814933 134
186 3300005614 Ga0068856_100752202 Ga0068856_1007522022 134
187 3300005616 Ga0068852_100177395 Ga0068852_1001773954 134
188 3300005617 Ga0068859_100448446 Ga0068859_1004484462 134
189 3300006931 Ga0097620_100448429 Ga0097620_1004484292 134
190 3300009093 Ga0105240_10578730 Ga0105240_105787301 134
191 3300009098 Ga0105245_12403182 Ga0105245_124031821 134
192 3300009176 Ga0105242_10001012 Ga0105242_1000101222 134
193 3300009551 Ga0105238_10802758 Ga0105238_108027583 134
194 3300010375 Ga0105239_10045921 Ga0105239_100459213 134
195 3300013102 Ga0157371_10048015 Ga0157371_100480155 134
196 3300013104 Ga0157370_10752564 Ga0157370_107525642 134
197 3300013104 Ga0157370_10835440 Ga0157370_108354402 134
198 3300013104 Ga0157370_11272535 Ga0157370_112725351 134
199 3300013296 Ga0157374_10427883 Ga0157374_104278832 134
200 3300013297 Ga0157378_10012400 Ga0157378_100124007 134
201 3300020080 Ga0206350_10585354 Ga0206350_105853541 134
202 3300020081 Ga0206354_10885409 Ga0206354_108854091 134
203 3300025904 Ga0207647_10741282 Ga0207647_107412822 134
204 3300025907 Ga0207645_10129392 Ga0207645_101293923 134
205 3300025909 Ga0207705_10028083 Ga0207705_100280834 134
206 3300025926 Ga0207659_10033094 Ga0207659_100330945 134
207 3300025927 Ga0207687_10149363 Ga0207687_101493633 134
208 3300025934 Ga0207686_10000414 Ga0207686_1000041410 134
209 3300025935 Ga0207709_10045121 Ga0207709_100451213 134
210 3300025945 Ga0207679_10924592 Ga0207679_109245922 134
211 3300026067 Ga0207678_10043907 Ga0207678_100439075 134
212 3300026089 Ga0207648_10045428 Ga0207648_100454284 134
213 3300028800 Ga0265338_10001643 Ga0265338_1000164319 134
214 3300035113 Ga0373936_0115057 Ga0373936_0115057_485_925 134
215 3300046461 Ga0495641_0027210 Ga0495641_0027210_1389_1862 134
216 3300046517 Ga0495630_0000037 Ga0495630_0000037_47993_48466 134
217 3300046681 Ga0495647_0003378 Ga0495647_0003378_2581_3054 134
218 3300048911 Ga0496108_0325096 Ga0496108_0325096_248_682 134
219 3300005458 Ga0070681_11366302 Ga0070681_113663021 135
220 3300031548 Ga0307408_100089797 Ga0307408_1000897973 135
221 3300031731 Ga0307405_10124261 Ga0307405_101242612 135
222 3300031824 Ga0307413_10039268 Ga0307413_100392684 135
223 3300031852 Ga0307410_10027546 Ga0307410_100275464 135
224 3300031901 Ga0307406_10052099 Ga0307406_100520993 135
225 3300031903 Ga0307407_10041577 Ga0307407_100415773 135
226 3300031911 Ga0307412_10064994 Ga0307412_100649943 135
227 3300031995 Ga0307409_100119344 Ga0307409_1001193443 135
228 3300032002 Ga0307416_100306160 Ga0307416_1003061602 135
229 3300032004 Ga0307414_10148518 Ga0307414_101485182 135
230 3300032005 Ga0307411_10033789 Ga0307411_100337894 135
231 3300032126 Ga0307415_100016693 Ga0307415_1000166933 135
232 3300041505 Ga0451849_0048515 Ga0451849_0048515_250_699 135
233 3300049127 Ga0501306_015133 Ga0501306_015133_259_705 135
234 3300049129 Ga0501309_035323 Ga0501309_035323_247_693 135
235 3300049527 Ga0501311_036375 Ga0501311_036375_38_484 135
236 3300049531 Ga0501315_013620 Ga0501315_013620_480_926 135
237 3300049532 Ga0501316_021738 Ga0501316_021738_238_684 135
238 3300049533 Ga0501317_013613 Ga0501317_013613_328_774 135
239 3300049534 Ga0501318_027131 Ga0501318_027131_256_702 135
240 3300049536 Ga0501320_008286 Ga0501320_008286_478_924 135
241 3300049537 Ga0501321_026682 Ga0501321_026682_246_692 135
242 3300049539 Ga0501323_012061 Ga0501323_012061_477_923 135
243 3300049669 Ga0501235_101987 Ga0501235_101987_236_682 135
244 3300049741 Ga0501079_0934588 Ga0501079_0934588_27_497 135
245 3300049823 Ga0501044_0524598 Ga0501044_0524598_40_525 135
246 3300005330 Ga0070690_101148090 Ga0070690_1011480901 136
247 3300005338 Ga0068868_100000741 Ga0068868_10000074113 136
248 3300005614 Ga0068856_100548895 Ga0068856_1005488952 136
249 3300025944 Ga0207661_10107371 Ga0207661_101073714 136
250 3300026023 Ga0207677_10000465 Ga0207677_1000046510 136
251 3300026078 Ga0207702_10597620 Ga0207702_105976201 136
252 3300044694 Ga0466963_0299612 Ga0466963_0299612_123_590 136
253 3300045976 Ga0466967_0685363 Ga0466967_0685363_192_659 136
254 3300046533 Ga0495640_0049122 Ga0495640_0049122_105_557 136
255 3300047319 Ga0495674_0000108 Ga0495674_0000108_9821_10273 136
256 3300048911 Ga0496108_0505941 Ga0496108_0505941_555_1034 136
257 3300048912 Ga0496109_0292013 Ga0496109_0292013_758_1237 136
258 3300048913 Ga0496110_0060815 Ga0496110_0060815_1679_2158 136
259 3300048914 Ga0496111_0003563 Ga0496111_0003563_3530_4009 136
260 3300048915 Ga0496112_0110816 Ga0496112_0110816_1410_1889 136
261 3300048922 Ga0496119_0060935 Ga0496119_0060935_933_1364 136
262 3300004799 Ga0058863_11900107 Ga0058863_119001072 137
263 3300005347 Ga0070668_100031904 Ga0070668_1000319042 137
264 3300005356 Ga0070674_100002696 Ga0070674_1000026963 137
265 3300005441 Ga0070700_100000580 Ga0070700_10000058024 137
266 3300005459 Ga0068867_100053792 Ga0068867_1000537924 137
267 3300005937 Ga0081455_10735714 Ga0081455_107357141 137
268 3300009148 Ga0105243_10036575 Ga0105243_100365754 137
269 3300020069 Ga0197907_10277474 Ga0197907_102774742 137
270 3300020069 Ga0197907_10800161 Ga0197907_108001611 137
271 3300020075 Ga0206349_1257685 Ga0206349_12576852 137
272 3300020078 Ga0206352_10433741 Ga0206352_104337412 137
273 3300020081 Ga0206354_10989501 Ga0206354_109895013 137
274 3300020081 Ga0206354_11028322 Ga0206354_110283222 137
275 3300022467 Ga0224712_10014346 Ga0224712_100143462 137
276 3300022467 Ga0224712_10402934 Ga0224712_104029341 137
277 3300025893 Ga0207682_10062188 Ga0207682_100621882 137
278 3300025935 Ga0207709_10168827 Ga0207709_101688273 137
279 3300025937 Ga0207669_10014900 Ga0207669_100149005 137
280 3300025944 Ga0207661_10242778 Ga0207661_102427782 137
281 3300025972 Ga0207668_10017540 Ga0207668_100175406 137
282 3300026075 Ga0207708_10004693 Ga0207708_100046937 137
283 3300026089 Ga0207648_10074950 Ga0207648_100749504 137
284 3300031727 Ga0316576_10542298 Ga0316576_105422981 137
285 3300032126 Ga0307415_100696522 Ga0307415_1006965221 137
286 3300037312 Ga0395899_0139547 Ga0395899_0139547_96_527 137
287 3300037418 Ga0395900_0089562 Ga0395900_0089562_684_1115 137
288 3300037418 Ga0395900_0767161 Ga0395900_0767161_264_692 137
289 3300037466 Ga0395898_0005527 Ga0395898_0005527_5408_5839 137
290 3300037471 Ga0395905_0027496 Ga0395905_0027496_2642_3073 137
291 3300038443 Ga0395901_0022139 Ga0395901_0022139_3913_4344 137
292 3300044658 Ga0466972_0583853 Ga0466972_0583853_22_480 137
293 3300048909 Ga0496106_0217385 Ga0496106_0217385_655_1089 137
294 3300048915 Ga0496112_0000293 Ga0496112_0000293_29357_29791 137
295 3300048915 Ga0496112_0783507 Ga0496112_0783507_345_779 137
296 3300049581 Ga0501047_0035747 Ga0501047_0035747_2002_2487 137
297 3300049582 Ga0501048_0811702 Ga0501048_0811702_59_544 137
298 3300049586 Ga0501070_0072814 Ga0501070_0072814_1227_1712 137
299 3300053085 Ga0495619_0021730 Ga0495619_0021730_737_1177 137
300 3300005329 Ga0070683_100381673 Ga0070683_1003816733 138
301 3300005334 Ga0068869_101337302 Ga0068869_1013373021 138
302 3300005366 Ga0070659_100596607 Ga0070659_1005966072 138
303 3300005435 Ga0070714_101362587 Ga0070714_1013625871 138
304 3300005439 Ga0070711_100220871 Ga0070711_1002208713 138
305 3300005459 Ga0068867_100000766 Ga0068867_10000076612 138
306 3300005468 Ga0070707_100858866 Ga0070707_1008588662 138
307 3300005618 Ga0068864_100665506 Ga0068864_1006655062 138
308 3300005981 Ga0081538_10079429 Ga0081538_100794292 138
309 3300005985 Ga0081539_10017263 Ga0081539_100172631 138
310 3300006038 Ga0075365_10179505 Ga0075365_101795052 138
311 3300006048 Ga0075363_100198398 Ga0075363_1001983982 138
312 3300006852 Ga0075433_10288372 Ga0075433_102883723 138
313 3300006871 Ga0075434_100262629 Ga0075434_1002626293 138
314 3300007076 Ga0075435_100068856 Ga0075435_1000688563 138
315 3300009098 Ga0105245_11890960 Ga0105245_118909602 138
316 3300009147 Ga0114129_12321721 Ga0114129_123217212 138
317 3300010375 Ga0105239_12111880 Ga0105239_121118801 138
318 3300014325 Ga0163163_10951663 Ga0163163_109516631 138
319 3300014325 Ga0163163_11152471 Ga0163163_111524712 138
320 3300014326 Ga0157380_10414883 Ga0157380_104148831 138
321 3300014497 Ga0182008_10028739 Ga0182008_100287394 138
322 3300025927 Ga0207687_10752592 Ga0207687_107525922 138
323 3300025928 Ga0207700_11580532 Ga0207700_115805321 138
324 3300025932 Ga0207690_10299541 Ga0207690_102995412 138
325 3300025944 Ga0207661_10419653 Ga0207661_104196531 138
326 3300026095 Ga0207676_10624897 Ga0207676_106248972 138
327 3300029957 Ga0265324_10036423 Ga0265324_100364234 138
328 3300031240 Ga0265320_10000666 Ga0265320_1000066615 138
329 3300031249 Ga0265339_10084756 Ga0265339_100847562 138
330 3300031901 Ga0307406_11799910 Ga0307406_117999101 138
331 3300044694 Ga0466963_0018752 Ga0466963_0018752_1631_2065 138
332 3300045976 Ga0466967_0304393 Ga0466967_0304393_732_1196 138
333 3300045976 Ga0466967_0502194 Ga0466967_0502194_438_875 138
334 3300046674 Ga0495588_0386407 Ga0495588_0386407_208_678 138
335 3300048911 Ga0496108_0059784 Ga0496108_0059784_2511_2972 138
336 3300048912 Ga0496109_0013442 Ga0496109_0013442_2481_2942 138
337 3300048913 Ga0496110_0702872 Ga0496110_0702872_194_655 138
338 3300048914 Ga0496111_0147022 Ga0496111_0147022_207_668 138
339 3300048915 Ga0496112_0716029 Ga0496112_0716029_269_730 138
340 3300048916 Ga0496113_0038683 Ga0496113_0038683_2379_2840 138
341 3300050490 nmdc:mga03n38_107406_c1 nmdc:mga03n38_107406_c1_149_619 138
342 3300050492 nmdc:mga0yw44_187225_c1 nmdc:mga0yw44_187225_c1_416_886 138
343 3300050515 nmdc:mga0a205_309526_c1 nmdc:mga0a205_309526_c1_741_1172 138
344 3300061734 Ga0530510_0521974 Ga0530510_0521974_106_540 138
345 3300005327 Ga0070658_10136115 Ga0070658_101361154 139
346 3300005329 Ga0070683_100023952 Ga0070683_1000239526 139
347 3300005338 Ga0068868_100017477 Ga0068868_1000174773 139
348 3300005339 Ga0070660_100003054 Ga0070660_1000030548 139
349 3300005341 Ga0070691_10301873 Ga0070691_103018731 139
350 3300005343 Ga0070687_100348615 Ga0070687_1003486152 139
351 3300005344 Ga0070661_100031733 Ga0070661_1000317332 139
352 3300005345 Ga0070692_10014157 Ga0070692_100141573 139
353 3300005354 Ga0070675_100007308 Ga0070675_1000073085 139
354 3300005354 Ga0070675_101433240 Ga0070675_1014332401 139
355 3300005356 Ga0070674_100054232 Ga0070674_1000542324 139
356 3300005365 Ga0070688_100101347 Ga0070688_1001013474 139
357 3300005366 Ga0070659_100002893 Ga0070659_1000028936 139
358 3300005367 Ga0070667_100102662 Ga0070667_1001026622 139
359 3300005438 Ga0070701_10103693 Ga0070701_101036933 139
360 3300005441 Ga0070700_100061460 Ga0070700_1000614603 139
361 3300005444 Ga0070694_100087803 Ga0070694_1000878033 139
362 3300005455 Ga0070663_100076662 Ga0070663_1000766623 139
363 3300005457 Ga0070662_100025726 Ga0070662_1000257265 139
364 3300005459 Ga0068867_100205899 Ga0068867_1002058993 139
365 3300005466 Ga0070685_10007278 Ga0070685_100072781 139
366 3300005535 Ga0070684_100074737 Ga0070684_1000747374 139
367 3300005539 Ga0068853_100027027 Ga0068853_1000270276 139
368 3300005544 Ga0070686_100003109 Ga0070686_1000031098 139
369 3300005547 Ga0070693_100018587 Ga0070693_1000185875 139
370 3300005548 Ga0070665_100025513 Ga0070665_1000255135 139
371 3300005548 Ga0070665_100130912 Ga0070665_1001309123 139
372 3300005564 Ga0070664_100055063 Ga0070664_1000550632 139
373 3300005578 Ga0068854_100196899 Ga0068854_1001968993 139
374 3300005614 Ga0068856_100214288 Ga0068856_1002142882 139
375 3300005615 Ga0070702_100333122 Ga0070702_1003331222 139
376 3300005616 Ga0068852_100230790 Ga0068852_1002307904 139
377 3300005718 Ga0068866_10015734 Ga0068866_100157344 139
378 3300005834 Ga0068851_10034140 Ga0068851_100341403 139
379 3300005842 Ga0068858_100262168 Ga0068858_1002621682 139
380 3300005937 Ga0081455_10062003 Ga0081455_100620033 139
381 3300006038 Ga0075365_10040006 Ga0075365_100400064 139
382 3300006048 Ga0075363_100015254 Ga0075363_1000152542 139
383 3300006051 Ga0075364_10030019 Ga0075364_100300195 139
384 3300006847 Ga0075431_100146364 Ga0075431_1001463644 139
385 3300006852 Ga0075433_10087408 Ga0075433_100874084 139
386 3300006881 Ga0068865_100015601 Ga0068865_1000156013 139
387 3300009094 Ga0111539_10109537 Ga0111539_101095374 139
388 3300009094 Ga0111539_10757200 Ga0111539_107572002 139
389 3300009098 Ga0105245_10000159 Ga0105245_100001592 139
390 3300009098 Ga0105245_10004565 Ga0105245_100045654 139
391 3300009148 Ga0105243_10030929 Ga0105243_100309293 139
392 3300009553 Ga0105249_10221528 Ga0105249_102215284 139
393 3300013102 Ga0157371_10711406 Ga0157371_107114061 139
394 3300013307 Ga0157372_10061286 Ga0157372_100612864 139
395 3300014325 Ga0163163_10786208 Ga0163163_107862081 139
396 3300014497 Ga0182008_10365841 Ga0182008_103658413 139
397 3300014745 Ga0157377_10101152 Ga0157377_101011522 139
398 3300025321 Ga0207656_10016418 Ga0207656_100164183 139
399 3300025899 Ga0207642_10028406 Ga0207642_100284062 139
400 3300025904 Ga0207647_10100983 Ga0207647_101009832 139
401 3300025907 Ga0207645_10288660 Ga0207645_102886602 139
402 3300025909 Ga0207705_10023067 Ga0207705_100230673 139
403 3300025919 Ga0207657_10008958 Ga0207657_1000895811 139
404 3300025920 Ga0207649_10058099 Ga0207649_100580994 139
405 3300025921 Ga0207652_10436960 Ga0207652_104369602 139
406 3300025926 Ga0207659_10578606 Ga0207659_105786062 139
407 3300025926 Ga0207659_11542013 Ga0207659_115420131 139
408 3300025927 Ga0207687_10041108 Ga0207687_100411083 139
409 3300025932 Ga0207690_10034867 Ga0207690_100348671 139
410 3300025933 Ga0207706_10004968 Ga0207706_100049689 139
411 3300025935 Ga0207709_10030922 Ga0207709_100309224 139
412 3300025937 Ga0207669_10367904 Ga0207669_103679042 139
413 3300025938 Ga0207704_10057780 Ga0207704_100577801 139
414 3300025945 Ga0207679_10310795 Ga0207679_103107952 139
415 3300025961 Ga0207712_10252078 Ga0207712_102520783 139
416 3300025972 Ga0207668_10073183 Ga0207668_100731833 139
417 3300025981 Ga0207640_10069523 Ga0207640_100695233 139
418 3300025986 Ga0207658_10344448 Ga0207658_103444481 139
419 3300026023 Ga0207677_10027442 Ga0207677_100274423 139
420 3300026035 Ga0207703_10108685 Ga0207703_101086854 139
421 3300026041 Ga0207639_10050374 Ga0207639_100503744 139
422 3300026067 Ga0207678_10006324 Ga0207678_100063243 139
423 3300026075 Ga0207708_10008095 Ga0207708_100080953 139
424 3300026078 Ga0207702_10488503 Ga0207702_104885032 139
425 3300026089 Ga0207648_10158331 Ga0207648_101583314 139
426 3300026116 Ga0207674_10070583 Ga0207674_100705834 139
427 3300026121 Ga0207683_10138363 Ga0207683_101383634 139
428 3300026142 Ga0207698_10286779 Ga0207698_102867793 139
429 3300027907 Ga0207428_10072004 Ga0207428_100720044 139
430 3300028379 Ga0268266_10018170 Ga0268266_100181705 139
431 3300028379 Ga0268266_10220856 Ga0268266_102208564 139
432 3300028577 Ga0265318_10043575 Ga0265318_100435753 139
433 3300031911 Ga0307412_11752890 Ga0307412_117528901 139
434 3300031995 Ga0307409_100317296 Ga0307409_1003172962 139
435 3300032002 Ga0307416_100854557 Ga0307416_1008545572 139
436 3300032002 Ga0307416_101706132 Ga0307416_1017061321 139
437 3300032005 Ga0307411_10350869 Ga0307411_103508691 139
438 3300044693 Ga0466961_0726483 Ga0466961_0726483_51_518 139
439 3300044842 Ga0466957_0000697 Ga0466957_0000697_10108_10575 139
440 3300045836 Ga0466958_0449977 Ga0466958_0449977_109_588 139
441 3300047673 Ga0495593_0029526 Ga0495593_0029526_2269_2733 139
442 3300048904 Ga0496101_0481305 Ga0496101_0481305_163_642 139
443 3300048905 Ga0496102_0604709 Ga0496102_0604709_352_831 139
444 3300048910 Ga0496107_0074213 Ga0496107_0074213_980_1459 139
445 3300048911 Ga0496108_0002794 Ga0496108_0002794_6155_6634 139
446 3300048912 Ga0496109_0302055 Ga0496109_0302055_486_965 139
447 3300048913 Ga0496110_0095026 Ga0496110_0095026_178_657 139
448 3300048914 Ga0496111_0106027 Ga0496111_0106027_578_1057 139
449 3300049514 Ga0501291_049642 Ga0501291_049642_113_547 139
450 3300049587 Ga0501071_0810121 Ga0501071_0810121_248_682 139
451 3300049590 Ga0501074_0654358 Ga0501074_0654358_10_444 139
452 3300049592 Ga0501076_0434851 Ga0501076_0434851_30_464 139
453 3300050490 nmdc:mga03n38_15679_c1 nmdc:mga03n38_15679_c1_1845_2324 139
454 3300050491 nmdc:mga00v17_28476_c1 nmdc:mga00v17_28476_c1_487_966 139
455 3300050492 nmdc:mga0yw44_99293_c1 nmdc:mga0yw44_99293_c1_811_1290 139
456 3300050507 nmdc:mga05p37_586484_c1 nmdc:mga05p37_586484_c1_446_919 139
457 3300050510 nmdc:mga06r32_413186_c1 nmdc:mga06r32_413186_c1_120_593 139
458 3300050511 nmdc:mga08y16_239741_c1 nmdc:mga08y16_239741_c1_799_1272 139
459 3300054114 Ga0501084_0927535 Ga0501084_0927535_247_681 139
460 3300060353 Ga0501082_0782012 Ga0501082_0782012_125_562 139
461 3300060353 Ga0501082_0929047 Ga0501082_0929047_309_743 139
462 3300061734 Ga0530510_1078794 Ga0530510_1078794_31_465 139
463 3300005340 Ga0070689_100076737 Ga0070689_1000767372 140
464 3300005441 Ga0070700_101045638 Ga0070700_1010456382 140
465 3300005459 Ga0068867_100460467 Ga0068867_1004604672 140
466 3300009094 Ga0111539_10283300 Ga0111539_102833003 140
467 3300009148 Ga0105243_10206613 Ga0105243_102066133 140
468 3300009553 Ga0105249_10815412 Ga0105249_108154122 140
469 3300013105 Ga0157369_10001902 Ga0157369_1000190214 140
470 3300020080 Ga0206350_10773500 Ga0206350_107735001 140
471 3300025918 Ga0207662_10745471 Ga0207662_107454711 140
472 3300025936 Ga0207670_10020104 Ga0207670_100201041 140
473 3300025961 Ga0207712_10942185 Ga0207712_109421851 140
474 3300026075 Ga0207708_10870884 Ga0207708_108708842 140
475 3300026089 Ga0207648_10082193 Ga0207648_100821933 140
476 3300028556 Ga0265337_1000409 Ga0265337_10004099 140
477 3300028666 Ga0265336_10000836 Ga0265336_100008366 140
478 3300028800 Ga0265338_10001224 Ga0265338_100012247 140
479 3300041494 Ga0451837_1397650 Ga0451837_1397650_16_486 140
480 3300042438 Ga0439459_0112160 Ga0439459_0112160_76_510 140
481 3300047320 Ga0495672_0006597 Ga0495672_0006597_819_1292 140
482 3300048906 Ga0496103_0873276 Ga0496103_0873276_92_547 140
483 3300048907 Ga0496104_0026472 Ga0496104_0026472_2716_3204 140
484 3300048908 Ga0496105_0002894 Ga0496105_0002894_9871_10359 140
485 3300048913 Ga0496110_0665562 Ga0496110_0665562_116_574 140
486 3300048914 Ga0496111_0239221 Ga0496111_0239221_361_819 140
487 3300048915 Ga0496112_0057563 Ga0496112_0057563_2282_2770 140
488 3300049162 Ga0501307_095072 Ga0501307_095072_13_450 140
489 3300049581 Ga0501047_0245491 Ga0501047_0245491_559_1029 140
490 3300061734 Ga0530510_1369944 Ga0530510_1369944_69_506 140
491 3300005345 Ga0070692_10006250 Ga0070692_100062506 141
492 3300005441 Ga0070700_100858839 Ga0070700_1008588391 141
493 3300005719 Ga0068861_100599050 Ga0068861_1005990503 141
494 3300006038 Ga0075365_10251253 Ga0075365_102512533 141
495 3300006844 Ga0075428_100083896 Ga0075428_1000838963 141
496 3300006847 Ga0075431_100563415 Ga0075431_1005634151 141
497 3300009147 Ga0114129_10474859 Ga0114129_104748592 141
498 3300009176 Ga0105242_10557358 Ga0105242_105573583 141
499 3300025909 Ga0207705_10615488 Ga0207705_106154881 141
500 3300025912 Ga0207707_10308264 Ga0207707_103082642 141
501 3300025921 Ga0207652_10202063 Ga0207652_102020633 141
502 3300025934 Ga0207686_11023422 Ga0207686_110234221 141
503 3300025981 Ga0207640_10886231 Ga0207640_108862312 141
504 3300028558 Ga0265326_10000004 Ga0265326_10000004215 141
505 3300037466 Ga0395898_0674620 Ga0395898_0674620_454_918 141
506 3300046474 Ga0495605_0157975 Ga0495605_0157975_564_998 141
507 3300048907 Ga0496104_0000007 Ga0496104_0000007_290632_291078 141
508 3300048908 Ga0496105_0000002 Ga0496105_0000002_493571_494017 141
509 3300048914 Ga0496111_0619677 Ga0496111_0619677_238_711 141
510 3300048923 Ga0496120_0403461 Ga0496120_0403461_40_486 141
511 3300050492 nmdc:mga0yw44_77423_c1 nmdc:mga0yw44_77423_c1_1006_1458 141
512 3300005331 Ga0070670_100011812 Ga0070670_1000118124 142
513 3300005337 Ga0070682_100738657 Ga0070682_1007386572 142
514 3300005366 Ga0070659_100325138 Ga0070659_1003251383 142
515 3300005937 Ga0081455_10241399 Ga0081455_102413992 142
516 3300006038 Ga0075365_10596924 Ga0075365_105969241 142
517 3300006178 Ga0075367_10806620 Ga0075367_108066201 142
518 3300009177 Ga0105248_10000022 Ga0105248_10000022290 142
519 3300013104 Ga0157370_10343265 Ga0157370_103432653 142
520 3300021384 Ga0213876_10081529 Ga0213876_100815291 142
521 3300025906 Ga0207699_10286050 Ga0207699_102860501 142
522 3300025925 Ga0207650_10107664 Ga0207650_101076641 142
523 3300025932 Ga0207690_10162618 Ga0207690_101626182 142
524 3300025941 Ga0207711_10000019 Ga0207711_1000001948 142
525 3300025944 Ga0207661_10351667 Ga0207661_103516672 142
526 3300031548 Ga0307408_101698149 Ga0307408_1016981491 142
527 3300031995 Ga0307409_100210588 Ga0307409_1002105881 142
528 3300037853 Ga0436364_0566822 Ga0436364_0566822_202_657 142
529 3300039437 Ga0436365_0654443 Ga0436365_0654443_1652_2113 142
530 3300039450 Ga0436363_0046650 Ga0436363_0046650_22632_23093 142
531 3300039453 Ga0436362_1246024 Ga0436362_1246024_176_643 142
532 3300044658 Ga0466972_0186121 Ga0466972_0186121_143_622 142
533 3300044693 Ga0466961_0162616 Ga0466961_0162616_769_1248 142
534 3300044694 Ga0466963_0073369 Ga0466963_0073369_1033_1512 142
535 3300044765 Ga0466970_0048058 Ga0466970_0048058_1616_2095 142
536 3300044765 Ga0466970_0077917 Ga0466970_0077917_458_937 142
537 3300044842 Ga0466957_0113200 Ga0466957_0113200_1063_1542 142
538 3300045049 Ga0466959_0129570 Ga0466959_0129570_687_1166 142
539 3300048912 Ga0496109_0776174 Ga0496109_0776174_363_815 142
540 3300048914 Ga0496111_0569738 Ga0496111_0569738_40_492 142
541 3300048922 Ga0496119_0032546 Ga0496119_0032546_1390_1854 142
542 3300048927 Ga0496124_0093327 Ga0496124_0093327_1294_1773 142
543 3300049584 Ga0501068_0225721 Ga0501068_0225721_674_1153 142
544 3300049590 Ga0501074_0024292 Ga0501074_0024292_786_1265 142
545 3300049741 Ga0501079_0081496 Ga0501079_0081496_1636_2115 142
546 3300049742 Ga0501080_0013630 Ga0501080_0013630_6149_6628 142
547 3300050512 nmdc:mga0n895_1169236_c1 nmdc:mga0n895_1169236_c1_13_498 142
548 3300053083 Ga0495655_0004243 Ga0495655_0004243_1590_2078 142
549 3300005365 Ga0070688_100000344 Ga0070688_10000034422 143
550 3300005436 Ga0070713_101210501 Ga0070713_1012105011 143
551 3300005466 Ga0070685_10000290 Ga0070685_1000029022 143
552 3300005614 Ga0068856_100000057 Ga0068856_1000000575 143
553 3300005937 Ga0081455_10332764 Ga0081455_103327642 143
554 3300009147 Ga0114129_13336210 Ga0114129_133362101 143
555 3300025928 Ga0207700_10781928 Ga0207700_107819281 143
556 3300026078 Ga0207702_10000027 Ga0207702_10000027141 143
557 3300031995 Ga0307409_100078685 Ga0307409_1000786854 143
558 3300038443 Ga0395901_0122913 Ga0395901_0122913_2144_2608 143
559 3300038443 Ga0395901_0480471 Ga0395901_0480471_83_544 143
560 3300039453 Ga0436362_1118531 Ga0436362_1118531_413_871 143
561 3300044684 Ga0466966_0318307 Ga0466966_0318307_265_723 143
562 3300044693 Ga0466961_0794864 Ga0466961_0794864_46_504 143
563 3300046455 Ga0495603_0005110 Ga0495603_0005110_7130_7609 143
564 3300046681 Ga0495647_0205198 Ga0495647_0205198_245_724 143
565 3300047321 Ga0495676_0071215 Ga0495676_0071215_795_1436 143
566 3300049576 Ga0501040_0359911 Ga0501040_0359911_12_467 143
567 3300003203 JGI25406J46586_10004410 JGI25406J46586_100044101 144
568 3300005334 Ga0068869_100809000 Ga0068869_1008090001 144
569 3300005337 Ga0070682_100005793 Ga0070682_1000057937 144
570 3300005338 Ga0068868_100860305 Ga0068868_1008603051 144
571 3300005344 Ga0070661_101309255 Ga0070661_1013092551 144
572 3300005435 Ga0070714_100368285 Ga0070714_1003682851 144
573 3300005441 Ga0070700_100493138 Ga0070700_1004931381 144
574 3300005441 Ga0070700_100713191 Ga0070700_1007131912 144
575 3300005614 Ga0068856_100717900 Ga0068856_1007179002 144
576 3300005937 Ga0081455_10123476 Ga0081455_101234762 144
577 3300005937 Ga0081455_10266880 Ga0081455_102668801 144
578 3300005937 Ga0081455_10587474 Ga0081455_105874742 144
579 3300005983 Ga0081540_1121390 Ga0081540_11213901 144
580 3300009094 Ga0111539_10113127 Ga0111539_101131274 144
581 3300009101 Ga0105247_10000838 Ga0105247_1000083813 144
582 3300009553 Ga0105249_11201558 Ga0105249_112015581 144
583 3300010375 Ga0105239_10359881 Ga0105239_103598811 144
584 3300013105 Ga0157369_11599938 Ga0157369_115999381 144
585 3300013306 Ga0163162_11238719 Ga0163162_112387192 144
586 3300014326 Ga0157380_10910232 Ga0157380_109102322 144
587 3300020082 Ga0206353_11178628 Ga0206353_111786284 144
588 3300021384 Ga0213876_10061056 Ga0213876_100610561 144
589 3300021388 Ga0213875_10096172 Ga0213875_100961722 144
590 3300025900 Ga0207710_10001786 Ga0207710_1000178613 144
591 3300025927 Ga0207687_10000011 Ga0207687_10000011391 144
592 3300025937 Ga0207669_10209707 Ga0207669_102097072 144
593 3300025944 Ga0207661_10491273 Ga0207661_104912731 144
594 3300025981 Ga0207640_11080523 Ga0207640_110805231 144
595 3300026035 Ga0207703_11981674 Ga0207703_119816741 144
596 3300026075 Ga0207708_10614269 Ga0207708_106142692 144
597 3300026121 Ga0207683_10851265 Ga0207683_108512651 144
598 3300026142 Ga0207698_11669317 Ga0207698_116693171 144
599 3300031995 Ga0307409_100939462 Ga0307409_1009394621 144
600 3300035118 Ga0373954_0237694 Ga0373954_0237694_183_662 144
601 3300037418 Ga0395900_1196132 Ga0395900_1196132_52_528 144
602 3300037853 Ga0436364_0997712 Ga0436364_0997712_1258_1719 144
603 3300039437 Ga0436365_1237803 Ga0436365_1237803_5910_6371 144
604 3300041512 Ga0451853_2670470 Ga0451853_2670470_293_754 144
605 3300044901 Ga0466960_0038448 Ga0466960_0038448_1378_1866 144
606 3300045976 Ga0466967_0485026 Ga0466967_0485026_326_790 144
607 3300046615 Ga0495656_0340014 Ga0495656_0340014_30_494 144
608 3300046691 Ga0495670_0800172 Ga0495670_0800172_33_497 144
609 3300047471 Ga0495684_0328752 Ga0495684_0328752_24_473 144
610 3300048907 Ga0496104_0000002 Ga0496104_0000002_25933_26406 144
611 3300048908 Ga0496105_0000001 Ga0496105_0000001_1301773_1302246 144
612 3300048911 Ga0496108_0000024 Ga0496108_0000024_25892_26374 144
613 3300048912 Ga0496109_0000033 Ga0496109_0000033_2999_3481 144
614 3300048912 Ga0496109_0455758 Ga0496109_0455758_695_1162 144
615 3300048923 Ga0496120_0086626 Ga0496120_0086626_391_864 144
616 3300049572 Ga0501036_1655586 Ga0501036_1655586_37_504 144
617 3300005327 Ga0070658_10928120 Ga0070658_109281201 145
618 3300005329 Ga0070683_100055916 Ga0070683_1000559161 145
619 3300005329 Ga0070683_101217807 Ga0070683_1012178071 145
620 3300005344 Ga0070661_100334113 Ga0070661_1003341132 145
621 3300005356 Ga0070674_101086001 Ga0070674_1010860011 145
622 3300005366 Ga0070659_100115142 Ga0070659_1001151423 145
623 3300005366 Ga0070659_100296785 Ga0070659_1002967852 145
624 3300005440 Ga0070705_100176359 Ga0070705_1001763593 145
625 3300005455 Ga0070663_100070278 Ga0070663_1000702784 145
626 3300005457 Ga0070662_100338927 Ga0070662_1003389271 145
627 3300005530 Ga0070679_100263399 Ga0070679_1002633991 145
628 3300005535 Ga0070684_100259261 Ga0070684_1002592612 145
629 3300005539 Ga0068853_100696305 Ga0068853_1006963051 145
630 3300005539 Ga0068853_100961284 Ga0068853_1009612841 145
631 3300005545 Ga0070695_100076484 Ga0070695_1000764844 145
632 3300005549 Ga0070704_100218694 Ga0070704_1002186942 145
633 3300005564 Ga0070664_100328736 Ga0070664_1003287362 145
634 3300005564 Ga0070664_100412199 Ga0070664_1004121991 145
635 3300005577 Ga0068857_100106454 Ga0068857_1001064544 145
636 3300005615 Ga0070702_100120835 Ga0070702_1001208351 145
637 3300005616 Ga0068852_100000058 Ga0068852_10000005872 145
638 3300005981 Ga0081538_10020689 Ga0081538_100206893 145
639 3300005985 Ga0081539_10186475 Ga0081539_101864752 145
640 3300006195 Ga0075366_10321400 Ga0075366_103214001 145
641 3300006358 Ga0068871_101915773 Ga0068871_1019157731 145
642 3300006871 Ga0075434_100010868 Ga0075434_1000108685 145
643 3300006871 Ga0075434_100195933 Ga0075434_1001959333 145
644 3300006914 Ga0075436_100466669 Ga0075436_1004666692 145
645 3300007076 Ga0075435_100360935 Ga0075435_1003609352 145
646 3300009094 Ga0111539_10576004 Ga0111539_105760041 145
647 3300009098 Ga0105245_10126764 Ga0105245_101267643 145
648 3300009147 Ga0114129_10045130 Ga0114129_100451306 145
649 3300009148 Ga0105243_10069881 Ga0105243_100698813 145
650 3300009176 Ga0105242_10120725 Ga0105242_101207253 145
651 3300010375 Ga0105239_10601666 Ga0105239_106016662 145
652 3300010375 Ga0105239_11357800 Ga0105239_113578001 145
653 3300011119 Ga0105246_11165939 Ga0105246_111659391 145
654 3300013102 Ga0157371_10501409 Ga0157371_105014091 145
655 3300013105 Ga0157369_11563459 Ga0157369_115634591 145
656 3300013297 Ga0157378_10185172 Ga0157378_101851724 145
657 3300013306 Ga0163162_10830624 Ga0163162_108306243 145
658 3300013307 Ga0157372_10533797 Ga0157372_105337971 145
659 3300013308 Ga0157375_10269222 Ga0157375_102692222 145
660 3300013308 Ga0157375_12059850 Ga0157375_120598501 145
661 3300014745 Ga0157377_10143378 Ga0157377_101433782 145
662 3300020070 Ga0206356_11759950 Ga0206356_117599501 145
663 3300025927 Ga0207687_10085822 Ga0207687_100858223 145
664 3300025931 Ga0207644_10248387 Ga0207644_102483872 145
665 3300025932 Ga0207690_10155403 Ga0207690_101554032 145
666 3300025933 Ga0207706_10390981 Ga0207706_103909812 145
667 3300025937 Ga0207669_10371849 Ga0207669_103718492 145
668 3300025944 Ga0207661_10183527 Ga0207661_101835271 145
669 3300025944 Ga0207661_11092381 Ga0207661_110923811 145
670 3300026023 Ga0207677_11440837 Ga0207677_114408371 145
671 3300026067 Ga0207678_10628402 Ga0207678_106284022 145
672 3300026075 Ga0207708_10869133 Ga0207708_108691331 145
673 3300026088 Ga0207641_11764899 Ga0207641_117648991 145
674 3300026089 Ga0207648_10260681 Ga0207648_102606813 145
675 3300026116 Ga0207674_10948824 Ga0207674_109488241 145
676 3300026142 Ga0207698_10000002 Ga0207698_10000002212 145
677 3300026142 Ga0207698_10330135 Ga0207698_103301352 145
678 3300031824 Ga0307413_10238231 Ga0307413_102382312 145
679 3300031852 Ga0307410_10426017 Ga0307410_104260173 145
680 3300031901 Ga0307406_10511448 Ga0307406_105114481 145
681 3300031903 Ga0307407_10153050 Ga0307407_101530503 145
682 3300031995 Ga0307409_100117484 Ga0307409_1001174841 145
683 3300032004 Ga0307414_10172025 Ga0307414_101720252 145
684 3300032126 Ga0307415_101521401 Ga0307415_1015214011 145
685 3300035398 Ga0316574_0061749 Ga0316574_0061749_436_909 145
686 3300037466 Ga0395898_1357451 Ga0395898_1357451_120_566 145
687 3300038443 Ga0395901_1341353 Ga0395901_1341353_189_635 145
688 3300041512 Ga0451853_0757159 Ga0451853_0757159_469_939 145
689 3300044706 Ga0466964_0304889 Ga0466964_0304889_323_784 145
690 3300045976 Ga0466967_0032630 Ga0466967_0032630_96_569 145
691 3300045976 Ga0466967_0280667 Ga0466967_0280667_818_1300 145
692 3300045976 Ga0466967_1078248 Ga0466967_1078248_58_519 145
693 3300048905 Ga0496102_0449953 Ga0496102_0449953_729_1175 145
694 3300048909 Ga0496106_0188359 Ga0496106_0188359_695_1141 145
695 3300048912 Ga0496109_0310002 Ga0496109_0310002_670_1146 145
696 3300048913 Ga0496110_0409563 Ga0496110_0409563_663_1139 145
697 3300048914 Ga0496111_1057206 Ga0496111_1057206_28_498 145
698 3300050507 nmdc:mga05p37_54356_c1 nmdc:mga05p37_54356_c1_1043_1495 145
699 3300050510 nmdc:mga06r32_1263448_c1 nmdc:mga06r32_1263448_c1_91_540 145
700 3300050512 nmdc:mga0n895_189723_c1 nmdc:mga0n895_189723_c1_783_1232 145
701 3300050512 nmdc:mga0n895_55336_c1 nmdc:mga0n895_55336_c1_3143_3595 145
702 3300050513 nmdc:mga0rr50_322551_c1 nmdc:mga0rr50_322551_c1_263_718 145
703 3300050515 nmdc:mga0a205_20641_c1 nmdc:mga0a205_20641_c1_4660_5112 145
704 3300005719 Ga0068861_101713398 Ga0068861_1017133981 146
705 3300009147 Ga0114129_12094590 Ga0114129_120945901 146
706 3300009545 Ga0105237_10001106 Ga0105237_1000110631 146
707 3300014497 Ga0182008_10127331 Ga0182008_101273312 146
708 3300025915 Ga0207693_10370815 Ga0207693_103708152 146
709 3300028577 Ga0265318_10032403 Ga0265318_100324033 146
710 3300031251 Ga0265327_10011293 Ga0265327_100112936 146
711 3300031251 Ga0265327_10033767 Ga0265327_100337673 146
712 3300031852 Ga0307410_10002660 Ga0307410_100026602 146
713 3300032002 Ga0307416_100330015 Ga0307416_1003300152 146
714 3300032126 Ga0307415_100001983 Ga0307415_1000019839 146
715 3300035119 Ga0373956_0581178 Ga0373956_0581178_21_488 146
716 3300037466 Ga0395898_0226295 Ga0395898_0226295_893_1372 146
717 3300037471 Ga0395905_0506836 Ga0395905_0506836_584_1063 146
718 3300044694 Ga0466963_0195320 Ga0466963_0195320_192_662 146
719 3300044694 Ga0466963_0204414 Ga0466963_0204414_86_553 146
720 3300045976 Ga0466967_0276665 Ga0466967_0276665_1014_1493 146
721 3300046663 Ga0495635_0561848 Ga0495635_0561848_62_529 146
722 3300048912 Ga0496109_0574838 Ga0496109_0574838_405_887 146
723 3300049586 Ga0501070_0819531 Ga0501070_0819531_103_573 146
724 3300053085 Ga0495619_0173023 Ga0495619_0173023_742_1209 146
725 3300005983 Ga0081540_1003253 Ga0081540_100325312 147
726 3300005983 Ga0081540_1103668 Ga0081540_11036681 147
727 3300006844 Ga0075428_100335854 Ga0075428_1003358543 147
728 3300006846 Ga0075430_100090709 Ga0075430_1000907094 147
729 3300006847 Ga0075431_100055610 Ga0075431_1000556103 147
730 3300006871 Ga0075434_100913602 Ga0075434_1009136021 147
731 3300006880 Ga0075429_100013154 Ga0075429_1000131545 147
732 3300006881 Ga0068865_100912347 Ga0068865_1009123471 147
733 3300009147 Ga0114129_10494082 Ga0114129_104940822 147
734 3300009147 Ga0114129_10889851 Ga0114129_108898511 147
735 3300025925 Ga0207650_11254361 Ga0207650_112543611 147
736 3300031901 Ga0307406_10773307 Ga0307406_107733071 147
737 3300031903 Ga0307407_10601270 Ga0307407_106012701 147
738 3300032126 Ga0307415_100629868 Ga0307415_1006298681 147
739 3300037312 Ga0395899_0255730 Ga0395899_0255730_656_1126 147
740 3300037418 Ga0395900_0106773 Ga0395900_0106773_1335_1805 147
741 3300037466 Ga0395898_0015974 Ga0395898_0015974_6060_6530 147
742 3300037471 Ga0395905_0015836 Ga0395905_0015836_1584_2054 147
743 3300038443 Ga0395901_0019600 Ga0395901_0019600_4662_5132 147
744 3300044694 Ga0466963_0042130 Ga0466963_0042130_1893_2363 147
745 3300044842 Ga0466957_0239355 Ga0466957_0239355_329_799 147
746 3300045836 Ga0466958_0111359 Ga0466958_0111359_675_1145 147
747 3300049582 Ga0501048_0522952 Ga0501048_0522952_386_838 147
748 3300049585 Ga0501069_0230232 Ga0501069_0230232_597_1061 147
749 3300049591 Ga0501075_0727464 Ga0501075_0727464_151_615 147
750 3300049741 Ga0501079_0404537 Ga0501079_0404537_352_804 147
751 3300050507 nmdc:mga05p37_1240364_c1 nmdc:mga05p37_1240364_c1_62_529 147
752 3300050507 nmdc:mga05p37_371224_c1 nmdc:mga05p37_371224_c1_805_1254 147
753 3300050508 nmdc:mga09592_52641_c1 nmdc:mga09592_52641_c1_971_1420 147
754 3300050510 nmdc:mga06r32_122626_c1 nmdc:mga06r32_122626_c1_345_794 147
755 3300060353 Ga0501082_0964359 Ga0501082_0964359_25_477 147
756 3300005330 Ga0070690_100372389 Ga0070690_1003723891 148
757 3300005337 Ga0070682_100103473 Ga0070682_1001034732 148
758 3300005340 Ga0070689_100712527 Ga0070689_1007125271 148
759 3300005341 Ga0070691_10311047 Ga0070691_103110472 148
760 3300005347 Ga0070668_100089905 Ga0070668_1000899053 148
761 3300005355 Ga0070671_100671685 Ga0070671_1006716851 148
762 3300005356 Ga0070674_100144727 Ga0070674_1001447273 148
763 3300005364 Ga0070673_100432843 Ga0070673_1004328431 148
764 3300005434 Ga0070709_10101666 Ga0070709_101016661 148
765 3300005437 Ga0070710_10103279 Ga0070710_101032793 148
766 3300005439 Ga0070711_100063702 Ga0070711_1000637022 148
767 3300005444 Ga0070694_100375921 Ga0070694_1003759212 148
768 3300005456 Ga0070678_100014808 Ga0070678_1000148084 148
769 3300005471 Ga0070698_100983281 Ga0070698_1009832811 148
770 3300005536 Ga0070697_100278722 Ga0070697_1002787223 148
771 3300005549 Ga0070704_100039805 Ga0070704_1000398053 148
772 3300005718 Ga0068866_10255556 Ga0068866_102555562 148
773 3300005719 Ga0068861_100135106 Ga0068861_1001351063 148
774 3300005842 Ga0068858_100200859 Ga0068858_1002008592 148
775 3300005937 Ga0081455_10209326 Ga0081455_102093263 148
776 3300006038 Ga0075365_10012498 Ga0075365_100124986 148
777 3300006038 Ga0075365_10022183 Ga0075365_100221834 148
778 3300006038 Ga0075365_10086436 Ga0075365_100864363 148
779 3300006038 Ga0075365_10259537 Ga0075365_102595372 148
780 3300006051 Ga0075364_10047086 Ga0075364_100470864 148
781 3300006051 Ga0075364_10295271 Ga0075364_102952712 148
782 3300006173 Ga0070716_100266038 Ga0070716_1002660382 148
783 3300006175 Ga0070712_100012995 Ga0070712_1000129954 148
784 3300006844 Ga0075428_100051023 Ga0075428_1000510231 148
785 3300006846 Ga0075430_100778405 Ga0075430_1007784052 148
786 3300006847 Ga0075431_100000134 Ga0075431_10000013445 148
787 3300006847 Ga0075431_100302839 Ga0075431_1003028393 148
788 3300006847 Ga0075431_100938973 Ga0075431_1009389731 148
789 3300006852 Ga0075433_10009707 Ga0075433_100097077 148
790 3300006871 Ga0075434_100009612 Ga0075434_1000096127 148
791 3300006880 Ga0075429_100587573 Ga0075429_1005875731 148
792 3300006881 Ga0068865_100503576 Ga0068865_1005035761 148
793 3300009094 Ga0111539_10016678 Ga0111539_100166784 148
794 3300009098 Ga0105245_10002823 Ga0105245_1000282315 148
795 3300009101 Ga0105247_10506042 Ga0105247_105060421 148
796 3300009147 Ga0114129_10051817 Ga0114129_100518173 148
797 3300009148 Ga0105243_10066378 Ga0105243_100663782 148
798 3300009148 Ga0105243_10735610 Ga0105243_107356102 148
799 3300009553 Ga0105249_10676117 Ga0105249_106761172 148
800 3300011119 Ga0105246_10114148 Ga0105246_101141482 148
801 3300013297 Ga0157378_10866825 Ga0157378_108668251 148
802 3300013306 Ga0163162_10781478 Ga0163162_107814783 148
803 3300013308 Ga0157375_10027026 Ga0157375_100270266 148
804 3300013308 Ga0157375_11220304 Ga0157375_112203042 148
805 3300014968 Ga0157379_10157217 Ga0157379_101572172 148
806 3300020082 Ga0206353_10927289 Ga0206353_109272891 148
807 3300025899 Ga0207642_10208162 Ga0207642_102081622 148
808 3300025915 Ga0207693_10013895 Ga0207693_100138954 148
809 3300025916 Ga0207663_10057775 Ga0207663_100577753 148
810 3300025927 Ga0207687_10032650 Ga0207687_100326502 148
811 3300025935 Ga0207709_10057610 Ga0207709_100576102 148
812 3300025935 Ga0207709_10321957 Ga0207709_103219572 148
813 3300025937 Ga0207669_10232338 Ga0207669_102323381 148
814 3300025938 Ga0207704_10210494 Ga0207704_102104943 148
815 3300025939 Ga0207665_10110275 Ga0207665_101102752 148
816 3300025961 Ga0207712_10693833 Ga0207712_106938331 148
817 3300025972 Ga0207668_11027723 Ga0207668_110277231 148
818 3300026035 Ga0207703_10335689 Ga0207703_103356892 148
819 3300026121 Ga0207683_10033551 Ga0207683_100335514 148
820 3300026142 Ga0207698_10543636 Ga0207698_105436361 148
821 3300027907 Ga0207428_10044132 Ga0207428_100441323 148
822 3300028381 Ga0268264_11079816 Ga0268264_110798161 148
823 3300031901 Ga0307406_10018517 Ga0307406_100185171 148
824 3300032005 Ga0307411_10861001 Ga0307411_108610011 148
825 3300037068 Ga0373925_0117282 Ga0373925_0117282_1461_1934 148
826 3300046459 Ga0495629_0155703 Ga0495629_0155703_89_562 148
827 3300046473 Ga0495582_0108015 Ga0495582_0108015_941_1414 148
828 3300046475 Ga0495639_0397053 Ga0495639_0397053_67_540 148
829 3300046499 Ga0495594_0021711 Ga0495594_0021711_874_1347 148
830 3300046674 Ga0495588_0103934 Ga0495588_0103934_466_939 148
831 3300046681 Ga0495647_0070427 Ga0495647_0070427_336_797 148
832 3300047321 Ga0495676_0092642 Ga0495676_0092642_1279_1752 148
833 3300048903 Ga0496100_0016889 Ga0496100_0016889_3555_4028 148
834 3300048904 Ga0496101_0004260 Ga0496101_0004260_6651_7124 148
835 3300048905 Ga0496102_0029219 Ga0496102_0029219_1334_1807 148
836 3300048906 Ga0496103_0006391 Ga0496103_0006391_6492_6965 148
837 3300048907 Ga0496104_0043868 Ga0496104_0043868_3515_3988 148
838 3300048908 Ga0496105_0059859 Ga0496105_0059859_1462_1935 148
839 3300048909 Ga0496106_0096802 Ga0496106_0096802_786_1259 148
840 3300048910 Ga0496107_0075197 Ga0496107_0075197_524_997 148
841 3300048911 Ga0496108_0061700 Ga0496108_0061700_396_869 148
842 3300048915 Ga0496112_0084664 Ga0496112_0084664_45_518 148
843 3300048916 Ga0496113_0060774 Ga0496113_0060774_1078_1551 148
844 3300048917 Ga0496114_0009129 Ga0496114_0009129_5558_6031 148
845 3300048918 Ga0496115_0015903 Ga0496115_0015903_3920_4393 148
846 3300048922 Ga0496119_0325163 Ga0496119_0325163_192_665 148
847 3300049572 Ga0501036_0247847 Ga0501036_0247847_425_880 148
848 3300049575 Ga0501039_1273101 Ga0501039_1273101_44_499 148
849 3300049587 Ga0501071_0418170 Ga0501071_0418170_287_742 148
850 3300049588 Ga0501072_0252158 Ga0501072_0252158_696_1151 148
851 3300049591 Ga0501075_0542730 Ga0501075_0542730_80_535 148
852 3300049742 Ga0501080_0715963 Ga0501080_0715963_330_785 148
853 3300050490 nmdc:mga03n38_367325_c1 nmdc:mga03n38_367325_c1_277_738 148
854 3300050491 nmdc:mga00v17_39916_c1 nmdc:mga00v17_39916_c1_313_786 148
855 3300050492 nmdc:mga0yw44_21221_c1 nmdc:mga0yw44_21221_c1_1145_1618 148
856 3300050492 nmdc:mga0yw44_316918_c1 nmdc:mga0yw44_316918_c1_405_866 148
857 3300050492 nmdc:mga0yw44_327462_c1 nmdc:mga0yw44_327462_c1_459_932 148
858 3300050492 nmdc:mga0yw44_4200_c1 nmdc:mga0yw44_4200_c1_4864_5337 148
859 3300050494 nmdc:mga06z11_147302_c1 nmdc:mga06z11_147302_c1_622_1083 148
860 3300050495 nmdc:mga04h51_55684_c1 nmdc:mga04h51_55684_c1_687_1160 148
861 3300050507 nmdc:mga05p37_718193_c1 nmdc:mga05p37_718193_c1_329_790 148
862 3300050508 nmdc:mga09592_529798_c1 nmdc:mga09592_529798_c1_408_872 148
863 3300050509 nmdc:mga0qj67_774068_c1 nmdc:mga0qj67_774068_c1_191_655 148
864 3300050510 nmdc:mga06r32_1055111_c1 nmdc:mga06r32_1055111_c1_89_550 148
865 3300050510 nmdc:mga06r32_624925_c1 nmdc:mga06r32_624925_c1_203_667 148
866 3300061734 Ga0530510_0323169 Ga0530510_0323169_261_716 148
867 3300003373 JGI25407J50210_10064186 JGI25407J50210_100641861 149
868 3300005339 Ga0070660_100853618 Ga0070660_1008536182 149
869 3300005355 Ga0070671_100957844 Ga0070671_1009578441 149
870 3300005719 Ga0068861_100523350 Ga0068861_1005233501 149
871 3300005842 Ga0068858_101140088 Ga0068858_1011400881 149
872 3300005844 Ga0068862_100603407 Ga0068862_1006034072 149
873 3300005981 Ga0081538_10000169 Ga0081538_1000016939 149
874 3300005981 Ga0081538_10006323 Ga0081538_100063231 149
875 3300005981 Ga0081538_10010481 Ga0081538_100104817 149
876 3300006846 Ga0075430_100003262 Ga0075430_1000032624 149
877 3300006846 Ga0075430_101719440 Ga0075430_1017194401 149
878 3300006847 Ga0075431_100308493 Ga0075431_1003084932 149
879 3300006847 Ga0075431_100314032 Ga0075431_1003140323 149
880 3300009094 Ga0111539_10345316 Ga0111539_103453162 149
881 3300009094 Ga0111539_12493335 Ga0111539_124933351 149
882 3300009147 Ga0114129_10158733 Ga0114129_101587332 149
883 3300009147 Ga0114129_10165258 Ga0114129_101652582 149
884 3300009147 Ga0114129_10202666 Ga0114129_102026662 149
885 3300009147 Ga0114129_11293864 Ga0114129_112938642 149
886 3300009147 Ga0114129_12081929 Ga0114129_120819291 149
887 3300010375 Ga0105239_10605418 Ga0105239_106054182 149
888 3300025919 Ga0207657_10483936 Ga0207657_104839361 149
889 3300027907 Ga0207428_10184362 Ga0207428_101843622 149
890 3300031903 Ga0307407_10673025 Ga0307407_106730252 149
891 3300032002 Ga0307416_100540174 Ga0307416_1005401742 149
892 3300032126 Ga0307415_100878998 Ga0307415_1008789982 149
893 3300035170 Ga0373943_0097273 Ga0373943_0097273_255_710 149
894 3300037068 Ga0373925_0127391 Ga0373925_0127391_816_1271 149
895 3300037466 Ga0395898_0587861 Ga0395898_0587861_335_790 149
896 3300038443 Ga0395901_0333098 Ga0395901_0333098_123_578 149
897 3300039437 Ga0436365_0080349 Ga0436365_0080349_1063_1515 149
898 3300045976 Ga0466967_0030212 Ga0466967_0030212_2978_3430 149
899 3300045976 Ga0466967_0751181 Ga0466967_0751181_445_900 149
900 3300045976 Ga0466967_1205463 Ga0466967_1205463_272_724 149
901 3300046665 Ga0495661_0127460 Ga0495661_0127460_24_482 149
902 3300047321 Ga0495676_0386603 Ga0495676_0386603_308_763 149
903 3300048903 Ga0496100_1210574 Ga0496100_1210574_125_577 149
904 3300048906 Ga0496103_0229582 Ga0496103_0229582_370_822 149
905 3300048917 Ga0496114_0677253 Ga0496114_0677253_71_523 149
906 3300049573 Ga0501037_0554984 Ga0501037_0554984_143_601 149
907 3300049575 Ga0501039_0061911 Ga0501039_0061911_673_1131 149
908 3300049582 Ga0501048_0188785 Ga0501048_0188785_655_1113 149
909 3300049583 Ga0501067_0490032 Ga0501067_0490032_21_473 149
910 3300049587 Ga0501071_0112827 Ga0501071_0112827_753_1211 149
911 3300049592 Ga0501076_0187133 Ga0501076_0187133_52_510 149
912 3300050507 nmdc:mga05p37_135113_c1 nmdc:mga05p37_135113_c1_2104_2562 149
913 3300050507 nmdc:mga05p37_1548414_c1 nmdc:mga05p37_1548414_c1_136_591 149
914 3300050507 nmdc:mga05p37_421060_c1 nmdc:mga05p37_421060_c1_371_829 149
915 3300050507 nmdc:mga05p37_764306_c1 nmdc:mga05p37_764306_c1_330_788 149
916 3300050509 nmdc:mga0qj67_22421_c1 nmdc:mga0qj67_22421_c1_3193_3648 149
917 3300050510 nmdc:mga06r32_110190_c1 nmdc:mga06r32_110190_c1_1128_1583 149
918 3300050511 nmdc:mga08y16_1167048_c1 nmdc:mga08y16_1167048_c1_205_666 149
919 3300050511 nmdc:mga08y16_280795_c1 nmdc:mga08y16_280795_c1_967_1425 149
920 3300054114 Ga0501084_0053276 Ga0501084_0053276_2045_2503 149
921 3300000549 LJQas_1041288 LJQas_10412881 150
922 3300004799 Ga0058863_11942618 Ga0058863_119426182 150
923 3300004800 Ga0058861_10018033 Ga0058861_100180331 150
924 3300004800 Ga0058861_10095910 Ga0058861_100959102 150
925 3300004803 Ga0058862_12871359 Ga0058862_128713591 150
926 3300005327 Ga0070658_10192327 Ga0070658_101923273 150
927 3300005329 Ga0070683_100027055 Ga0070683_1000270555 150
928 3300005329 Ga0070683_100361528 Ga0070683_1003615281 150
929 3300005334 Ga0068869_100779971 Ga0068869_1007799712 150
930 3300005336 Ga0070680_100013514 Ga0070680_1000135142 150
931 3300005337 Ga0070682_100077760 Ga0070682_1000777602 150
932 3300005339 Ga0070660_100027936 Ga0070660_1000279364 150
933 3300005341 Ga0070691_10252833 Ga0070691_102528332 150
934 3300005344 Ga0070661_100243727 Ga0070661_1002437272 150
935 3300005345 Ga0070692_10114640 Ga0070692_101146403 150
936 3300005366 Ga0070659_100001090 Ga0070659_1000010908 150
937 3300005455 Ga0070663_100370573 Ga0070663_1003705731 150
938 3300005458 Ga0070681_10053595 Ga0070681_100535954 150
939 3300005530 Ga0070679_100007731 Ga0070679_1000077319 150
940 3300005530 Ga0070679_100102311 Ga0070679_1001023112 150
941 3300005535 Ga0070684_100043240 Ga0070684_1000432403 150
942 3300005535 Ga0070684_100076661 Ga0070684_1000766614 150
943 3300005539 Ga0068853_100181114 Ga0068853_1001811142 150
944 3300005549 Ga0070704_100781742 Ga0070704_1007817422 150
945 3300005563 Ga0068855_101583571 Ga0068855_1015835712 150
946 3300005564 Ga0070664_100231868 Ga0070664_1002318681 150
947 3300005577 Ga0068857_100095645 Ga0068857_1000956452 150
948 3300005614 Ga0068856_100021501 Ga0068856_1000215013 150
949 3300005616 Ga0068852_100018498 Ga0068852_1000184985 150
950 3300005937 Ga0081455_10096425 Ga0081455_100964253 150
951 3300005981 Ga0081538_10029713 Ga0081538_100297133 150
952 3300005981 Ga0081538_10109548 Ga0081538_101095481 150
953 3300005981 Ga0081538_10201070 Ga0081538_102010702 150
954 3300006038 Ga0075365_10483760 Ga0075365_104837602 150
955 3300006844 Ga0075428_100374456 Ga0075428_1003744563 150
956 3300006846 Ga0075430_100121169 Ga0075430_1001211692 150
957 3300006880 Ga0075429_100101123 Ga0075429_1001011234 150
958 3300009093 Ga0105240_10008942 Ga0105240_1000894216 150
959 3300009094 Ga0111539_11408874 Ga0111539_114088742 150
960 3300009147 Ga0114129_10355863 Ga0114129_103558633 150
961 3300009545 Ga0105237_10049038 Ga0105237_100490382 150
962 3300009551 Ga0105238_10233208 Ga0105238_102332082 150
963 3300010375 Ga0105239_10072996 Ga0105239_100729965 150
964 3300013102 Ga0157371_10114126 Ga0157371_101141262 150
965 3300013104 Ga0157370_10007123 Ga0157370_100071235 150
966 3300013105 Ga0157369_10006254 Ga0157369_1000625413 150
967 3300013105 Ga0157369_10205232 Ga0157369_102052323 150
968 3300013307 Ga0157372_10023313 Ga0157372_100233133 150
969 3300013307 Ga0157372_10385187 Ga0157372_103851872 150
970 3300020069 Ga0197907_10303868 Ga0197907_103038681 150
971 3300020069 Ga0197907_11011833 Ga0197907_110118331 150
972 3300020070 Ga0206356_10218075 Ga0206356_102180752 150
973 3300020070 Ga0206356_11205897 Ga0206356_112058971 150
974 3300020075 Ga0206349_1187371 Ga0206349_11873711 150
975 3300020077 Ga0206351_10461011 Ga0206351_104610111 150
976 3300020078 Ga0206352_10659006 Ga0206352_106590062 150
977 3300020080 Ga0206350_11617956 Ga0206350_116179561 150
978 3300020081 Ga0206354_10011853 Ga0206354_100118532 150
979 3300020082 Ga0206353_10752841 Ga0206353_107528411 150
980 3300020082 Ga0206353_11402362 Ga0206353_114023622 150
981 3300020610 Ga0154015_1665967 Ga0154015_16659673 150
982 3300022467 Ga0224712_10030580 Ga0224712_100305804 150
983 3300022467 Ga0224712_10055400 Ga0224712_100554004 150
984 3300022467 Ga0224712_10108653 Ga0224712_101086531 150
985 3300025909 Ga0207705_10636199 Ga0207705_106361991 150
986 3300025912 Ga0207707_10003121 Ga0207707_1000312114 150
987 3300025912 Ga0207707_10045352 Ga0207707_100453521 150
988 3300025913 Ga0207695_10030945 Ga0207695_100309454 150
989 3300025914 Ga0207671_10280151 Ga0207671_102801511 150
990 3300025917 Ga0207660_10033479 Ga0207660_100334794 150
991 3300025917 Ga0207660_10511571 Ga0207660_105115712 150
992 3300025919 Ga0207657_10009720 Ga0207657_100097209 150
993 3300025920 Ga0207649_10015628 Ga0207649_100156285 150
994 3300025921 Ga0207652_10018700 Ga0207652_100187006 150
995 3300025924 Ga0207694_10043711 Ga0207694_100437113 150
996 3300025932 Ga0207690_10008222 Ga0207690_100082223 150
997 3300025937 Ga0207669_10334430 Ga0207669_103344303 150
998 3300025944 Ga0207661_10000599 Ga0207661_1000059919 150
999 3300025945 Ga0207679_10150819 Ga0207679_101508194 150
1000 3300025949 Ga0207667_11258810 Ga0207667_112588101 150
1001 3300026041 Ga0207639_10047917 Ga0207639_100479174 150
1002 3300026078 Ga0207702_10059276 Ga0207702_100592763 150
1003 3300026142 Ga0207698_10258159 Ga0207698_102581592 150
1004 3300031548 Ga0307408_100344126 Ga0307408_1003441262 150
1005 3300031731 Ga0307405_10741164 Ga0307405_107411642 150
1006 3300031824 Ga0307413_10101734 Ga0307413_101017342 150
1007 3300031824 Ga0307413_10119173 Ga0307413_101191733 150
1008 3300031852 Ga0307410_10105406 Ga0307410_101054061 150
1009 3300031901 Ga0307406_10035203 Ga0307406_100352034 150
1010 3300031903 Ga0307407_10055796 Ga0307407_100557962 150
1011 3300031995 Ga0307409_100066780 Ga0307409_1000667801 150
1012 3300031995 Ga0307409_100667766 Ga0307409_1006677662 150
1013 3300032002 Ga0307416_100326620 Ga0307416_1003266202 150
1014 3300032005 Ga0307411_10316353 Ga0307411_103163531 150
1015 3300032005 Ga0307411_10355804 Ga0307411_103558041 150
1016 3300032126 Ga0307415_100080697 Ga0307415_1000806974 150
1017 3300037471 Ga0395905_0364967 Ga0395905_0364967_193_651 150
1018 3300038443 Ga0395901_0735708 Ga0395901_0735708_309_767 150
1019 3300041503 Ga0451847_0146959 Ga0451847_0146959_235_696 150
1020 3300045976 Ga0466967_0058577 Ga0466967_0058577_79_531 150
1021 3300046500 Ga0495596_0125313 Ga0495596_0125313_123_578 150
1022 3300046513 Ga0495616_0206562 Ga0495616_0206562_135_596 150
1023 3300046518 Ga0495631_0156094 Ga0495631_0156094_41_502 150
1024 3300046616 Ga0495668_0181270 Ga0495668_0181270_674_1135 150
1025 3300048906 Ga0496103_0172314 Ga0496103_0172314_910_1371 150
1026 3300048911 Ga0496108_0323583 Ga0496108_0323583_227_679 150
1027 3300048912 Ga0496109_0914498 Ga0496109_0914498_334_786 150
1028 3300048913 Ga0496110_0821511 Ga0496110_0821511_179_631 150
1029 3300048914 Ga0496111_0173409 Ga0496111_0173409_190_642 150
1030 3300049572 Ga0501036_0086481 Ga0501036_0086481_548_1009 150
1031 3300049578 Ga0501042_0110441 Ga0501042_0110441_572_1033 150
1032 3300049591 Ga0501075_0540490 Ga0501075_0540490_92_553 150
1033 3300049824 Ga0501045_0257607 Ga0501045_0257607_243_704 150
1034 3300050494 nmdc:mga06z11_573058_c1 nmdc:mga06z11_573058_c1_97_555 150
1035 3300050507 nmdc:mga05p37_670336_c1 nmdc:mga05p37_670336_c1_142_600 150
1036 3300050507 nmdc:mga05p37_902306_c1 nmdc:mga05p37_902306_c1_10_471 150
1037 3300050508 nmdc:mga09592_270371_c1 nmdc:mga09592_270371_c1_15_476 150
1038 3300050508 nmdc:mga09592_612435_c1 nmdc:mga09592_612435_c1_61_519 150
1039 3300050509 nmdc:mga0qj67_198569_c1 nmdc:mga0qj67_198569_c1_838_1296 150
1040 3300050510 nmdc:mga06r32_291772_c1 nmdc:mga06r32_291772_c1_959_1417 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

31

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bhx-assembly1.cif.gz_D b. subtilis ssba with dna 0.9546 5 110
2cwa-assembly1.cif.gz_A crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 0.9513 6 109
6bhw-assembly2.cif.gz_E b. subtilis ssba 0.9478 5 109
6bhx-assembly1.cif.gz_D b. subtilis ssba with dna 0.9451 5 110
3tqy-assembly1.cif.gz_D structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii 0.9429 5 110
ID Description Score Start End Superfamily
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9169 1 109 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.908 1 109 2.40.50.140
6bhwF00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8948 5 108 2.40.50.140
af_C4J9S9_72_176_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8943 7 111 2.40.50.140
af_Q2G112_1_115_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8932 5 110 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A552VCC4-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9132 6 109 GO:0003697
GO:0006260
GO:0009295
AF-A0A6M3JK56-F1-model_v4 Putative single-stranded DNA-binding protein 0.9103 4 104 GO:0003697
GO:0006260
GO:0009295
AF-A0A316KG36-F1-model_v4 Single-stranded DNA-binding protein 0.9102 2 109 GO:0003697
GO:0006260
GO:0009295
AF-A0A2V9H5Y2-F1-model_v4 Single-stranded DNA-binding protein 0.91 4 113 GO:0003697
GO:0006260
GO:0009295
AF-A0A7Y4QE12-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9096 4 113 GO:0003697
GO:0006260
GO:0009295

Feature Viewer

pLDDT pTM Quality
84.02 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map