F488813
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1040 | 375 | 1040 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10735610|Ga0105243_107356102 |
| Length | 177 |
| Sequence | MPRKRAESSRVRAYTVNSIFRREQIVEAPNINRVVITGNLTRDPELRSTPNNGMSICSLRVAVNGRKKDPDSGQWVDKPNYFDVTVFGAQGENCAQYLSKGRPVAVEGRLNWREWEAQDGGKRQSVDIIADTVQFLGSRDAAPQSNGVVESDVPADTSDFQEAGVAGGXXKDDDIPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 244 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 245 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 326 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.1 |
| Metatranscriptomes | 4.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0 |
| Rhizoplane | 7.21 |
| Rhizosphere | 87.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1041288 | 3300000549 | Bacteria | 547 |
| 2 | JGI24738J21930_10003699 | 3300002075 | Bacteria | 3827 |
| 3 | JGI24744J21845_10048405 | 3300002077 | Bacteria | 786 |
| 4 | JGI24034J26672_10000335 | 3300002239 | Bacteria | 6050 |
| 5 | JGI24742J22300_10013846 | 3300002244 | Bacteria | 1352 |
| 6 | JGI25406J46586_10004410 | 3300003203 | Bacteria | 6554 |
| 7 | JGI25407J50210_10064186 | 3300003373 | Bacteria | 920 |
| 8 | Ga0058863_11900107 | 3300004799 | Unclassified | 1051 |
| 9 | Ga0058863_11942618 | 3300004799 | Bacteria | 897 |
| 10 | Ga0058861_10018033 | 3300004800 | Unclassified | 595 |
| 11 | Ga0058861_10095910 | 3300004800 | Bacteria | 995 |
| 12 | Ga0058862_12871359 | 3300004803 | Unclassified | 616 |
| 13 | Ga0070658_10020698 | 3300005327 | Bacteria | 5270 |
| 14 | Ga0070658_10136115 | 3300005327 | Bacteria | 2050 |
| 15 | Ga0070658_10192327 | 3300005327 | Bacteria | 1720 |
| 16 | Ga0070658_10928120 | 3300005327 | Bacteria | 757 |
| 17 | Ga0070683_100023952 | 3300005329 | Bacteria | 5464 |
| 18 | Ga0070683_100027055 | 3300005329 | Bacteria | 5169 |
| 19 | Ga0070683_100055916 | 3300005329 | Bacteria | 3663 |
| 20 | Ga0070683_100197337 | 3300005329 | Bacteria | 1911 |
| 21 | Ga0070683_100361528 | 3300005329 | Bacteria | 1382 |
| 22 | Ga0070683_100381673 | 3300005329 | Bacteria | 1343 |
| 23 | Ga0070683_101217807 | 3300005329 | Bacteria | 723 |
| 24 | Ga0070690_100372389 | 3300005330 | Bacteria | 1042 |
| 25 | Ga0070690_101148090 | 3300005330 | Bacteria | 618 |
| 26 | Ga0070690_101239554 | 3300005330 | Bacteria | 596 |
| 27 | Ga0070670_100011812 | 3300005331 | Bacteria | 7467 |
| 28 | Ga0070670_100224949 | 3300005331 | Bacteria | 1633 |
| 29 | Ga0068869_100101392 | 3300005334 | Bacteria | 2177 |
| 30 | Ga0068869_100779971 | 3300005334 | Bacteria | 820 |
| 31 | Ga0068869_100809000 | 3300005334 | Bacteria | 806 |
| 32 | Ga0068869_101337302 | 3300005334 | Bacteria | 633 |
| 33 | Ga0070680_100013514 | 3300005336 | Bacteria | 6359 |
| 34 | Ga0070680_100417420 | 3300005336 | Bacteria | 1145 |
| 35 | Ga0070680_101561444 | 3300005336 | Bacteria | 572 |
| 36 | Ga0070682_100005793 | 3300005337 | Bacteria | 6898 |
| 37 | Ga0070682_100077760 | 3300005337 | Bacteria | 2139 |
| 38 | Ga0070682_100103473 | 3300005337 | Bacteria | 1884 |
| 39 | Ga0070682_100738657 | 3300005337 | Unclassified | 793 |
| 40 | Ga0068868_100000741 | 3300005338 | Bacteria | 22121 |
| 41 | Ga0068868_100017477 | 3300005338 | Bacteria | 5346 |
| 42 | Ga0068868_100184292 | 3300005338 | Bacteria | 1733 |
| 43 | Ga0068868_100860305 | 3300005338 | Bacteria | 822 |
| 44 | Ga0070660_100003054 | 3300005339 | Bacteria | 11522 |
| 45 | Ga0070660_100008259 | 3300005339 | Bacteria | 7277 |
| 46 | Ga0070660_100027936 | 3300005339 | Bacteria | 4216 |
| 47 | Ga0070660_100853618 | 3300005339 | Unclassified | 767 |
| 48 | Ga0070689_100076737 | 3300005340 | Bacteria | 2618 |
| 49 | Ga0070689_100712527 | 3300005340 | Unclassified | 877 |
| 50 | Ga0070689_101510792 | 3300005340 | Unclassified | 608 |
| 51 | Ga0070691_10134445 | 3300005341 | Bacteria | 1255 |
| 52 | Ga0070691_10252833 | 3300005341 | Bacteria | 946 |
| 53 | Ga0070691_10301873 | 3300005341 | Unclassified | 875 |
| 54 | Ga0070691_10311047 | 3300005341 | Bacteria | 864 |
| 55 | Ga0070687_100348615 | 3300005343 | Bacteria | 955 |
| 56 | Ga0070661_100031733 | 3300005344 | Bacteria | 3821 |
| 57 | Ga0070661_100032298 | 3300005344 | Bacteria | 3789 |
| 58 | Ga0070661_100243727 | 3300005344 | Bacteria | 1385 |
| 59 | Ga0070661_100334113 | 3300005344 | Bacteria | 1186 |
| 60 | Ga0070661_101309255 | 3300005344 | Bacteria | 608 |
| 61 | Ga0070692_10003022 | 3300005345 | Bacteria | 6707 |
| 62 | Ga0070692_10006250 | 3300005345 | Bacteria | 5159 |
| 63 | Ga0070692_10014157 | 3300005345 | Bacteria | 3737 |
| 64 | Ga0070692_10114640 | 3300005345 | Bacteria | 1495 |
| 65 | Ga0070668_100031904 | 3300005347 | Bacteria | 4009 |
| 66 | Ga0070668_100089905 | 3300005347 | Bacteria | 2419 |
| 67 | Ga0070675_100007308 | 3300005354 | Bacteria | 8524 |
| 68 | Ga0070675_100167077 | 3300005354 | Bacteria | 1895 |
| 69 | Ga0070675_101433240 | 3300005354 | Bacteria | 637 |
| 70 | Ga0070671_100671685 | 3300005355 | Unclassified | 898 |
| 71 | Ga0070671_100957844 | 3300005355 | Bacteria | 749 |
| 72 | Ga0070674_100002696 | 3300005356 | Bacteria | 9824 |
| 73 | Ga0070674_100021607 | 3300005356 | Bacteria | 4136 |
| 74 | Ga0070674_100054232 | 3300005356 | Bacteria | 2772 |
| 75 | Ga0070674_100144727 | 3300005356 | Bacteria | 1788 |
| 76 | Ga0070674_101086001 | 3300005356 | Bacteria | 706 |
| 77 | Ga0070673_100043613 | 3300005364 | Bacteria | 3467 |
| 78 | Ga0070673_100432843 | 3300005364 | Bacteria | 1181 |
| 79 | Ga0070688_100000344 | 3300005365 | Bacteria | 23634 |
| 80 | Ga0070688_100101347 | 3300005365 | Bacteria | 1899 |
| 81 | Ga0070659_100001090 | 3300005366 | Bacteria | 19781 |
| 82 | Ga0070659_100002893 | 3300005366 | Bacteria | 12221 |
| 83 | Ga0070659_100041578 | 3300005366 | Bacteria | 3594 |
| 84 | Ga0070659_100115142 | 3300005366 | Bacteria | 2173 |
| 85 | Ga0070659_100296785 | 3300005366 | Bacteria | 1347 |
| 86 | Ga0070659_100325138 | 3300005366 | Bacteria | 1286 |
| 87 | Ga0070659_100596607 | 3300005366 | Bacteria | 949 |
| 88 | Ga0070667_100102662 | 3300005367 | Bacteria | 2471 |
| 89 | Ga0070709_10101666 | 3300005434 | Bacteria | 1916 |
| 90 | Ga0070709_10601253 | 3300005434 | Viruses | 847 |
| 91 | Ga0070714_100368285 | 3300005435 | Bacteria | 1352 |
| 92 | Ga0070714_101362587 | 3300005435 | Bacteria | 693 |
| 93 | Ga0070713_101210501 | 3300005436 | Bacteria | 731 |
| 94 | Ga0070710_10103279 | 3300005437 | Bacteria | 1701 |
| 95 | Ga0070701_10078083 | 3300005438 | Bacteria | 1786 |
| 96 | Ga0070701_10103693 | 3300005438 | Bacteria | 1579 |
| 97 | Ga0070711_100063702 | 3300005439 | Bacteria | 2574 |
| 98 | Ga0070711_100220871 | 3300005439 | Bacteria | 1473 |
| 99 | Ga0070705_100176359 | 3300005440 | Bacteria | 1444 |
| 100 | Ga0070700_100000580 | 3300005441 | Bacteria | 18347 |
| 101 | Ga0070700_100061460 | 3300005441 | Bacteria | 2370 |
| 102 | Ga0070700_100180501 | 3300005441 | Bacteria | 1469 |
| 103 | Ga0070700_100493138 | 3300005441 | Bacteria | 941 |
| 104 | Ga0070700_100713191 | 3300005441 | Bacteria | 799 |
| 105 | Ga0070700_100743171 | 3300005441 | Bacteria | 784 |
| 106 | Ga0070700_100858839 | 3300005441 | Bacteria | 736 |
| 107 | Ga0070700_101045638 | 3300005441 | Bacteria | 674 |
| 108 | Ga0070694_100087803 | 3300005444 | Bacteria | 2176 |
| 109 | Ga0070694_100297455 | 3300005444 | Bacteria | 1236 |
| 110 | Ga0070694_100375921 | 3300005444 | Unclassified | 1107 |
| 111 | Ga0070663_100020403 | 3300005455 | Bacteria | 4388 |
| 112 | Ga0070663_100070278 | 3300005455 | Bacteria | 2546 |
| 113 | Ga0070663_100076662 | 3300005455 | Bacteria | 2445 |
| 114 | Ga0070663_100370573 | 3300005455 | Bacteria | 1164 |
| 115 | Ga0070678_100011039 | 3300005456 | Bacteria | 5552 |
| 116 | Ga0070678_100014808 | 3300005456 | Bacteria | 4933 |
| 117 | Ga0070662_100025726 | 3300005457 | Bacteria | 4068 |
| 118 | Ga0070662_100067437 | 3300005457 | Bacteria | 2627 |
| 119 | Ga0070662_100338927 | 3300005457 | Bacteria | 1230 |
| 120 | Ga0070681_10053595 | 3300005458 | Bacteria | 4020 |
| 121 | Ga0070681_10365242 | 3300005458 | Unclassified | 1354 |
| 122 | Ga0070681_11366302 | 3300005458 | Bacteria | 632 |
| 123 | Ga0068867_100000766 | 3300005459 | Bacteria | 21675 |
| 124 | Ga0068867_100053792 | 3300005459 | Bacteria | 2973 |
| 125 | Ga0068867_100205899 | 3300005459 | Bacteria | 1577 |
| 126 | Ga0068867_100460467 | 3300005459 | Bacteria | 1086 |
| 127 | Ga0070685_10000290 | 3300005466 | Bacteria | 31634 |
| 128 | Ga0070685_10007278 | 3300005466 | Bacteria | 5660 |
| 129 | Ga0070707_100858866 | 3300005468 | Unclassified | 872 |
| 130 | Ga0070698_100983281 | 3300005471 | Bacteria | 791 |
| 131 | Ga0070679_100007731 | 3300005530 | Bacteria | 10065 |
| 132 | Ga0070679_100102311 | 3300005530 | Bacteria | 2851 |
| 133 | Ga0070679_100131322 | 3300005530 | Bacteria | 2485 |
| 134 | Ga0070679_100263399 | 3300005530 | Bacteria | 1679 |
| 135 | Ga0070679_101414840 | 3300005530 | Bacteria | 642 |
| 136 | Ga0070684_100031436 | 3300005535 | Bacteria | 4519 |
| 137 | Ga0070684_100043240 | 3300005535 | Bacteria | 3889 |
| 138 | Ga0070684_100059452 | 3300005535 | Bacteria | 3341 |
| 139 | Ga0070684_100074737 | 3300005535 | Bacteria | 2987 |
| 140 | Ga0070684_100076661 | 3300005535 | Bacteria | 2951 |
| 141 | Ga0070684_100259261 | 3300005535 | Bacteria | 1590 |
| 142 | Ga0070697_100278722 | 3300005536 | Bacteria | 1434 |
| 143 | Ga0068853_100009434 | 3300005539 | Bacteria | 7862 |
| 144 | Ga0068853_100027027 | 3300005539 | Bacteria | 4822 |
| 145 | Ga0068853_100181114 | 3300005539 | Bacteria | 1911 |
| 146 | Ga0068853_100696305 | 3300005539 | Bacteria | 969 |
| 147 | Ga0068853_100961284 | 3300005539 | Bacteria | 822 |
| 148 | Ga0070672_100003359 | 3300005543 | Bacteria | 10371 |
| 149 | Ga0070686_100003109 | 3300005544 | Bacteria | 9102 |
| 150 | Ga0070686_100016247 | 3300005544 | Bacteria | 4325 |
| 151 | Ga0070686_100034256 | 3300005544 | Bacteria | 3128 |
| 152 | Ga0070695_100076484 | 3300005545 | Bacteria | 2205 |
| 153 | Ga0070693_100018587 | 3300005547 | Bacteria | 3634 |
| 154 | Ga0070693_100180463 | 3300005547 | Bacteria | 1359 |
| 155 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 156 | Ga0070665_100025513 | 3300005548 | Bacteria | 5954 |
| 157 | Ga0070665_100130912 | 3300005548 | Bacteria | 2511 |
| 158 | Ga0070704_100039805 | 3300005549 | Bacteria | 3229 |
| 159 | Ga0070704_100218694 | 3300005549 | Bacteria | 1548 |
| 160 | Ga0070704_100781742 | 3300005549 | Bacteria | 852 |
| 161 | Ga0068855_101583571 | 3300005563 | Bacteria | 671 |
| 162 | Ga0070664_100055063 | 3300005564 | Bacteria | 3375 |
| 163 | Ga0070664_100181493 | 3300005564 | Bacteria | 1871 |
| 164 | Ga0070664_100231868 | 3300005564 | Bacteria | 1655 |
| 165 | Ga0070664_100328736 | 3300005564 | Bacteria | 1386 |
| 166 | Ga0070664_100412199 | 3300005564 | Bacteria | 1236 |
| 167 | Ga0068857_100095645 | 3300005577 | Bacteria | 2662 |
| 168 | Ga0068857_100106454 | 3300005577 | Bacteria | 2519 |
| 169 | Ga0068857_101070401 | 3300005577 | Bacteria | 778 |
| 170 | Ga0068854_100007097 | 3300005578 | Bacteria | 7153 |
| 171 | Ga0068854_100196899 | 3300005578 | Bacteria | 1582 |
| 172 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 173 | Ga0068856_100021501 | 3300005614 | Bacteria | 6270 |
| 174 | Ga0068856_100081262 | 3300005614 | Bacteria | 3215 |
| 175 | Ga0068856_100214288 | 3300005614 | Bacteria | 1941 |
| 176 | Ga0068856_100548895 | 3300005614 | Bacteria | 1177 |
| 177 | Ga0068856_100717900 | 3300005614 | Bacteria | 1020 |
| 178 | Ga0068856_100752202 | 3300005614 | Bacteria | 995 |
| 179 | Ga0070702_100120835 | 3300005615 | Bacteria | 1640 |
| 180 | Ga0070702_100185633 | 3300005615 | Bacteria | 1364 |
| 181 | Ga0070702_100333122 | 3300005615 | Unclassified | 1062 |
| 182 | Ga0068852_100000058 | 3300005616 | Bacteria | 75312 |
| 183 | Ga0068852_100018498 | 3300005616 | Bacteria | 5490 |
| 184 | Ga0068852_100177395 | 3300005616 | Bacteria | 2001 |
| 185 | Ga0068852_100230790 | 3300005616 | Bacteria | 1764 |
| 186 | Ga0068859_100448446 | 3300005617 | Bacteria | 1386 |
| 187 | Ga0068864_100665506 | 3300005618 | Bacteria | 1015 |
| 188 | Ga0068864_102696228 | 3300005618 | Bacteria | 503 |
| 189 | Ga0068866_10015734 | 3300005718 | Bacteria | 3367 |
| 190 | Ga0068866_10255556 | 3300005718 | Bacteria | 1074 |
| 191 | Ga0068866_10262706 | 3300005718 | Bacteria | 1062 |
| 192 | Ga0068861_100135106 | 3300005719 | Bacteria | 2006 |
| 193 | Ga0068861_100523350 | 3300005719 | Bacteria | 1076 |
| 194 | Ga0068861_100529750 | 3300005719 | Bacteria | 1070 |
| 195 | Ga0068861_100599050 | 3300005719 | Bacteria | 1011 |
| 196 | Ga0068861_101713398 | 3300005719 | Bacteria | 622 |
| 197 | Ga0068851_10034140 | 3300005834 | Bacteria | 2538 |
| 198 | Ga0068851_10346341 | 3300005834 | Bacteria | 863 |
| 199 | Ga0068863_100365716 | 3300005841 | Bacteria | 1407 |
| 200 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 201 | Ga0068858_100200859 | 3300005842 | Bacteria | 1885 |
| 202 | Ga0068858_100262168 | 3300005842 | Bacteria | 1643 |
| 203 | Ga0068858_100879357 | 3300005842 | Bacteria | 876 |
| 204 | Ga0068858_101140088 | 3300005842 | Bacteria | 766 |
| 205 | Ga0068860_100631960 | 3300005843 | Bacteria | 1078 |
| 206 | Ga0068862_100603407 | 3300005844 | Unclassified | 1054 |
| 207 | Ga0081455_10062003 | 3300005937 | Bacteria | 3144 |
| 208 | Ga0081455_10096425 | 3300005937 | Bacteria | 2385 |
| 209 | Ga0081455_10123476 | 3300005937 | Bacteria | 2037 |
| 210 | Ga0081455_10209326 | 3300005937 | Bacteria | 1454 |
| 211 | Ga0081455_10241399 | 3300005937 | Bacteria | 1327 |
| 212 | Ga0081455_10266880 | 3300005937 | Bacteria | 1244 |
| 213 | Ga0081455_10332764 | 3300005937 | Bacteria | 1077 |
| 214 | Ga0081455_10587474 | 3300005937 | Bacteria | 729 |
| 215 | Ga0081455_10735714 | 3300005937 | Bacteria | 625 |
| 216 | Ga0081538_10000169 | 3300005981 | Bacteria | 69684 |
| 217 | Ga0081538_10006323 | 3300005981 | Bacteria | 10454 |
| 218 | Ga0081538_10010481 | 3300005981 | Bacteria | 7602 |
| 219 | Ga0081538_10020689 | 3300005981 | Bacteria | 4831 |
| 220 | Ga0081538_10029713 | 3300005981 | Bacteria | 3728 |
| 221 | Ga0081538_10079429 | 3300005981 | Bacteria | 1755 |
| 222 | Ga0081538_10109548 | 3300005981 | Bacteria | 1360 |
| 223 | Ga0081538_10201070 | 3300005981 | Bacteria | 818 |
| 224 | Ga0081540_1003253 | 3300005983 | Bacteria | 12913 |
| 225 | Ga0081540_1103668 | 3300005983 | Bacteria | 1219 |
| 226 | Ga0081540_1121390 | 3300005983 | Bacteria | 1084 |
| 227 | Ga0081539_10017263 | 3300005985 | Bacteria | 5079 |
| 228 | Ga0081539_10186475 | 3300005985 | Bacteria | 969 |
| 229 | Ga0075365_10012498 | 3300006038 | Bacteria | 5046 |
| 230 | Ga0075365_10022183 | 3300006038 | Bacteria | 3974 |
| 231 | Ga0075365_10040006 | 3300006038 | Bacteria | 3055 |
| 232 | Ga0075365_10086436 | 3300006038 | Bacteria | 2131 |
| 233 | Ga0075365_10179505 | 3300006038 | Bacteria | 1480 |
| 234 | Ga0075365_10251253 | 3300006038 | Bacteria | 1243 |
| 235 | Ga0075365_10259537 | 3300006038 | Unclassified | 1221 |
| 236 | Ga0075365_10483760 | 3300006038 | Bacteria | 875 |
| 237 | Ga0075365_10596924 | 3300006038 | Bacteria | 781 |
| 238 | Ga0075363_100015254 | 3300006048 | Bacteria | 3774 |
| 239 | Ga0075363_100198398 | 3300006048 | Bacteria | 1146 |
| 240 | Ga0075364_10030019 | 3300006051 | Bacteria | 3488 |
| 241 | Ga0075364_10047086 | 3300006051 | Bacteria | 2808 |
| 242 | Ga0075364_10295271 | 3300006051 | Bacteria | 1103 |
| 243 | Ga0070716_100266038 | 3300006173 | Unclassified | 1176 |
| 244 | Ga0070712_100012995 | 3300006175 | Bacteria | 5309 |
| 245 | Ga0075367_10806620 | 3300006178 | Bacteria | 598 |
| 246 | Ga0075366_10321400 | 3300006195 | Bacteria | 948 |
| 247 | Ga0097621_100426881 | 3300006237 | Bacteria | 1191 |
| 248 | Ga0068871_100109772 | 3300006358 | Bacteria | 2320 |
| 249 | Ga0068871_101915773 | 3300006358 | Bacteria | 564 |
| 250 | Ga0075428_100051023 | 3300006844 | Bacteria | 4536 |
| 251 | Ga0075428_100083896 | 3300006844 | Bacteria | 3476 |
| 252 | Ga0075428_100335854 | 3300006844 | Bacteria | 1623 |
| 253 | Ga0075428_100374456 | 3300006844 | Bacteria | 1527 |
| 254 | Ga0075430_100003262 | 3300006846 | Bacteria | 13592 |
| 255 | Ga0075430_100090709 | 3300006846 | Bacteria | 2556 |
| 256 | Ga0075430_100121169 | 3300006846 | Bacteria | 2181 |
| 257 | Ga0075430_100778405 | 3300006846 | Bacteria | 788 |
| 258 | Ga0075430_101719440 | 3300006846 | Bacteria | 515 |
| 259 | Ga0075431_100000134 | 3300006847 | Bacteria | 49630 |
| 260 | Ga0075431_100055610 | 3300006847 | Bacteria | 4082 |
| 261 | Ga0075431_100146364 | 3300006847 | Bacteria | 2435 |
| 262 | Ga0075431_100302839 | 3300006847 | Bacteria | 1614 |
| 263 | Ga0075431_100308493 | 3300006847 | Bacteria | 1598 |
| 264 | Ga0075431_100314032 | 3300006847 | Bacteria | 1581 |
| 265 | Ga0075431_100563415 | 3300006847 | Bacteria | 1126 |
| 266 | Ga0075431_100938973 | 3300006847 | Bacteria | 834 |
| 267 | Ga0075433_10009707 | 3300006852 | Bacteria | 7708 |
| 268 | Ga0075433_10087408 | 3300006852 | Bacteria | 2753 |
| 269 | Ga0075433_10288372 | 3300006852 | Bacteria | 1454 |
| 270 | Ga0075434_100009612 | 3300006871 | Bacteria | 9030 |
| 271 | Ga0075434_100010868 | 3300006871 | Bacteria | 8557 |
| 272 | Ga0075434_100195933 | 3300006871 | Bacteria | 2040 |
| 273 | Ga0075434_100262629 | 3300006871 | Bacteria | 1746 |
| 274 | Ga0075434_100913602 | 3300006871 | Bacteria | 893 |
| 275 | Ga0075429_100013154 | 3300006880 | Bacteria | 7179 |
| 276 | Ga0075429_100101123 | 3300006880 | Bacteria | 2516 |
| 277 | Ga0075429_100587573 | 3300006880 | Bacteria | 976 |
| 278 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 279 | Ga0068865_100015601 | 3300006881 | Bacteria | 4847 |
| 280 | Ga0068865_100187254 | 3300006881 | Bacteria | 1598 |
| 281 | Ga0068865_100503576 | 3300006881 | Unclassified | 1010 |
| 282 | Ga0068865_100912347 | 3300006881 | Bacteria | 765 |
| 283 | Ga0075436_100466669 | 3300006914 | Bacteria | 921 |
| 284 | Ga0097620_100448429 | 3300006931 | Bacteria | 1386 |
| 285 | Ga0075435_100068856 | 3300007076 | Bacteria | 2884 |
| 286 | Ga0075435_100360935 | 3300007076 | Bacteria | 1246 |
| 287 | Ga0075435_100612577 | 3300007076 | Bacteria | 944 |
| 288 | Ga0105240_10008942 | 3300009093 | Bacteria | 14243 |
| 289 | Ga0105240_10578730 | 3300009093 | Bacteria | 1239 |
| 290 | Ga0111539_10016678 | 3300009094 | Bacteria | 9103 |
| 291 | Ga0111539_10109537 | 3300009094 | Bacteria | 3241 |
| 292 | Ga0111539_10113127 | 3300009094 | Bacteria | 3184 |
| 293 | Ga0111539_10283300 | 3300009094 | Bacteria | 1928 |
| 294 | Ga0111539_10345316 | 3300009094 | Bacteria | 1732 |
| 295 | Ga0111539_10576004 | 3300009094 | Bacteria | 1311 |
| 296 | Ga0111539_10757200 | 3300009094 | Unclassified | 1130 |
| 297 | Ga0111539_11408874 | 3300009094 | Bacteria | 808 |
| 298 | Ga0111539_12493335 | 3300009094 | Unclassified | 600 |
| 299 | Ga0105245_10000159 | 3300009098 | Bacteria | 63630 |
| 300 | Ga0105245_10001840 | 3300009098 | Bacteria | 19302 |
| 301 | Ga0105245_10002823 | 3300009098 | Bacteria | 15605 |
| 302 | Ga0105245_10004565 | 3300009098 | Bacteria | 12223 |
| 303 | Ga0105245_10126764 | 3300009098 | Bacteria | 2390 |
| 304 | Ga0105245_11890960 | 3300009098 | Bacteria | 650 |
| 305 | Ga0105245_12403182 | 3300009098 | Bacteria | 580 |
| 306 | Ga0105247_10000838 | 3300009101 | Bacteria | 23349 |
| 307 | Ga0105247_10506042 | 3300009101 | Bacteria | 881 |
| 308 | Ga0114129_10045130 | 3300009147 | Bacteria | 6196 |
| 309 | Ga0114129_10051817 | 3300009147 | Bacteria | 5761 |
| 310 | Ga0114129_10158733 | 3300009147 | Bacteria | 3092 |
| 311 | Ga0114129_10165258 | 3300009147 | Bacteria | 3021 |
| 312 | Ga0114129_10202666 | 3300009147 | Bacteria | 2686 |
| 313 | Ga0114129_10355863 | 3300009147 | Bacteria | 1938 |
| 314 | Ga0114129_10474859 | 3300009147 | Bacteria | 1637 |
| 315 | Ga0114129_10494082 | 3300009147 | Bacteria | 1599 |
| 316 | Ga0114129_10889851 | 3300009147 | Bacteria | 1129 |
| 317 | Ga0114129_11293864 | 3300009147 | Viruses | 904 |
| 318 | Ga0114129_12081929 | 3300009147 | Bacteria | 685 |
| 319 | Ga0114129_12094590 | 3300009147 | Bacteria | 682 |
| 320 | Ga0114129_12321721 | 3300009147 | Bacteria | 644 |
| 321 | Ga0114129_13336210 | 3300009147 | Bacteria | 518 |
| 322 | Ga0105243_10030929 | 3300009148 | Bacteria | 4125 |
| 323 | Ga0105243_10036575 | 3300009148 | Bacteria | 3812 |
| 324 | Ga0105243_10066378 | 3300009148 | Bacteria | 2902 |
| 325 | Ga0105243_10069881 | 3300009148 | Bacteria | 2834 |
| 326 | Ga0105243_10137177 | 3300009148 | Bacteria | 2083 |
| 327 | Ga0105243_10206613 | 3300009148 | Bacteria | 1726 |
| 328 | Ga0105243_10735610 | 3300009148 | Unclassified | 965 |
| 329 | Ga0105241_10175191 | 3300009174 | Bacteria | 1775 |
| 330 | Ga0105242_10001012 | 3300009176 | Bacteria | 22084 |
| 331 | Ga0105242_10081328 | 3300009176 | Bacteria | 2709 |
| 332 | Ga0105242_10120725 | 3300009176 | Bacteria | 2249 |
| 333 | Ga0105242_10557358 | 3300009176 | Bacteria | 1100 |
| 334 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 335 | Ga0105248_11066971 | 3300009177 | Bacteria | 913 |
| 336 | Ga0105237_10001106 | 3300009545 | Bacteria | 36105 |
| 337 | Ga0105237_10049038 | 3300009545 | Bacteria | 4245 |
| 338 | Ga0105237_10284469 | 3300009545 | Bacteria | 1656 |
| 339 | Ga0105238_10071517 | 3300009551 | Bacteria | 3466 |
| 340 | Ga0105238_10233208 | 3300009551 | Bacteria | 1817 |
| 341 | Ga0105238_10802758 | 3300009551 | Bacteria | 957 |
| 342 | Ga0105249_10221528 | 3300009553 | Bacteria | 1862 |
| 343 | Ga0105249_10676117 | 3300009553 | Bacteria | 1091 |
| 344 | Ga0105249_10815412 | 3300009553 | Bacteria | 998 |
| 345 | Ga0105249_11201558 | 3300009553 | Bacteria | 829 |
| 346 | Ga0105239_10045921 | 3300010375 | Bacteria | 4787 |
| 347 | Ga0105239_10072996 | 3300010375 | Bacteria | 3773 |
| 348 | Ga0105239_10359881 | 3300010375 | Bacteria | 1643 |
| 349 | Ga0105239_10601666 | 3300010375 | Bacteria | 1254 |
| 350 | Ga0105239_10605418 | 3300010375 | Bacteria | 1250 |
| 351 | Ga0105239_11357800 | 3300010375 | Bacteria | 820 |
| 352 | Ga0105239_12024073 | 3300010375 | Bacteria | 669 |
| 353 | Ga0105239_12111880 | 3300010375 | Unclassified | 655 |
| 354 | Ga0105246_10114148 | 3300011119 | Bacteria | 1990 |
| 355 | Ga0105246_11165939 | 3300011119 | Bacteria | 707 |
| 356 | Ga0157371_10009783 | 3300013102 | Bacteria | 7518 |
| 357 | Ga0157371_10048015 | 3300013102 | Bacteria | 3035 |
| 358 | Ga0157371_10114126 | 3300013102 | Bacteria | 1919 |
| 359 | Ga0157371_10501409 | 3300013102 | Bacteria | 896 |
| 360 | Ga0157371_10711406 | 3300013102 | Unclassified | 752 |
| 361 | Ga0157370_10007123 | 3300013104 | Bacteria | 12201 |
| 362 | Ga0157370_10343265 | 3300013104 | Unclassified | 1376 |
| 363 | Ga0157370_10752564 | 3300013104 | Unclassified | 888 |
| 364 | Ga0157370_10835440 | 3300013104 | Bacteria | 837 |
| 365 | Ga0157370_11272535 | 3300013104 | Bacteria | 663 |
| 366 | Ga0157369_10001902 | 3300013105 | Bacteria | 25182 |
| 367 | Ga0157369_10006254 | 3300013105 | Bacteria | 13819 |
| 368 | Ga0157369_10205232 | 3300013105 | Bacteria | 2067 |
| 369 | Ga0157369_11563459 | 3300013105 | Bacteria | 671 |
| 370 | Ga0157369_11599938 | 3300013105 | Bacteria | 662 |
| 371 | Ga0157374_10427883 | 3300013296 | Bacteria | 1323 |
| 372 | Ga0157378_10012400 | 3300013297 | Bacteria | 7462 |
| 373 | Ga0157378_10185172 | 3300013297 | Bacteria | 1961 |
| 374 | Ga0157378_10866825 | 3300013297 | Bacteria | 932 |
| 375 | Ga0163162_10781478 | 3300013306 | Bacteria | 1073 |
| 376 | Ga0163162_10830624 | 3300013306 | Bacteria | 1040 |
| 377 | Ga0163162_11039566 | 3300013306 | Bacteria | 927 |
| 378 | Ga0163162_11238719 | 3300013306 | Bacteria | 847 |
| 379 | Ga0157372_10023313 | 3300013307 | Bacteria | 6708 |
| 380 | Ga0157372_10061286 | 3300013307 | Bacteria | 4212 |
| 381 | Ga0157372_10181647 | 3300013307 | Bacteria | 2435 |
| 382 | Ga0157372_10385187 | 3300013307 | Unclassified | 1634 |
| 383 | Ga0157372_10533797 | 3300013307 | Bacteria | 1368 |
| 384 | Ga0157372_11174813 | 3300013307 | Bacteria | 887 |
| 385 | Ga0157375_10027026 | 3300013308 | Bacteria | 5358 |
| 386 | Ga0157375_10103896 | 3300013308 | Bacteria | 2929 |
| 387 | Ga0157375_10269222 | 3300013308 | Bacteria | 1865 |
| 388 | Ga0157375_10463748 | 3300013308 | Bacteria | 1432 |
| 389 | Ga0157375_11220304 | 3300013308 | Bacteria | 883 |
| 390 | Ga0157375_12059850 | 3300013308 | Unclassified | 679 |
| 391 | Ga0163163_10786208 | 3300014325 | Bacteria | 1015 |
| 392 | Ga0163163_10951663 | 3300014325 | Bacteria | 922 |
| 393 | Ga0163163_11152471 | 3300014325 | Bacteria | 838 |
| 394 | Ga0157380_10414883 | 3300014326 | Bacteria | 1282 |
| 395 | Ga0157380_10910232 | 3300014326 | Bacteria | 906 |
| 396 | Ga0182008_10028739 | 3300014497 | Bacteria | 2812 |
| 397 | Ga0182008_10127331 | 3300014497 | Bacteria | 1268 |
| 398 | Ga0182008_10365841 | 3300014497 | Bacteria | 768 |
| 399 | Ga0157377_10049399 | 3300014745 | Bacteria | 2365 |
| 400 | Ga0157377_10101152 | 3300014745 | Bacteria | 1718 |
| 401 | Ga0157377_10143378 | 3300014745 | Bacteria | 1470 |
| 402 | Ga0157379_10157217 | 3300014968 | Bacteria | 2051 |
| 403 | Ga0157379_10939036 | 3300014968 | Unclassified | 822 |
| 404 | Ga0157376_10257788 | 3300014969 | Bacteria | 1632 |
| 405 | Ga0157376_10704118 | 3300014969 | Bacteria | 1015 |
| 406 | Ga0197907_10277474 | 3300020069 | Bacteria | 1691 |
| 407 | Ga0197907_10303868 | 3300020069 | Bacteria | 1582 |
| 408 | Ga0197907_10800161 | 3300020069 | Bacteria | 1338 |
| 409 | Ga0197907_11011833 | 3300020069 | Bacteria | 1580 |
| 410 | Ga0197907_11459340 | 3300020069 | Bacteria | 562 |
| 411 | Ga0206356_10218075 | 3300020070 | Bacteria | 3317 |
| 412 | Ga0206356_11205897 | 3300020070 | Unclassified | 1104 |
| 413 | Ga0206356_11759950 | 3300020070 | Bacteria | 743 |
| 414 | Ga0206349_1187371 | 3300020075 | Bacteria | 803 |
| 415 | Ga0206349_1257685 | 3300020075 | Bacteria | 1478 |
| 416 | Ga0206351_10461011 | 3300020077 | Bacteria | 856 |
| 417 | Ga0206352_10008056 | 3300020078 | Bacteria | 1018 |
| 418 | Ga0206352_10433741 | 3300020078 | Bacteria | 1063 |
| 419 | Ga0206352_10659006 | 3300020078 | Bacteria | 975 |
| 420 | Ga0206352_10747119 | 3300020078 | Bacteria | 523 |
| 421 | Ga0206350_10585354 | 3300020080 | Bacteria | 882 |
| 422 | Ga0206350_10773500 | 3300020080 | Bacteria | 648 |
| 423 | Ga0206350_11617956 | 3300020080 | Bacteria | 925 |
| 424 | Ga0206354_10011853 | 3300020081 | Bacteria | 1840 |
| 425 | Ga0206354_10885409 | 3300020081 | Bacteria | 572 |
| 426 | Ga0206354_10989501 | 3300020081 | Unclassified | 1893 |
| 427 | Ga0206354_11028322 | 3300020081 | Bacteria | 1123 |
| 428 | Ga0206353_10752841 | 3300020082 | Unclassified | 686 |
| 429 | Ga0206353_10927289 | 3300020082 | Bacteria | 518 |
| 430 | Ga0206353_11178628 | 3300020082 | Bacteria | 1948 |
| 431 | Ga0206353_11402362 | 3300020082 | Bacteria | 1952 |
| 432 | Ga0154015_1665967 | 3300020610 | Bacteria | 1279 |
| 433 | Ga0213876_10061056 | 3300021384 | Unclassified | 1989 |
| 434 | Ga0213876_10081529 | 3300021384 | Unclassified | 1711 |
| 435 | Ga0213875_10096172 | 3300021388 | Bacteria | 1381 |
| 436 | Ga0224712_10014346 | 3300022467 | Bacteria | 2549 |
| 437 | Ga0224712_10030580 | 3300022467 | Bacteria | 1945 |
| 438 | Ga0224712_10055400 | 3300022467 | Bacteria | 1560 |
| 439 | Ga0224712_10108653 | 3300022467 | Bacteria | 1187 |
| 440 | Ga0224712_10354617 | 3300022467 | Bacteria | 694 |
| 441 | Ga0224712_10402934 | 3300022467 | Bacteria | 652 |
| 442 | Ga0207656_10016418 | 3300025321 | Bacteria | 2882 |
| 443 | Ga0207656_10029861 | 3300025321 | Bacteria | 2248 |
| 444 | Ga0207682_10062188 | 3300025893 | Unclassified | 1565 |
| 445 | Ga0207642_10028406 | 3300025899 | Bacteria | 2303 |
| 446 | Ga0207642_10208162 | 3300025899 | Bacteria | 1085 |
| 447 | Ga0207710_10001786 | 3300025900 | Bacteria | 10368 |
| 448 | Ga0207688_10025229 | 3300025901 | Bacteria | 3264 |
| 449 | Ga0207647_10100983 | 3300025904 | Bacteria | 1712 |
| 450 | Ga0207647_10741282 | 3300025904 | Bacteria | 532 |
| 451 | Ga0207699_10286050 | 3300025906 | Bacteria | 1147 |
| 452 | Ga0207645_10129392 | 3300025907 | Bacteria | 1643 |
| 453 | Ga0207645_10288660 | 3300025907 | Bacteria | 1091 |
| 454 | Ga0207705_10023067 | 3300025909 | Bacteria | 4439 |
| 455 | Ga0207705_10028083 | 3300025909 | Bacteria | 4011 |
| 456 | Ga0207705_10615488 | 3300025909 | Bacteria | 844 |
| 457 | Ga0207705_10636199 | 3300025909 | Bacteria | 829 |
| 458 | Ga0207707_10003121 | 3300025912 | Bacteria | 14712 |
| 459 | Ga0207707_10045352 | 3300025912 | Bacteria | 3831 |
| 460 | Ga0207707_10308264 | 3300025912 | Unclassified | 1368 |
| 461 | Ga0207695_10030945 | 3300025913 | Bacteria | 5884 |
| 462 | Ga0207671_10280151 | 3300025914 | Bacteria | 1315 |
| 463 | Ga0207693_10013895 | 3300025915 | Bacteria | 6484 |
| 464 | Ga0207693_10370815 | 3300025915 | Bacteria | 1120 |
| 465 | Ga0207663_10057775 | 3300025916 | Bacteria | 2446 |
| 466 | Ga0207660_10033479 | 3300025917 | Bacteria | 3555 |
| 467 | Ga0207660_10511571 | 3300025917 | Unclassified | 975 |
| 468 | Ga0207662_10745471 | 3300025918 | Bacteria | 688 |
| 469 | Ga0207657_10008958 | 3300025919 | Bacteria | 10111 |
| 470 | Ga0207657_10009720 | 3300025919 | Bacteria | 9645 |
| 471 | Ga0207657_10021929 | 3300025919 | Bacteria | 5997 |
| 472 | Ga0207657_10483936 | 3300025919 | Bacteria | 970 |
| 473 | Ga0207649_10015628 | 3300025920 | Bacteria | 4263 |
| 474 | Ga0207649_10031433 | 3300025920 | Bacteria | 3155 |
| 475 | Ga0207649_10058099 | 3300025920 | Bacteria | 2421 |
| 476 | Ga0207652_10018700 | 3300025921 | Bacteria | 5685 |
| 477 | Ga0207652_10202063 | 3300025921 | Bacteria | 1788 |
| 478 | Ga0207652_10436960 | 3300025921 | Unclassified | 1180 |
| 479 | Ga0207694_10043711 | 3300025924 | Bacteria | 3458 |
| 480 | Ga0207650_10107664 | 3300025925 | Bacteria | 2154 |
| 481 | Ga0207650_11254361 | 3300025925 | Unclassified | 631 |
| 482 | Ga0207659_10033094 | 3300025926 | Bacteria | 3554 |
| 483 | Ga0207659_10578606 | 3300025926 | Bacteria | 956 |
| 484 | Ga0207659_11542013 | 3300025926 | Bacteria | 568 |
| 485 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 486 | Ga0207687_10000785 | 3300025927 | Bacteria | 21381 |
| 487 | Ga0207687_10032650 | 3300025927 | Bacteria | 3527 |
| 488 | Ga0207687_10041108 | 3300025927 | Bacteria | 3173 |
| 489 | Ga0207687_10085822 | 3300025927 | Bacteria | 2284 |
| 490 | Ga0207687_10149363 | 3300025927 | Bacteria | 1781 |
| 491 | Ga0207687_10752592 | 3300025927 | Bacteria | 829 |
| 492 | Ga0207700_10781928 | 3300025928 | Bacteria | 853 |
| 493 | Ga0207700_11580532 | 3300025928 | Bacteria | 581 |
| 494 | Ga0207644_10248387 | 3300025931 | Bacteria | 1419 |
| 495 | Ga0207690_10008222 | 3300025932 | Bacteria | 6189 |
| 496 | Ga0207690_10034867 | 3300025932 | Bacteria | 3245 |
| 497 | Ga0207690_10155403 | 3300025932 | Bacteria | 1700 |
| 498 | Ga0207690_10162618 | 3300025932 | Bacteria | 1665 |
| 499 | Ga0207690_10299541 | 3300025932 | Bacteria | 1258 |
| 500 | Ga0207706_10004968 | 3300025933 | Bacteria | 12429 |
| 501 | Ga0207706_10010365 | 3300025933 | Bacteria | 8512 |
| 502 | Ga0207706_10390981 | 3300025933 | Bacteria | 1206 |
| 503 | Ga0207686_10000414 | 3300025934 | Bacteria | 29497 |
| 504 | Ga0207686_10119805 | 3300025934 | Bacteria | 1789 |
| 505 | Ga0207686_11023422 | 3300025934 | Bacteria | 671 |
| 506 | Ga0207709_10030922 | 3300025935 | Bacteria | 3120 |
| 507 | Ga0207709_10045121 | 3300025935 | Bacteria | 2668 |
| 508 | Ga0207709_10057610 | 3300025935 | Bacteria | 2410 |
| 509 | Ga0207709_10168827 | 3300025935 | Bacteria | 1533 |
| 510 | Ga0207709_10321957 | 3300025935 | Unclassified | 1157 |
| 511 | Ga0207670_10020104 | 3300025936 | Bacteria | 4095 |
| 512 | Ga0207669_10014900 | 3300025937 | Bacteria | 3909 |
| 513 | Ga0207669_10102192 | 3300025937 | Bacteria | 1898 |
| 514 | Ga0207669_10209707 | 3300025937 | Bacteria | 1421 |
| 515 | Ga0207669_10232338 | 3300025937 | Bacteria | 1361 |
| 516 | Ga0207669_10334430 | 3300025937 | Bacteria | 1164 |
| 517 | Ga0207669_10367904 | 3300025937 | Bacteria | 1116 |
| 518 | Ga0207669_10371849 | 3300025937 | Bacteria | 1111 |
| 519 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 520 | Ga0207704_10057780 | 3300025938 | Bacteria | 2385 |
| 521 | Ga0207704_10210494 | 3300025938 | Bacteria | 1431 |
| 522 | Ga0207665_10110275 | 3300025939 | Bacteria | 1932 |
| 523 | Ga0207691_10031948 | 3300025940 | Bacteria | 4912 |
| 524 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 525 | Ga0207711_10673000 | 3300025941 | Bacteria | 965 |
| 526 | Ga0207689_10069762 | 3300025942 | Bacteria | 2888 |
| 527 | Ga0207661_10000599 | 3300025944 | Bacteria | 22999 |
| 528 | Ga0207661_10012321 | 3300025944 | Bacteria | 6212 |
| 529 | Ga0207661_10107371 | 3300025944 | Bacteria | 2355 |
| 530 | Ga0207661_10183527 | 3300025944 | Bacteria | 1829 |
| 531 | Ga0207661_10242778 | 3300025944 | Bacteria | 1599 |
| 532 | Ga0207661_10351667 | 3300025944 | Bacteria | 1330 |
| 533 | Ga0207661_10419653 | 3300025944 | Bacteria | 1215 |
| 534 | Ga0207661_10491273 | 3300025944 | Bacteria | 1121 |
| 535 | Ga0207661_11092381 | 3300025944 | Bacteria | 734 |
| 536 | Ga0207679_10150819 | 3300025945 | Bacteria | 1891 |
| 537 | Ga0207679_10310795 | 3300025945 | Bacteria | 1361 |
| 538 | Ga0207679_10924592 | 3300025945 | Bacteria | 798 |
| 539 | Ga0207667_10517346 | 3300025949 | Bacteria | 1209 |
| 540 | Ga0207667_11258810 | 3300025949 | Bacteria | 717 |
| 541 | Ga0207651_10020522 | 3300025960 | Bacteria | 3990 |
| 542 | Ga0207712_10252078 | 3300025961 | Bacteria | 1427 |
| 543 | Ga0207712_10693833 | 3300025961 | Unclassified | 888 |
| 544 | Ga0207712_10942185 | 3300025961 | Bacteria | 764 |
| 545 | Ga0207668_10017540 | 3300025972 | Bacteria | 4487 |
| 546 | Ga0207668_10073183 | 3300025972 | Bacteria | 2455 |
| 547 | Ga0207668_11027723 | 3300025972 | Bacteria | 737 |
| 548 | Ga0207640_10058367 | 3300025981 | Bacteria | 2542 |
| 549 | Ga0207640_10069523 | 3300025981 | Bacteria | 2365 |
| 550 | Ga0207640_10886231 | 3300025981 | Bacteria | 778 |
| 551 | Ga0207640_11080523 | 3300025981 | Bacteria | 709 |
| 552 | Ga0207658_10344448 | 3300025986 | Bacteria | 1296 |
| 553 | Ga0207677_10000465 | 3300026023 | Bacteria | 27000 |
| 554 | Ga0207677_10027442 | 3300026023 | Bacteria | 3586 |
| 555 | Ga0207677_10101037 | 3300026023 | Bacteria | 2122 |
| 556 | Ga0207677_11440837 | 3300026023 | Bacteria | 635 |
| 557 | Ga0207703_10009202 | 3300026035 | Bacteria | 7768 |
| 558 | Ga0207703_10108685 | 3300026035 | Bacteria | 2362 |
| 559 | Ga0207703_10335689 | 3300026035 | Bacteria | 1388 |
| 560 | Ga0207703_11330224 | 3300026035 | Bacteria | 691 |
| 561 | Ga0207703_11981674 | 3300026035 | Bacteria | 559 |
| 562 | Ga0207639_10047917 | 3300026041 | Bacteria | 3232 |
| 563 | Ga0207639_10050374 | 3300026041 | Bacteria | 3163 |
| 564 | Ga0207639_10063847 | 3300026041 | Bacteria | 2853 |
| 565 | Ga0207639_10179766 | 3300026041 | Bacteria | 1798 |
| 566 | Ga0207678_10006324 | 3300026067 | Bacteria | 10517 |
| 567 | Ga0207678_10043907 | 3300026067 | Bacteria | 3867 |
| 568 | Ga0207678_10628402 | 3300026067 | Bacteria | 943 |
| 569 | Ga0207708_10004693 | 3300026075 | Bacteria | 10052 |
| 570 | Ga0207708_10008095 | 3300026075 | Bacteria | 7790 |
| 571 | Ga0207708_10129580 | 3300026075 | Bacteria | 1972 |
| 572 | Ga0207708_10614269 | 3300026075 | Bacteria | 922 |
| 573 | Ga0207708_10869133 | 3300026075 | Bacteria | 779 |
| 574 | Ga0207708_10870884 | 3300026075 | Bacteria | 778 |
| 575 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 576 | Ga0207702_10059276 | 3300026078 | Bacteria | 3260 |
| 577 | Ga0207702_10488503 | 3300026078 | Bacteria | 1199 |
| 578 | Ga0207702_10552570 | 3300026078 | Bacteria | 1126 |
| 579 | Ga0207702_10597620 | 3300026078 | Bacteria | 1082 |
| 580 | Ga0207641_11764899 | 3300026088 | Bacteria | 621 |
| 581 | Ga0207648_10045428 | 3300026089 | Bacteria | 3852 |
| 582 | Ga0207648_10074950 | 3300026089 | Bacteria | 2950 |
| 583 | Ga0207648_10082193 | 3300026089 | Bacteria | 2809 |
| 584 | Ga0207648_10158331 | 3300026089 | Bacteria | 1999 |
| 585 | Ga0207648_10260681 | 3300026089 | Bacteria | 1547 |
| 586 | Ga0207676_10624897 | 3300026095 | Bacteria | 1037 |
| 587 | Ga0207674_10070583 | 3300026116 | Bacteria | 3512 |
| 588 | Ga0207674_10948824 | 3300026116 | Bacteria | 829 |
| 589 | Ga0207675_100039448 | 3300026118 | Bacteria | 4407 |
| 590 | Ga0207683_10033551 | 3300026121 | Bacteria | 4459 |
| 591 | Ga0207683_10089021 | 3300026121 | Bacteria | 2747 |
| 592 | Ga0207683_10138363 | 3300026121 | Bacteria | 2193 |
| 593 | Ga0207683_10851265 | 3300026121 | Bacteria | 846 |
| 594 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 595 | Ga0207698_10258159 | 3300026142 | Bacteria | 1599 |
| 596 | Ga0207698_10286779 | 3300026142 | Bacteria | 1525 |
| 597 | Ga0207698_10330135 | 3300026142 | Bacteria | 1432 |
| 598 | Ga0207698_10543636 | 3300026142 | Bacteria | 1137 |
| 599 | Ga0207698_11669317 | 3300026142 | Bacteria | 652 |
| 600 | Ga0207428_10044132 | 3300027907 | Bacteria | 3597 |
| 601 | Ga0207428_10072004 | 3300027907 | Bacteria | 2714 |
| 602 | Ga0207428_10184362 | 3300027907 | Bacteria | 1575 |
| 603 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 604 | Ga0268266_10018170 | 3300028379 | Bacteria | 5995 |
| 605 | Ga0268266_10220856 | 3300028379 | Bacteria | 1742 |
| 606 | Ga0268264_10559911 | 3300028381 | Bacteria | 1122 |
| 607 | Ga0268264_11079816 | 3300028381 | Unclassified | 811 |
| 608 | Ga0265337_1000409 | 3300028556 | Bacteria | 22991 |
| 609 | Ga0265326_10000004 | 3300028558 | Bacteria | 283947 |
| 610 | Ga0265326_10037205 | 3300028558 | Bacteria | 1383 |
| 611 | Ga0265318_10032403 | 3300028577 | Bacteria | 2022 |
| 612 | Ga0265318_10043575 | 3300028577 | Bacteria | 1700 |
| 613 | Ga0265318_10242422 | 3300028577 | Unclassified | 658 |
| 614 | Ga0265336_10000836 | 3300028666 | Bacteria | 16045 |
| 615 | Ga0265338_10000008 | 3300028800 | Bacteria | 481542 |
| 616 | Ga0265338_10001224 | 3300028800 | Bacteria | 42394 |
| 617 | Ga0265338_10001643 | 3300028800 | Bacteria | 35770 |
| 618 | Ga0265338_10464430 | 3300028800 | Bacteria | 895 |
| 619 | Ga0265338_10746194 | 3300028800 | Unclassified | 673 |
| 620 | Ga0265324_10005973 | 3300029957 | Bacteria | 5154 |
| 621 | Ga0265324_10028426 | 3300029957 | Unclassified | 1972 |
| 622 | Ga0265324_10036423 | 3300029957 | Bacteria | 1711 |
| 623 | Ga0265332_10102326 | 3300031238 | Bacteria | 1208 |
| 624 | Ga0265320_10000666 | 3300031240 | Bacteria | 26164 |
| 625 | Ga0265339_10050790 | 3300031249 | Unclassified | 2266 |
| 626 | Ga0265339_10084756 | 3300031249 | Bacteria | 1670 |
| 627 | Ga0265327_10011293 | 3300031251 | Bacteria | 6170 |
| 628 | Ga0265327_10033767 | 3300031251 | Bacteria | 2846 |
| 629 | Ga0307408_100089797 | 3300031548 | Bacteria | 2317 |
| 630 | Ga0307408_100344126 | 3300031548 | Bacteria | 1263 |
| 631 | Ga0307408_101698149 | 3300031548 | Bacteria | 602 |
| 632 | Ga0265342_10052456 | 3300031712 | Unclassified | 2431 |
| 633 | Ga0316576_10542298 | 3300031727 | Bacteria | 853 |
| 634 | Ga0307405_10124261 | 3300031731 | Bacteria | 1771 |
| 635 | Ga0307405_10741164 | 3300031731 | Bacteria | 817 |
| 636 | Ga0307413_10039268 | 3300031824 | Bacteria | 2751 |
| 637 | Ga0307413_10101734 | 3300031824 | Bacteria | 1900 |
| 638 | Ga0307413_10119173 | 3300031824 | Bacteria | 1784 |
| 639 | Ga0307413_10238231 | 3300031824 | Bacteria | 1341 |
| 640 | Ga0307410_10002660 | 3300031852 | Bacteria | 8711 |
| 641 | Ga0307410_10027546 | 3300031852 | Bacteria | 3592 |
| 642 | Ga0307410_10105406 | 3300031852 | Bacteria | 2029 |
| 643 | Ga0307410_10426017 | 3300031852 | Bacteria | 1077 |
| 644 | Ga0307406_10018517 | 3300031901 | Bacteria | 4070 |
| 645 | Ga0307406_10035203 | 3300031901 | Bacteria | 3077 |
| 646 | Ga0307406_10052099 | 3300031901 | Bacteria | 2601 |
| 647 | Ga0307406_10511448 | 3300031901 | Bacteria | 975 |
| 648 | Ga0307406_10773307 | 3300031901 | Bacteria | 808 |
| 649 | Ga0307406_11799910 | 3300031901 | Bacteria | 544 |
| 650 | Ga0307407_10041577 | 3300031903 | Bacteria | 2571 |
| 651 | Ga0307407_10055796 | 3300031903 | Bacteria | 2284 |
| 652 | Ga0307407_10153050 | 3300031903 | Bacteria | 1501 |
| 653 | Ga0307407_10601270 | 3300031903 | Bacteria | 819 |
| 654 | Ga0307407_10673025 | 3300031903 | Bacteria | 777 |
| 655 | Ga0307412_10064994 | 3300031911 | Bacteria | 2467 |
| 656 | Ga0307412_11752890 | 3300031911 | Bacteria | 570 |
| 657 | Ga0307409_100066780 | 3300031995 | Bacteria | 2837 |
| 658 | Ga0307409_100078685 | 3300031995 | Bacteria | 2654 |
| 659 | Ga0307409_100117484 | 3300031995 | Bacteria | 2244 |
| 660 | Ga0307409_100119344 | 3300031995 | Bacteria | 2229 |
| 661 | Ga0307409_100210588 | 3300031995 | Bacteria | 1747 |
| 662 | Ga0307409_100317296 | 3300031995 | Bacteria | 1457 |
| 663 | Ga0307409_100667766 | 3300031995 | Bacteria | 1035 |
| 664 | Ga0307409_100939462 | 3300031995 | Bacteria | 880 |
| 665 | Ga0307416_100306160 | 3300032002 | Bacteria | 1582 |
| 666 | Ga0307416_100326620 | 3300032002 | Bacteria | 1539 |
| 667 | Ga0307416_100330015 | 3300032002 | Bacteria | 1532 |
| 668 | Ga0307416_100540174 | 3300032002 | Bacteria | 1237 |
| 669 | Ga0307416_100854557 | 3300032002 | Bacteria | 1008 |
| 670 | Ga0307416_101706132 | 3300032002 | Bacteria | 734 |
| 671 | Ga0307414_10148518 | 3300032004 | Bacteria | 1845 |
| 672 | Ga0307414_10172025 | 3300032004 | Bacteria | 1733 |
| 673 | Ga0307411_10033789 | 3300032005 | Bacteria | 3175 |
| 674 | Ga0307411_10316353 | 3300032005 | Bacteria | 1259 |
| 675 | Ga0307411_10350869 | 3300032005 | Bacteria | 1203 |
| 676 | Ga0307411_10355804 | 3300032005 | Bacteria | 1195 |
| 677 | Ga0307411_10861001 | 3300032005 | Bacteria | 802 |
| 678 | Ga0307415_100001983 | 3300032126 | Bacteria | 10067 |
| 679 | Ga0307415_100003452 | 3300032126 | Bacteria | 8047 |
| 680 | Ga0307415_100016693 | 3300032126 | Bacteria | 4383 |
| 681 | Ga0307415_100080697 | 3300032126 | Bacteria | 2321 |
| 682 | Ga0307415_100629868 | 3300032126 | Bacteria | 959 |
| 683 | Ga0307415_100696522 | 3300032126 | Bacteria | 916 |
| 684 | Ga0307415_100878998 | 3300032126 | Bacteria | 824 |
| 685 | Ga0307415_101521401 | 3300032126 | Bacteria | 641 |
| 686 | Ga0373948_0042954 | 3300034817 | Bacteria | 951 |
| 687 | Ga0373938_0050720 | 3300034957 | Bacteria | 947 |
| 688 | Ga0373936_0115057 | 3300035113 | Bacteria | 1145 |
| 689 | Ga0373954_0237694 | 3300035118 | Unclassified | 897 |
| 690 | Ga0373956_0581178 | 3300035119 | Bacteria | 535 |
| 691 | Ga0373943_0097273 | 3300035170 | Bacteria | 1533 |
| 692 | Ga0373961_0083554 | 3300035241 | Bacteria | 1008 |
| 693 | Ga0316574_0061749 | 3300035398 | Bacteria | 2354 |
| 694 | Ga0373935_0235002 | 3300035692 | Bacteria | 1278 |
| 695 | Ga0373925_0117282 | 3300037068 | Bacteria | 2063 |
| 696 | Ga0373925_0127391 | 3300037068 | Bacteria | 1982 |
| 697 | Ga0395899_0139547 | 3300037312 | Unclassified | 1725 |
| 698 | Ga0395899_0255730 | 3300037312 | Bacteria | 1200 |
| 699 | Ga0395900_0089562 | 3300037418 | Bacteria | 3162 |
| 700 | Ga0395900_0106773 | 3300037418 | Bacteria | 2876 |
| 701 | Ga0395900_0767161 | 3300037418 | Unclassified | 894 |
| 702 | Ga0395900_1196132 | 3300037418 | Bacteria | 676 |
| 703 | Ga0395898_0005527 | 3300037466 | Bacteria | 13639 |
| 704 | Ga0395898_0015974 | 3300037466 | Bacteria | 7691 |
| 705 | Ga0395898_0226295 | 3300037466 | Bacteria | 1784 |
| 706 | Ga0395898_0587861 | 3300037466 | Unclassified | 1056 |
| 707 | Ga0395898_0674620 | 3300037466 | Bacteria | 976 |
| 708 | Ga0395898_1357451 | 3300037466 | Bacteria | 639 |
| 709 | Ga0395905_0015836 | 3300037471 | Bacteria | 7162 |
| 710 | Ga0395905_0027496 | 3300037471 | Bacteria | 5364 |
| 711 | Ga0395905_0364967 | 3300037471 | Bacteria | 1337 |
| 712 | Ga0395905_0506836 | 3300037471 | Bacteria | 1107 |
| 713 | Ga0436364_0566822 | 3300037853 | Unclassified | 1075 |
| 714 | Ga0436364_0997712 | 3300037853 | Bacteria | 1882 |
| 715 | Ga0395901_0019600 | 3300038443 | Bacteria | 6914 |
| 716 | Ga0395901_0022139 | 3300038443 | Bacteria | 6511 |
| 717 | Ga0395901_0122913 | 3300038443 | Bacteria | 2728 |
| 718 | Ga0395901_0333098 | 3300038443 | Bacteria | 1569 |
| 719 | Ga0395901_0480471 | 3300038443 | Bacteria | 1267 |
| 720 | Ga0395901_0735708 | 3300038443 | Bacteria | 981 |
| 721 | Ga0395901_1341353 | 3300038443 | Bacteria | 676 |
| 722 | Ga0436365_0080349 | 3300039437 | Unclassified | 1665 |
| 723 | Ga0436365_0654443 | 3300039437 | Unclassified | 2477 |
| 724 | Ga0436365_1237803 | 3300039437 | Bacteria | 8741 |
| 725 | Ga0436363_0046650 | 3300039450 | Bacteria | 33316 |
| 726 | Ga0436362_1118531 | 3300039453 | Unclassified | 973 |
| 727 | Ga0436362_1246024 | 3300039453 | Unclassified | 889 |
| 728 | Ga0451789_0914259 | 3300041443 | Unclassified | 679 |
| 729 | Ga0451789_1169276 | 3300041443 | Unclassified | 520 |
| 730 | Ga0451837_1397650 | 3300041494 | Bacteria | 582 |
| 731 | Ga0451847_0146959 | 3300041503 | Bacteria | 729 |
| 732 | Ga0451849_0048515 | 3300041505 | Unclassified | 983 |
| 733 | Ga0451853_0757159 | 3300041512 | Bacteria | 1380 |
| 734 | Ga0451853_0887436 | 3300041512 | Unclassified | 633 |
| 735 | Ga0451853_2670470 | 3300041512 | Bacteria | 882 |
| 736 | Ga0439459_0112160 | 3300042438 | Bacteria | 679 |
| 737 | Ga0451577_0339972 | 3300042876 | Bacteria | 1361 |
| 738 | Ga0466972_0186121 | 3300044658 | Bacteria | 973 |
| 739 | Ga0466972_0583853 | 3300044658 | Bacteria | 528 |
| 740 | Ga0466966_0318307 | 3300044684 | Unclassified | 935 |
| 741 | Ga0466961_0162616 | 3300044693 | Bacteria | 1391 |
| 742 | Ga0466961_0726483 | 3300044693 | Bacteria | 594 |
| 743 | Ga0466961_0794864 | 3300044693 | Bacteria | 565 |
| 744 | Ga0466963_0018752 | 3300044694 | Bacteria | 4331 |
| 745 | Ga0466963_0042130 | 3300044694 | Bacteria | 2997 |
| 746 | Ga0466963_0073369 | 3300044694 | Bacteria | 2307 |
| 747 | Ga0466963_0195320 | 3300044694 | Bacteria | 1415 |
| 748 | Ga0466963_0204414 | 3300044694 | Bacteria | 1381 |
| 749 | Ga0466963_0299612 | 3300044694 | Bacteria | 1131 |
| 750 | Ga0466963_0542154 | 3300044694 | Bacteria | 822 |
| 751 | Ga0466964_0304889 | 3300044706 | Bacteria | 804 |
| 752 | Ga0466964_0353047 | 3300044706 | Bacteria | 756 |
| 753 | Ga0466970_0048058 | 3300044765 | Bacteria | 2275 |
| 754 | Ga0466970_0077917 | 3300044765 | Bacteria | 1787 |
| 755 | Ga0466957_0000697 | 3300044842 | Bacteria | 17168 |
| 756 | Ga0466957_0113200 | 3300044842 | Bacteria | 1723 |
| 757 | Ga0466957_0239355 | 3300044842 | Bacteria | 1204 |
| 758 | Ga0466960_0038448 | 3300044901 | Bacteria | 2250 |
| 759 | Ga0466959_0129570 | 3300045049 | Bacteria | 1788 |
| 760 | Ga0451576_0403540 | 3300045051 | Unclassified | 1433 |
| 761 | Ga0451576_0577870 | 3300045051 | Bacteria | 1181 |
| 762 | Ga0451576_2231118 | 3300045051 | Unclassified | 562 |
| 763 | Ga0466958_0111359 | 3300045836 | Bacteria | 1709 |
| 764 | Ga0466958_0449977 | 3300045836 | Bacteria | 834 |
| 765 | Ga0466967_0030212 | 3300045976 | Bacteria | 4545 |
| 766 | Ga0466967_0031626 | 3300045976 | Bacteria | 4458 |
| 767 | Ga0466967_0032630 | 3300045976 | Bacteria | 4399 |
| 768 | Ga0466967_0058577 | 3300045976 | Bacteria | 3405 |
| 769 | Ga0466967_0276665 | 3300045976 | Bacteria | 1610 |
| 770 | Ga0466967_0280667 | 3300045976 | Bacteria | 1598 |
| 771 | Ga0466967_0304393 | 3300045976 | Bacteria | 1534 |
| 772 | Ga0466967_0485026 | 3300045976 | Bacteria | 1211 |
| 773 | Ga0466967_0502194 | 3300045976 | Bacteria | 1190 |
| 774 | Ga0466967_0685363 | 3300045976 | Bacteria | 1014 |
| 775 | Ga0466967_0751181 | 3300045976 | Bacteria | 967 |
| 776 | Ga0466967_1078248 | 3300045976 | Bacteria | 800 |
| 777 | Ga0466967_1205463 | 3300045976 | Bacteria | 754 |
| 778 | Ga0466967_1467449 | 3300045976 | Bacteria | 679 |
| 779 | Ga0495592_0547305 | 3300046454 | Bacteria | 712 |
| 780 | Ga0495603_0005110 | 3300046455 | Bacteria | 7836 |
| 781 | Ga0495629_0155703 | 3300046459 | Bacteria | 1588 |
| 782 | Ga0495641_0027210 | 3300046461 | Bacteria | 2783 |
| 783 | Ga0495651_0367023 | 3300046462 | Bacteria | 947 |
| 784 | Ga0495651_0547882 | 3300046462 | Bacteria | 735 |
| 785 | Ga0495651_0772084 | 3300046462 | Unclassified | 595 |
| 786 | Ga0495653_0296448 | 3300046463 | Bacteria | 1056 |
| 787 | Ga0495582_0016761 | 3300046473 | Unclassified | 4013 |
| 788 | Ga0495582_0108015 | 3300046473 | Bacteria | 1562 |
| 789 | Ga0495605_0157975 | 3300046474 | Bacteria | 1008 |
| 790 | Ga0495639_0397053 | 3300046475 | Bacteria | 696 |
| 791 | Ga0495662_0000027 | 3300046476 | Bacteria | 52057 |
| 792 | Ga0495662_0025426 | 3300046476 | Unclassified | 2859 |
| 793 | Ga0495584_0482061 | 3300046491 | Bacteria | 631 |
| 794 | Ga0495594_0021711 | 3300046499 | Bacteria | 3429 |
| 795 | Ga0495596_0082383 | 3300046500 | Bacteria | 1249 |
| 796 | Ga0495596_0125313 | 3300046500 | Bacteria | 997 |
| 797 | Ga0495616_0206562 | 3300046513 | Bacteria | 861 |
| 798 | Ga0495630_0000037 | 3300046517 | Bacteria | 114404 |
| 799 | Ga0495630_0000210 | 3300046517 | Bacteria | 46241 |
| 800 | Ga0495630_0012186 | 3300046517 | Bacteria | 6238 |
| 801 | Ga0495631_0156094 | 3300046518 | Bacteria | 979 |
| 802 | Ga0495666_0026986 | 3300046526 | Unclassified | 2827 |
| 803 | Ga0495652_0458499 | 3300046529 | Unclassified | 891 |
| 804 | Ga0495640_0049122 | 3300046533 | Unclassified | 2911 |
| 805 | Ga0495640_0672865 | 3300046533 | Bacteria | 622 |
| 806 | Ga0495586_0000094 | 3300046535 | Bacteria | 54446 |
| 807 | Ga0495645_0007330 | 3300046543 | Bacteria | 7672 |
| 808 | Ga0495656_0340014 | 3300046615 | Bacteria | 776 |
| 809 | Ga0495668_0181270 | 3300046616 | Bacteria | 1154 |
| 810 | Ga0495634_0000982 | 3300046642 | Bacteria | 26859 |
| 811 | Ga0495634_0005363 | 3300046642 | Bacteria | 9880 |
| 812 | Ga0495634_0056022 | 3300046642 | Unclassified | 2635 |
| 813 | Ga0495635_0031266 | 3300046663 | Bacteria | 3697 |
| 814 | Ga0495635_0561848 | 3300046663 | Bacteria | 747 |
| 815 | Ga0495661_0127460 | 3300046665 | Bacteria | 1399 |
| 816 | Ga0495588_0103934 | 3300046674 | Bacteria | 1494 |
| 817 | Ga0495588_0386407 | 3300046674 | Bacteria | 735 |
| 818 | Ga0495657_0248990 | 3300046675 | Bacteria | 1070 |
| 819 | Ga0495599_0158452 | 3300046678 | Unclassified | 1400 |
| 820 | Ga0495623_0401325 | 3300046679 | Bacteria | 738 |
| 821 | Ga0495647_0003378 | 3300046681 | Bacteria | 5114 |
| 822 | Ga0495647_0009441 | 3300046681 | Bacteria | 3306 |
| 823 | Ga0495647_0070427 | 3300046681 | Bacteria | 1399 |
| 824 | Ga0495647_0205198 | 3300046681 | Bacteria | 865 |
| 825 | Ga0495647_0209234 | 3300046681 | Bacteria | 858 |
| 826 | Ga0495613_0000003 | 3300046689 | Bacteria | 248826 |
| 827 | Ga0495624_0342181 | 3300046690 | Bacteria | 900 |
| 828 | Ga0495670_0800172 | 3300046691 | Bacteria | 514 |
| 829 | Ga0495600_0417902 | 3300046809 | Bacteria | 832 |
| 830 | Ga0495674_0000108 | 3300047319 | Bacteria | 61101 |
| 831 | Ga0495674_0002905 | 3300047319 | Bacteria | 16677 |
| 832 | Ga0495674_0168501 | 3300047319 | Bacteria | 1829 |
| 833 | Ga0495672_0006597 | 3300047320 | Bacteria | 8934 |
| 834 | Ga0495676_0071215 | 3300047321 | Unclassified | 2673 |
| 835 | Ga0495676_0092642 | 3300047321 | Bacteria | 2255 |
| 836 | Ga0495676_0386603 | 3300047321 | Bacteria | 930 |
| 837 | Ga0495684_0141756 | 3300047471 | Bacteria | 1802 |
| 838 | Ga0495684_0328752 | 3300047471 | Bacteria | 1091 |
| 839 | Ga0495684_0813084 | 3300047471 | Bacteria | 610 |
| 840 | Ga0495593_0029526 | 3300047673 | Bacteria | 3006 |
| 841 | Ga0495602_0606089 | 3300048088 | Unclassified | 753 |
| 842 | Ga0495614_0074722 | 3300048089 | Bacteria | 1464 |
| 843 | Ga0496100_0016889 | 3300048903 | Bacteria | 4294 |
| 844 | Ga0496100_1210574 | 3300048903 | Bacteria | 596 |
| 845 | Ga0496101_0004260 | 3300048904 | Bacteria | 8972 |
| 846 | Ga0496101_0156775 | 3300048904 | Bacteria | 1744 |
| 847 | Ga0496101_0481305 | 3300048904 | Bacteria | 980 |
| 848 | Ga0496102_0029219 | 3300048905 | Bacteria | 4931 |
| 849 | Ga0496102_0449953 | 3300048905 | Bacteria | 1208 |
| 850 | Ga0496102_0604709 | 3300048905 | Bacteria | 1019 |
| 851 | Ga0496103_0006391 | 3300048906 | Bacteria | 7041 |
| 852 | Ga0496103_0172314 | 3300048906 | Bacteria | 1390 |
| 853 | Ga0496103_0229582 | 3300048906 | Bacteria | 1194 |
| 854 | Ga0496103_0873276 | 3300048906 | Bacteria | 565 |
| 855 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 856 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 857 | Ga0496104_0026472 | 3300048907 | Bacteria | 5356 |
| 858 | Ga0496104_0043868 | 3300048907 | Bacteria | 4200 |
| 859 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 860 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 861 | Ga0496105_0002894 | 3300048908 | Bacteria | 12592 |
| 862 | Ga0496105_0059859 | 3300048908 | Bacteria | 3142 |
| 863 | Ga0496105_0088368 | 3300048908 | Bacteria | 2560 |
| 864 | Ga0496106_0096802 | 3300048909 | Bacteria | 2284 |
| 865 | Ga0496106_0188359 | 3300048909 | Bacteria | 1640 |
| 866 | Ga0496106_0217385 | 3300048909 | Bacteria | 1523 |
| 867 | Ga0496107_0074213 | 3300048910 | Bacteria | 2475 |
| 868 | Ga0496107_0075197 | 3300048910 | Bacteria | 2458 |
| 869 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 870 | Ga0496108_0000094 | 3300048911 | Bacteria | 93075 |
| 871 | Ga0496108_0002794 | 3300048911 | Bacteria | 13992 |
| 872 | Ga0496108_0059784 | 3300048911 | Bacteria | 3205 |
| 873 | Ga0496108_0061700 | 3300048911 | Bacteria | 3155 |
| 874 | Ga0496108_0323583 | 3300048911 | Bacteria | 1344 |
| 875 | Ga0496108_0325096 | 3300048911 | Bacteria | 1341 |
| 876 | Ga0496108_0505941 | 3300048911 | Bacteria | 1055 |
| 877 | Ga0496109_0000024 | 3300048912 | Bacteria | 174723 |
| 878 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 879 | Ga0496109_0013442 | 3300048912 | Bacteria | 7101 |
| 880 | Ga0496109_0292013 | 3300048912 | Bacteria | 1537 |
| 881 | Ga0496109_0302055 | 3300048912 | Bacteria | 1509 |
| 882 | Ga0496109_0310002 | 3300048912 | Bacteria | 1489 |
| 883 | Ga0496109_0380012 | 3300048912 | Bacteria | 1334 |
| 884 | Ga0496109_0455758 | 3300048912 | Bacteria | 1208 |
| 885 | Ga0496109_0574838 | 3300048912 | Bacteria | 1062 |
| 886 | Ga0496109_0776174 | 3300048912 | Bacteria | 896 |
| 887 | Ga0496109_0914498 | 3300048912 | Bacteria | 815 |
| 888 | Ga0496110_0045483 | 3300048913 | Bacteria | 3838 |
| 889 | Ga0496110_0060815 | 3300048913 | Bacteria | 3332 |
| 890 | Ga0496110_0095026 | 3300048913 | Bacteria | 2669 |
| 891 | Ga0496110_0409563 | 3300048913 | Bacteria | 1236 |
| 892 | Ga0496110_0665562 | 3300048913 | Bacteria | 941 |
| 893 | Ga0496110_0702872 | 3300048913 | Bacteria | 912 |
| 894 | Ga0496110_0821511 | 3300048913 | Bacteria | 834 |
| 895 | Ga0496111_0003563 | 3300048914 | Bacteria | 9640 |
| 896 | Ga0496111_0106027 | 3300048914 | Bacteria | 2068 |
| 897 | Ga0496111_0147022 | 3300048914 | Bacteria | 1747 |
| 898 | Ga0496111_0173409 | 3300048914 | Bacteria | 1603 |
| 899 | Ga0496111_0239221 | 3300048914 | Bacteria | 1348 |
| 900 | Ga0496111_0281146 | 3300048914 | Bacteria | 1234 |
| 901 | Ga0496111_0569738 | 3300048914 | Bacteria | 830 |
| 902 | Ga0496111_0619677 | 3300048914 | Bacteria | 791 |
| 903 | Ga0496111_1057206 | 3300048914 | Bacteria | 580 |
| 904 | Ga0496112_0000293 | 3300048915 | Bacteria | 32490 |
| 905 | Ga0496112_0057563 | 3300048915 | Bacteria | 3827 |
| 906 | Ga0496112_0084664 | 3300048915 | Bacteria | 3136 |
| 907 | Ga0496112_0110816 | 3300048915 | Bacteria | 2715 |
| 908 | Ga0496112_0716029 | 3300048915 | Bacteria | 928 |
| 909 | Ga0496112_0783507 | 3300048915 | Unclassified | 879 |
| 910 | Ga0496113_0038683 | 3300048916 | Bacteria | 3508 |
| 911 | Ga0496113_0060774 | 3300048916 | Bacteria | 2849 |
| 912 | Ga0496114_0009129 | 3300048917 | Bacteria | 7861 |
| 913 | Ga0496114_0435951 | 3300048917 | Bacteria | 1161 |
| 914 | Ga0496114_0677253 | 3300048917 | Bacteria | 906 |
| 915 | Ga0496115_0015903 | 3300048918 | Bacteria | 5718 |
| 916 | Ga0496119_0032546 | 3300048922 | Viruses | 3473 |
| 917 | Ga0496119_0060935 | 3300048922 | Bacteria | 2256 |
| 918 | Ga0496119_0325163 | 3300048922 | Unclassified | 752 |
| 919 | Ga0496120_0086626 | 3300048923 | Bacteria | 1683 |
| 920 | Ga0496120_0403461 | 3300048923 | Bacteria | 603 |
| 921 | Ga0496124_0093327 | 3300048927 | Bacteria | 2450 |
| 922 | Ga0501306_015133 | 3300049127 | Bacteria | 1024 |
| 923 | Ga0501309_035323 | 3300049129 | Bacteria | 750 |
| 924 | Ga0501307_095072 | 3300049162 | Unclassified | 501 |
| 925 | Ga0501291_049642 | 3300049514 | Bacteria | 761 |
| 926 | Ga0501311_036375 | 3300049527 | Bacteria | 732 |
| 927 | Ga0501315_013620 | 3300049531 | Bacteria | 1021 |
| 928 | Ga0501316_021738 | 3300049532 | Bacteria | 813 |
| 929 | Ga0501317_013613 | 3300049533 | Bacteria | 1019 |
| 930 | Ga0501318_027131 | 3300049534 | Bacteria | 760 |
| 931 | Ga0501320_008286 | 3300049536 | Bacteria | 1019 |
| 932 | Ga0501321_026682 | 3300049537 | Bacteria | 751 |
| 933 | Ga0501323_012061 | 3300049539 | Bacteria | 1051 |
| 934 | Ga0501325_027564 | 3300049541 | Bacteria | 634 |
| 935 | Ga0501036_0086481 | 3300049572 | Bacteria | 2650 |
| 936 | Ga0501036_0247847 | 3300049572 | Bacteria | 1493 |
| 937 | Ga0501036_1655586 | 3300049572 | Bacteria | 516 |
| 938 | Ga0501037_0554984 | 3300049573 | Bacteria | 775 |
| 939 | Ga0501039_0061911 | 3300049575 | Bacteria | 2899 |
| 940 | Ga0501039_1273101 | 3300049575 | Bacteria | 568 |
| 941 | Ga0501040_0359911 | 3300049576 | Bacteria | 1043 |
| 942 | Ga0501042_0110441 | 3300049578 | Bacteria | 1980 |
| 943 | Ga0501047_0035747 | 3300049581 | Bacteria | 4799 |
| 944 | Ga0501047_0245491 | 3300049581 | Bacteria | 1640 |
| 945 | Ga0501048_0188785 | 3300049582 | Bacteria | 1460 |
| 946 | Ga0501048_0522952 | 3300049582 | Bacteria | 851 |
| 947 | Ga0501048_0811702 | 3300049582 | Unclassified | 672 |
| 948 | Ga0501067_0490032 | 3300049583 | Bacteria | 687 |
| 949 | Ga0501068_0225721 | 3300049584 | Bacteria | 1191 |
| 950 | Ga0501069_0230232 | 3300049585 | Bacteria | 1079 |
| 951 | Ga0501069_0238862 | 3300049585 | Bacteria | 1058 |
| 952 | Ga0501070_0072814 | 3300049586 | Bacteria | 2844 |
| 953 | Ga0501070_0819531 | 3300049586 | Bacteria | 730 |
| 954 | Ga0501071_0112827 | 3300049587 | Bacteria | 2010 |
| 955 | Ga0501071_0418170 | 3300049587 | Bacteria | 1024 |
| 956 | Ga0501071_0810121 | 3300049587 | Bacteria | 722 |
| 957 | Ga0501072_0252158 | 3300049588 | Bacteria | 1405 |
| 958 | Ga0501074_0024292 | 3300049590 | Bacteria | 4405 |
| 959 | Ga0501074_0654358 | 3300049590 | Unclassified | 742 |
| 960 | Ga0501075_0540490 | 3300049591 | Bacteria | 889 |
| 961 | Ga0501075_0542730 | 3300049591 | Bacteria | 887 |
| 962 | Ga0501075_0727464 | 3300049591 | Bacteria | 756 |
| 963 | Ga0501076_0080998 | 3300049592 | Bacteria | 2606 |
| 964 | Ga0501076_0187133 | 3300049592 | Bacteria | 1689 |
| 965 | Ga0501076_0434851 | 3300049592 | Bacteria | 1080 |
| 966 | Ga0501235_101987 | 3300049669 | Bacteria | 702 |
| 967 | Ga0501079_0081496 | 3300049741 | Bacteria | 2502 |
| 968 | Ga0501079_0404537 | 3300049741 | Bacteria | 1071 |
| 969 | Ga0501079_0934588 | 3300049741 | Unclassified | 683 |
| 970 | Ga0501080_0013630 | 3300049742 | Bacteria | 7485 |
| 971 | Ga0501080_0715963 | 3300049742 | Bacteria | 882 |
| 972 | Ga0501044_0524598 | 3300049823 | Bacteria | 1084 |
| 973 | Ga0501045_0257607 | 3300049824 | Bacteria | 1298 |
| 974 | nmdc:mga03n38_107406_c1 | 3300050490 | Bacteria | 1354 |
| 975 | nmdc:mga03n38_15679_c1 | 3300050490 | Bacteria | 2930 |
| 976 | nmdc:mga03n38_367325_c1 | 3300050490 | Unclassified | 786 |
| 977 | nmdc:mga00v17_28476_c1 | 3300050491 | Bacteria | 3272 |
| 978 | nmdc:mga00v17_39916_c1 | 3300050491 | Bacteria | 2813 |
| 979 | nmdc:mga0yw44_187225_c1 | 3300050492 | Bacteria | 1364 |
| 980 | nmdc:mga0yw44_21221_c1 | 3300050492 | Bacteria | 3619 |
| 981 | nmdc:mga0yw44_316918_c1 | 3300050492 | Bacteria | 1047 |
| 982 | nmdc:mga0yw44_327462_c1 | 3300050492 | Unclassified | 1029 |
| 983 | nmdc:mga0yw44_4200_c1 | 3300050492 | Bacteria | 6553 |
| 984 | nmdc:mga0yw44_77423_c1 | 3300050492 | Bacteria | 2077 |
| 985 | nmdc:mga0yw44_99293_c1 | 3300050492 | Bacteria | 1852 |
| 986 | nmdc:mga06z11_147302_c1 | 3300050494 | Bacteria | 1335 |
| 987 | nmdc:mga06z11_573058_c1 | 3300050494 | Bacteria | 686 |
| 988 | nmdc:mga04h51_55684_c1 | 3300050495 | Unclassified | 1340 |
| 989 | nmdc:mga05p37_1240364_c1 | 3300050507 | Bacteria | 766 |
| 990 | nmdc:mga05p37_135113_c1 | 3300050507 | Bacteria | 3025 |
| 991 | nmdc:mga05p37_1548414_c1 | 3300050507 | Viruses | 657 |
| 992 | nmdc:mga05p37_371224_c1 | 3300050507 | Bacteria | 1679 |
| 993 | nmdc:mga05p37_421060_c1 | 3300050507 | Bacteria | 1554 |
| 994 | nmdc:mga05p37_54356_c1 | 3300050507 | Bacteria | 4926 |
| 995 | nmdc:mga05p37_586484_c1 | 3300050507 | Bacteria | 1261 |
| 996 | nmdc:mga05p37_670336_c1 | 3300050507 | Bacteria | 1158 |
| 997 | nmdc:mga05p37_718193_c1 | 3300050507 | Bacteria | 1107 |
| 998 | nmdc:mga05p37_764306_c1 | 3300050507 | Bacteria | 1063 |
| 999 | nmdc:mga05p37_902306_c1 | 3300050507 | Bacteria | 953 |
| 1000 | nmdc:mga09592_270371_c1 | 3300050508 | Bacteria | 1474 |
| 1001 | nmdc:mga09592_52641_c1 | 3300050508 | Bacteria | 3436 |
| 1002 | nmdc:mga09592_529798_c1 | 3300050508 | Bacteria | 1013 |
| 1003 | nmdc:mga09592_612435_c1 | 3300050508 | Bacteria | 932 |
| 1004 | nmdc:mga0qj67_198569_c1 | 3300050509 | Bacteria | 1630 |
| 1005 | nmdc:mga0qj67_22421_c1 | 3300050509 | Bacteria | 4851 |
| 1006 | nmdc:mga0qj67_774068_c1 | 3300050509 | Bacteria | 761 |
| 1007 | nmdc:mga06r32_1055111_c1 | 3300050510 | Bacteria | 763 |
| 1008 | nmdc:mga06r32_110190_c1 | 3300050510 | Bacteria | 2708 |
| 1009 | nmdc:mga06r32_122626_c1 | 3300050510 | Bacteria | 2565 |
| 1010 | nmdc:mga06r32_1263448_c1 | 3300050510 | Bacteria | 683 |
| 1011 | nmdc:mga06r32_291772_c1 | 3300050510 | Bacteria | 1618 |
| 1012 | nmdc:mga06r32_413186_c1 | 3300050510 | Bacteria | 1331 |
| 1013 | nmdc:mga06r32_624925_c1 | 3300050510 | Bacteria | 1047 |
| 1014 | nmdc:mga08y16_1167048_c1 | 3300050511 | Bacteria | 742 |
| 1015 | nmdc:mga08y16_239741_c1 | 3300050511 | Bacteria | 1875 |
| 1016 | nmdc:mga08y16_280795_c1 | 3300050511 | Bacteria | 1718 |
| 1017 | nmdc:mga0n895_1169236_c1 | 3300050512 | Bacteria | 744 |
| 1018 | nmdc:mga0n895_189723_c1 | 3300050512 | Bacteria | 2086 |
| 1019 | nmdc:mga0n895_55336_c1 | 3300050512 | Bacteria | 3905 |
| 1020 | nmdc:mga0rr50_322551_c1 | 3300050513 | Bacteria | 1295 |
| 1021 | nmdc:mga0a205_20641_c1 | 3300050515 | Bacteria | 6221 |
| 1022 | nmdc:mga0a205_309526_c1 | 3300050515 | Bacteria | 1452 |
| 1023 | Ga0495601_0027950 | 3300053077 | Bacteria | 3490 |
| 1024 | Ga0495655_0004243 | 3300053083 | Bacteria | 2436 |
| 1025 | Ga0495655_0097632 | 3300053083 | Bacteria | 865 |
| 1026 | Ga0495619_0021730 | 3300053085 | Bacteria | 4099 |
| 1027 | Ga0495619_0030777 | 3300053085 | Bacteria | 3474 |
| 1028 | Ga0495619_0173023 | 3300053085 | Bacteria | 1493 |
| 1029 | Ga0495619_0175849 | 3300053085 | Bacteria | 1481 |
| 1030 | Ga0495619_0197205 | 3300053085 | Bacteria | 1394 |
| 1031 | Ga0501084_0053276 | 3300054114 | Bacteria | 3384 |
| 1032 | Ga0501084_0927535 | 3300054114 | Bacteria | 732 |
| 1033 | Ga0587111_0172385 | 3300060346 | Bacteria | 596 |
| 1034 | Ga0501082_0782012 | 3300060353 | Bacteria | 835 |
| 1035 | Ga0501082_0929047 | 3300060353 | Bacteria | 761 |
| 1036 | Ga0501082_0964359 | 3300060353 | Bacteria | 746 |
| 1037 | Ga0530510_0323169 | 3300061734 | Bacteria | 1157 |
| 1038 | Ga0530510_0521974 | 3300061734 | Unclassified | 901 |
| 1039 | Ga0530510_1078794 | 3300061734 | Unclassified | 615 |
| 1040 | Ga0530510_1369944 | 3300061734 | Unclassified | 543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_101510792 | Ga0070689_1015107921 | 110 |
| 2 | 3300005841 | Ga0068863_100365716 | Ga0068863_1003657162 | 112 |
| 3 | 3300007076 | Ga0075435_100612577 | Ga0075435_1006125772 | 112 |
| 4 | 3300013307 | Ga0157372_11174813 | Ga0157372_111748131 | 114 |
| 5 | 3300046462 | Ga0495651_0367023 | Ga0495651_0367023_391_864 | 114 |
| 6 | 3300046642 | Ga0495634_0000982 | Ga0495634_0000982_8160_8627 | 114 |
| 7 | 3300046679 | Ga0495623_0401325 | Ga0495623_0401325_199_678 | 114 |
| 8 | 3300005535 | Ga0070684_100059452 | Ga0070684_1000594523 | 115 |
| 9 | 3300005539 | Ga0068853_100009434 | Ga0068853_1000094347 | 115 |
| 10 | 3300005548 | Ga0070665_100000120 | Ga0070665_100000120111 | 115 |
| 11 | 3300005842 | Ga0068858_100000035 | Ga0068858_100000035109 | 115 |
| 12 | 3300009098 | Ga0105245_10001840 | Ga0105245_1000184018 | 115 |
| 13 | 3300013308 | Ga0157375_10463748 | Ga0157375_104637482 | 115 |
| 14 | 3300020078 | Ga0206352_10747119 | Ga0206352_107471191 | 115 |
| 15 | 3300025927 | Ga0207687_10000785 | Ga0207687_100007854 | 115 |
| 16 | 3300025944 | Ga0207661_10012321 | Ga0207661_100123214 | 115 |
| 17 | 3300026035 | Ga0207703_10009202 | Ga0207703_100092027 | 115 |
| 18 | 3300026041 | Ga0207639_10063847 | Ga0207639_100638472 | 115 |
| 19 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023471 | 115 |
| 20 | 3300028558 | Ga0265326_10037205 | Ga0265326_100372052 | 115 |
| 21 | 3300028800 | Ga0265338_10464430 | Ga0265338_104644302 | 115 |
| 22 | 3300046809 | Ga0495600_0417902 | Ga0495600_0417902_18_482 | 115 |
| 23 | 3300048913 | Ga0496110_0045483 | Ga0496110_0045483_2678_3139 | 115 |
| 24 | 3300048914 | Ga0496111_0281146 | Ga0496111_0281146_119_580 | 115 |
| 25 | 3300002239 | JGI24034J26672_10000335 | JGI24034J26672_100003357 | 116 |
| 26 | 3300002244 | JGI24742J22300_10013846 | JGI24742J22300_100138463 | 116 |
| 27 | 3300005441 | Ga0070700_100743171 | Ga0070700_1007431712 | 116 |
| 28 | 3300005577 | Ga0068857_101070401 | Ga0068857_1010704012 | 116 |
| 29 | 3300028800 | Ga0265338_10000008 | Ga0265338_1000000876 | 116 |
| 30 | 3300029957 | Ga0265324_10028426 | Ga0265324_100284263 | 116 |
| 31 | 3300031238 | Ga0265332_10102326 | Ga0265332_101023262 | 116 |
| 32 | 3300031249 | Ga0265339_10050790 | Ga0265339_100507902 | 116 |
| 33 | 3300031712 | Ga0265342_10052456 | Ga0265342_100524563 | 116 |
| 34 | 3300035692 | Ga0373935_0235002 | Ga0373935_0235002_235_711 | 117 |
| 35 | 3300042876 | Ga0451577_0339972 | Ga0451577_0339972_816_1286 | 117 |
| 36 | 3300048911 | Ga0496108_0000094 | Ga0496108_0000094_34009_34458 | 117 |
| 37 | 3300048912 | Ga0496109_0000024 | Ga0496109_0000024_136149_136598 | 117 |
| 38 | 3300014969 | Ga0157376_10257788 | Ga0157376_102577883 | 118 |
| 39 | 3300046529 | Ga0495652_0458499 | Ga0495652_0458499_88_552 | 118 |
| 40 | 3300046675 | Ga0495657_0248990 | Ga0495657_0248990_433_897 | 118 |
| 41 | 3300047471 | Ga0495684_0141756 | Ga0495684_0141756_383_859 | 118 |
| 42 | 3300053085 | Ga0495619_0197205 | Ga0495619_0197205_179_649 | 118 |
| 43 | 3300060346 | Ga0587111_0172385 | Ga0587111_0172385_34_471 | 118 |
| 44 | 3300014969 | Ga0157376_10704118 | Ga0157376_107041183 | 119 |
| 45 | 3300026078 | Ga0207702_10552570 | Ga0207702_105525703 | 119 |
| 46 | 3300045051 | Ga0451576_2231118 | Ga0451576_2231118_78_539 | 119 |
| 47 | 3300046462 | Ga0495651_0772084 | Ga0495651_0772084_73_534 | 119 |
| 48 | 3300046473 | Ga0495582_0016761 | Ga0495582_0016761_1820_2281 | 119 |
| 49 | 3300046476 | Ga0495662_0025426 | Ga0495662_0025426_18_479 | 119 |
| 50 | 3300046517 | Ga0495630_0000210 | Ga0495630_0000210_14099_14560 | 119 |
| 51 | 3300046526 | Ga0495666_0026986 | Ga0495666_0026986_1642_2103 | 119 |
| 52 | 3300046535 | Ga0495586_0000094 | Ga0495586_0000094_14099_14560 | 119 |
| 53 | 3300046642 | Ga0495634_0056022 | Ga0495634_0056022_868_1329 | 119 |
| 54 | 3300046678 | Ga0495599_0158452 | Ga0495599_0158452_710_1171 | 119 |
| 55 | 3300046681 | Ga0495647_0009441 | Ga0495647_0009441_2771_3232 | 119 |
| 56 | 3300047319 | Ga0495674_0002905 | Ga0495674_0002905_3043_3504 | 119 |
| 57 | 3300048089 | Ga0495614_0074722 | Ga0495614_0074722_90_551 | 119 |
| 58 | 3300053085 | Ga0495619_0175849 | Ga0495619_0175849_149_619 | 119 |
| 59 | 3300028577 | Ga0265318_10242422 | Ga0265318_102424222 | 120 |
| 60 | 3300029957 | Ga0265324_10005973 | Ga0265324_100059733 | 120 |
| 61 | 3300013102 | Ga0157371_10009783 | Ga0157371_100097838 | 121 |
| 62 | 3300028800 | Ga0265338_10746194 | Ga0265338_107461941 | 121 |
| 63 | 3300044694 | Ga0466963_0542154 | Ga0466963_0542154_294_731 | 121 |
| 64 | 3300044706 | Ga0466964_0353047 | Ga0466964_0353047_15_380 | 121 |
| 65 | 3300046462 | Ga0495651_0547882 | Ga0495651_0547882_126_596 | 121 |
| 66 | 3300046463 | Ga0495653_0296448 | Ga0495653_0296448_544_993 | 121 |
| 67 | 3300046517 | Ga0495630_0012186 | Ga0495630_0012186_929_1378 | 121 |
| 68 | 3300046533 | Ga0495640_0672865 | Ga0495640_0672865_67_516 | 121 |
| 69 | 3300046663 | Ga0495635_0031266 | Ga0495635_0031266_1820_2266 | 121 |
| 70 | 3300046690 | Ga0495624_0342181 | Ga0495624_0342181_357_806 | 121 |
| 71 | 3300047319 | Ga0495674_0168501 | Ga0495674_0168501_68_517 | 121 |
| 72 | 3300047471 | Ga0495684_0813084 | Ga0495684_0813084_118_567 | 121 |
| 73 | 3300053077 | Ga0495601_0027950 | Ga0495601_0027950_278_727 | 121 |
| 74 | 3300053085 | Ga0495619_0030777 | Ga0495619_0030777_766_1215 | 121 |
| 75 | 3300046454 | Ga0495592_0547305 | Ga0495592_0547305_226_678 | 122 |
| 76 | 3300046543 | Ga0495645_0007330 | Ga0495645_0007330_4547_4996 | 122 |
| 77 | 3300034817 | Ga0373948_0042954 | Ga0373948_0042954_402_851 | 123 |
| 78 | 3300034957 | Ga0373938_0050720 | Ga0373938_0050720_166_615 | 123 |
| 79 | 3300035241 | Ga0373961_0083554 | Ga0373961_0083554_363_812 | 123 |
| 80 | 3300046491 | Ga0495584_0482061 | Ga0495584_0482061_133_615 | 123 |
| 81 | 3300046500 | Ga0495596_0082383 | Ga0495596_0082383_31_513 | 123 |
| 82 | 3300049541 | Ga0501325_027564 | Ga0501325_027564_225_602 | 123 |
| 83 | 3300041443 | Ga0451789_1169276 | Ga0451789_1169276_53_472 | 125 |
| 84 | 3300009177 | Ga0105248_11066971 | Ga0105248_110669712 | 126 |
| 85 | 3300014968 | Ga0157379_10939036 | Ga0157379_109390362 | 126 |
| 86 | 3300025941 | Ga0207711_10673000 | Ga0207711_106730002 | 126 |
| 87 | 3300045051 | Ga0451576_0577870 | Ga0451576_0577870_555_1019 | 126 |
| 88 | 3300045976 | Ga0466967_0031626 | Ga0466967_0031626_3990_4433 | 126 |
| 89 | 3300049592 | Ga0501076_0080998 | Ga0501076_0080998_1030_1518 | 127 |
| 90 | 3300010375 | Ga0105239_12024073 | Ga0105239_120240731 | 129 |
| 91 | 3300020069 | Ga0197907_11459340 | Ga0197907_114593401 | 129 |
| 92 | 3300045051 | Ga0451576_0403540 | Ga0451576_0403540_615_1091 | 129 |
| 93 | 3300053083 | Ga0495655_0097632 | Ga0495655_0097632_25_453 | 130 |
| 94 | 3300032126 | Ga0307415_100003452 | Ga0307415_1000034528 | 131 |
| 95 | 3300041512 | Ga0451853_0887436 | Ga0451853_0887436_151_585 | 131 |
| 96 | 3300045976 | Ga0466967_1467449 | Ga0466967_1467449_116_577 | 131 |
| 97 | 3300046642 | Ga0495634_0005363 | Ga0495634_0005363_6350_6823 | 131 |
| 98 | 3300046681 | Ga0495647_0209234 | Ga0495647_0209234_307_774 | 131 |
| 99 | 3300046689 | Ga0495613_0000003 | Ga0495613_0000003_59751_60188 | 131 |
| 100 | 3300005330 | Ga0070690_101239554 | Ga0070690_1012395541 | 132 |
| 101 | 3300005544 | Ga0070686_100034256 | Ga0070686_1000342565 | 132 |
| 102 | 3300022467 | Ga0224712_10354617 | Ga0224712_103546171 | 132 |
| 103 | 3300041443 | Ga0451789_0914259 | Ga0451789_0914259_193_648 | 132 |
| 104 | 3300046476 | Ga0495662_0000027 | Ga0495662_0000027_19133_19570 | 132 |
| 105 | 3300048088 | Ga0495602_0606089 | Ga0495602_0606089_125_592 | 132 |
| 106 | 3300049585 | Ga0501069_0238862 | Ga0501069_0238862_74_556 | 132 |
| 107 | 3300002075 | JGI24738J21930_10003699 | JGI24738J21930_100036996 | 133 |
| 108 | 3300002077 | JGI24744J21845_10048405 | JGI24744J21845_100484052 | 133 |
| 109 | 3300005327 | Ga0070658_10020698 | Ga0070658_100206984 | 133 |
| 110 | 3300005329 | Ga0070683_100197337 | Ga0070683_1001973371 | 133 |
| 111 | 3300005331 | Ga0070670_100224949 | Ga0070670_1002249494 | 133 |
| 112 | 3300005334 | Ga0068869_100101392 | Ga0068869_1001013924 | 133 |
| 113 | 3300005336 | Ga0070680_100417420 | Ga0070680_1004174202 | 133 |
| 114 | 3300005338 | Ga0068868_100184292 | Ga0068868_1001842922 | 133 |
| 115 | 3300005339 | Ga0070660_100008259 | Ga0070660_1000082594 | 133 |
| 116 | 3300005341 | Ga0070691_10134445 | Ga0070691_101344452 | 133 |
| 117 | 3300005344 | Ga0070661_100032298 | Ga0070661_1000322986 | 133 |
| 118 | 3300005345 | Ga0070692_10003022 | Ga0070692_100030226 | 133 |
| 119 | 3300005356 | Ga0070674_100021607 | Ga0070674_1000216075 | 133 |
| 120 | 3300005366 | Ga0070659_100041578 | Ga0070659_1000415785 | 133 |
| 121 | 3300005434 | Ga0070709_10601253 | Ga0070709_106012532 | 133 |
| 122 | 3300005438 | Ga0070701_10078083 | Ga0070701_100780833 | 133 |
| 123 | 3300005441 | Ga0070700_100180501 | Ga0070700_1001805011 | 133 |
| 124 | 3300005456 | Ga0070678_100011039 | Ga0070678_1000110395 | 133 |
| 125 | 3300005530 | Ga0070679_101414840 | Ga0070679_1014148402 | 133 |
| 126 | 3300005535 | Ga0070684_100031436 | Ga0070684_1000314364 | 133 |
| 127 | 3300005543 | Ga0070672_100003359 | Ga0070672_10000335910 | 133 |
| 128 | 3300005544 | Ga0070686_100016247 | Ga0070686_1000162474 | 133 |
| 129 | 3300005547 | Ga0070693_100180463 | Ga0070693_1001804633 | 133 |
| 130 | 3300005578 | Ga0068854_100007097 | Ga0068854_1000070977 | 133 |
| 131 | 3300005614 | Ga0068856_100081262 | Ga0068856_1000812623 | 133 |
| 132 | 3300005615 | Ga0070702_100185633 | Ga0070702_1001856333 | 133 |
| 133 | 3300005618 | Ga0068864_102696228 | Ga0068864_1026962281 | 133 |
| 134 | 3300005718 | Ga0068866_10262706 | Ga0068866_102627062 | 133 |
| 135 | 3300005719 | Ga0068861_100529750 | Ga0068861_1005297502 | 133 |
| 136 | 3300005834 | Ga0068851_10346341 | Ga0068851_103463411 | 133 |
| 137 | 3300005842 | Ga0068858_100879357 | Ga0068858_1008793572 | 133 |
| 138 | 3300005843 | Ga0068860_100631960 | Ga0068860_1006319602 | 133 |
| 139 | 3300006237 | Ga0097621_100426881 | Ga0097621_1004268812 | 133 |
| 140 | 3300006358 | Ga0068871_100109772 | Ga0068871_1001097724 | 133 |
| 141 | 3300006881 | Ga0068865_100000020 | Ga0068865_10000002066 | 133 |
| 142 | 3300006881 | Ga0068865_100187254 | Ga0068865_1001872542 | 133 |
| 143 | 3300009148 | Ga0105243_10137177 | Ga0105243_101371773 | 133 |
| 144 | 3300009174 | Ga0105241_10175191 | Ga0105241_101751912 | 133 |
| 145 | 3300009176 | Ga0105242_10081328 | Ga0105242_100813282 | 133 |
| 146 | 3300009545 | Ga0105237_10284469 | Ga0105237_102844693 | 133 |
| 147 | 3300009551 | Ga0105238_10071517 | Ga0105238_100715172 | 133 |
| 148 | 3300013306 | Ga0163162_11039566 | Ga0163162_110395662 | 133 |
| 149 | 3300013307 | Ga0157372_10181647 | Ga0157372_101816475 | 133 |
| 150 | 3300013308 | Ga0157375_10103896 | Ga0157375_101038965 | 133 |
| 151 | 3300014745 | Ga0157377_10049399 | Ga0157377_100493995 | 133 |
| 152 | 3300020078 | Ga0206352_10008056 | Ga0206352_100080562 | 133 |
| 153 | 3300025321 | Ga0207656_10029861 | Ga0207656_100298614 | 133 |
| 154 | 3300025901 | Ga0207688_10025229 | Ga0207688_100252293 | 133 |
| 155 | 3300025919 | Ga0207657_10021929 | Ga0207657_100219295 | 133 |
| 156 | 3300025920 | Ga0207649_10031433 | Ga0207649_100314335 | 133 |
| 157 | 3300025933 | Ga0207706_10010365 | Ga0207706_100103657 | 133 |
| 158 | 3300025934 | Ga0207686_10119805 | Ga0207686_101198053 | 133 |
| 159 | 3300025937 | Ga0207669_10102192 | Ga0207669_101021922 | 133 |
| 160 | 3300025938 | Ga0207704_10000004 | Ga0207704_10000004127 | 133 |
| 161 | 3300025940 | Ga0207691_10031948 | Ga0207691_100319485 | 133 |
| 162 | 3300025942 | Ga0207689_10069762 | Ga0207689_100697624 | 133 |
| 163 | 3300025949 | Ga0207667_10517346 | Ga0207667_105173463 | 133 |
| 164 | 3300025960 | Ga0207651_10020522 | Ga0207651_100205222 | 133 |
| 165 | 3300025981 | Ga0207640_10058367 | Ga0207640_100583674 | 133 |
| 166 | 3300026023 | Ga0207677_10101037 | Ga0207677_101010373 | 133 |
| 167 | 3300026035 | Ga0207703_11330224 | Ga0207703_113302242 | 133 |
| 168 | 3300026041 | Ga0207639_10179766 | Ga0207639_101797664 | 133 |
| 169 | 3300026075 | Ga0207708_10129580 | Ga0207708_101295803 | 133 |
| 170 | 3300026118 | Ga0207675_100039448 | Ga0207675_1000394484 | 133 |
| 171 | 3300026121 | Ga0207683_10089021 | Ga0207683_100890212 | 133 |
| 172 | 3300028381 | Ga0268264_10559911 | Ga0268264_105599112 | 133 |
| 173 | 3300048904 | Ga0496101_0156775 | Ga0496101_0156775_169_606 | 133 |
| 174 | 3300048908 | Ga0496105_0088368 | Ga0496105_0088368_2059_2496 | 133 |
| 175 | 3300048912 | Ga0496109_0380012 | Ga0496109_0380012_699_1136 | 133 |
| 176 | 3300048917 | Ga0496114_0435951 | Ga0496114_0435951_593_1030 | 133 |
| 177 | 3300005336 | Ga0070680_101561444 | Ga0070680_1015614441 | 134 |
| 178 | 3300005354 | Ga0070675_100167077 | Ga0070675_1001670774 | 134 |
| 179 | 3300005364 | Ga0070673_100043613 | Ga0070673_1000436134 | 134 |
| 180 | 3300005444 | Ga0070694_100297455 | Ga0070694_1002974553 | 134 |
| 181 | 3300005455 | Ga0070663_100020403 | Ga0070663_1000204033 | 134 |
| 182 | 3300005457 | Ga0070662_100067437 | Ga0070662_1000674373 | 134 |
| 183 | 3300005458 | Ga0070681_10365242 | Ga0070681_103652422 | 134 |
| 184 | 3300005530 | Ga0070679_100131322 | Ga0070679_1001313224 | 134 |
| 185 | 3300005564 | Ga0070664_100181493 | Ga0070664_1001814933 | 134 |
| 186 | 3300005614 | Ga0068856_100752202 | Ga0068856_1007522022 | 134 |
| 187 | 3300005616 | Ga0068852_100177395 | Ga0068852_1001773954 | 134 |
| 188 | 3300005617 | Ga0068859_100448446 | Ga0068859_1004484462 | 134 |
| 189 | 3300006931 | Ga0097620_100448429 | Ga0097620_1004484292 | 134 |
| 190 | 3300009093 | Ga0105240_10578730 | Ga0105240_105787301 | 134 |
| 191 | 3300009098 | Ga0105245_12403182 | Ga0105245_124031821 | 134 |
| 192 | 3300009176 | Ga0105242_10001012 | Ga0105242_1000101222 | 134 |
| 193 | 3300009551 | Ga0105238_10802758 | Ga0105238_108027583 | 134 |
| 194 | 3300010375 | Ga0105239_10045921 | Ga0105239_100459213 | 134 |
| 195 | 3300013102 | Ga0157371_10048015 | Ga0157371_100480155 | 134 |
| 196 | 3300013104 | Ga0157370_10752564 | Ga0157370_107525642 | 134 |
| 197 | 3300013104 | Ga0157370_10835440 | Ga0157370_108354402 | 134 |
| 198 | 3300013104 | Ga0157370_11272535 | Ga0157370_112725351 | 134 |
| 199 | 3300013296 | Ga0157374_10427883 | Ga0157374_104278832 | 134 |
| 200 | 3300013297 | Ga0157378_10012400 | Ga0157378_100124007 | 134 |
| 201 | 3300020080 | Ga0206350_10585354 | Ga0206350_105853541 | 134 |
| 202 | 3300020081 | Ga0206354_10885409 | Ga0206354_108854091 | 134 |
| 203 | 3300025904 | Ga0207647_10741282 | Ga0207647_107412822 | 134 |
| 204 | 3300025907 | Ga0207645_10129392 | Ga0207645_101293923 | 134 |
| 205 | 3300025909 | Ga0207705_10028083 | Ga0207705_100280834 | 134 |
| 206 | 3300025926 | Ga0207659_10033094 | Ga0207659_100330945 | 134 |
| 207 | 3300025927 | Ga0207687_10149363 | Ga0207687_101493633 | 134 |
| 208 | 3300025934 | Ga0207686_10000414 | Ga0207686_1000041410 | 134 |
| 209 | 3300025935 | Ga0207709_10045121 | Ga0207709_100451213 | 134 |
| 210 | 3300025945 | Ga0207679_10924592 | Ga0207679_109245922 | 134 |
| 211 | 3300026067 | Ga0207678_10043907 | Ga0207678_100439075 | 134 |
| 212 | 3300026089 | Ga0207648_10045428 | Ga0207648_100454284 | 134 |
| 213 | 3300028800 | Ga0265338_10001643 | Ga0265338_1000164319 | 134 |
| 214 | 3300035113 | Ga0373936_0115057 | Ga0373936_0115057_485_925 | 134 |
| 215 | 3300046461 | Ga0495641_0027210 | Ga0495641_0027210_1389_1862 | 134 |
| 216 | 3300046517 | Ga0495630_0000037 | Ga0495630_0000037_47993_48466 | 134 |
| 217 | 3300046681 | Ga0495647_0003378 | Ga0495647_0003378_2581_3054 | 134 |
| 218 | 3300048911 | Ga0496108_0325096 | Ga0496108_0325096_248_682 | 134 |
| 219 | 3300005458 | Ga0070681_11366302 | Ga0070681_113663021 | 135 |
| 220 | 3300031548 | Ga0307408_100089797 | Ga0307408_1000897973 | 135 |
| 221 | 3300031731 | Ga0307405_10124261 | Ga0307405_101242612 | 135 |
| 222 | 3300031824 | Ga0307413_10039268 | Ga0307413_100392684 | 135 |
| 223 | 3300031852 | Ga0307410_10027546 | Ga0307410_100275464 | 135 |
| 224 | 3300031901 | Ga0307406_10052099 | Ga0307406_100520993 | 135 |
| 225 | 3300031903 | Ga0307407_10041577 | Ga0307407_100415773 | 135 |
| 226 | 3300031911 | Ga0307412_10064994 | Ga0307412_100649943 | 135 |
| 227 | 3300031995 | Ga0307409_100119344 | Ga0307409_1001193443 | 135 |
| 228 | 3300032002 | Ga0307416_100306160 | Ga0307416_1003061602 | 135 |
| 229 | 3300032004 | Ga0307414_10148518 | Ga0307414_101485182 | 135 |
| 230 | 3300032005 | Ga0307411_10033789 | Ga0307411_100337894 | 135 |
| 231 | 3300032126 | Ga0307415_100016693 | Ga0307415_1000166933 | 135 |
| 232 | 3300041505 | Ga0451849_0048515 | Ga0451849_0048515_250_699 | 135 |
| 233 | 3300049127 | Ga0501306_015133 | Ga0501306_015133_259_705 | 135 |
| 234 | 3300049129 | Ga0501309_035323 | Ga0501309_035323_247_693 | 135 |
| 235 | 3300049527 | Ga0501311_036375 | Ga0501311_036375_38_484 | 135 |
| 236 | 3300049531 | Ga0501315_013620 | Ga0501315_013620_480_926 | 135 |
| 237 | 3300049532 | Ga0501316_021738 | Ga0501316_021738_238_684 | 135 |
| 238 | 3300049533 | Ga0501317_013613 | Ga0501317_013613_328_774 | 135 |
| 239 | 3300049534 | Ga0501318_027131 | Ga0501318_027131_256_702 | 135 |
| 240 | 3300049536 | Ga0501320_008286 | Ga0501320_008286_478_924 | 135 |
| 241 | 3300049537 | Ga0501321_026682 | Ga0501321_026682_246_692 | 135 |
| 242 | 3300049539 | Ga0501323_012061 | Ga0501323_012061_477_923 | 135 |
| 243 | 3300049669 | Ga0501235_101987 | Ga0501235_101987_236_682 | 135 |
| 244 | 3300049741 | Ga0501079_0934588 | Ga0501079_0934588_27_497 | 135 |
| 245 | 3300049823 | Ga0501044_0524598 | Ga0501044_0524598_40_525 | 135 |
| 246 | 3300005330 | Ga0070690_101148090 | Ga0070690_1011480901 | 136 |
| 247 | 3300005338 | Ga0068868_100000741 | Ga0068868_10000074113 | 136 |
| 248 | 3300005614 | Ga0068856_100548895 | Ga0068856_1005488952 | 136 |
| 249 | 3300025944 | Ga0207661_10107371 | Ga0207661_101073714 | 136 |
| 250 | 3300026023 | Ga0207677_10000465 | Ga0207677_1000046510 | 136 |
| 251 | 3300026078 | Ga0207702_10597620 | Ga0207702_105976201 | 136 |
| 252 | 3300044694 | Ga0466963_0299612 | Ga0466963_0299612_123_590 | 136 |
| 253 | 3300045976 | Ga0466967_0685363 | Ga0466967_0685363_192_659 | 136 |
| 254 | 3300046533 | Ga0495640_0049122 | Ga0495640_0049122_105_557 | 136 |
| 255 | 3300047319 | Ga0495674_0000108 | Ga0495674_0000108_9821_10273 | 136 |
| 256 | 3300048911 | Ga0496108_0505941 | Ga0496108_0505941_555_1034 | 136 |
| 257 | 3300048912 | Ga0496109_0292013 | Ga0496109_0292013_758_1237 | 136 |
| 258 | 3300048913 | Ga0496110_0060815 | Ga0496110_0060815_1679_2158 | 136 |
| 259 | 3300048914 | Ga0496111_0003563 | Ga0496111_0003563_3530_4009 | 136 |
| 260 | 3300048915 | Ga0496112_0110816 | Ga0496112_0110816_1410_1889 | 136 |
| 261 | 3300048922 | Ga0496119_0060935 | Ga0496119_0060935_933_1364 | 136 |
| 262 | 3300004799 | Ga0058863_11900107 | Ga0058863_119001072 | 137 |
| 263 | 3300005347 | Ga0070668_100031904 | Ga0070668_1000319042 | 137 |
| 264 | 3300005356 | Ga0070674_100002696 | Ga0070674_1000026963 | 137 |
| 265 | 3300005441 | Ga0070700_100000580 | Ga0070700_10000058024 | 137 |
| 266 | 3300005459 | Ga0068867_100053792 | Ga0068867_1000537924 | 137 |
| 267 | 3300005937 | Ga0081455_10735714 | Ga0081455_107357141 | 137 |
| 268 | 3300009148 | Ga0105243_10036575 | Ga0105243_100365754 | 137 |
| 269 | 3300020069 | Ga0197907_10277474 | Ga0197907_102774742 | 137 |
| 270 | 3300020069 | Ga0197907_10800161 | Ga0197907_108001611 | 137 |
| 271 | 3300020075 | Ga0206349_1257685 | Ga0206349_12576852 | 137 |
| 272 | 3300020078 | Ga0206352_10433741 | Ga0206352_104337412 | 137 |
| 273 | 3300020081 | Ga0206354_10989501 | Ga0206354_109895013 | 137 |
| 274 | 3300020081 | Ga0206354_11028322 | Ga0206354_110283222 | 137 |
| 275 | 3300022467 | Ga0224712_10014346 | Ga0224712_100143462 | 137 |
| 276 | 3300022467 | Ga0224712_10402934 | Ga0224712_104029341 | 137 |
| 277 | 3300025893 | Ga0207682_10062188 | Ga0207682_100621882 | 137 |
| 278 | 3300025935 | Ga0207709_10168827 | Ga0207709_101688273 | 137 |
| 279 | 3300025937 | Ga0207669_10014900 | Ga0207669_100149005 | 137 |
| 280 | 3300025944 | Ga0207661_10242778 | Ga0207661_102427782 | 137 |
| 281 | 3300025972 | Ga0207668_10017540 | Ga0207668_100175406 | 137 |
| 282 | 3300026075 | Ga0207708_10004693 | Ga0207708_100046937 | 137 |
| 283 | 3300026089 | Ga0207648_10074950 | Ga0207648_100749504 | 137 |
| 284 | 3300031727 | Ga0316576_10542298 | Ga0316576_105422981 | 137 |
| 285 | 3300032126 | Ga0307415_100696522 | Ga0307415_1006965221 | 137 |
| 286 | 3300037312 | Ga0395899_0139547 | Ga0395899_0139547_96_527 | 137 |
| 287 | 3300037418 | Ga0395900_0089562 | Ga0395900_0089562_684_1115 | 137 |
| 288 | 3300037418 | Ga0395900_0767161 | Ga0395900_0767161_264_692 | 137 |
| 289 | 3300037466 | Ga0395898_0005527 | Ga0395898_0005527_5408_5839 | 137 |
| 290 | 3300037471 | Ga0395905_0027496 | Ga0395905_0027496_2642_3073 | 137 |
| 291 | 3300038443 | Ga0395901_0022139 | Ga0395901_0022139_3913_4344 | 137 |
| 292 | 3300044658 | Ga0466972_0583853 | Ga0466972_0583853_22_480 | 137 |
| 293 | 3300048909 | Ga0496106_0217385 | Ga0496106_0217385_655_1089 | 137 |
| 294 | 3300048915 | Ga0496112_0000293 | Ga0496112_0000293_29357_29791 | 137 |
| 295 | 3300048915 | Ga0496112_0783507 | Ga0496112_0783507_345_779 | 137 |
| 296 | 3300049581 | Ga0501047_0035747 | Ga0501047_0035747_2002_2487 | 137 |
| 297 | 3300049582 | Ga0501048_0811702 | Ga0501048_0811702_59_544 | 137 |
| 298 | 3300049586 | Ga0501070_0072814 | Ga0501070_0072814_1227_1712 | 137 |
| 299 | 3300053085 | Ga0495619_0021730 | Ga0495619_0021730_737_1177 | 137 |
| 300 | 3300005329 | Ga0070683_100381673 | Ga0070683_1003816733 | 138 |
| 301 | 3300005334 | Ga0068869_101337302 | Ga0068869_1013373021 | 138 |
| 302 | 3300005366 | Ga0070659_100596607 | Ga0070659_1005966072 | 138 |
| 303 | 3300005435 | Ga0070714_101362587 | Ga0070714_1013625871 | 138 |
| 304 | 3300005439 | Ga0070711_100220871 | Ga0070711_1002208713 | 138 |
| 305 | 3300005459 | Ga0068867_100000766 | Ga0068867_10000076612 | 138 |
| 306 | 3300005468 | Ga0070707_100858866 | Ga0070707_1008588662 | 138 |
| 307 | 3300005618 | Ga0068864_100665506 | Ga0068864_1006655062 | 138 |
| 308 | 3300005981 | Ga0081538_10079429 | Ga0081538_100794292 | 138 |
| 309 | 3300005985 | Ga0081539_10017263 | Ga0081539_100172631 | 138 |
| 310 | 3300006038 | Ga0075365_10179505 | Ga0075365_101795052 | 138 |
| 311 | 3300006048 | Ga0075363_100198398 | Ga0075363_1001983982 | 138 |
| 312 | 3300006852 | Ga0075433_10288372 | Ga0075433_102883723 | 138 |
| 313 | 3300006871 | Ga0075434_100262629 | Ga0075434_1002626293 | 138 |
| 314 | 3300007076 | Ga0075435_100068856 | Ga0075435_1000688563 | 138 |
| 315 | 3300009098 | Ga0105245_11890960 | Ga0105245_118909602 | 138 |
| 316 | 3300009147 | Ga0114129_12321721 | Ga0114129_123217212 | 138 |
| 317 | 3300010375 | Ga0105239_12111880 | Ga0105239_121118801 | 138 |
| 318 | 3300014325 | Ga0163163_10951663 | Ga0163163_109516631 | 138 |
| 319 | 3300014325 | Ga0163163_11152471 | Ga0163163_111524712 | 138 |
| 320 | 3300014326 | Ga0157380_10414883 | Ga0157380_104148831 | 138 |
| 321 | 3300014497 | Ga0182008_10028739 | Ga0182008_100287394 | 138 |
| 322 | 3300025927 | Ga0207687_10752592 | Ga0207687_107525922 | 138 |
| 323 | 3300025928 | Ga0207700_11580532 | Ga0207700_115805321 | 138 |
| 324 | 3300025932 | Ga0207690_10299541 | Ga0207690_102995412 | 138 |
| 325 | 3300025944 | Ga0207661_10419653 | Ga0207661_104196531 | 138 |
| 326 | 3300026095 | Ga0207676_10624897 | Ga0207676_106248972 | 138 |
| 327 | 3300029957 | Ga0265324_10036423 | Ga0265324_100364234 | 138 |
| 328 | 3300031240 | Ga0265320_10000666 | Ga0265320_1000066615 | 138 |
| 329 | 3300031249 | Ga0265339_10084756 | Ga0265339_100847562 | 138 |
| 330 | 3300031901 | Ga0307406_11799910 | Ga0307406_117999101 | 138 |
| 331 | 3300044694 | Ga0466963_0018752 | Ga0466963_0018752_1631_2065 | 138 |
| 332 | 3300045976 | Ga0466967_0304393 | Ga0466967_0304393_732_1196 | 138 |
| 333 | 3300045976 | Ga0466967_0502194 | Ga0466967_0502194_438_875 | 138 |
| 334 | 3300046674 | Ga0495588_0386407 | Ga0495588_0386407_208_678 | 138 |
| 335 | 3300048911 | Ga0496108_0059784 | Ga0496108_0059784_2511_2972 | 138 |
| 336 | 3300048912 | Ga0496109_0013442 | Ga0496109_0013442_2481_2942 | 138 |
| 337 | 3300048913 | Ga0496110_0702872 | Ga0496110_0702872_194_655 | 138 |
| 338 | 3300048914 | Ga0496111_0147022 | Ga0496111_0147022_207_668 | 138 |
| 339 | 3300048915 | Ga0496112_0716029 | Ga0496112_0716029_269_730 | 138 |
| 340 | 3300048916 | Ga0496113_0038683 | Ga0496113_0038683_2379_2840 | 138 |
| 341 | 3300050490 | nmdc:mga03n38_107406_c1 | nmdc:mga03n38_107406_c1_149_619 | 138 |
| 342 | 3300050492 | nmdc:mga0yw44_187225_c1 | nmdc:mga0yw44_187225_c1_416_886 | 138 |
| 343 | 3300050515 | nmdc:mga0a205_309526_c1 | nmdc:mga0a205_309526_c1_741_1172 | 138 |
| 344 | 3300061734 | Ga0530510_0521974 | Ga0530510_0521974_106_540 | 138 |
| 345 | 3300005327 | Ga0070658_10136115 | Ga0070658_101361154 | 139 |
| 346 | 3300005329 | Ga0070683_100023952 | Ga0070683_1000239526 | 139 |
| 347 | 3300005338 | Ga0068868_100017477 | Ga0068868_1000174773 | 139 |
| 348 | 3300005339 | Ga0070660_100003054 | Ga0070660_1000030548 | 139 |
| 349 | 3300005341 | Ga0070691_10301873 | Ga0070691_103018731 | 139 |
| 350 | 3300005343 | Ga0070687_100348615 | Ga0070687_1003486152 | 139 |
| 351 | 3300005344 | Ga0070661_100031733 | Ga0070661_1000317332 | 139 |
| 352 | 3300005345 | Ga0070692_10014157 | Ga0070692_100141573 | 139 |
| 353 | 3300005354 | Ga0070675_100007308 | Ga0070675_1000073085 | 139 |
| 354 | 3300005354 | Ga0070675_101433240 | Ga0070675_1014332401 | 139 |
| 355 | 3300005356 | Ga0070674_100054232 | Ga0070674_1000542324 | 139 |
| 356 | 3300005365 | Ga0070688_100101347 | Ga0070688_1001013474 | 139 |
| 357 | 3300005366 | Ga0070659_100002893 | Ga0070659_1000028936 | 139 |
| 358 | 3300005367 | Ga0070667_100102662 | Ga0070667_1001026622 | 139 |
| 359 | 3300005438 | Ga0070701_10103693 | Ga0070701_101036933 | 139 |
| 360 | 3300005441 | Ga0070700_100061460 | Ga0070700_1000614603 | 139 |
| 361 | 3300005444 | Ga0070694_100087803 | Ga0070694_1000878033 | 139 |
| 362 | 3300005455 | Ga0070663_100076662 | Ga0070663_1000766623 | 139 |
| 363 | 3300005457 | Ga0070662_100025726 | Ga0070662_1000257265 | 139 |
| 364 | 3300005459 | Ga0068867_100205899 | Ga0068867_1002058993 | 139 |
| 365 | 3300005466 | Ga0070685_10007278 | Ga0070685_100072781 | 139 |
| 366 | 3300005535 | Ga0070684_100074737 | Ga0070684_1000747374 | 139 |
| 367 | 3300005539 | Ga0068853_100027027 | Ga0068853_1000270276 | 139 |
| 368 | 3300005544 | Ga0070686_100003109 | Ga0070686_1000031098 | 139 |
| 369 | 3300005547 | Ga0070693_100018587 | Ga0070693_1000185875 | 139 |
| 370 | 3300005548 | Ga0070665_100025513 | Ga0070665_1000255135 | 139 |
| 371 | 3300005548 | Ga0070665_100130912 | Ga0070665_1001309123 | 139 |
| 372 | 3300005564 | Ga0070664_100055063 | Ga0070664_1000550632 | 139 |
| 373 | 3300005578 | Ga0068854_100196899 | Ga0068854_1001968993 | 139 |
| 374 | 3300005614 | Ga0068856_100214288 | Ga0068856_1002142882 | 139 |
| 375 | 3300005615 | Ga0070702_100333122 | Ga0070702_1003331222 | 139 |
| 376 | 3300005616 | Ga0068852_100230790 | Ga0068852_1002307904 | 139 |
| 377 | 3300005718 | Ga0068866_10015734 | Ga0068866_100157344 | 139 |
| 378 | 3300005834 | Ga0068851_10034140 | Ga0068851_100341403 | 139 |
| 379 | 3300005842 | Ga0068858_100262168 | Ga0068858_1002621682 | 139 |
| 380 | 3300005937 | Ga0081455_10062003 | Ga0081455_100620033 | 139 |
| 381 | 3300006038 | Ga0075365_10040006 | Ga0075365_100400064 | 139 |
| 382 | 3300006048 | Ga0075363_100015254 | Ga0075363_1000152542 | 139 |
| 383 | 3300006051 | Ga0075364_10030019 | Ga0075364_100300195 | 139 |
| 384 | 3300006847 | Ga0075431_100146364 | Ga0075431_1001463644 | 139 |
| 385 | 3300006852 | Ga0075433_10087408 | Ga0075433_100874084 | 139 |
| 386 | 3300006881 | Ga0068865_100015601 | Ga0068865_1000156013 | 139 |
| 387 | 3300009094 | Ga0111539_10109537 | Ga0111539_101095374 | 139 |
| 388 | 3300009094 | Ga0111539_10757200 | Ga0111539_107572002 | 139 |
| 389 | 3300009098 | Ga0105245_10000159 | Ga0105245_100001592 | 139 |
| 390 | 3300009098 | Ga0105245_10004565 | Ga0105245_100045654 | 139 |
| 391 | 3300009148 | Ga0105243_10030929 | Ga0105243_100309293 | 139 |
| 392 | 3300009553 | Ga0105249_10221528 | Ga0105249_102215284 | 139 |
| 393 | 3300013102 | Ga0157371_10711406 | Ga0157371_107114061 | 139 |
| 394 | 3300013307 | Ga0157372_10061286 | Ga0157372_100612864 | 139 |
| 395 | 3300014325 | Ga0163163_10786208 | Ga0163163_107862081 | 139 |
| 396 | 3300014497 | Ga0182008_10365841 | Ga0182008_103658413 | 139 |
| 397 | 3300014745 | Ga0157377_10101152 | Ga0157377_101011522 | 139 |
| 398 | 3300025321 | Ga0207656_10016418 | Ga0207656_100164183 | 139 |
| 399 | 3300025899 | Ga0207642_10028406 | Ga0207642_100284062 | 139 |
| 400 | 3300025904 | Ga0207647_10100983 | Ga0207647_101009832 | 139 |
| 401 | 3300025907 | Ga0207645_10288660 | Ga0207645_102886602 | 139 |
| 402 | 3300025909 | Ga0207705_10023067 | Ga0207705_100230673 | 139 |
| 403 | 3300025919 | Ga0207657_10008958 | Ga0207657_1000895811 | 139 |
| 404 | 3300025920 | Ga0207649_10058099 | Ga0207649_100580994 | 139 |
| 405 | 3300025921 | Ga0207652_10436960 | Ga0207652_104369602 | 139 |
| 406 | 3300025926 | Ga0207659_10578606 | Ga0207659_105786062 | 139 |
| 407 | 3300025926 | Ga0207659_11542013 | Ga0207659_115420131 | 139 |
| 408 | 3300025927 | Ga0207687_10041108 | Ga0207687_100411083 | 139 |
| 409 | 3300025932 | Ga0207690_10034867 | Ga0207690_100348671 | 139 |
| 410 | 3300025933 | Ga0207706_10004968 | Ga0207706_100049689 | 139 |
| 411 | 3300025935 | Ga0207709_10030922 | Ga0207709_100309224 | 139 |
| 412 | 3300025937 | Ga0207669_10367904 | Ga0207669_103679042 | 139 |
| 413 | 3300025938 | Ga0207704_10057780 | Ga0207704_100577801 | 139 |
| 414 | 3300025945 | Ga0207679_10310795 | Ga0207679_103107952 | 139 |
| 415 | 3300025961 | Ga0207712_10252078 | Ga0207712_102520783 | 139 |
| 416 | 3300025972 | Ga0207668_10073183 | Ga0207668_100731833 | 139 |
| 417 | 3300025981 | Ga0207640_10069523 | Ga0207640_100695233 | 139 |
| 418 | 3300025986 | Ga0207658_10344448 | Ga0207658_103444481 | 139 |
| 419 | 3300026023 | Ga0207677_10027442 | Ga0207677_100274423 | 139 |
| 420 | 3300026035 | Ga0207703_10108685 | Ga0207703_101086854 | 139 |
| 421 | 3300026041 | Ga0207639_10050374 | Ga0207639_100503744 | 139 |
| 422 | 3300026067 | Ga0207678_10006324 | Ga0207678_100063243 | 139 |
| 423 | 3300026075 | Ga0207708_10008095 | Ga0207708_100080953 | 139 |
| 424 | 3300026078 | Ga0207702_10488503 | Ga0207702_104885032 | 139 |
| 425 | 3300026089 | Ga0207648_10158331 | Ga0207648_101583314 | 139 |
| 426 | 3300026116 | Ga0207674_10070583 | Ga0207674_100705834 | 139 |
| 427 | 3300026121 | Ga0207683_10138363 | Ga0207683_101383634 | 139 |
| 428 | 3300026142 | Ga0207698_10286779 | Ga0207698_102867793 | 139 |
| 429 | 3300027907 | Ga0207428_10072004 | Ga0207428_100720044 | 139 |
| 430 | 3300028379 | Ga0268266_10018170 | Ga0268266_100181705 | 139 |
| 431 | 3300028379 | Ga0268266_10220856 | Ga0268266_102208564 | 139 |
| 432 | 3300028577 | Ga0265318_10043575 | Ga0265318_100435753 | 139 |
| 433 | 3300031911 | Ga0307412_11752890 | Ga0307412_117528901 | 139 |
| 434 | 3300031995 | Ga0307409_100317296 | Ga0307409_1003172962 | 139 |
| 435 | 3300032002 | Ga0307416_100854557 | Ga0307416_1008545572 | 139 |
| 436 | 3300032002 | Ga0307416_101706132 | Ga0307416_1017061321 | 139 |
| 437 | 3300032005 | Ga0307411_10350869 | Ga0307411_103508691 | 139 |
| 438 | 3300044693 | Ga0466961_0726483 | Ga0466961_0726483_51_518 | 139 |
| 439 | 3300044842 | Ga0466957_0000697 | Ga0466957_0000697_10108_10575 | 139 |
| 440 | 3300045836 | Ga0466958_0449977 | Ga0466958_0449977_109_588 | 139 |
| 441 | 3300047673 | Ga0495593_0029526 | Ga0495593_0029526_2269_2733 | 139 |
| 442 | 3300048904 | Ga0496101_0481305 | Ga0496101_0481305_163_642 | 139 |
| 443 | 3300048905 | Ga0496102_0604709 | Ga0496102_0604709_352_831 | 139 |
| 444 | 3300048910 | Ga0496107_0074213 | Ga0496107_0074213_980_1459 | 139 |
| 445 | 3300048911 | Ga0496108_0002794 | Ga0496108_0002794_6155_6634 | 139 |
| 446 | 3300048912 | Ga0496109_0302055 | Ga0496109_0302055_486_965 | 139 |
| 447 | 3300048913 | Ga0496110_0095026 | Ga0496110_0095026_178_657 | 139 |
| 448 | 3300048914 | Ga0496111_0106027 | Ga0496111_0106027_578_1057 | 139 |
| 449 | 3300049514 | Ga0501291_049642 | Ga0501291_049642_113_547 | 139 |
| 450 | 3300049587 | Ga0501071_0810121 | Ga0501071_0810121_248_682 | 139 |
| 451 | 3300049590 | Ga0501074_0654358 | Ga0501074_0654358_10_444 | 139 |
| 452 | 3300049592 | Ga0501076_0434851 | Ga0501076_0434851_30_464 | 139 |
| 453 | 3300050490 | nmdc:mga03n38_15679_c1 | nmdc:mga03n38_15679_c1_1845_2324 | 139 |
| 454 | 3300050491 | nmdc:mga00v17_28476_c1 | nmdc:mga00v17_28476_c1_487_966 | 139 |
| 455 | 3300050492 | nmdc:mga0yw44_99293_c1 | nmdc:mga0yw44_99293_c1_811_1290 | 139 |
| 456 | 3300050507 | nmdc:mga05p37_586484_c1 | nmdc:mga05p37_586484_c1_446_919 | 139 |
| 457 | 3300050510 | nmdc:mga06r32_413186_c1 | nmdc:mga06r32_413186_c1_120_593 | 139 |
| 458 | 3300050511 | nmdc:mga08y16_239741_c1 | nmdc:mga08y16_239741_c1_799_1272 | 139 |
| 459 | 3300054114 | Ga0501084_0927535 | Ga0501084_0927535_247_681 | 139 |
| 460 | 3300060353 | Ga0501082_0782012 | Ga0501082_0782012_125_562 | 139 |
| 461 | 3300060353 | Ga0501082_0929047 | Ga0501082_0929047_309_743 | 139 |
| 462 | 3300061734 | Ga0530510_1078794 | Ga0530510_1078794_31_465 | 139 |
| 463 | 3300005340 | Ga0070689_100076737 | Ga0070689_1000767372 | 140 |
| 464 | 3300005441 | Ga0070700_101045638 | Ga0070700_1010456382 | 140 |
| 465 | 3300005459 | Ga0068867_100460467 | Ga0068867_1004604672 | 140 |
| 466 | 3300009094 | Ga0111539_10283300 | Ga0111539_102833003 | 140 |
| 467 | 3300009148 | Ga0105243_10206613 | Ga0105243_102066133 | 140 |
| 468 | 3300009553 | Ga0105249_10815412 | Ga0105249_108154122 | 140 |
| 469 | 3300013105 | Ga0157369_10001902 | Ga0157369_1000190214 | 140 |
| 470 | 3300020080 | Ga0206350_10773500 | Ga0206350_107735001 | 140 |
| 471 | 3300025918 | Ga0207662_10745471 | Ga0207662_107454711 | 140 |
| 472 | 3300025936 | Ga0207670_10020104 | Ga0207670_100201041 | 140 |
| 473 | 3300025961 | Ga0207712_10942185 | Ga0207712_109421851 | 140 |
| 474 | 3300026075 | Ga0207708_10870884 | Ga0207708_108708842 | 140 |
| 475 | 3300026089 | Ga0207648_10082193 | Ga0207648_100821933 | 140 |
| 476 | 3300028556 | Ga0265337_1000409 | Ga0265337_10004099 | 140 |
| 477 | 3300028666 | Ga0265336_10000836 | Ga0265336_100008366 | 140 |
| 478 | 3300028800 | Ga0265338_10001224 | Ga0265338_100012247 | 140 |
| 479 | 3300041494 | Ga0451837_1397650 | Ga0451837_1397650_16_486 | 140 |
| 480 | 3300042438 | Ga0439459_0112160 | Ga0439459_0112160_76_510 | 140 |
| 481 | 3300047320 | Ga0495672_0006597 | Ga0495672_0006597_819_1292 | 140 |
| 482 | 3300048906 | Ga0496103_0873276 | Ga0496103_0873276_92_547 | 140 |
| 483 | 3300048907 | Ga0496104_0026472 | Ga0496104_0026472_2716_3204 | 140 |
| 484 | 3300048908 | Ga0496105_0002894 | Ga0496105_0002894_9871_10359 | 140 |
| 485 | 3300048913 | Ga0496110_0665562 | Ga0496110_0665562_116_574 | 140 |
| 486 | 3300048914 | Ga0496111_0239221 | Ga0496111_0239221_361_819 | 140 |
| 487 | 3300048915 | Ga0496112_0057563 | Ga0496112_0057563_2282_2770 | 140 |
| 488 | 3300049162 | Ga0501307_095072 | Ga0501307_095072_13_450 | 140 |
| 489 | 3300049581 | Ga0501047_0245491 | Ga0501047_0245491_559_1029 | 140 |
| 490 | 3300061734 | Ga0530510_1369944 | Ga0530510_1369944_69_506 | 140 |
| 491 | 3300005345 | Ga0070692_10006250 | Ga0070692_100062506 | 141 |
| 492 | 3300005441 | Ga0070700_100858839 | Ga0070700_1008588391 | 141 |
| 493 | 3300005719 | Ga0068861_100599050 | Ga0068861_1005990503 | 141 |
| 494 | 3300006038 | Ga0075365_10251253 | Ga0075365_102512533 | 141 |
| 495 | 3300006844 | Ga0075428_100083896 | Ga0075428_1000838963 | 141 |
| 496 | 3300006847 | Ga0075431_100563415 | Ga0075431_1005634151 | 141 |
| 497 | 3300009147 | Ga0114129_10474859 | Ga0114129_104748592 | 141 |
| 498 | 3300009176 | Ga0105242_10557358 | Ga0105242_105573583 | 141 |
| 499 | 3300025909 | Ga0207705_10615488 | Ga0207705_106154881 | 141 |
| 500 | 3300025912 | Ga0207707_10308264 | Ga0207707_103082642 | 141 |
| 501 | 3300025921 | Ga0207652_10202063 | Ga0207652_102020633 | 141 |
| 502 | 3300025934 | Ga0207686_11023422 | Ga0207686_110234221 | 141 |
| 503 | 3300025981 | Ga0207640_10886231 | Ga0207640_108862312 | 141 |
| 504 | 3300028558 | Ga0265326_10000004 | Ga0265326_10000004215 | 141 |
| 505 | 3300037466 | Ga0395898_0674620 | Ga0395898_0674620_454_918 | 141 |
| 506 | 3300046474 | Ga0495605_0157975 | Ga0495605_0157975_564_998 | 141 |
| 507 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_290632_291078 | 141 |
| 508 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_493571_494017 | 141 |
| 509 | 3300048914 | Ga0496111_0619677 | Ga0496111_0619677_238_711 | 141 |
| 510 | 3300048923 | Ga0496120_0403461 | Ga0496120_0403461_40_486 | 141 |
| 511 | 3300050492 | nmdc:mga0yw44_77423_c1 | nmdc:mga0yw44_77423_c1_1006_1458 | 141 |
| 512 | 3300005331 | Ga0070670_100011812 | Ga0070670_1000118124 | 142 |
| 513 | 3300005337 | Ga0070682_100738657 | Ga0070682_1007386572 | 142 |
| 514 | 3300005366 | Ga0070659_100325138 | Ga0070659_1003251383 | 142 |
| 515 | 3300005937 | Ga0081455_10241399 | Ga0081455_102413992 | 142 |
| 516 | 3300006038 | Ga0075365_10596924 | Ga0075365_105969241 | 142 |
| 517 | 3300006178 | Ga0075367_10806620 | Ga0075367_108066201 | 142 |
| 518 | 3300009177 | Ga0105248_10000022 | Ga0105248_10000022290 | 142 |
| 519 | 3300013104 | Ga0157370_10343265 | Ga0157370_103432653 | 142 |
| 520 | 3300021384 | Ga0213876_10081529 | Ga0213876_100815291 | 142 |
| 521 | 3300025906 | Ga0207699_10286050 | Ga0207699_102860501 | 142 |
| 522 | 3300025925 | Ga0207650_10107664 | Ga0207650_101076641 | 142 |
| 523 | 3300025932 | Ga0207690_10162618 | Ga0207690_101626182 | 142 |
| 524 | 3300025941 | Ga0207711_10000019 | Ga0207711_1000001948 | 142 |
| 525 | 3300025944 | Ga0207661_10351667 | Ga0207661_103516672 | 142 |
| 526 | 3300031548 | Ga0307408_101698149 | Ga0307408_1016981491 | 142 |
| 527 | 3300031995 | Ga0307409_100210588 | Ga0307409_1002105881 | 142 |
| 528 | 3300037853 | Ga0436364_0566822 | Ga0436364_0566822_202_657 | 142 |
| 529 | 3300039437 | Ga0436365_0654443 | Ga0436365_0654443_1652_2113 | 142 |
| 530 | 3300039450 | Ga0436363_0046650 | Ga0436363_0046650_22632_23093 | 142 |
| 531 | 3300039453 | Ga0436362_1246024 | Ga0436362_1246024_176_643 | 142 |
| 532 | 3300044658 | Ga0466972_0186121 | Ga0466972_0186121_143_622 | 142 |
| 533 | 3300044693 | Ga0466961_0162616 | Ga0466961_0162616_769_1248 | 142 |
| 534 | 3300044694 | Ga0466963_0073369 | Ga0466963_0073369_1033_1512 | 142 |
| 535 | 3300044765 | Ga0466970_0048058 | Ga0466970_0048058_1616_2095 | 142 |
| 536 | 3300044765 | Ga0466970_0077917 | Ga0466970_0077917_458_937 | 142 |
| 537 | 3300044842 | Ga0466957_0113200 | Ga0466957_0113200_1063_1542 | 142 |
| 538 | 3300045049 | Ga0466959_0129570 | Ga0466959_0129570_687_1166 | 142 |
| 539 | 3300048912 | Ga0496109_0776174 | Ga0496109_0776174_363_815 | 142 |
| 540 | 3300048914 | Ga0496111_0569738 | Ga0496111_0569738_40_492 | 142 |
| 541 | 3300048922 | Ga0496119_0032546 | Ga0496119_0032546_1390_1854 | 142 |
| 542 | 3300048927 | Ga0496124_0093327 | Ga0496124_0093327_1294_1773 | 142 |
| 543 | 3300049584 | Ga0501068_0225721 | Ga0501068_0225721_674_1153 | 142 |
| 544 | 3300049590 | Ga0501074_0024292 | Ga0501074_0024292_786_1265 | 142 |
| 545 | 3300049741 | Ga0501079_0081496 | Ga0501079_0081496_1636_2115 | 142 |
| 546 | 3300049742 | Ga0501080_0013630 | Ga0501080_0013630_6149_6628 | 142 |
| 547 | 3300050512 | nmdc:mga0n895_1169236_c1 | nmdc:mga0n895_1169236_c1_13_498 | 142 |
| 548 | 3300053083 | Ga0495655_0004243 | Ga0495655_0004243_1590_2078 | 142 |
| 549 | 3300005365 | Ga0070688_100000344 | Ga0070688_10000034422 | 143 |
| 550 | 3300005436 | Ga0070713_101210501 | Ga0070713_1012105011 | 143 |
| 551 | 3300005466 | Ga0070685_10000290 | Ga0070685_1000029022 | 143 |
| 552 | 3300005614 | Ga0068856_100000057 | Ga0068856_1000000575 | 143 |
| 553 | 3300005937 | Ga0081455_10332764 | Ga0081455_103327642 | 143 |
| 554 | 3300009147 | Ga0114129_13336210 | Ga0114129_133362101 | 143 |
| 555 | 3300025928 | Ga0207700_10781928 | Ga0207700_107819281 | 143 |
| 556 | 3300026078 | Ga0207702_10000027 | Ga0207702_10000027141 | 143 |
| 557 | 3300031995 | Ga0307409_100078685 | Ga0307409_1000786854 | 143 |
| 558 | 3300038443 | Ga0395901_0122913 | Ga0395901_0122913_2144_2608 | 143 |
| 559 | 3300038443 | Ga0395901_0480471 | Ga0395901_0480471_83_544 | 143 |
| 560 | 3300039453 | Ga0436362_1118531 | Ga0436362_1118531_413_871 | 143 |
| 561 | 3300044684 | Ga0466966_0318307 | Ga0466966_0318307_265_723 | 143 |
| 562 | 3300044693 | Ga0466961_0794864 | Ga0466961_0794864_46_504 | 143 |
| 563 | 3300046455 | Ga0495603_0005110 | Ga0495603_0005110_7130_7609 | 143 |
| 564 | 3300046681 | Ga0495647_0205198 | Ga0495647_0205198_245_724 | 143 |
| 565 | 3300047321 | Ga0495676_0071215 | Ga0495676_0071215_795_1436 | 143 |
| 566 | 3300049576 | Ga0501040_0359911 | Ga0501040_0359911_12_467 | 143 |
| 567 | 3300003203 | JGI25406J46586_10004410 | JGI25406J46586_100044101 | 144 |
| 568 | 3300005334 | Ga0068869_100809000 | Ga0068869_1008090001 | 144 |
| 569 | 3300005337 | Ga0070682_100005793 | Ga0070682_1000057937 | 144 |
| 570 | 3300005338 | Ga0068868_100860305 | Ga0068868_1008603051 | 144 |
| 571 | 3300005344 | Ga0070661_101309255 | Ga0070661_1013092551 | 144 |
| 572 | 3300005435 | Ga0070714_100368285 | Ga0070714_1003682851 | 144 |
| 573 | 3300005441 | Ga0070700_100493138 | Ga0070700_1004931381 | 144 |
| 574 | 3300005441 | Ga0070700_100713191 | Ga0070700_1007131912 | 144 |
| 575 | 3300005614 | Ga0068856_100717900 | Ga0068856_1007179002 | 144 |
| 576 | 3300005937 | Ga0081455_10123476 | Ga0081455_101234762 | 144 |
| 577 | 3300005937 | Ga0081455_10266880 | Ga0081455_102668801 | 144 |
| 578 | 3300005937 | Ga0081455_10587474 | Ga0081455_105874742 | 144 |
| 579 | 3300005983 | Ga0081540_1121390 | Ga0081540_11213901 | 144 |
| 580 | 3300009094 | Ga0111539_10113127 | Ga0111539_101131274 | 144 |
| 581 | 3300009101 | Ga0105247_10000838 | Ga0105247_1000083813 | 144 |
| 582 | 3300009553 | Ga0105249_11201558 | Ga0105249_112015581 | 144 |
| 583 | 3300010375 | Ga0105239_10359881 | Ga0105239_103598811 | 144 |
| 584 | 3300013105 | Ga0157369_11599938 | Ga0157369_115999381 | 144 |
| 585 | 3300013306 | Ga0163162_11238719 | Ga0163162_112387192 | 144 |
| 586 | 3300014326 | Ga0157380_10910232 | Ga0157380_109102322 | 144 |
| 587 | 3300020082 | Ga0206353_11178628 | Ga0206353_111786284 | 144 |
| 588 | 3300021384 | Ga0213876_10061056 | Ga0213876_100610561 | 144 |
| 589 | 3300021388 | Ga0213875_10096172 | Ga0213875_100961722 | 144 |
| 590 | 3300025900 | Ga0207710_10001786 | Ga0207710_1000178613 | 144 |
| 591 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011391 | 144 |
| 592 | 3300025937 | Ga0207669_10209707 | Ga0207669_102097072 | 144 |
| 593 | 3300025944 | Ga0207661_10491273 | Ga0207661_104912731 | 144 |
| 594 | 3300025981 | Ga0207640_11080523 | Ga0207640_110805231 | 144 |
| 595 | 3300026035 | Ga0207703_11981674 | Ga0207703_119816741 | 144 |
| 596 | 3300026075 | Ga0207708_10614269 | Ga0207708_106142692 | 144 |
| 597 | 3300026121 | Ga0207683_10851265 | Ga0207683_108512651 | 144 |
| 598 | 3300026142 | Ga0207698_11669317 | Ga0207698_116693171 | 144 |
| 599 | 3300031995 | Ga0307409_100939462 | Ga0307409_1009394621 | 144 |
| 600 | 3300035118 | Ga0373954_0237694 | Ga0373954_0237694_183_662 | 144 |
| 601 | 3300037418 | Ga0395900_1196132 | Ga0395900_1196132_52_528 | 144 |
| 602 | 3300037853 | Ga0436364_0997712 | Ga0436364_0997712_1258_1719 | 144 |
| 603 | 3300039437 | Ga0436365_1237803 | Ga0436365_1237803_5910_6371 | 144 |
| 604 | 3300041512 | Ga0451853_2670470 | Ga0451853_2670470_293_754 | 144 |
| 605 | 3300044901 | Ga0466960_0038448 | Ga0466960_0038448_1378_1866 | 144 |
| 606 | 3300045976 | Ga0466967_0485026 | Ga0466967_0485026_326_790 | 144 |
| 607 | 3300046615 | Ga0495656_0340014 | Ga0495656_0340014_30_494 | 144 |
| 608 | 3300046691 | Ga0495670_0800172 | Ga0495670_0800172_33_497 | 144 |
| 609 | 3300047471 | Ga0495684_0328752 | Ga0495684_0328752_24_473 | 144 |
| 610 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_25933_26406 | 144 |
| 611 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_1301773_1302246 | 144 |
| 612 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_25892_26374 | 144 |
| 613 | 3300048912 | Ga0496109_0000033 | Ga0496109_0000033_2999_3481 | 144 |
| 614 | 3300048912 | Ga0496109_0455758 | Ga0496109_0455758_695_1162 | 144 |
| 615 | 3300048923 | Ga0496120_0086626 | Ga0496120_0086626_391_864 | 144 |
| 616 | 3300049572 | Ga0501036_1655586 | Ga0501036_1655586_37_504 | 144 |
| 617 | 3300005327 | Ga0070658_10928120 | Ga0070658_109281201 | 145 |
| 618 | 3300005329 | Ga0070683_100055916 | Ga0070683_1000559161 | 145 |
| 619 | 3300005329 | Ga0070683_101217807 | Ga0070683_1012178071 | 145 |
| 620 | 3300005344 | Ga0070661_100334113 | Ga0070661_1003341132 | 145 |
| 621 | 3300005356 | Ga0070674_101086001 | Ga0070674_1010860011 | 145 |
| 622 | 3300005366 | Ga0070659_100115142 | Ga0070659_1001151423 | 145 |
| 623 | 3300005366 | Ga0070659_100296785 | Ga0070659_1002967852 | 145 |
| 624 | 3300005440 | Ga0070705_100176359 | Ga0070705_1001763593 | 145 |
| 625 | 3300005455 | Ga0070663_100070278 | Ga0070663_1000702784 | 145 |
| 626 | 3300005457 | Ga0070662_100338927 | Ga0070662_1003389271 | 145 |
| 627 | 3300005530 | Ga0070679_100263399 | Ga0070679_1002633991 | 145 |
| 628 | 3300005535 | Ga0070684_100259261 | Ga0070684_1002592612 | 145 |
| 629 | 3300005539 | Ga0068853_100696305 | Ga0068853_1006963051 | 145 |
| 630 | 3300005539 | Ga0068853_100961284 | Ga0068853_1009612841 | 145 |
| 631 | 3300005545 | Ga0070695_100076484 | Ga0070695_1000764844 | 145 |
| 632 | 3300005549 | Ga0070704_100218694 | Ga0070704_1002186942 | 145 |
| 633 | 3300005564 | Ga0070664_100328736 | Ga0070664_1003287362 | 145 |
| 634 | 3300005564 | Ga0070664_100412199 | Ga0070664_1004121991 | 145 |
| 635 | 3300005577 | Ga0068857_100106454 | Ga0068857_1001064544 | 145 |
| 636 | 3300005615 | Ga0070702_100120835 | Ga0070702_1001208351 | 145 |
| 637 | 3300005616 | Ga0068852_100000058 | Ga0068852_10000005872 | 145 |
| 638 | 3300005981 | Ga0081538_10020689 | Ga0081538_100206893 | 145 |
| 639 | 3300005985 | Ga0081539_10186475 | Ga0081539_101864752 | 145 |
| 640 | 3300006195 | Ga0075366_10321400 | Ga0075366_103214001 | 145 |
| 641 | 3300006358 | Ga0068871_101915773 | Ga0068871_1019157731 | 145 |
| 642 | 3300006871 | Ga0075434_100010868 | Ga0075434_1000108685 | 145 |
| 643 | 3300006871 | Ga0075434_100195933 | Ga0075434_1001959333 | 145 |
| 644 | 3300006914 | Ga0075436_100466669 | Ga0075436_1004666692 | 145 |
| 645 | 3300007076 | Ga0075435_100360935 | Ga0075435_1003609352 | 145 |
| 646 | 3300009094 | Ga0111539_10576004 | Ga0111539_105760041 | 145 |
| 647 | 3300009098 | Ga0105245_10126764 | Ga0105245_101267643 | 145 |
| 648 | 3300009147 | Ga0114129_10045130 | Ga0114129_100451306 | 145 |
| 649 | 3300009148 | Ga0105243_10069881 | Ga0105243_100698813 | 145 |
| 650 | 3300009176 | Ga0105242_10120725 | Ga0105242_101207253 | 145 |
| 651 | 3300010375 | Ga0105239_10601666 | Ga0105239_106016662 | 145 |
| 652 | 3300010375 | Ga0105239_11357800 | Ga0105239_113578001 | 145 |
| 653 | 3300011119 | Ga0105246_11165939 | Ga0105246_111659391 | 145 |
| 654 | 3300013102 | Ga0157371_10501409 | Ga0157371_105014091 | 145 |
| 655 | 3300013105 | Ga0157369_11563459 | Ga0157369_115634591 | 145 |
| 656 | 3300013297 | Ga0157378_10185172 | Ga0157378_101851724 | 145 |
| 657 | 3300013306 | Ga0163162_10830624 | Ga0163162_108306243 | 145 |
| 658 | 3300013307 | Ga0157372_10533797 | Ga0157372_105337971 | 145 |
| 659 | 3300013308 | Ga0157375_10269222 | Ga0157375_102692222 | 145 |
| 660 | 3300013308 | Ga0157375_12059850 | Ga0157375_120598501 | 145 |
| 661 | 3300014745 | Ga0157377_10143378 | Ga0157377_101433782 | 145 |
| 662 | 3300020070 | Ga0206356_11759950 | Ga0206356_117599501 | 145 |
| 663 | 3300025927 | Ga0207687_10085822 | Ga0207687_100858223 | 145 |
| 664 | 3300025931 | Ga0207644_10248387 | Ga0207644_102483872 | 145 |
| 665 | 3300025932 | Ga0207690_10155403 | Ga0207690_101554032 | 145 |
| 666 | 3300025933 | Ga0207706_10390981 | Ga0207706_103909812 | 145 |
| 667 | 3300025937 | Ga0207669_10371849 | Ga0207669_103718492 | 145 |
| 668 | 3300025944 | Ga0207661_10183527 | Ga0207661_101835271 | 145 |
| 669 | 3300025944 | Ga0207661_11092381 | Ga0207661_110923811 | 145 |
| 670 | 3300026023 | Ga0207677_11440837 | Ga0207677_114408371 | 145 |
| 671 | 3300026067 | Ga0207678_10628402 | Ga0207678_106284022 | 145 |
| 672 | 3300026075 | Ga0207708_10869133 | Ga0207708_108691331 | 145 |
| 673 | 3300026088 | Ga0207641_11764899 | Ga0207641_117648991 | 145 |
| 674 | 3300026089 | Ga0207648_10260681 | Ga0207648_102606813 | 145 |
| 675 | 3300026116 | Ga0207674_10948824 | Ga0207674_109488241 | 145 |
| 676 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002212 | 145 |
| 677 | 3300026142 | Ga0207698_10330135 | Ga0207698_103301352 | 145 |
| 678 | 3300031824 | Ga0307413_10238231 | Ga0307413_102382312 | 145 |
| 679 | 3300031852 | Ga0307410_10426017 | Ga0307410_104260173 | 145 |
| 680 | 3300031901 | Ga0307406_10511448 | Ga0307406_105114481 | 145 |
| 681 | 3300031903 | Ga0307407_10153050 | Ga0307407_101530503 | 145 |
| 682 | 3300031995 | Ga0307409_100117484 | Ga0307409_1001174841 | 145 |
| 683 | 3300032004 | Ga0307414_10172025 | Ga0307414_101720252 | 145 |
| 684 | 3300032126 | Ga0307415_101521401 | Ga0307415_1015214011 | 145 |
| 685 | 3300035398 | Ga0316574_0061749 | Ga0316574_0061749_436_909 | 145 |
| 686 | 3300037466 | Ga0395898_1357451 | Ga0395898_1357451_120_566 | 145 |
| 687 | 3300038443 | Ga0395901_1341353 | Ga0395901_1341353_189_635 | 145 |
| 688 | 3300041512 | Ga0451853_0757159 | Ga0451853_0757159_469_939 | 145 |
| 689 | 3300044706 | Ga0466964_0304889 | Ga0466964_0304889_323_784 | 145 |
| 690 | 3300045976 | Ga0466967_0032630 | Ga0466967_0032630_96_569 | 145 |
| 691 | 3300045976 | Ga0466967_0280667 | Ga0466967_0280667_818_1300 | 145 |
| 692 | 3300045976 | Ga0466967_1078248 | Ga0466967_1078248_58_519 | 145 |
| 693 | 3300048905 | Ga0496102_0449953 | Ga0496102_0449953_729_1175 | 145 |
| 694 | 3300048909 | Ga0496106_0188359 | Ga0496106_0188359_695_1141 | 145 |
| 695 | 3300048912 | Ga0496109_0310002 | Ga0496109_0310002_670_1146 | 145 |
| 696 | 3300048913 | Ga0496110_0409563 | Ga0496110_0409563_663_1139 | 145 |
| 697 | 3300048914 | Ga0496111_1057206 | Ga0496111_1057206_28_498 | 145 |
| 698 | 3300050507 | nmdc:mga05p37_54356_c1 | nmdc:mga05p37_54356_c1_1043_1495 | 145 |
| 699 | 3300050510 | nmdc:mga06r32_1263448_c1 | nmdc:mga06r32_1263448_c1_91_540 | 145 |
| 700 | 3300050512 | nmdc:mga0n895_189723_c1 | nmdc:mga0n895_189723_c1_783_1232 | 145 |
| 701 | 3300050512 | nmdc:mga0n895_55336_c1 | nmdc:mga0n895_55336_c1_3143_3595 | 145 |
| 702 | 3300050513 | nmdc:mga0rr50_322551_c1 | nmdc:mga0rr50_322551_c1_263_718 | 145 |
| 703 | 3300050515 | nmdc:mga0a205_20641_c1 | nmdc:mga0a205_20641_c1_4660_5112 | 145 |
| 704 | 3300005719 | Ga0068861_101713398 | Ga0068861_1017133981 | 146 |
| 705 | 3300009147 | Ga0114129_12094590 | Ga0114129_120945901 | 146 |
| 706 | 3300009545 | Ga0105237_10001106 | Ga0105237_1000110631 | 146 |
| 707 | 3300014497 | Ga0182008_10127331 | Ga0182008_101273312 | 146 |
| 708 | 3300025915 | Ga0207693_10370815 | Ga0207693_103708152 | 146 |
| 709 | 3300028577 | Ga0265318_10032403 | Ga0265318_100324033 | 146 |
| 710 | 3300031251 | Ga0265327_10011293 | Ga0265327_100112936 | 146 |
| 711 | 3300031251 | Ga0265327_10033767 | Ga0265327_100337673 | 146 |
| 712 | 3300031852 | Ga0307410_10002660 | Ga0307410_100026602 | 146 |
| 713 | 3300032002 | Ga0307416_100330015 | Ga0307416_1003300152 | 146 |
| 714 | 3300032126 | Ga0307415_100001983 | Ga0307415_1000019839 | 146 |
| 715 | 3300035119 | Ga0373956_0581178 | Ga0373956_0581178_21_488 | 146 |
| 716 | 3300037466 | Ga0395898_0226295 | Ga0395898_0226295_893_1372 | 146 |
| 717 | 3300037471 | Ga0395905_0506836 | Ga0395905_0506836_584_1063 | 146 |
| 718 | 3300044694 | Ga0466963_0195320 | Ga0466963_0195320_192_662 | 146 |
| 719 | 3300044694 | Ga0466963_0204414 | Ga0466963_0204414_86_553 | 146 |
| 720 | 3300045976 | Ga0466967_0276665 | Ga0466967_0276665_1014_1493 | 146 |
| 721 | 3300046663 | Ga0495635_0561848 | Ga0495635_0561848_62_529 | 146 |
| 722 | 3300048912 | Ga0496109_0574838 | Ga0496109_0574838_405_887 | 146 |
| 723 | 3300049586 | Ga0501070_0819531 | Ga0501070_0819531_103_573 | 146 |
| 724 | 3300053085 | Ga0495619_0173023 | Ga0495619_0173023_742_1209 | 146 |
| 725 | 3300005983 | Ga0081540_1003253 | Ga0081540_100325312 | 147 |
| 726 | 3300005983 | Ga0081540_1103668 | Ga0081540_11036681 | 147 |
| 727 | 3300006844 | Ga0075428_100335854 | Ga0075428_1003358543 | 147 |
| 728 | 3300006846 | Ga0075430_100090709 | Ga0075430_1000907094 | 147 |
| 729 | 3300006847 | Ga0075431_100055610 | Ga0075431_1000556103 | 147 |
| 730 | 3300006871 | Ga0075434_100913602 | Ga0075434_1009136021 | 147 |
| 731 | 3300006880 | Ga0075429_100013154 | Ga0075429_1000131545 | 147 |
| 732 | 3300006881 | Ga0068865_100912347 | Ga0068865_1009123471 | 147 |
| 733 | 3300009147 | Ga0114129_10494082 | Ga0114129_104940822 | 147 |
| 734 | 3300009147 | Ga0114129_10889851 | Ga0114129_108898511 | 147 |
| 735 | 3300025925 | Ga0207650_11254361 | Ga0207650_112543611 | 147 |
| 736 | 3300031901 | Ga0307406_10773307 | Ga0307406_107733071 | 147 |
| 737 | 3300031903 | Ga0307407_10601270 | Ga0307407_106012701 | 147 |
| 738 | 3300032126 | Ga0307415_100629868 | Ga0307415_1006298681 | 147 |
| 739 | 3300037312 | Ga0395899_0255730 | Ga0395899_0255730_656_1126 | 147 |
| 740 | 3300037418 | Ga0395900_0106773 | Ga0395900_0106773_1335_1805 | 147 |
| 741 | 3300037466 | Ga0395898_0015974 | Ga0395898_0015974_6060_6530 | 147 |
| 742 | 3300037471 | Ga0395905_0015836 | Ga0395905_0015836_1584_2054 | 147 |
| 743 | 3300038443 | Ga0395901_0019600 | Ga0395901_0019600_4662_5132 | 147 |
| 744 | 3300044694 | Ga0466963_0042130 | Ga0466963_0042130_1893_2363 | 147 |
| 745 | 3300044842 | Ga0466957_0239355 | Ga0466957_0239355_329_799 | 147 |
| 746 | 3300045836 | Ga0466958_0111359 | Ga0466958_0111359_675_1145 | 147 |
| 747 | 3300049582 | Ga0501048_0522952 | Ga0501048_0522952_386_838 | 147 |
| 748 | 3300049585 | Ga0501069_0230232 | Ga0501069_0230232_597_1061 | 147 |
| 749 | 3300049591 | Ga0501075_0727464 | Ga0501075_0727464_151_615 | 147 |
| 750 | 3300049741 | Ga0501079_0404537 | Ga0501079_0404537_352_804 | 147 |
| 751 | 3300050507 | nmdc:mga05p37_1240364_c1 | nmdc:mga05p37_1240364_c1_62_529 | 147 |
| 752 | 3300050507 | nmdc:mga05p37_371224_c1 | nmdc:mga05p37_371224_c1_805_1254 | 147 |
| 753 | 3300050508 | nmdc:mga09592_52641_c1 | nmdc:mga09592_52641_c1_971_1420 | 147 |
| 754 | 3300050510 | nmdc:mga06r32_122626_c1 | nmdc:mga06r32_122626_c1_345_794 | 147 |
| 755 | 3300060353 | Ga0501082_0964359 | Ga0501082_0964359_25_477 | 147 |
| 756 | 3300005330 | Ga0070690_100372389 | Ga0070690_1003723891 | 148 |
| 757 | 3300005337 | Ga0070682_100103473 | Ga0070682_1001034732 | 148 |
| 758 | 3300005340 | Ga0070689_100712527 | Ga0070689_1007125271 | 148 |
| 759 | 3300005341 | Ga0070691_10311047 | Ga0070691_103110472 | 148 |
| 760 | 3300005347 | Ga0070668_100089905 | Ga0070668_1000899053 | 148 |
| 761 | 3300005355 | Ga0070671_100671685 | Ga0070671_1006716851 | 148 |
| 762 | 3300005356 | Ga0070674_100144727 | Ga0070674_1001447273 | 148 |
| 763 | 3300005364 | Ga0070673_100432843 | Ga0070673_1004328431 | 148 |
| 764 | 3300005434 | Ga0070709_10101666 | Ga0070709_101016661 | 148 |
| 765 | 3300005437 | Ga0070710_10103279 | Ga0070710_101032793 | 148 |
| 766 | 3300005439 | Ga0070711_100063702 | Ga0070711_1000637022 | 148 |
| 767 | 3300005444 | Ga0070694_100375921 | Ga0070694_1003759212 | 148 |
| 768 | 3300005456 | Ga0070678_100014808 | Ga0070678_1000148084 | 148 |
| 769 | 3300005471 | Ga0070698_100983281 | Ga0070698_1009832811 | 148 |
| 770 | 3300005536 | Ga0070697_100278722 | Ga0070697_1002787223 | 148 |
| 771 | 3300005549 | Ga0070704_100039805 | Ga0070704_1000398053 | 148 |
| 772 | 3300005718 | Ga0068866_10255556 | Ga0068866_102555562 | 148 |
| 773 | 3300005719 | Ga0068861_100135106 | Ga0068861_1001351063 | 148 |
| 774 | 3300005842 | Ga0068858_100200859 | Ga0068858_1002008592 | 148 |
| 775 | 3300005937 | Ga0081455_10209326 | Ga0081455_102093263 | 148 |
| 776 | 3300006038 | Ga0075365_10012498 | Ga0075365_100124986 | 148 |
| 777 | 3300006038 | Ga0075365_10022183 | Ga0075365_100221834 | 148 |
| 778 | 3300006038 | Ga0075365_10086436 | Ga0075365_100864363 | 148 |
| 779 | 3300006038 | Ga0075365_10259537 | Ga0075365_102595372 | 148 |
| 780 | 3300006051 | Ga0075364_10047086 | Ga0075364_100470864 | 148 |
| 781 | 3300006051 | Ga0075364_10295271 | Ga0075364_102952712 | 148 |
| 782 | 3300006173 | Ga0070716_100266038 | Ga0070716_1002660382 | 148 |
| 783 | 3300006175 | Ga0070712_100012995 | Ga0070712_1000129954 | 148 |
| 784 | 3300006844 | Ga0075428_100051023 | Ga0075428_1000510231 | 148 |
| 785 | 3300006846 | Ga0075430_100778405 | Ga0075430_1007784052 | 148 |
| 786 | 3300006847 | Ga0075431_100000134 | Ga0075431_10000013445 | 148 |
| 787 | 3300006847 | Ga0075431_100302839 | Ga0075431_1003028393 | 148 |
| 788 | 3300006847 | Ga0075431_100938973 | Ga0075431_1009389731 | 148 |
| 789 | 3300006852 | Ga0075433_10009707 | Ga0075433_100097077 | 148 |
| 790 | 3300006871 | Ga0075434_100009612 | Ga0075434_1000096127 | 148 |
| 791 | 3300006880 | Ga0075429_100587573 | Ga0075429_1005875731 | 148 |
| 792 | 3300006881 | Ga0068865_100503576 | Ga0068865_1005035761 | 148 |
| 793 | 3300009094 | Ga0111539_10016678 | Ga0111539_100166784 | 148 |
| 794 | 3300009098 | Ga0105245_10002823 | Ga0105245_1000282315 | 148 |
| 795 | 3300009101 | Ga0105247_10506042 | Ga0105247_105060421 | 148 |
| 796 | 3300009147 | Ga0114129_10051817 | Ga0114129_100518173 | 148 |
| 797 | 3300009148 | Ga0105243_10066378 | Ga0105243_100663782 | 148 |
| 798 | 3300009148 | Ga0105243_10735610 | Ga0105243_107356102 | 148 |
| 799 | 3300009553 | Ga0105249_10676117 | Ga0105249_106761172 | 148 |
| 800 | 3300011119 | Ga0105246_10114148 | Ga0105246_101141482 | 148 |
| 801 | 3300013297 | Ga0157378_10866825 | Ga0157378_108668251 | 148 |
| 802 | 3300013306 | Ga0163162_10781478 | Ga0163162_107814783 | 148 |
| 803 | 3300013308 | Ga0157375_10027026 | Ga0157375_100270266 | 148 |
| 804 | 3300013308 | Ga0157375_11220304 | Ga0157375_112203042 | 148 |
| 805 | 3300014968 | Ga0157379_10157217 | Ga0157379_101572172 | 148 |
| 806 | 3300020082 | Ga0206353_10927289 | Ga0206353_109272891 | 148 |
| 807 | 3300025899 | Ga0207642_10208162 | Ga0207642_102081622 | 148 |
| 808 | 3300025915 | Ga0207693_10013895 | Ga0207693_100138954 | 148 |
| 809 | 3300025916 | Ga0207663_10057775 | Ga0207663_100577753 | 148 |
| 810 | 3300025927 | Ga0207687_10032650 | Ga0207687_100326502 | 148 |
| 811 | 3300025935 | Ga0207709_10057610 | Ga0207709_100576102 | 148 |
| 812 | 3300025935 | Ga0207709_10321957 | Ga0207709_103219572 | 148 |
| 813 | 3300025937 | Ga0207669_10232338 | Ga0207669_102323381 | 148 |
| 814 | 3300025938 | Ga0207704_10210494 | Ga0207704_102104943 | 148 |
| 815 | 3300025939 | Ga0207665_10110275 | Ga0207665_101102752 | 148 |
| 816 | 3300025961 | Ga0207712_10693833 | Ga0207712_106938331 | 148 |
| 817 | 3300025972 | Ga0207668_11027723 | Ga0207668_110277231 | 148 |
| 818 | 3300026035 | Ga0207703_10335689 | Ga0207703_103356892 | 148 |
| 819 | 3300026121 | Ga0207683_10033551 | Ga0207683_100335514 | 148 |
| 820 | 3300026142 | Ga0207698_10543636 | Ga0207698_105436361 | 148 |
| 821 | 3300027907 | Ga0207428_10044132 | Ga0207428_100441323 | 148 |
| 822 | 3300028381 | Ga0268264_11079816 | Ga0268264_110798161 | 148 |
| 823 | 3300031901 | Ga0307406_10018517 | Ga0307406_100185171 | 148 |
| 824 | 3300032005 | Ga0307411_10861001 | Ga0307411_108610011 | 148 |
| 825 | 3300037068 | Ga0373925_0117282 | Ga0373925_0117282_1461_1934 | 148 |
| 826 | 3300046459 | Ga0495629_0155703 | Ga0495629_0155703_89_562 | 148 |
| 827 | 3300046473 | Ga0495582_0108015 | Ga0495582_0108015_941_1414 | 148 |
| 828 | 3300046475 | Ga0495639_0397053 | Ga0495639_0397053_67_540 | 148 |
| 829 | 3300046499 | Ga0495594_0021711 | Ga0495594_0021711_874_1347 | 148 |
| 830 | 3300046674 | Ga0495588_0103934 | Ga0495588_0103934_466_939 | 148 |
| 831 | 3300046681 | Ga0495647_0070427 | Ga0495647_0070427_336_797 | 148 |
| 832 | 3300047321 | Ga0495676_0092642 | Ga0495676_0092642_1279_1752 | 148 |
| 833 | 3300048903 | Ga0496100_0016889 | Ga0496100_0016889_3555_4028 | 148 |
| 834 | 3300048904 | Ga0496101_0004260 | Ga0496101_0004260_6651_7124 | 148 |
| 835 | 3300048905 | Ga0496102_0029219 | Ga0496102_0029219_1334_1807 | 148 |
| 836 | 3300048906 | Ga0496103_0006391 | Ga0496103_0006391_6492_6965 | 148 |
| 837 | 3300048907 | Ga0496104_0043868 | Ga0496104_0043868_3515_3988 | 148 |
| 838 | 3300048908 | Ga0496105_0059859 | Ga0496105_0059859_1462_1935 | 148 |
| 839 | 3300048909 | Ga0496106_0096802 | Ga0496106_0096802_786_1259 | 148 |
| 840 | 3300048910 | Ga0496107_0075197 | Ga0496107_0075197_524_997 | 148 |
| 841 | 3300048911 | Ga0496108_0061700 | Ga0496108_0061700_396_869 | 148 |
| 842 | 3300048915 | Ga0496112_0084664 | Ga0496112_0084664_45_518 | 148 |
| 843 | 3300048916 | Ga0496113_0060774 | Ga0496113_0060774_1078_1551 | 148 |
| 844 | 3300048917 | Ga0496114_0009129 | Ga0496114_0009129_5558_6031 | 148 |
| 845 | 3300048918 | Ga0496115_0015903 | Ga0496115_0015903_3920_4393 | 148 |
| 846 | 3300048922 | Ga0496119_0325163 | Ga0496119_0325163_192_665 | 148 |
| 847 | 3300049572 | Ga0501036_0247847 | Ga0501036_0247847_425_880 | 148 |
| 848 | 3300049575 | Ga0501039_1273101 | Ga0501039_1273101_44_499 | 148 |
| 849 | 3300049587 | Ga0501071_0418170 | Ga0501071_0418170_287_742 | 148 |
| 850 | 3300049588 | Ga0501072_0252158 | Ga0501072_0252158_696_1151 | 148 |
| 851 | 3300049591 | Ga0501075_0542730 | Ga0501075_0542730_80_535 | 148 |
| 852 | 3300049742 | Ga0501080_0715963 | Ga0501080_0715963_330_785 | 148 |
| 853 | 3300050490 | nmdc:mga03n38_367325_c1 | nmdc:mga03n38_367325_c1_277_738 | 148 |
| 854 | 3300050491 | nmdc:mga00v17_39916_c1 | nmdc:mga00v17_39916_c1_313_786 | 148 |
| 855 | 3300050492 | nmdc:mga0yw44_21221_c1 | nmdc:mga0yw44_21221_c1_1145_1618 | 148 |
| 856 | 3300050492 | nmdc:mga0yw44_316918_c1 | nmdc:mga0yw44_316918_c1_405_866 | 148 |
| 857 | 3300050492 | nmdc:mga0yw44_327462_c1 | nmdc:mga0yw44_327462_c1_459_932 | 148 |
| 858 | 3300050492 | nmdc:mga0yw44_4200_c1 | nmdc:mga0yw44_4200_c1_4864_5337 | 148 |
| 859 | 3300050494 | nmdc:mga06z11_147302_c1 | nmdc:mga06z11_147302_c1_622_1083 | 148 |
| 860 | 3300050495 | nmdc:mga04h51_55684_c1 | nmdc:mga04h51_55684_c1_687_1160 | 148 |
| 861 | 3300050507 | nmdc:mga05p37_718193_c1 | nmdc:mga05p37_718193_c1_329_790 | 148 |
| 862 | 3300050508 | nmdc:mga09592_529798_c1 | nmdc:mga09592_529798_c1_408_872 | 148 |
| 863 | 3300050509 | nmdc:mga0qj67_774068_c1 | nmdc:mga0qj67_774068_c1_191_655 | 148 |
| 864 | 3300050510 | nmdc:mga06r32_1055111_c1 | nmdc:mga06r32_1055111_c1_89_550 | 148 |
| 865 | 3300050510 | nmdc:mga06r32_624925_c1 | nmdc:mga06r32_624925_c1_203_667 | 148 |
| 866 | 3300061734 | Ga0530510_0323169 | Ga0530510_0323169_261_716 | 148 |
| 867 | 3300003373 | JGI25407J50210_10064186 | JGI25407J50210_100641861 | 149 |
| 868 | 3300005339 | Ga0070660_100853618 | Ga0070660_1008536182 | 149 |
| 869 | 3300005355 | Ga0070671_100957844 | Ga0070671_1009578441 | 149 |
| 870 | 3300005719 | Ga0068861_100523350 | Ga0068861_1005233501 | 149 |
| 871 | 3300005842 | Ga0068858_101140088 | Ga0068858_1011400881 | 149 |
| 872 | 3300005844 | Ga0068862_100603407 | Ga0068862_1006034072 | 149 |
| 873 | 3300005981 | Ga0081538_10000169 | Ga0081538_1000016939 | 149 |
| 874 | 3300005981 | Ga0081538_10006323 | Ga0081538_100063231 | 149 |
| 875 | 3300005981 | Ga0081538_10010481 | Ga0081538_100104817 | 149 |
| 876 | 3300006846 | Ga0075430_100003262 | Ga0075430_1000032624 | 149 |
| 877 | 3300006846 | Ga0075430_101719440 | Ga0075430_1017194401 | 149 |
| 878 | 3300006847 | Ga0075431_100308493 | Ga0075431_1003084932 | 149 |
| 879 | 3300006847 | Ga0075431_100314032 | Ga0075431_1003140323 | 149 |
| 880 | 3300009094 | Ga0111539_10345316 | Ga0111539_103453162 | 149 |
| 881 | 3300009094 | Ga0111539_12493335 | Ga0111539_124933351 | 149 |
| 882 | 3300009147 | Ga0114129_10158733 | Ga0114129_101587332 | 149 |
| 883 | 3300009147 | Ga0114129_10165258 | Ga0114129_101652582 | 149 |
| 884 | 3300009147 | Ga0114129_10202666 | Ga0114129_102026662 | 149 |
| 885 | 3300009147 | Ga0114129_11293864 | Ga0114129_112938642 | 149 |
| 886 | 3300009147 | Ga0114129_12081929 | Ga0114129_120819291 | 149 |
| 887 | 3300010375 | Ga0105239_10605418 | Ga0105239_106054182 | 149 |
| 888 | 3300025919 | Ga0207657_10483936 | Ga0207657_104839361 | 149 |
| 889 | 3300027907 | Ga0207428_10184362 | Ga0207428_101843622 | 149 |
| 890 | 3300031903 | Ga0307407_10673025 | Ga0307407_106730252 | 149 |
| 891 | 3300032002 | Ga0307416_100540174 | Ga0307416_1005401742 | 149 |
| 892 | 3300032126 | Ga0307415_100878998 | Ga0307415_1008789982 | 149 |
| 893 | 3300035170 | Ga0373943_0097273 | Ga0373943_0097273_255_710 | 149 |
| 894 | 3300037068 | Ga0373925_0127391 | Ga0373925_0127391_816_1271 | 149 |
| 895 | 3300037466 | Ga0395898_0587861 | Ga0395898_0587861_335_790 | 149 |
| 896 | 3300038443 | Ga0395901_0333098 | Ga0395901_0333098_123_578 | 149 |
| 897 | 3300039437 | Ga0436365_0080349 | Ga0436365_0080349_1063_1515 | 149 |
| 898 | 3300045976 | Ga0466967_0030212 | Ga0466967_0030212_2978_3430 | 149 |
| 899 | 3300045976 | Ga0466967_0751181 | Ga0466967_0751181_445_900 | 149 |
| 900 | 3300045976 | Ga0466967_1205463 | Ga0466967_1205463_272_724 | 149 |
| 901 | 3300046665 | Ga0495661_0127460 | Ga0495661_0127460_24_482 | 149 |
| 902 | 3300047321 | Ga0495676_0386603 | Ga0495676_0386603_308_763 | 149 |
| 903 | 3300048903 | Ga0496100_1210574 | Ga0496100_1210574_125_577 | 149 |
| 904 | 3300048906 | Ga0496103_0229582 | Ga0496103_0229582_370_822 | 149 |
| 905 | 3300048917 | Ga0496114_0677253 | Ga0496114_0677253_71_523 | 149 |
| 906 | 3300049573 | Ga0501037_0554984 | Ga0501037_0554984_143_601 | 149 |
| 907 | 3300049575 | Ga0501039_0061911 | Ga0501039_0061911_673_1131 | 149 |
| 908 | 3300049582 | Ga0501048_0188785 | Ga0501048_0188785_655_1113 | 149 |
| 909 | 3300049583 | Ga0501067_0490032 | Ga0501067_0490032_21_473 | 149 |
| 910 | 3300049587 | Ga0501071_0112827 | Ga0501071_0112827_753_1211 | 149 |
| 911 | 3300049592 | Ga0501076_0187133 | Ga0501076_0187133_52_510 | 149 |
| 912 | 3300050507 | nmdc:mga05p37_135113_c1 | nmdc:mga05p37_135113_c1_2104_2562 | 149 |
| 913 | 3300050507 | nmdc:mga05p37_1548414_c1 | nmdc:mga05p37_1548414_c1_136_591 | 149 |
| 914 | 3300050507 | nmdc:mga05p37_421060_c1 | nmdc:mga05p37_421060_c1_371_829 | 149 |
| 915 | 3300050507 | nmdc:mga05p37_764306_c1 | nmdc:mga05p37_764306_c1_330_788 | 149 |
| 916 | 3300050509 | nmdc:mga0qj67_22421_c1 | nmdc:mga0qj67_22421_c1_3193_3648 | 149 |
| 917 | 3300050510 | nmdc:mga06r32_110190_c1 | nmdc:mga06r32_110190_c1_1128_1583 | 149 |
| 918 | 3300050511 | nmdc:mga08y16_1167048_c1 | nmdc:mga08y16_1167048_c1_205_666 | 149 |
| 919 | 3300050511 | nmdc:mga08y16_280795_c1 | nmdc:mga08y16_280795_c1_967_1425 | 149 |
| 920 | 3300054114 | Ga0501084_0053276 | Ga0501084_0053276_2045_2503 | 149 |
| 921 | 3300000549 | LJQas_1041288 | LJQas_10412881 | 150 |
| 922 | 3300004799 | Ga0058863_11942618 | Ga0058863_119426182 | 150 |
| 923 | 3300004800 | Ga0058861_10018033 | Ga0058861_100180331 | 150 |
| 924 | 3300004800 | Ga0058861_10095910 | Ga0058861_100959102 | 150 |
| 925 | 3300004803 | Ga0058862_12871359 | Ga0058862_128713591 | 150 |
| 926 | 3300005327 | Ga0070658_10192327 | Ga0070658_101923273 | 150 |
| 927 | 3300005329 | Ga0070683_100027055 | Ga0070683_1000270555 | 150 |
| 928 | 3300005329 | Ga0070683_100361528 | Ga0070683_1003615281 | 150 |
| 929 | 3300005334 | Ga0068869_100779971 | Ga0068869_1007799712 | 150 |
| 930 | 3300005336 | Ga0070680_100013514 | Ga0070680_1000135142 | 150 |
| 931 | 3300005337 | Ga0070682_100077760 | Ga0070682_1000777602 | 150 |
| 932 | 3300005339 | Ga0070660_100027936 | Ga0070660_1000279364 | 150 |
| 933 | 3300005341 | Ga0070691_10252833 | Ga0070691_102528332 | 150 |
| 934 | 3300005344 | Ga0070661_100243727 | Ga0070661_1002437272 | 150 |
| 935 | 3300005345 | Ga0070692_10114640 | Ga0070692_101146403 | 150 |
| 936 | 3300005366 | Ga0070659_100001090 | Ga0070659_1000010908 | 150 |
| 937 | 3300005455 | Ga0070663_100370573 | Ga0070663_1003705731 | 150 |
| 938 | 3300005458 | Ga0070681_10053595 | Ga0070681_100535954 | 150 |
| 939 | 3300005530 | Ga0070679_100007731 | Ga0070679_1000077319 | 150 |
| 940 | 3300005530 | Ga0070679_100102311 | Ga0070679_1001023112 | 150 |
| 941 | 3300005535 | Ga0070684_100043240 | Ga0070684_1000432403 | 150 |
| 942 | 3300005535 | Ga0070684_100076661 | Ga0070684_1000766614 | 150 |
| 943 | 3300005539 | Ga0068853_100181114 | Ga0068853_1001811142 | 150 |
| 944 | 3300005549 | Ga0070704_100781742 | Ga0070704_1007817422 | 150 |
| 945 | 3300005563 | Ga0068855_101583571 | Ga0068855_1015835712 | 150 |
| 946 | 3300005564 | Ga0070664_100231868 | Ga0070664_1002318681 | 150 |
| 947 | 3300005577 | Ga0068857_100095645 | Ga0068857_1000956452 | 150 |
| 948 | 3300005614 | Ga0068856_100021501 | Ga0068856_1000215013 | 150 |
| 949 | 3300005616 | Ga0068852_100018498 | Ga0068852_1000184985 | 150 |
| 950 | 3300005937 | Ga0081455_10096425 | Ga0081455_100964253 | 150 |
| 951 | 3300005981 | Ga0081538_10029713 | Ga0081538_100297133 | 150 |
| 952 | 3300005981 | Ga0081538_10109548 | Ga0081538_101095481 | 150 |
| 953 | 3300005981 | Ga0081538_10201070 | Ga0081538_102010702 | 150 |
| 954 | 3300006038 | Ga0075365_10483760 | Ga0075365_104837602 | 150 |
| 955 | 3300006844 | Ga0075428_100374456 | Ga0075428_1003744563 | 150 |
| 956 | 3300006846 | Ga0075430_100121169 | Ga0075430_1001211692 | 150 |
| 957 | 3300006880 | Ga0075429_100101123 | Ga0075429_1001011234 | 150 |
| 958 | 3300009093 | Ga0105240_10008942 | Ga0105240_1000894216 | 150 |
| 959 | 3300009094 | Ga0111539_11408874 | Ga0111539_114088742 | 150 |
| 960 | 3300009147 | Ga0114129_10355863 | Ga0114129_103558633 | 150 |
| 961 | 3300009545 | Ga0105237_10049038 | Ga0105237_100490382 | 150 |
| 962 | 3300009551 | Ga0105238_10233208 | Ga0105238_102332082 | 150 |
| 963 | 3300010375 | Ga0105239_10072996 | Ga0105239_100729965 | 150 |
| 964 | 3300013102 | Ga0157371_10114126 | Ga0157371_101141262 | 150 |
| 965 | 3300013104 | Ga0157370_10007123 | Ga0157370_100071235 | 150 |
| 966 | 3300013105 | Ga0157369_10006254 | Ga0157369_1000625413 | 150 |
| 967 | 3300013105 | Ga0157369_10205232 | Ga0157369_102052323 | 150 |
| 968 | 3300013307 | Ga0157372_10023313 | Ga0157372_100233133 | 150 |
| 969 | 3300013307 | Ga0157372_10385187 | Ga0157372_103851872 | 150 |
| 970 | 3300020069 | Ga0197907_10303868 | Ga0197907_103038681 | 150 |
| 971 | 3300020069 | Ga0197907_11011833 | Ga0197907_110118331 | 150 |
| 972 | 3300020070 | Ga0206356_10218075 | Ga0206356_102180752 | 150 |
| 973 | 3300020070 | Ga0206356_11205897 | Ga0206356_112058971 | 150 |
| 974 | 3300020075 | Ga0206349_1187371 | Ga0206349_11873711 | 150 |
| 975 | 3300020077 | Ga0206351_10461011 | Ga0206351_104610111 | 150 |
| 976 | 3300020078 | Ga0206352_10659006 | Ga0206352_106590062 | 150 |
| 977 | 3300020080 | Ga0206350_11617956 | Ga0206350_116179561 | 150 |
| 978 | 3300020081 | Ga0206354_10011853 | Ga0206354_100118532 | 150 |
| 979 | 3300020082 | Ga0206353_10752841 | Ga0206353_107528411 | 150 |
| 980 | 3300020082 | Ga0206353_11402362 | Ga0206353_114023622 | 150 |
| 981 | 3300020610 | Ga0154015_1665967 | Ga0154015_16659673 | 150 |
| 982 | 3300022467 | Ga0224712_10030580 | Ga0224712_100305804 | 150 |
| 983 | 3300022467 | Ga0224712_10055400 | Ga0224712_100554004 | 150 |
| 984 | 3300022467 | Ga0224712_10108653 | Ga0224712_101086531 | 150 |
| 985 | 3300025909 | Ga0207705_10636199 | Ga0207705_106361991 | 150 |
| 986 | 3300025912 | Ga0207707_10003121 | Ga0207707_1000312114 | 150 |
| 987 | 3300025912 | Ga0207707_10045352 | Ga0207707_100453521 | 150 |
| 988 | 3300025913 | Ga0207695_10030945 | Ga0207695_100309454 | 150 |
| 989 | 3300025914 | Ga0207671_10280151 | Ga0207671_102801511 | 150 |
| 990 | 3300025917 | Ga0207660_10033479 | Ga0207660_100334794 | 150 |
| 991 | 3300025917 | Ga0207660_10511571 | Ga0207660_105115712 | 150 |
| 992 | 3300025919 | Ga0207657_10009720 | Ga0207657_100097209 | 150 |
| 993 | 3300025920 | Ga0207649_10015628 | Ga0207649_100156285 | 150 |
| 994 | 3300025921 | Ga0207652_10018700 | Ga0207652_100187006 | 150 |
| 995 | 3300025924 | Ga0207694_10043711 | Ga0207694_100437113 | 150 |
| 996 | 3300025932 | Ga0207690_10008222 | Ga0207690_100082223 | 150 |
| 997 | 3300025937 | Ga0207669_10334430 | Ga0207669_103344303 | 150 |
| 998 | 3300025944 | Ga0207661_10000599 | Ga0207661_1000059919 | 150 |
| 999 | 3300025945 | Ga0207679_10150819 | Ga0207679_101508194 | 150 |
| 1000 | 3300025949 | Ga0207667_11258810 | Ga0207667_112588101 | 150 |
| 1001 | 3300026041 | Ga0207639_10047917 | Ga0207639_100479174 | 150 |
| 1002 | 3300026078 | Ga0207702_10059276 | Ga0207702_100592763 | 150 |
| 1003 | 3300026142 | Ga0207698_10258159 | Ga0207698_102581592 | 150 |
| 1004 | 3300031548 | Ga0307408_100344126 | Ga0307408_1003441262 | 150 |
| 1005 | 3300031731 | Ga0307405_10741164 | Ga0307405_107411642 | 150 |
| 1006 | 3300031824 | Ga0307413_10101734 | Ga0307413_101017342 | 150 |
| 1007 | 3300031824 | Ga0307413_10119173 | Ga0307413_101191733 | 150 |
| 1008 | 3300031852 | Ga0307410_10105406 | Ga0307410_101054061 | 150 |
| 1009 | 3300031901 | Ga0307406_10035203 | Ga0307406_100352034 | 150 |
| 1010 | 3300031903 | Ga0307407_10055796 | Ga0307407_100557962 | 150 |
| 1011 | 3300031995 | Ga0307409_100066780 | Ga0307409_1000667801 | 150 |
| 1012 | 3300031995 | Ga0307409_100667766 | Ga0307409_1006677662 | 150 |
| 1013 | 3300032002 | Ga0307416_100326620 | Ga0307416_1003266202 | 150 |
| 1014 | 3300032005 | Ga0307411_10316353 | Ga0307411_103163531 | 150 |
| 1015 | 3300032005 | Ga0307411_10355804 | Ga0307411_103558041 | 150 |
| 1016 | 3300032126 | Ga0307415_100080697 | Ga0307415_1000806974 | 150 |
| 1017 | 3300037471 | Ga0395905_0364967 | Ga0395905_0364967_193_651 | 150 |
| 1018 | 3300038443 | Ga0395901_0735708 | Ga0395901_0735708_309_767 | 150 |
| 1019 | 3300041503 | Ga0451847_0146959 | Ga0451847_0146959_235_696 | 150 |
| 1020 | 3300045976 | Ga0466967_0058577 | Ga0466967_0058577_79_531 | 150 |
| 1021 | 3300046500 | Ga0495596_0125313 | Ga0495596_0125313_123_578 | 150 |
| 1022 | 3300046513 | Ga0495616_0206562 | Ga0495616_0206562_135_596 | 150 |
| 1023 | 3300046518 | Ga0495631_0156094 | Ga0495631_0156094_41_502 | 150 |
| 1024 | 3300046616 | Ga0495668_0181270 | Ga0495668_0181270_674_1135 | 150 |
| 1025 | 3300048906 | Ga0496103_0172314 | Ga0496103_0172314_910_1371 | 150 |
| 1026 | 3300048911 | Ga0496108_0323583 | Ga0496108_0323583_227_679 | 150 |
| 1027 | 3300048912 | Ga0496109_0914498 | Ga0496109_0914498_334_786 | 150 |
| 1028 | 3300048913 | Ga0496110_0821511 | Ga0496110_0821511_179_631 | 150 |
| 1029 | 3300048914 | Ga0496111_0173409 | Ga0496111_0173409_190_642 | 150 |
| 1030 | 3300049572 | Ga0501036_0086481 | Ga0501036_0086481_548_1009 | 150 |
| 1031 | 3300049578 | Ga0501042_0110441 | Ga0501042_0110441_572_1033 | 150 |
| 1032 | 3300049591 | Ga0501075_0540490 | Ga0501075_0540490_92_553 | 150 |
| 1033 | 3300049824 | Ga0501045_0257607 | Ga0501045_0257607_243_704 | 150 |
| 1034 | 3300050494 | nmdc:mga06z11_573058_c1 | nmdc:mga06z11_573058_c1_97_555 | 150 |
| 1035 | 3300050507 | nmdc:mga05p37_670336_c1 | nmdc:mga05p37_670336_c1_142_600 | 150 |
| 1036 | 3300050507 | nmdc:mga05p37_902306_c1 | nmdc:mga05p37_902306_c1_10_471 | 150 |
| 1037 | 3300050508 | nmdc:mga09592_270371_c1 | nmdc:mga09592_270371_c1_15_476 | 150 |
| 1038 | 3300050508 | nmdc:mga09592_612435_c1 | nmdc:mga09592_612435_c1_61_519 | 150 |
| 1039 | 3300050509 | nmdc:mga0qj67_198569_c1 | nmdc:mga0qj67_198569_c1_838_1296 | 150 |
| 1040 | 3300050510 | nmdc:mga06r32_291772_c1 | nmdc:mga06r32_291772_c1_959_1417 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bhx-assembly1.cif.gz_D | b. subtilis ssba with dna | 0.9546 | 5 | 110 |
| 2cwa-assembly1.cif.gz_A | crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 | 0.9513 | 6 | 109 |
| 6bhw-assembly2.cif.gz_E | b. subtilis ssba | 0.9478 | 5 | 109 |
| 6bhx-assembly1.cif.gz_D | b. subtilis ssba with dna | 0.9451 | 5 | 110 |
| 3tqy-assembly1.cif.gz_D | structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii | 0.9429 | 5 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9169 | 1 | 109 | 2.40.50.140 |
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.908 | 1 | 109 | 2.40.50.140 |
| 6bhwF00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8948 | 5 | 108 | 2.40.50.140 |
| af_C4J9S9_72_176_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8943 | 7 | 111 | 2.40.50.140 |
| af_Q2G112_1_115_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8932 | 5 | 110 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A552VCC4-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9132 | 6 | 109 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A6M3JK56-F1-model_v4 | Putative single-stranded DNA-binding protein | 0.9103 | 4 | 104 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A316KG36-F1-model_v4 | Single-stranded DNA-binding protein | 0.9102 | 2 | 109 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A2V9H5Y2-F1-model_v4 | Single-stranded DNA-binding protein | 0.91 | 4 | 113 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A7Y4QE12-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.9096 | 4 | 113 |
GO:0003697
GO:0006260 GO:0009295 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar