F488782

General Info

Members Datasets Scaffolds Average Seq Length
1039 529 943 340

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10020087|Ga0075432_100200872
Length 371
Sequence MKNLGTIFLLFVLLTVPLWVTDQYYLHIVITTGIFIIGAMSLNLLLGFTGQLSLGHIAFFGIGAYTSALTSLGFDIPVFWGDGRIIHEAWHPVIGILLGTFVAGVCGYVVGKLSFKIRGAYFVIVTISFAEVVRLVALNWVDLTQGPLALSNIPPLGYNLPGLGEMVFWAKAPNYYLVLALALVAYVLIRRIVRSRMGRAMIALRENESLATSVGIDVTRYLVFAAVVSAALAGATGSLYAHYIRIIDPDIFLFVYTVTMVIMVVTGGKGTLAGPIVGGVIFGALPVGLRAVAAPEVQWIVYGIVMILIVFFLPRGIVPAVSDYWHRKTGSSPRHTRATPSAPSKQSPEQASKWDGAASQTMLSAKALTGK

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
13 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
14 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
15 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
19 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
26 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
27 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
28 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
29 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
30 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
34 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
35 2842694124 Methylopila sp. R-72369 Isolate Unclassified
36 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
37 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
38 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
39 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
40 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
41 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
42 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
43 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
44 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
45 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
46 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
47 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
48 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
49 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
50 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
51 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
52 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
53 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
54 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
55 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
56 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
57 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
58 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
59 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
60 2906610324
61 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
62 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
63 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
64 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
65 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
66 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
67 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
68 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
69 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
70 2922425934
71 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
72 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
73 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
74 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
75 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
76 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
77 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
78 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
79 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
80 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
81 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
82 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
83 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
84 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
85 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
86 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
87 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
88 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
89 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
90 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
91 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
92 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
103 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
104 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
105 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
122 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
123 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
124 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
125 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
126 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
127 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
128 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
129 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
132 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
133 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
149 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
150 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
151 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
152 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
153 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
160 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
161 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
162 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
163 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
164 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
165 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
168 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
169 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
170 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
175 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
176 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
177 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
178 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
179 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
180 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
181 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
182 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
183 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
185 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
186 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
190 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
211 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
212 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
213 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
214 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
215 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
216 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
217 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
218 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
219 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
220 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
225 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
287 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
288 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
290 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
291 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
294 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
300 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
303 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
304 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
305 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
306 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
307 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
308 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
309 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
310 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
311 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
312 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
314 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
317 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
318 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
319 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
320 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
334 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
335 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
336 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
337 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
338 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
353 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
354 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
359 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
394 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
395 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
396 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
397 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
398 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
403 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
444 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
457 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
458 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
459 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
470 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
475 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
479 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
480 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
481 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
482 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
485 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
486 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
487 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
488 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
489 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
490 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
498 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
499 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
500 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
501 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
502 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
503 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
504 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
507 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
508 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
509 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
510 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
511 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
512 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
516 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
517 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
518 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
519 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
520 641522639 Methylobacterium sp. 4-46 Isolate Nodule
521 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
522 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
528 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
529 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.94
Metatranscriptomes 0
Isolates 9.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.13
Nodule 5.49
Rhizoplane 8.57
Rhizosphere 63.33
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10032906 3300001990 Bacteria 1612
2 JGI24744J21845_10002032 3300002077 Bacteria 4101
3 JGI24033J26618_1003073 3300002155 Bacteria 1744
4 JGI25153J46596_10000068 3300003215 Bacteria 117909
5 JGI25153J46596_10000094 3300003215 Bacteria 103036
6 JGI25153J46596_10002675 3300003215 Bacteria 10176
7 JGI25160J50197_1000777 3300003354 Bacteria 17100
8 JGI25404J52841_10000108 3300003659 Bacteria 8267
9 Ga0055531_10018269 3300003794 Bacteria 2904
10 Ga0065165_1001845 3300005262 Bacteria 20647
11 Ga0065165_1005504 3300005262 Bacteria 7081
12 Ga0065704_10020805 3300005289 Bacteria 1912
13 Ga0070676_10035764 3300005328 Bacteria 2858
14 Ga0070690_100040155 3300005330 Bacteria 2959
15 Ga0070690_100123144 3300005330 Bacteria 1743
16 Ga0070670_100010874 3300005331 Bacteria 7773
17 Ga0070670_100051718 3300005331 Bacteria 3528
18 Ga0068869_100055588 3300005334 Bacteria 2885
19 Ga0068869_100119789 3300005334 Bacteria 2012
20 Ga0068869_100175633 3300005334 Bacteria 1676
21 Ga0070666_10147580 3300005335 Bacteria 1640
22 Ga0070680_100011909 3300005336 Bacteria 6748
23 Ga0070680_100013678 3300005336 Bacteria 6327
24 Ga0070680_100177071 3300005336 Bacteria 1795
25 Ga0068868_100023511 3300005338 Bacteria 4665
26 Ga0070689_100059991 3300005340 Bacteria 2957
27 Ga0070689_100082543 3300005340 Bacteria 2525
28 Ga0070691_10009631 3300005341 Bacteria 4408
29 Ga0070687_100002478 3300005343 Bacteria 6943
30 Ga0070687_100064871 3300005343 Bacteria 1941
31 Ga0070661_100331832 3300005344 Bacteria 1190
32 Ga0070692_10120819 3300005345 Bacteria 1461
33 Ga0070692_10155862 3300005345 Bacteria 1304
34 Ga0070668_100109997 3300005347 Bacteria 2192
35 Ga0070669_100013682 3300005353 Bacteria 5769
36 Ga0070669_100060444 3300005353 Bacteria 2783
37 Ga0070675_100003565 3300005354 Bacteria 11829
38 Ga0070671_100012862 3300005355 Bacteria 6748
39 Ga0070671_100053207 3300005355 Bacteria 3365
40 Ga0070671_100063572 3300005355 Bacteria 3073
41 Ga0070674_100039243 3300005356 Bacteria 3196
42 Ga0070674_100060525 3300005356 Bacteria 2640
43 Ga0070674_100287504 3300005356 Bacteria 1306
44 Ga0070673_100084789 3300005364 Bacteria 2578
45 Ga0070673_100469065 3300005364 Bacteria 1135
46 Ga0070688_100002030 3300005365 Bacteria 10204
47 Ga0070659_100032166 3300005366 Bacteria 4067
48 Ga0070659_100060819 3300005366 Bacteria 2984
49 Ga0070667_100004500 3300005367 Bacteria 11760
50 Ga0070667_100030529 3300005367 Bacteria 4495
51 Ga0070667_100113122 3300005367 Bacteria 2355
52 Ga0070709_10004866 3300005434 Bacteria 7259
53 Ga0070709_10199039 3300005434 Bacteria 1418
54 Ga0070714_100001309 3300005435 Bacteria 17977
55 Ga0070714_100204624 3300005435 Bacteria 1807
56 Ga0070714_100429654 3300005435 Bacteria 1252
57 Ga0070714_100464283 3300005435 Bacteria 1204
58 Ga0070713_100002404 3300005436 Bacteria 12210
59 Ga0070713_100138447 3300005436 Bacteria 2154
60 Ga0070710_10004275 3300005437 Bacteria 6770
61 Ga0070710_10177003 3300005437 Bacteria 1333
62 Ga0070711_100000362 3300005439 Bacteria 23459
63 Ga0070711_100015017 3300005439 Bacteria 4894
64 Ga0070711_100028066 3300005439 Bacteria 3700
65 Ga0070705_100004675 3300005440 Bacteria 6667
66 Ga0070700_100018434 3300005441 Bacteria 4012
67 Ga0070700_100115285 3300005441 Bacteria 1792
68 Ga0070700_100215770 3300005441 Bacteria 1356
69 Ga0070694_100002889 3300005444 Bacteria 10208
70 Ga0070694_100138247 3300005444 Bacteria 1767
71 Ga0070708_100008473 3300005445 Bacteria 8257
72 Ga0070708_100062084 3300005445 Bacteria 3340
73 Ga0070663_100007257 3300005455 Bacteria 6738
74 Ga0070663_100021917 3300005455 Bacteria 4259
75 Ga0070663_100029127 3300005455 Bacteria 3768
76 Ga0070663_100031511 3300005455 Bacteria 3644
77 Ga0070678_100042423 3300005456 Bacteria 3233
78 Ga0070678_100071874 3300005456 Bacteria 2591
79 Ga0070678_100195659 3300005456 Bacteria 1665
80 Ga0070662_100081318 3300005457 Bacteria 2413
81 Ga0070662_100174128 3300005457 Bacteria 1692
82 Ga0070662_100175436 3300005457 Bacteria 1686
83 Ga0070681_10020166 3300005458 Bacteria 6682
84 Ga0070681_10066987 3300005458 Bacteria 3559
85 Ga0070681_10152622 3300005458 Bacteria 2236
86 Ga0068867_100033474 3300005459 Bacteria 3722
87 Ga0068867_100045107 3300005459 Bacteria 3231
88 Ga0070685_10029846 3300005466 Bacteria 3033
89 Ga0070685_10076575 3300005466 Bacteria 1995
90 Ga0070699_100000545 3300005518 Bacteria 35461
91 Ga0070699_100035875 3300005518 Bacteria 4287
92 Ga0070699_100116591 3300005518 Bacteria 2347
93 Ga0070679_100113019 3300005530 Bacteria 2701
94 Ga0070697_100015043 3300005536 Bacteria 6073
95 Ga0068853_100031522 3300005539 Bacteria 4483
96 Ga0068853_100056742 3300005539 Bacteria 3378
97 Ga0068853_100444590 3300005539 Bacteria 1219
98 Ga0070672_100004369 3300005543 Bacteria 9260
99 Ga0070686_100005070 3300005544 Bacteria 7272
100 Ga0070686_100366433 3300005544 Bacteria 1087
101 Ga0070695_100004516 3300005545 Bacteria 8168
102 Ga0070695_100007706 3300005545 Bacteria 6377
103 Ga0070695_100191255 3300005545 Bacteria 1457
104 Ga0070696_100000249 3300005546 Bacteria 32415
105 Ga0070696_100012128 3300005546 Bacteria 5775
106 Ga0070696_100057255 3300005546 Bacteria 2720
107 Ga0070696_100183914 3300005546 Bacteria 1551
108 Ga0070693_100008195 3300005547 Bacteria 5136
109 Ga0070693_100124044 3300005547 Bacteria 1605
110 Ga0070665_100115402 3300005548 Bacteria 2688
111 Ga0070665_100165949 3300005548 Bacteria 2210
112 Ga0070704_100029961 3300005549 Bacteria 3641
113 Ga0070704_100048479 3300005549 Bacteria 2973
114 Ga0070704_100174802 3300005549 Bacteria 1712
115 Ga0068855_100025399 3300005563 Bacteria 7089
116 Ga0068855_100060100 3300005563 Bacteria 4446
117 Ga0068855_100123173 3300005563 Bacteria 2966
118 Ga0070664_100043666 3300005564 Bacteria 3783
119 Ga0068857_100014404 3300005577 Bacteria 6895
120 Ga0068854_100079306 3300005578 Bacteria 2420
121 Ga0068856_100108101 3300005614 Bacteria 2778
122 Ga0068856_100166670 3300005614 Bacteria 2214
123 Ga0068856_100252217 3300005614 Bacteria 1780
124 Ga0070702_100005145 3300005615 Bacteria 6055
125 Ga0070702_100267274 3300005615 Bacteria 1168
126 Ga0068859_100016683 3300005617 Bacteria 7373
127 Ga0068859_100039940 3300005617 Bacteria 4710
128 Ga0068859_100284152 3300005617 Bacteria 1747
129 Ga0068864_100045321 3300005618 Bacteria 3772
130 Ga0068864_100168521 3300005618 Bacteria 1995
131 Ga0068864_100575089 3300005618 Bacteria 1091
132 Ga0068866_10001554 3300005718 Bacteria 9755
133 Ga0068866_10005088 3300005718 Bacteria 5418
134 Ga0068861_100011419 3300005719 Bacteria 6175
135 Ga0068870_10064265 3300005840 Bacteria 1982
136 Ga0068863_100082082 3300005841 Bacteria 3054
137 Ga0068863_100567432 3300005841 Bacteria 1121
138 Ga0068858_100005194 3300005842 Bacteria 12756
139 Ga0068858_100025390 3300005842 Bacteria 5513
140 Ga0068860_100016382 3300005843 Bacteria 7228
141 Ga0068860_100049518 3300005843 Bacteria 4001
142 Ga0068860_100369935 3300005843 Bacteria 1413
143 Ga0068862_100005647 3300005844 Bacteria 10446
144 Ga0081455_10000029 3300005937 Bacteria 155672
145 Ga0081455_10003782 3300005937 Bacteria 17285
146 Ga0081455_10005788 3300005937 Bacteria 13470
147 Ga0081455_10031199 3300005937 Bacteria 4827
148 Ga0081455_10052904 3300005937 Bacteria 3473
149 Ga0081455_10057782 3300005937 Bacteria 3286
150 Ga0081538_10006418 3300005981 Bacteria 10357
151 Ga0081538_10017150 3300005981 Bacteria 5509
152 Ga0081538_10020850 3300005981 Bacteria 4809
153 Ga0081540_1000048 3300005983 Bacteria 127924
154 Ga0081540_1000937 3300005983 Bacteria 26234
155 Ga0081540_1001679 3300005983 Bacteria 18835
156 Ga0081540_1005784 3300005983 Bacteria 9152
157 Ga0081540_1008639 3300005983 Bacteria 7098
158 Ga0081540_1015468 3300005983 Bacteria 4831
159 Ga0081540_1020642 3300005983 Bacteria 3953
160 Ga0081540_1058933 3300005983 Bacteria 1846
161 Ga0081539_10004692 3300005985 Bacteria 14824
162 Ga0070717_10002967 3300006028 Bacteria 12064
163 Ga0070717_10074371 3300006028 Bacteria 2840
164 Ga0075365_10003935 3300006038 Bacteria 7775
165 Ga0075365_10021126 3300006038 Bacteria 4055
166 Ga0075365_10039788 3300006038 Bacteria 3063
167 Ga0075368_10000671 3300006042 Bacteria 10423
168 Ga0075368_10007055 3300006042 Bacteria 3955
169 Ga0075368_10072004 3300006042 Bacteria 1397
170 Ga0075363_100000761 3300006048 Bacteria 11035
171 Ga0075363_100013498 3300006048 Bacteria 3962
172 Ga0075363_100153852 3300006048 Bacteria 1299
173 Ga0075364_10009955 3300006051 Bacteria 5721
174 Ga0075364_10013926 3300006051 Bacteria 4957
175 Ga0075364_10094586 3300006051 Bacteria 1986
176 Ga0075432_10020087 3300006058 Bacteria 2284
177 Ga0070715_10011015 3300006163 Bacteria 3242
178 Ga0070715_10059722 3300006163 Bacteria 1669
179 Ga0070715_10076423 3300006163 Bacteria 1509
180 Ga0070716_100011005 3300006173 Bacteria 4552
181 Ga0070716_100013289 3300006173 Bacteria 4193
182 Ga0070716_100018949 3300006173 Bacteria 3591
183 Ga0070712_100057934 3300006175 Bacteria 2723
184 Ga0070712_100064170 3300006175 Bacteria 2603
185 Ga0070712_100140922 3300006175 Bacteria 1840
186 Ga0075367_10002090 3300006178 Bacteria 8952
187 Ga0075367_10035633 3300006178 Bacteria 2881
188 Ga0075369_10000436 3300006186 Bacteria 12671
189 Ga0075369_10008913 3300006186 Bacteria 3881
190 Ga0075369_10012833 3300006186 Bacteria 3313
191 Ga0075369_10079228 3300006186 Bacteria 1455
192 Ga0075366_10022499 3300006195 Bacteria 3668
193 Ga0075366_10078135 3300006195 Bacteria 1975
194 Ga0097621_100145673 3300006237 Bacteria 2028
195 Ga0075370_10041668 3300006353 Bacteria 2592
196 Ga0075428_100024125 3300006844 Bacteria 6728
197 Ga0075428_100053458 3300006844 Bacteria 4425
198 Ga0075428_100058333 3300006844 Bacteria 4226
199 Ga0075428_100069932 3300006844 Bacteria 3837
200 Ga0075428_100096916 3300006844 Bacteria 3215
201 Ga0075428_100100255 3300006844 Bacteria 3158
202 Ga0075428_100117413 3300006844 Bacteria 2898
203 Ga0075428_100194866 3300006844 Bacteria 2191
204 Ga0075428_100200691 3300006844 Bacteria 2156
205 Ga0075428_100204869 3300006844 Bacteria 2132
206 Ga0075430_100007063 3300006846 Bacteria 9469
207 Ga0075430_100012474 3300006846 Bacteria 7232
208 Ga0075430_100014692 3300006846 Bacteria 6670
209 Ga0075430_100115306 3300006846 Bacteria 2238
210 Ga0075431_100001007 3300006847 Bacteria 25062
211 Ga0075431_100002204 3300006847 Bacteria 18653
212 Ga0075431_100004487 3300006847 Bacteria 13696
213 Ga0075431_100020866 3300006847 Bacteria 6695
214 Ga0075431_100026130 3300006847 Bacteria 5989
215 Ga0075431_100055261 3300006847 Bacteria 4095
216 Ga0075431_100206039 3300006847 Bacteria 2011
217 Ga0075431_100258715 3300006847 Bacteria 1767
218 Ga0075433_10000125 3300006852 Bacteria 38878
219 Ga0075433_10075221 3300006852 Bacteria 2972
220 Ga0075434_100008387 3300006871 Bacteria 9607
221 Ga0075434_100377658 3300006871 Bacteria 1438
222 Ga0075429_100000183 3300006880 Bacteria 40888
223 Ga0075429_100020360 3300006880 Bacteria 5755
224 Ga0075429_100050064 3300006880 Bacteria 3635
225 Ga0068865_100067979 3300006881 Bacteria 2518
226 Ga0097620_100016683 3300006931 Bacteria 7373
227 Ga0097620_100039940 3300006931 Bacteria 4710
228 Ga0097620_100284153 3300006931 Bacteria 1747
229 Ga0099825_1033101 3300006941 Bacteria 2033
230 Ga0079104_1000772 3300006946 Bacteria 27473
231 Ga0075435_100006471 3300007076 Bacteria 8284
232 Ga0075435_100175503 3300007076 Bacteria 1809
233 Ga0105240_10021211 3300009093 Bacteria 8647
234 Ga0111539_10003120 3300009094 Bacteria 21947
235 Ga0111539_10010381 3300009094 Bacteria 11724
236 Ga0111539_10035947 3300009094 Bacteria 5995
237 Ga0111539_10168777 3300009094 Bacteria 2557
238 Ga0105245_10003785 3300009098 Bacteria 13456
239 Ga0105245_10039830 3300009098 Bacteria 4183
240 Ga0105245_10080471 3300009098 Bacteria 2976
241 Ga0105247_10006629 3300009101 Bacteria 7153
242 Ga0105247_10034192 3300009101 Bacteria 3096
243 Ga0105247_10077134 3300009101 Bacteria 2094
244 Ga0114129_10005398 3300009147 Bacteria 18046
245 Ga0114129_10021657 3300009147 Bacteria 9123
246 Ga0114129_10221736 3300009147 Bacteria 2550
247 Ga0114129_10409322 3300009147 Bacteria 1786
248 Ga0105243_10027268 3300009148 Bacteria 4375
249 Ga0105243_10115385 3300009148 Bacteria 2255
250 Ga0105243_10138101 3300009148 Bacteria 2076
251 Ga0105241_10029956 3300009174 Bacteria 4064
252 Ga0105241_10127258 3300009174 Bacteria 2058
253 Ga0105242_10104545 3300009176 Bacteria 2404
254 Ga0105248_10014926 3300009177 Bacteria 8552
255 Ga0105248_10043198 3300009177 Bacteria 5054
256 Ga0105248_10260904 3300009177 Bacteria 1951
257 Ga0105237_10046888 3300009545 Bacteria 4344
258 Ga0105237_10244619 3300009545 Bacteria 1795
259 Ga0105238_10072474 3300009551 Bacteria 3440
260 Ga0105238_10183534 3300009551 Bacteria 2069
261 Ga0105238_10201674 3300009551 Bacteria 1965
262 Ga0105249_10107666 3300009553 Bacteria 2631
263 Ga0105249_10108754 3300009553 Bacteria 2618
264 Ga0105249_10256209 3300009553 Bacteria 1737
265 Ga0105239_10128432 3300010375 Bacteria 2818
266 Ga0105239_10147389 3300010375 Bacteria 2626
267 Ga0105239_10155237 3300010375 Bacteria 2556
268 Ga0105239_10209072 3300010375 Bacteria 2187
269 Ga0105246_10006437 3300011119 Bacteria 7177
270 Ga0105246_10008875 3300011119 Bacteria 6186
271 Ga0105246_10063443 3300011119 Bacteria 2577
272 Ga0105246_10079580 3300011119 Bacteria 2331
273 Ga0157373_10022116 3300013100 Bacteria 4616
274 Ga0157371_10285144 3300013102 Bacteria 1194
275 Ga0157370_10034208 3300013104 Bacteria 4951
276 Ga0157370_10090185 3300013104 Bacteria 2879
277 Ga0157370_10090695 3300013104 Bacteria 2870
278 Ga0157369_10259333 3300013105 Bacteria 1813
279 Ga0157374_10051941 3300013296 Bacteria 3816
280 Ga0157374_10262320 3300013296 Bacteria 1702
281 Ga0157378_10136986 3300013297 Bacteria 2270
282 Ga0163162_10103627 3300013306 Bacteria 2939
283 Ga0163162_10142417 3300013306 Bacteria 2512
284 Ga0163162_10541075 3300013306 Bacteria 1293
285 Ga0157375_10009111 3300013308 Bacteria 8696
286 Ga0163163_10003696 3300014325 Bacteria 13022
287 Ga0163163_10008749 3300014325 Bacteria 9007
288 Ga0163163_10093806 3300014325 Bacteria 3018
289 Ga0163163_10294721 3300014325 Bacteria 1674
290 Ga0163163_10312257 3300014325 Bacteria 1625
291 Ga0157380_10098758 3300014326 Bacteria 2427
292 Ga0182008_10053802 3300014497 Unclassified 1993
293 Ga0157377_10226984 3300014745 Bacteria 1198
294 Ga0157379_10019887 3300014968 Bacteria 5931
295 Ga0157379_10039826 3300014968 Bacteria 4193
296 Ga0157379_10046373 3300014968 Bacteria 3877
297 Ga0157379_10150442 3300014968 Bacteria 2099
298 Ga0157376_10003716 3300014969 Bacteria 10546
299 Ga0157376_10196217 3300014969 Bacteria 1854
300 Ga0157376_10226284 3300014969 Bacteria 1735
301 Ga0214544_1000004 3300021320 Bacteria 455869
302 Ga0214542_1000001 3300021321 Bacteria 1018696
303 Ga0214542_1027275 3300021321 Bacteria 2637
304 Ga0214545_1000001 3300021324 Bacteria 1092817
305 Ga0214545_1028004 3300021324 Bacteria 2775
306 Ga0214543_1000006 3300021327 Bacteria 443395
307 Ga0214543_1029823 3300021327 Bacteria 2378
308 Ga0213876_10000816 3300021384 Bacteria 21075
309 Ga0213876_10000944 3300021384 Bacteria 19157
310 Ga0213876_10024495 3300021384 Bacteria 3186
311 Ga0213875_10000007 3300021388 Bacteria 562717
312 Ga0209233_1007993 3300025261 Bacteria 3305
313 Ga0209025_1066051 3300025294 Bacteria 1317
314 Ga0209564_1001626 3300025295 Bacteria 21795
315 Ga0209564_1008466 3300025295 Bacteria 5070
316 Ga0209758_1000024 3300025297 Bacteria 591966
317 Ga0209758_1000097 3300025297 Bacteria 230529
318 Ga0209758_1002191 3300025297 Bacteria 20457
319 Ga0209256_1001501 3300025299 Bacteria 23665
320 Ga0207426_1000439 3300025302 Bacteria 67107
321 Ga0209257_1000588 3300025304 Bacteria 60654
322 Ga0209257_1018568 3300025304 Bacteria 2667
323 Ga0207682_10001905 3300025893 Bacteria 9471
324 Ga0207692_10010733 3300025898 Bacteria 3874
325 Ga0207642_10104134 3300025899 Bacteria 1431
326 Ga0207710_10011889 3300025900 Bacteria 3662
327 Ga0207688_10001053 3300025901 Bacteria 14128
328 Ga0207688_10019972 3300025901 Bacteria 3655
329 Ga0207680_10236359 3300025903 Bacteria 1258
330 Ga0207647_10011848 3300025904 Bacteria 6094
331 Ga0207647_10022689 3300025904 Bacteria 4165
332 Ga0207647_10030106 3300025904 Bacteria 3506
333 Ga0207647_10038482 3300025904 Bacteria 3023
334 Ga0207685_10025753 3300025905 Bacteria 2035
335 Ga0207699_10010277 3300025906 Bacteria 4690
336 Ga0207645_10008189 3300025907 Bacteria 7319
337 Ga0207645_10010590 3300025907 Bacteria 6327
338 Ga0207645_10127742 3300025907 Bacteria 1653
339 Ga0207643_10003366 3300025908 Bacteria 8614
340 Ga0207643_10020063 3300025908 Bacteria 3666
341 Ga0207684_10108773 3300025910 Bacteria 2372
342 Ga0207654_10252886 3300025911 Bacteria 1182
343 Ga0207707_10018781 3300025912 Bacteria 6029
344 Ga0207707_10072454 3300025912 Bacteria 3003
345 Ga0207693_10001150 3300025915 Bacteria 23634
346 Ga0207693_10016959 3300025915 Bacteria 5817
347 Ga0207693_10024155 3300025915 Bacteria 4826
348 Ga0207693_10027969 3300025915 Bacteria 4457
349 Ga0207693_10129223 3300025915 Bacteria 1986
350 Ga0207693_10195953 3300025915 Bacteria 1589
351 Ga0207663_10002241 3300025916 Bacteria 9253
352 Ga0207660_10008445 3300025917 Bacteria 6661
353 Ga0207660_10068232 3300025917 Bacteria 2578
354 Ga0207662_10002137 3300025918 Bacteria 9837
355 Ga0207662_10072254 3300025918 Bacteria 2090
356 Ga0207657_10013624 3300025919 Bacteria 7972
357 Ga0207649_10067228 3300025920 Bacteria 2274
358 Ga0207652_10125048 3300025921 Bacteria 2290
359 Ga0207646_10039558 3300025922 Bacteria 4244
360 Ga0207681_10170299 3300025923 Bacteria 1650
361 Ga0207694_10047081 3300025924 Bacteria 3335
362 Ga0207694_10156488 3300025924 Bacteria 1838
363 Ga0207650_10039381 3300025925 Bacteria 3455
364 Ga0207650_10148324 3300025925 Bacteria 1849
365 Ga0207650_10150214 3300025925 Bacteria 1838
366 Ga0207659_10194068 3300025926 Bacteria 1617
367 Ga0207687_10001252 3300025927 Bacteria 17372
368 Ga0207687_10013163 3300025927 Bacteria 5403
369 Ga0207687_10021234 3300025927 Bacteria 4313
370 Ga0207700_10022348 3300025928 Bacteria 4340
371 Ga0207700_10217672 3300025928 Bacteria 1617
372 Ga0207664_10036615 3300025929 Bacteria 3793
373 Ga0207664_10121412 3300025929 Bacteria 2187
374 Ga0207664_10244199 3300025929 Bacteria 1565
375 Ga0207644_10040575 3300025931 Bacteria 3290
376 Ga0207706_10030478 3300025933 Bacteria 4810
377 Ga0207706_10126822 3300025933 Bacteria 2244
378 Ga0207706_10142460 3300025933 Bacteria 2109
379 Ga0207686_10009550 3300025934 Bacteria 5263
380 Ga0207709_10033632 3300025935 Bacteria 3013
381 Ga0207709_10039461 3300025935 Bacteria 2820
382 Ga0207670_10003594 3300025936 Bacteria 8224
383 Ga0207670_10091129 3300025936 Bacteria 2155
384 Ga0207670_10290929 3300025936 Bacteria 1276
385 Ga0207669_10026195 3300025937 Bacteria 3167
386 Ga0207669_10032407 3300025937 Bacteria 2934
387 Ga0207704_10068433 3300025938 Bacteria 2238
388 Ga0207665_10000775 3300025939 Bacteria 21527
389 Ga0207665_10002581 3300025939 Bacteria 12169
390 Ga0207665_10024249 3300025939 Bacteria 3999
391 Ga0207691_10022886 3300025940 Bacteria 5890
392 Ga0207691_10024151 3300025940 Bacteria 5717
393 Ga0207691_10163394 3300025940 Bacteria 1952
394 Ga0207689_10002991 3300025942 Bacteria 15584
395 Ga0207689_10009502 3300025942 Bacteria 8397
396 Ga0207689_10304709 3300025942 Unclassified 1321
397 Ga0207679_10061777 3300025945 Bacteria 2790
398 Ga0207679_10211038 3300025945 Bacteria 1628
399 Ga0207651_10157413 3300025960 Bacteria 1777
400 Ga0207712_10004686 3300025961 Bacteria 8648
401 Ga0207668_10237249 3300025972 Bacteria 1473
402 Ga0207640_10027914 3300025981 Bacteria 3444
403 Ga0207658_10010199 3300025986 Bacteria 6384
404 Ga0207677_10004452 3300026023 Bacteria 7522
405 Ga0207677_10105099 3300026023 Bacteria 2089
406 Ga0207703_10007538 3300026035 Bacteria 8631
407 Ga0207703_10007965 3300026035 Bacteria 8375
408 Ga0207703_10084126 3300026035 Bacteria 2660
409 Ga0207639_10096489 3300026041 Bacteria 2378
410 Ga0207639_10299097 3300026041 Bacteria 1422
411 Ga0207678_10002455 3300026067 Bacteria 16839
412 Ga0207678_10016550 3300026067 Bacteria 6475
413 Ga0207678_10031893 3300026067 Bacteria 4594
414 Ga0207678_10057223 3300026067 Bacteria 3355
415 Ga0207678_10081798 3300026067 Bacteria 2764
416 Ga0207708_10002956 3300026075 Bacteria 12522
417 Ga0207708_10040488 3300026075 Bacteria 3552
418 Ga0207708_10095183 3300026075 Bacteria 2300
419 Ga0207708_10128499 3300026075 Bacteria 1979
420 Ga0207708_10131512 3300026075 Bacteria 1957
421 Ga0207702_10140357 3300026078 Bacteria 2186
422 Ga0207702_10260362 3300026078 Bacteria 1633
423 Ga0207702_10375880 3300026078 Bacteria 1365
424 Ga0207702_10504217 3300026078 Bacteria 1180
425 Ga0207641_10010922 3300026088 Bacteria 7441
426 Ga0207641_10111317 3300026088 Bacteria 2427
427 Ga0207648_10003243 3300026089 Bacteria 17119
428 Ga0207648_10004365 3300026089 Bacteria 14546
429 Ga0207648_10009198 3300026089 Bacteria 9490
430 Ga0207648_10391202 3300026089 Bacteria 1258
431 Ga0207676_10002494 3300026095 Bacteria 13103
432 Ga0207676_10015497 3300026095 Bacteria 5500
433 Ga0207674_10017744 3300026116 Bacteria 7757
434 Ga0207674_10026785 3300026116 Bacteria 6115
435 Ga0207674_10111536 3300026116 Bacteria 2709
436 Ga0207674_10153745 3300026116 Bacteria 2257
437 Ga0207675_100005260 3300026118 Bacteria 12449
438 Ga0207675_100061604 3300026118 Bacteria 3502
439 Ga0207675_100072011 3300026118 Bacteria 3232
440 Ga0207675_100126982 3300026118 Bacteria 2416
441 Ga0207675_100379843 3300026118 Bacteria 1389
442 Ga0207683_10048849 3300026121 Bacteria 3702
443 Ga0207683_10260409 3300026121 Bacteria 1584
444 Ga0207698_10298476 3300026142 Bacteria 1499
445 Ga0209281_1000839 3300027111 Bacteria 27458
446 Ga0209389_1000199 3300027296 Bacteria 43170
447 Ga0209969_1001317 3300027360 Bacteria 3408
448 Ga0209489_102148 3300027361 Bacteria 40384
449 Ga0209700_100005 3300027363 Bacteria 573969
450 Ga0209967_1002257 3300027364 Bacteria 2503
451 Ga0210000_1003297 3300027462 Bacteria 2327
452 Ga0209813_10000408 3300027866 Bacteria 10485
453 Ga0209974_10020453 3300027876 Bacteria 2193
454 Ga0207428_10040114 3300027907 Bacteria 3800
455 Ga0268266_10022350 3300028379 Bacteria 5391
456 Ga0268266_10024247 3300028379 Bacteria 5162
457 Ga0268266_10040575 3300028379 Bacteria 3967
458 Ga0268265_10001732 3300028380 Bacteria 17566
459 Ga0268265_10119178 3300028380 Bacteria 2171
460 Ga0268264_10100948 3300028381 Bacteria 2507
461 Ga0307511_10000014 3300030521 Bacteria 127602
462 Ga0265316_10190919 3300031344 Bacteria 1522
463 Ga0307408_100053003 3300031548 Bacteria 2928
464 Ga0265314_10004888 3300031711 Bacteria 12255
465 Ga0316578_10020840 3300031728 Bacteria 3628
466 Ga0307405_10074589 3300031731 Bacteria 2194
467 Ga0307409_100107720 3300031995 Bacteria 2329
468 Ga0307409_100439824 3300031995 Bacteria 1256
469 Ga0307416_100478923 3300032002 Bacteria 1304
470 Ga0307415_100027417 3300032126 Bacteria 3609
471 Ga0307415_100159664 3300032126 Bacteria 1746
472 Ga0307510_10045817 3300033180 Bacteria 4712
473 Ga0307510_10047901 3300033180 Bacteria 4569
474 Ga0373934_0003068 3300035086 Bacteria 6100
475 Ga0373944_0005124 3300035089 Bacteria 3444
476 Ga0373949_0004068 3300035090 Bacteria 3387
477 Ga0373936_0045182 3300035113 Bacteria 1774
478 Ga0373945_0011192 3300035116 Bacteria 2963
479 Ga0373954_0004828 3300035118 Bacteria 5812
480 Ga0373956_0009898 3300035119 Bacteria 3886
481 Ga0373960_0009259 3300035121 Bacteria 2380
482 Ga0373943_0004642 3300035170 Bacteria 6213
483 Ga0373946_0016859 3300035171 Bacteria 2788
484 Ga0373946_0044250 3300035171 Bacteria 1838
485 Ga0373961_0004701 3300035241 Bacteria 3285
486 Ga0373961_0020627 3300035241 Bacteria 1745
487 Ga0316574_0003660 3300035398 Bacteria 7960
488 Ga0373931_0000199 3300035691 Bacteria 25657
489 Ga0373931_0001050 3300035691 Bacteria 11689
490 Ga0373935_0158844 3300035692 Bacteria 1539
491 Ga0373927_0105012 3300035695 Bacteria 1839
492 Ga0373927_0162364 3300035695 Bacteria 1464
493 Ga0373927_0179206 3300035695 Bacteria 1390
494 Ga0373933_0001341 3300035724 Bacteria 14499
495 Ga0373937_0178249 3300036401 Bacteria 1995
496 Ga0316584_0010529 3300036712 Bacteria 6467
497 Ga0373925_0048671 3300037068 Bacteria 3159
498 Ga0395900_0264308 3300037418 Bacteria 1717
499 Ga0395898_0162622 3300037466 Bacteria 2135
500 Ga0395905_0069896 3300037471 Bacteria 3289
501 Ga0436364_0207394 3300037853 Bacteria 14617
502 Ga0436364_0286306 3300037853 Bacteria 1395
503 Ga0436364_0430154 3300037853 Bacteria 16915
504 Ga0436364_0434654 3300037853 Bacteria 3712
505 Ga0395901_0385679 3300038443 Bacteria 1441
506 Ga0436365_0159339 3300039437 Bacteria 58353
507 Ga0436365_0413923 3300039437 Bacteria 6603
508 Ga0436365_0736793 3300039437 Bacteria 96466
509 Ga0436365_0940551 3300039437 Bacteria 10885
510 Ga0436365_1187256 3300039437 Bacteria 1547
511 Ga0436365_1368008 3300039437 Bacteria 6440
512 Ga0436360_0504894 3300039438 Bacteria 7022
513 Ga0436360_1076044 3300039438 Bacteria 1337
514 Ga0436361_0905452 3300039447 Bacteria 5518
515 Ga0436363_0287186 3300039450 Bacteria 2199
516 Ga0436363_0313348 3300039450 Bacteria 32729
517 Ga0436363_0703923 3300039450 Bacteria 1783
518 Ga0436363_1475436 3300039450 Bacteria 11441
519 Ga0436362_0274206 3300039453 Bacteria 1162
520 Ga0450911_000064 3300042115 Bacteria 43716
521 Ga0466966_0041438 3300044684 Bacteria 2959
522 Ga0466963_0194984 3300044694 Bacteria 1416
523 Ga0466968_0009238 3300044735 Bacteria 3790
524 Ga0466970_0183530 3300044765 Bacteria 1161
525 Ga0466957_0036272 3300044842 Bacteria 2964
526 Ga0466957_0049790 3300044842 Bacteria 2548
527 Ga0466959_0018887 3300045049 Bacteria 5065
528 Ga0451576_0190182 3300045051 Bacteria 2144
529 Ga0495603_0000815 3300046455 Bacteria 17889
530 Ga0495603_0014909 3300046455 Bacteria 4701
531 Ga0495603_0055846 3300046455 Bacteria 2339
532 Ga0495638_0002133 3300046460 Bacteria 16607
533 Ga0495638_0079907 3300046460 Bacteria 1987
534 Ga0495651_0130767 3300046462 Bacteria 1832
535 Ga0495605_0061752 3300046474 Bacteria 1792
536 Ga0495585_0101648 3300046492 Bacteria 1537
537 Ga0495594_0125454 3300046499 Bacteria 1452
538 Ga0495596_0054852 3300046500 Bacteria 1558
539 Ga0495610_0075765 3300046512 Bacteria 1557
540 Ga0495616_0118733 3300046513 Bacteria 1223
541 Ga0495618_0166601 3300046514 Bacteria 1403
542 Ga0495628_0003683 3300046516 Bacteria 13678
543 Ga0495630_0051524 3300046517 Bacteria 3081
544 Ga0495632_0037042 3300046519 Bacteria 2478
545 Ga0495632_0098174 3300046519 Bacteria 1382
546 Ga0495637_0026576 3300046520 Bacteria 2596
547 Ga0495643_0047109 3300046522 Bacteria 2335
548 Ga0495648_0034559 3300046524 Bacteria 3288
549 Ga0495648_0111791 3300046524 Bacteria 1485
550 Ga0495652_0011271 3300046529 Bacteria 8090
551 Ga0495652_0115861 3300046529 Bacteria 2146
552 Ga0495654_0078628 3300046530 Bacteria 1550
553 Ga0495640_0022824 3300046533 Bacteria 4568
554 Ga0495587_0091556 3300046536 Bacteria 1756
555 Ga0495621_0056061 3300046539 Bacteria 1420
556 Ga0495597_0000256 3300046542 Bacteria 48492
557 Ga0495645_0001496 3300046543 Bacteria 15843
558 Ga0495645_0056473 3300046543 Bacteria 2850
559 Ga0495622_0003864 3300046557 Bacteria 6999
560 Ga0495622_0055459 3300046557 Bacteria 1838
561 Ga0495667_0018521 3300046559 Bacteria 4704
562 Ga0495656_0008757 3300046615 Bacteria 3624
563 Ga0495656_0021968 3300046615 Bacteria 2492
564 Ga0495668_0037199 3300046616 Bacteria 2724
565 Ga0495611_0029563 3300046648 Bacteria 2403
566 Ga0495625_0040647 3300046660 Bacteria 3389
567 Ga0495635_0054834 3300046663 Bacteria 2745
568 Ga0495661_0079214 3300046665 Bacteria 1898
569 Ga0495588_0049897 3300046674 Bacteria 2153
570 Ga0495623_0004849 3300046679 Bacteria 8825
571 Ga0495623_0053390 3300046679 Bacteria 2552
572 Ga0495646_0038638 3300046680 Bacteria 2946
573 Ga0495647_0009849 3300046681 Bacteria 3245
574 Ga0495658_0033412 3300046683 Bacteria 2817
575 Ga0495658_0045587 3300046683 Bacteria 2461
576 Ga0495624_0046293 3300046690 Bacteria 2766
577 Ga0495671_0052863 3300046692 Bacteria 2018
578 Ga0495649_0064668 3300046694 Bacteria 1964
579 Ga0495600_0083000 3300046809 Bacteria 2091
580 Ga0495581_0036050 3300047315 Bacteria 2862
581 Ga0495581_0052066 3300047315 Bacteria 2365
582 Ga0495604_0018955 3300047317 Bacteria 5509
583 Ga0495604_0030809 3300047317 Bacteria 4257
584 Ga0495674_0014695 3300047319 Bacteria 7327
585 Ga0495672_0046617 3300047320 Bacteria 2584
586 Ga0495672_0097344 3300047320 Bacteria 1602
587 Ga0495680_0086176 3300047322 Bacteria 2364
588 Ga0495675_0003891 3300047444 Bacteria 9052
589 Ga0495675_0009097 3300047444 Bacteria 6173
590 Ga0495684_0008620 3300047471 Bacteria 7892
591 Ga0495686_0036654 3300047472 Bacteria 3147
592 Ga0495593_0105613 3300047673 Unclassified 1441
593 Ga0495602_0012370 3300048088 Bacteria 8779
594 Ga0495602_0119735 3300048088 Bacteria 2120
595 Ga0495602_0162233 3300048088 Bacteria 1744
596 Ga0495626_0033986 3300048091 Bacteria 2441
597 Ga0495626_0083870 3300048091 Bacteria 1411
598 Ga0496100_0022978 3300048903 Bacteria 3781
599 Ga0496101_0011389 3300048904 Bacteria 5900
600 Ga0496101_0111578 3300048904 Bacteria 2059
601 Ga0496101_0230071 3300048904 Bacteria 1441
602 Ga0496102_0004325 3300048905 Bacteria 12013
603 Ga0496102_0009419 3300048905 Bacteria 8390
604 Ga0496102_0036387 3300048905 Bacteria 4435
605 Ga0496103_0006135 3300048906 Bacteria 7181
606 Ga0496103_0007472 3300048906 Bacteria 6514
607 Ga0496103_0206902 3300048906 Bacteria 1262
608 Ga0496104_0000064 3300048907 Bacteria 112084
609 Ga0496104_0013698 3300048907 Bacteria 7311
610 Ga0496104_0032361 3300048907 Bacteria 4867
611 Ga0496104_0038719 3300048907 Bacteria 4462
612 Ga0496104_0097120 3300048907 Bacteria 2819
613 Ga0496104_0114237 3300048907 Bacteria 2589
614 Ga0496104_0127665 3300048907 Bacteria 2442
615 Ga0496104_0157650 3300048907 Bacteria 2178
616 Ga0496104_0477792 3300048907 Bacteria 1158
617 Ga0496104_0520479 3300048907 Bacteria 1101
618 Ga0496105_0004178 3300048908 Bacteria 10847
619 Ga0496105_0004868 3300048908 Bacteria 10140
620 Ga0496105_0007989 3300048908 Bacteria 8224
621 Ga0496105_0033160 3300048908 Bacteria 4240
622 Ga0496105_0047746 3300048908 Bacteria 3533
623 Ga0496105_0153677 3300048908 Bacteria 1891
624 Ga0496106_0009196 3300048909 Bacteria 7296
625 Ga0496106_0063359 3300048909 Bacteria 2810
626 Ga0496106_0130191 3300048909 Bacteria 1973
627 Ga0496106_0343276 3300048909 Bacteria 1199
628 Ga0496107_0003386 3300048910 Bacteria 10662
629 Ga0496107_0015375 3300048910 Bacteria 5363
630 Ga0496107_0089587 3300048910 Bacteria 2247
631 Ga0496108_0000378 3300048911 Bacteria 37061
632 Ga0496108_0001892 3300048911 Bacteria 16769
633 Ga0496108_0015446 3300048911 Bacteria 6228
634 Ga0496108_0023560 3300048911 Bacteria 5067
635 Ga0496108_0051787 3300048911 Bacteria 3439
636 Ga0496108_0139622 3300048911 Bacteria 2087
637 Ga0496108_0164187 3300048911 Bacteria 1920
638 Ga0496108_0378468 3300048911 Bacteria 1236
639 Ga0496109_0000386 3300048912 Bacteria 39999
640 Ga0496109_0002039 3300048912 Bacteria 16741
641 Ga0496109_0015519 3300048912 Bacteria 6641
642 Ga0496109_0022636 3300048912 Bacteria 5566
643 Ga0496109_0075201 3300048912 Bacteria 3105
644 Ga0496109_0075800 3300048912 Bacteria 3092
645 Ga0496109_0139178 3300048912 Bacteria 2269
646 Ga0496109_0187075 3300048912 Bacteria 1946
647 Ga0496109_0369859 3300048912 Bacteria 1354
648 Ga0496109_0381374 3300048912 Bacteria 1332
649 Ga0496110_0001431 3300048913 Bacteria 17258
650 Ga0496110_0050899 3300048913 Bacteria 3639
651 Ga0496110_0075637 3300048913 Bacteria 2992
652 Ga0496110_0218178 3300048913 Bacteria 1734
653 Ga0496110_0224258 3300048913 Bacteria 1709
654 Ga0496110_0244007 3300048913 Bacteria 1635
655 Ga0496110_0340113 3300048913 Bacteria 1367
656 Ga0496110_0387683 3300048913 Bacteria 1273
657 Ga0496111_0000314 3300048914 Bacteria 23921
658 Ga0496111_0000958 3300048914 Bacteria 15764
659 Ga0496111_0010973 3300048914 Bacteria 6095
660 Ga0496111_0012151 3300048914 Bacteria 5823
661 Ga0496111_0052500 3300048914 Bacteria 2944
662 Ga0496111_0103750 3300048914 Bacteria 2091
663 Ga0496112_0000681 3300048915 Bacteria 23700
664 Ga0496112_0003469 3300048915 Bacteria 13040
665 Ga0496112_0052980 3300048915 Bacteria 3984
666 Ga0496112_0106907 3300048915 Bacteria 2768
667 Ga0496112_0130104 3300048915 Bacteria 2488
668 Ga0496112_0184408 3300048915 Bacteria 2050
669 Ga0496112_0259193 3300048915 Bacteria 1688
670 Ga0496112_0363335 3300048915 Bacteria 1389
671 Ga0496112_0655450 3300048915 Bacteria 979
672 Ga0496113_0000206 3300048916 Bacteria 27352
673 Ga0496113_0000597 3300048916 Bacteria 18003
674 Ga0496113_0001350 3300048916 Bacteria 13586
675 Ga0496113_0013882 3300048916 Bacteria 5475
676 Ga0496113_0057399 3300048916 Bacteria 2925
677 Ga0496113_0070809 3300048916 Bacteria 2652
678 Ga0496114_0007174 3300048917 Bacteria 8793
679 Ga0496114_0067641 3300048917 Bacteria 2997
680 Ga0496114_0091345 3300048917 Bacteria 2586
681 Ga0496115_0014496 3300048918 Bacteria 5968
682 Ga0496115_0040846 3300048918 Bacteria 3689
683 Ga0496115_0136183 3300048918 Bacteria 2025
684 Ga0496115_0187546 3300048918 Bacteria 1709
685 Ga0496115_0189016 3300048918 Bacteria 1701
686 Ga0496116_0001099 3300048919 Bacteria 32485
687 Ga0496117_0041849 3300048920 Bacteria 3350
688 Ga0496117_0159468 3300048920 Bacteria 1324
689 Ga0496118_0023726 3300048921 Bacteria 5316
690 Ga0496118_0036135 3300048921 Bacteria 4000
691 Ga0496118_0043619 3300048921 Bacteria 3522
692 Ga0496118_0068161 3300048921 Bacteria 2586
693 Ga0496119_0049689 3300048922 Bacteria 2591
694 Ga0496119_0056562 3300048922 Bacteria 2377
695 Ga0496120_0026457 3300048923 Bacteria 3582
696 Ga0496121_0000385 3300048924 Bacteria 90105
697 Ga0496121_0004958 3300048924 Bacteria 17463
698 Ga0496121_0017055 3300048924 Bacteria 7448
699 Ga0496121_0017489 3300048924 Bacteria 7321
700 Ga0496121_0017759 3300048924 Bacteria 7235
701 Ga0496121_0019762 3300048924 Bacteria 6714
702 Ga0496121_0072659 3300048924 Bacteria 2761
703 Ga0496121_0114106 3300048924 Bacteria 2054
704 Ga0496122_0000528 3300048925 Bacteria 79201
705 Ga0496122_0030398 3300048925 Bacteria 4525
706 Ga0496123_0001698 3300048926 Bacteria 29435
707 Ga0496124_0000004 3300048927 Bacteria 976131
708 Ga0496124_0061900 3300048927 Bacteria 3135
709 Ga0496124_0130813 3300048927 Bacteria 1994
710 Ga0496125_0003427 3300048928 Bacteria 19225
711 Ga0496125_0006164 3300048928 Bacteria 13070
712 Ga0496125_0013040 3300048928 Bacteria 8201
713 Ga0496125_0029663 3300048928 Bacteria 4911
714 Ga0496125_0034775 3300048928 Bacteria 4434
715 Ga0496125_0070568 3300048928 Bacteria 2734
716 Ga0496126_0001329 3300048929 Bacteria 39310
717 Ga0496126_0007328 3300048929 Bacteria 12113
718 Ga0496126_0015687 3300048929 Bacteria 7612
719 Ga0496126_0022525 3300048929 Bacteria 6127
720 Ga0496126_0038938 3300048929 Bacteria 4418
721 Ga0496126_0083503 3300048929 Bacteria 2819
722 Ga0496126_0115348 3300048929 Bacteria 2336
723 Ga0496126_0123529 3300048929 Bacteria 2242
724 Ga0496126_0364539 3300048929 Bacteria 1179
725 Ga0501032_0047451 3300049569 Bacteria 2900
726 Ga0501033_0017045 3300049570 Bacteria 5491
727 Ga0501033_0056081 3300049570 Bacteria 2913
728 Ga0501033_0161827 3300049570 Bacteria 1611
729 Ga0501034_0024944 3300049571 Bacteria 6083
730 Ga0501034_0026362 3300049571 Bacteria 5919
731 Ga0501036_0019499 3300049572 Bacteria 5695
732 Ga0501036_0165046 3300049572 Bacteria 1867
733 Ga0501036_0394224 3300049572 Bacteria 1155
734 Ga0501038_0106917 3300049574 Bacteria 2321
735 Ga0501038_0204666 3300049574 Bacteria 1582
736 Ga0501039_0031975 3300049575 Bacteria 4057
737 Ga0501039_0411612 3300049575 Bacteria 1062
738 Ga0501040_0038136 3300049576 Bacteria 3266
739 Ga0501040_0149255 3300049576 Bacteria 1648
740 Ga0501041_0020793 3300049577 Bacteria 3927
741 Ga0501041_0038497 3300049577 Bacteria 2900
742 Ga0501041_0050299 3300049577 Bacteria 2540
743 Ga0501042_0029949 3300049578 Bacteria 3842
744 Ga0501042_0050955 3300049578 Bacteria 2953
745 Ga0501042_0146443 3300049578 Bacteria 1703
746 Ga0501043_0055748 3300049579 Bacteria 3105
747 Ga0501043_0164793 3300049579 Bacteria 1731
748 Ga0501046_0006011 3300049580 Bacteria 10798
749 Ga0501046_0063080 3300049580 Bacteria 2894
750 Ga0501046_0119377 3300049580 Bacteria 2008
751 Ga0501046_0225932 3300049580 Bacteria 1385
752 Ga0501047_0009379 3300049581 Bacteria 9245
753 Ga0501048_0178384 3300049582 Bacteria 1506
754 Ga0501070_0035967 3300049586 Bacteria 4136
755 Ga0501070_0061978 3300049586 Bacteria 3098
756 Ga0501070_0085226 3300049586 Bacteria 2616
757 Ga0501070_0140089 3300049586 Bacteria 1997
758 Ga0501071_0014840 3300049587 Bacteria 5336
759 Ga0501071_0072383 3300049587 Bacteria 2514
760 Ga0501071_0249090 3300049587 Bacteria 1341
761 Ga0501072_0004729 3300049588 Bacteria 10373
762 Ga0501072_0008188 3300049588 Bacteria 7936
763 Ga0501072_0019484 3300049588 Bacteria 5246
764 Ga0501072_0069334 3300049588 Bacteria 2784
765 Ga0501074_0072720 3300049590 Bacteria 2470
766 Ga0501074_0161020 3300049590 Bacteria 1603
767 Ga0501075_0003767 3300049591 Bacteria 10188
768 Ga0501075_0035408 3300049591 Bacteria 3723
769 Ga0501075_0175249 3300049591 Bacteria 1637
770 Ga0501076_0002632 3300049592 Bacteria 12380
771 Ga0501076_0088720 3300049592 Bacteria 2485
772 Ga0501076_0270348 3300049592 Bacteria 1392
773 Ga0501079_0011381 3300049741 Bacteria 6790
774 Ga0501079_0012771 3300049741 Bacteria 6416
775 Ga0501079_0019453 3300049741 Bacteria 5186
776 Ga0501079_0063679 3300049741 Bacteria 2845
777 Ga0501080_0007756 3300049742 Bacteria 9703
778 Ga0501080_0256665 3300049742 Bacteria 1593
779 Ga0501081_0044648 3300049743 Bacteria 3042
780 Ga0501081_0175615 3300049743 Bacteria 1548
781 Ga0501081_0301681 3300049743 Bacteria 1175
782 Ga0501083_0039745 3300049744 Bacteria 3195
783 Ga0501083_0195204 3300049744 Bacteria 1321
784 Ga0501083_0210194 3300049744 Bacteria 1268
785 Ga0501035_0016279 3300049822 Bacteria 6861
786 Ga0501035_0033610 3300049822 Bacteria 4663
787 Ga0501044_0087986 3300049823 Bacteria 3136
788 Ga0501044_0266397 3300049823 Bacteria 1650
789 Ga0501044_0361345 3300049823 Bacteria 1370
790 Ga0501045_0000328 3300049824 Bacteria 27844
791 Ga0501045_0078869 3300049824 Bacteria 2428
792 Ga0501045_0187412 3300049824 Bacteria 1542
793 Ga0501045_0205484 3300049824 Bacteria 1467
794 nmdc:mga03683_5781_c1 3300050489 Bacteria 4198
795 nmdc:mga03n38_181532_c1 3300050490 Bacteria 1078
796 nmdc:mga03n38_21055_c1 3300050490 Bacteria 2618
797 nmdc:mga03n38_4978_c1 3300050490 Bacteria 4469
798 nmdc:mga00v17_11124_c1 3300050491 Bacteria 4937
799 nmdc:mga00v17_116283_c1 3300050491 Bacteria 1700
800 nmdc:mga00v17_117840_c1 3300050491 Bacteria 1689
801 nmdc:mga0yw44_11160_c1 3300050492 Bacteria 4622
802 nmdc:mga0yw44_20547_c1 3300050492 Bacteria 3667
803 nmdc:mga0yw44_5724_c1 3300050492 Bacteria 5922
804 nmdc:mga0yw44_64731_c1 3300050492 Bacteria 2251
805 nmdc:mga0k408_96679_c1 3300050493 Bacteria 1739
806 nmdc:mga06z11_3902_c1 3300050494 Bacteria 5815
807 nmdc:mga06z11_7243_c1 3300050494 Bacteria 2635
808 nmdc:mga06z11_85195_c1 3300050494 Bacteria 1704
809 nmdc:mga04h51_1285_c1 3300050495 Bacteria 5796
810 nmdc:mga04h51_16333_c1 3300050495 Bacteria 2154
811 nmdc:mga07m45_69736_c1 3300050496 Bacteria 1999
812 nmdc:mga05p37_156332_c1 3300050507 Bacteria 2786
813 nmdc:mga05p37_186566_c1 3300050507 Bacteria 2521
814 nmdc:mga05p37_222666_c1 3300050507 Bacteria 2276
815 nmdc:mga05p37_278145_c1 3300050507 Bacteria 1997
816 nmdc:mga05p37_416_c1 3300050507 Bacteria 46050
817 nmdc:mga05p37_75754_c1 3300050507 Bacteria 4142
818 nmdc:mga09592_40498_c1 3300050508 Bacteria 3914
819 nmdc:mga09592_52428_c1 3300050508 Bacteria 3443
820 nmdc:mga09592_778_c1 3300050508 Bacteria 24622
821 nmdc:mga0qj67_12381_c1 3300050509 Bacteria 6425
822 nmdc:mga0qj67_148978_c1 3300050509 Bacteria 1898
823 nmdc:mga0qj67_16699_c1 3300050509 Bacteria 5572
824 nmdc:mga0qj67_171320_c1 3300050509 Bacteria 1763
825 nmdc:mga0qj67_25793_c1 3300050509 Bacteria 4546
826 nmdc:mga0qj67_304001_c1 3300050509 Bacteria 1292
827 nmdc:mga0qj67_35774_c1 3300050509 Bacteria 3884
828 nmdc:mga06r32_1227_c1 3300050510 Bacteria 23088
829 nmdc:mga06r32_131426_c1 3300050510 Bacteria 2476
830 nmdc:mga06r32_17258_c1 3300050510 Bacteria 6589
831 nmdc:mga06r32_21619_c1 3300050510 Bacteria 5941
832 nmdc:mga06r32_22348_c1 3300050510 Bacteria 5847
833 nmdc:mga06r32_244511_c1 3300050510 Bacteria 1782
834 nmdc:mga06r32_291121_c1 3300050510 Bacteria 1620
835 nmdc:mga06r32_2927_c1 3300050510 Bacteria 15312
836 nmdc:mga06r32_298284_c1 3300050510 Bacteria 1598
837 nmdc:mga06r32_325079_c1 3300050510 Bacteria 1523
838 nmdc:mga08y16_173347_c1 3300050511 Bacteria 2240
839 nmdc:mga08y16_76324_c1 3300050511 Bacteria 3493
840 nmdc:mga08y16_92306_c1 3300050511 Bacteria 3155
841 nmdc:mga0n895_22044_c1 3300050512 Bacteria 5969
842 nmdc:mga0n895_361535_c1 3300050512 Bacteria 1470
843 nmdc:mga0n895_435585_c1 3300050512 Bacteria 1324
844 nmdc:mga0n895_479237_c1 3300050512 Bacteria 1255
845 nmdc:mga0n895_94511_c1 3300050512 Bacteria 2993
846 nmdc:mga0rr50_434669_c1 3300050513 Bacteria 1111
847 nmdc:mga0rr50_572002_c1 3300050513 Bacteria 963
848 nmdc:mga0rr50_6667_c1 3300050513 Bacteria 7061
849 nmdc:mga0a205_101761_c1 3300050515 Bacteria 2772
850 nmdc:mga0a205_191916_c1 3300050515 Bacteria 1934
851 nmdc:mga0a205_335_c1 3300050515 Bacteria 35266
852 nmdc:mga0sz30_47096_c1 3300050516 Bacteria 1822
853 Ga0495601_0013359 3300053077 Bacteria 4937
854 Ga0495601_0021412 3300053077 Bacteria 3959
855 Ga0495601_0162141 3300053077 Bacteria 1461
856 Ga0495601_0394530 3300053077 Unclassified 897
857 Ga0495612_0007530 3300053078 Bacteria 4450
858 Ga0495612_0015354 3300053078 Bacteria 3069
859 Ga0495612_0063384 3300053078 Bacteria 1533
860 Ga0500635_0002895 3300053080 Bacteria 4270
861 Ga0495655_0005107 3300053083 Bacteria 2297
862 Ga0495595_0058430 3300053084 Bacteria 1801
863 Ga0495619_0030201 3300053085 Bacteria 3507
864 Ga0500643_000040 3300053087 Bacteria 168108
865 Ga0500646_0033522 3300053090 Bacteria 1421
866 Ga0500583_0003885 3300053092 Bacteria 4788
867 Ga0500651_0000787 3300053093 Bacteria 15478
868 Ga0500651_0023641 3300053093 Bacteria 3848
869 Ga0500566_0000005 3300053094 Bacteria 159299
870 Ga0500566_0001430 3300053094 Bacteria 13975
871 Ga0500640_004238 3300053095 Bacteria 5179
872 Ga0500640_061145 3300053095 Bacteria 1633
873 Ga0500641_0017337 3300053096 Bacteria 2692
874 Ga0500641_0071255 3300053096 Bacteria 1463
875 Ga0500650_0008348 3300053098 Bacteria 4090
876 Ga0500555_008753 3300053103 Bacteria 2889
877 Ga0500556_0000019 3300053104 Bacteria 186017
878 Ga0500556_0011374 3300053104 Bacteria 2635
879 Ga0500562_011024 3300053108 Bacteria 2294
880 Ga0500572_000164 3300053111 Bacteria 23114
881 Ga0500591_002791 3300053115 Bacteria 7259
882 Ga0500592_000378 3300053116 Bacteria 7482
883 Ga0500593_000284 3300053117 Bacteria 20609
884 Ga0500593_043337 3300053117 Bacteria 2009
885 Ga0500594_0003781 3300053118 Bacteria 3332
886 Ga0500595_000176 3300053119 Bacteria 42910
887 Ga0500595_002181 3300053119 Bacteria 9945
888 Ga0500595_003323 3300053119 Bacteria 7558
889 Ga0500595_007879 3300053119 Bacteria 4387
890 Ga0500607_035679 3300053121 Bacteria 2718
891 Ga0500608_001003 3300053122 Bacteria 10129
892 Ga0500608_009518 3300053122 Bacteria 4133
893 Ga0500614_000629 3300053123 Bacteria 8979
894 Ga0500614_007561 3300053123 Bacteria 2292
895 Ga0500642_0000048 3300053130 Bacteria 81787
896 Ga0500652_000394 3300053131 Bacteria 15616
897 Ga0500658_0096611 3300053134 Bacteria 1284
898 Ga0500559_0000543 3300053136 Bacteria 26112
899 Ga0500559_0000978 3300053136 Bacteria 17820
900 Ga0500559_0002490 3300053136 Bacteria 9482
901 Ga0500568_0000242 3300053139 Bacteria 46479
902 Ga0500568_0052815 3300053139 Bacteria 1594
903 Ga0500573_0009602 3300053140 Bacteria 5376
904 Ga0500577_0002021 3300053142 Bacteria 5194
905 Ga0500586_000115 3300053145 Bacteria 14310
906 Ga0500590_051710 3300053148 Bacteria 2087
907 Ga0500590_097370 3300053148 Bacteria 1418
908 Ga0500603_000097 3300053150 Bacteria 20631
909 Ga0500603_000900 3300053150 Bacteria 7049
910 Ga0500604_0000407 3300053151 Bacteria 11838
911 Ga0500616_0000059 3300053153 Bacteria 259741
912 Ga0500616_0005912 3300053153 Bacteria 8179
913 Ga0500622_0002088 3300053156 Bacteria 14880
914 Ga0500624_001594 3300053157 Bacteria 3469
915 Ga0500627_0008480 3300053158 Bacteria 3654
916 Ga0500630_000701 3300053159 Bacteria 15344
917 Ga0500633_0050632 3300053160 Bacteria 1432
918 Ga0500634_0132287 3300053161 Bacteria 1196
919 Ga0500638_023788 3300053162 Bacteria 2915
920 Ga0500638_053497 3300053162 Bacteria 1949
921 Ga0500639_000106 3300053163 Bacteria 39379
922 Ga0500639_068445 3300053163 Bacteria 1814
923 Ga0500636_0000028 3300053177 Bacteria 80398
924 Ga0500636_0001221 3300053177 Bacteria 13884
925 Ga0500637_0000119 3300053178 Bacteria 28866
926 Ga0500637_0019087 3300053178 Bacteria 3692
927 Ga0500645_013099 3300053730 Bacteria 2669
928 Ga0500645_025474 3300053730 Bacteria 1805
929 Ga0500601_000137 3300053737 Bacteria 14865
930 Ga0501084_0004628 3300054114 Bacteria 11238
931 Ga0501084_0026969 3300054114 Bacteria 4800
932 Ga0501084_0065115 3300054114 Bacteria 3049
933 Ga0501084_0125048 3300054114 Bacteria 2164
934 Ga0501082_0018381 3300060353 Bacteria 6020
935 Ga0501082_0024431 3300060353 Bacteria 5210
936 Ga0501082_0042663 3300060353 Bacteria 3910
937 Ga0501082_0053841 3300060353 Bacteria 3468
938 Ga0501082_0079675 3300060353 Bacteria 2826
939 Ga0501082_0087894 3300060353 Bacteria 2682
940 Ga0530510_0005801 3300061734 Bacteria 8554
941 Ga0530510_0027778 3300061734 Bacteria 4054
942 Ga0530510_0042778 3300061734 Bacteria 3273
943 Ga0530510_0047342 3300061734 Bacteria 3107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0394530 Ga0495601_0394530_10_876 286
2 3300036712 Ga0316584_0010529 Ga0316584_0010529_68_994 289
3 3300048915 Ga0496112_0655450 Ga0496112_0655450_86_964 290
4 3300046524 Ga0495648_0034559 Ga0495648_0034559_1356_2396 293
5 3300049824 Ga0501045_0187412 Ga0501045_0187412_430_1314 293
6 3300003215 JGI25153J46596_10000068 JGI25153J46596_1000006851 296
7 3300025297 Ga0209758_1000097 Ga0209758_1000097162 296
8 3300049743 Ga0501081_0175615 Ga0501081_0175615_14_949 296
9 3300049572 Ga0501036_0394224 Ga0501036_0394224_22_969 297
10 3300049575 Ga0501039_0411612 Ga0501039_0411612_116_1012 297
11 3300049582 Ga0501048_0178384 Ga0501048_0178384_380_1276 297
12 3300049592 Ga0501076_0270348 Ga0501076_0270348_220_1116 297
13 3300048912 Ga0496109_0369859 Ga0496109_0369859_387_1304 298
14 3300048917 Ga0496114_0067641 Ga0496114_0067641_484_1524 299
15 3300048928 Ga0496125_0003427 Ga0496125_0003427_13172_14212 299
16 3300049586 Ga0501070_0085226 Ga0501070_0085226_1637_2539 299
17 3300003215 JGI25153J46596_10000094 JGI25153J46596_1000009440 301
18 3300003794 Ga0055531_10018269 Ga0055531_100182692 301
19 3300005262 Ga0065165_1005504 Ga0065165_10055047 301
20 3300025297 Ga0209758_1000024 Ga0209758_1000024228 301
21 3300025299 Ga0209256_1001501 Ga0209256_100150120 301
22 3300025304 Ga0209257_1000588 Ga0209257_10005883 301
23 3300047320 Ga0495672_0046617 Ga0495672_0046617_1097_2143 301
24 3300048924 Ga0496121_0000385 Ga0496121_0000385_79554_80600 301
25 3300050513 nmdc:mga0rr50_572002_c1 nmdc:mga0rr50_572002_c1_30_938 301
26 3300053119 Ga0500595_007879 Ga0500595_007879_1633_2679 301
27 3300048929 Ga0496126_0123529 Ga0496126_0123529_812_1855 302
28 3300003354 JGI25160J50197_1000777 JGI25160J50197_10007779 303
29 3300006186 Ga0075369_10000436 Ga0075369_100004362 303
30 3300010375 Ga0105239_10155237 Ga0105239_101552373 303
31 3300025302 Ga0207426_1000439 Ga0207426_100043930 303
32 3300046529 Ga0495652_0115861 Ga0495652_0115861_28_945 303
33 3300048916 Ga0496113_0070809 Ga0496113_0070809_29_946 303
34 3300050492 nmdc:mga0yw44_64731_c1 nmdc:mga0yw44_64731_c1_1053_2099 303
35 3300050494 nmdc:mga06z11_85195_c1 nmdc:mga06z11_85195_c1_302_1348 303
36 3300050516 nmdc:mga0sz30_47096_c1 nmdc:mga0sz30_47096_c1_341_1387 303
37 3300053093 Ga0500651_0000787 Ga0500651_0000787_13127_14200 303
38 3300005344 Ga0070661_100331832 Ga0070661_1003318321 304
39 3300005983 Ga0081540_1020642 Ga0081540_10206422 304
40 3300026075 Ga0207708_10128499 Ga0207708_101284993 304
41 3300048915 Ga0496112_0259193 Ga0496112_0259193_255_1301 304
42 3300021321 Ga0214542_1000001 Ga0214542_1000001261 305
43 3300021324 Ga0214545_1000001 Ga0214545_1000001328 305
44 3300021327 Ga0214543_1000006 Ga0214543_1000006325 305
45 3300005262 Ga0065165_1001845 Ga0065165_100184511 306
46 3300005615 Ga0070702_100267274 Ga0070702_1002672742 306
47 3300025261 Ga0209233_1007993 Ga0209233_10079932 306
48 3300025304 Ga0209257_1018568 Ga0209257_10185682 306
49 3300025942 Ga0207689_10304709 Ga0207689_103047092 306
50 3300049743 Ga0501081_0301681 Ga0501081_0301681_233_1159 306
51 3300053136 Ga0500559_0000978 Ga0500559_0000978_6133_7185 306
52 3300048912 Ga0496109_0022636 Ga0496109_0022636_10_936 308
53 3300048918 Ga0496115_0189016 Ga0496115_0189016_765_1691 308
54 3300053140 Ga0500573_0009602 Ga0500573_0009602_3681_4733 308
55 3300006941 Ga0099825_1033101 Ga0099825_10331012 309
56 3300027296 Ga0209389_1000199 Ga0209389_100019929 309
57 3300027361 Ga0209489_102148 Ga0209489_10214826 309
58 3300027363 Ga0209700_100005 Ga0209700_100005463 309
59 3300046694 Ga0495649_0064668 Ga0495649_0064668_855_1808 309
60 3300048925 Ga0496122_0000528 Ga0496122_0000528_4764_5816 311
61 3300048926 Ga0496123_0001698 Ga0496123_0001698_4766_5818 311
62 3300006163 Ga0070715_10059722 Ga0070715_100597222 312
63 3300031731 Ga0307405_10074589 Ga0307405_100745892 312
64 3300039450 Ga0436363_1475436 Ga0436363_1475436_4671_5717 312
65 3300048927 Ga0496124_0130813 Ga0496124_0130813_83_1123 312
66 3300048928 Ga0496125_0070568 Ga0496125_0070568_1417_2457 312
67 3300048929 Ga0496126_0015687 Ga0496126_0015687_4868_5908 312
68 3300006844 Ga0075428_100194866 Ga0075428_1001948662 315
69 3300006844 Ga0075428_100200691 Ga0075428_1002006912 315
70 3300006846 Ga0075430_100115306 Ga0075430_1001153062 315
71 3300050507 nmdc:mga05p37_278145_c1 nmdc:mga05p37_278145_c1_658_1689 315
72 3300050509 nmdc:mga0qj67_148978_c1 nmdc:mga0qj67_148978_c1_607_1638 315
73 3300050509 nmdc:mga0qj67_171320_c1 nmdc:mga0qj67_171320_c1_676_1707 315
74 3300050509 nmdc:mga0qj67_35774_c1 nmdc:mga0qj67_35774_c1_2242_3273 315
75 3300050510 nmdc:mga06r32_131426_c1 nmdc:mga06r32_131426_c1_329_1360 315
76 3300050510 nmdc:mga06r32_244511_c1 nmdc:mga06r32_244511_c1_676_1707 315
77 3300050510 nmdc:mga06r32_298284_c1 nmdc:mga06r32_298284_c1_357_1388 315
78 3300005544 Ga0070686_100366433 Ga0070686_1003664331 316
79 3300005546 Ga0070696_100012128 Ga0070696_1000121287 316
80 3300005549 Ga0070704_100174802 Ga0070704_1001748022 316
81 3300005985 Ga0081539_10004692 Ga0081539_1000469211 316
82 3300025904 Ga0207647_10030106 Ga0207647_100301062 316
83 3300050513 nmdc:mga0rr50_434669_c1 nmdc:mga0rr50_434669_c1_107_1060 316
84 3300009177 Ga0105248_10014926 Ga0105248_100149264 317
85 3300014968 Ga0157379_10039826 Ga0157379_100398266 317
86 3300044842 Ga0466957_0036272 Ga0466957_0036272_1199_2242 317
87 3300048924 Ga0496121_0004958 Ga0496121_0004958_10587_11627 317
88 3300048928 Ga0496125_0034775 Ga0496125_0034775_2511_3551 317
89 3300049577 Ga0501041_0050299 Ga0501041_0050299_1268_2383 317
90 3300049580 Ga0501046_0006011 Ga0501046_0006011_2075_3190 317
91 3300050515 nmdc:mga0a205_191916_c1 nmdc:mga0a205_191916_c1_792_1850 317
92 3300060353 Ga0501082_0024431 Ga0501082_0024431_3061_4176 317
93 3300005334 Ga0068869_100055588 Ga0068869_1000555882 318
94 3300005336 Ga0070680_100013678 Ga0070680_1000136783 318
95 3300005341 Ga0070691_10009631 Ga0070691_100096315 318
96 3300005343 Ga0070687_100064871 Ga0070687_1000648712 318
97 3300005345 Ga0070692_10155862 Ga0070692_101558622 318
98 3300005440 Ga0070705_100004675 Ga0070705_1000046753 318
99 3300005444 Ga0070694_100002889 Ga0070694_1000028893 318
100 3300005444 Ga0070694_100138247 Ga0070694_1001382472 318
101 3300005445 Ga0070708_100008473 Ga0070708_1000084734 318
102 3300005455 Ga0070663_100007257 Ga0070663_1000072573 318
103 3300005457 Ga0070662_100174128 Ga0070662_1001741282 318
104 3300005518 Ga0070699_100000545 Ga0070699_10000054527 318
105 3300005536 Ga0070697_100015043 Ga0070697_1000150432 318
106 3300005545 Ga0070695_100004516 Ga0070695_1000045164 318
107 3300005546 Ga0070696_100000249 Ga0070696_10000024924 318
108 3300005547 Ga0070693_100008195 Ga0070693_1000081955 318
109 3300005577 Ga0068857_100014404 Ga0068857_1000144043 318
110 3300005617 Ga0068859_100039940 Ga0068859_1000399404 318
111 3300005844 Ga0068862_100005647 Ga0068862_1000056478 318
112 3300006931 Ga0097620_100039940 Ga0097620_1000399403 318
113 3300009094 Ga0111539_10010381 Ga0111539_100103813 318
114 3300010375 Ga0105239_10128432 Ga0105239_101284321 318
115 3300011119 Ga0105246_10008875 Ga0105246_100088754 318
116 3300025908 Ga0207643_10020063 Ga0207643_100200632 318
117 3300025912 Ga0207707_10072454 Ga0207707_100724543 318
118 3300025917 Ga0207660_10008445 Ga0207660_100084454 318
119 3300025918 Ga0207662_10072254 Ga0207662_100722541 318
120 3300025961 Ga0207712_10004686 Ga0207712_100046863 318
121 3300026067 Ga0207678_10016550 Ga0207678_100165503 318
122 3300026095 Ga0207676_10015497 Ga0207676_100154972 318
123 3300026116 Ga0207674_10017744 Ga0207674_100177445 318
124 3300026118 Ga0207675_100126982 Ga0207675_1001269823 318
125 3300028380 Ga0268265_10001732 Ga0268265_1000173213 318
126 3300048905 Ga0496102_0036387 Ga0496102_0036387_3242_4282 318
127 3300048907 Ga0496104_0127665 Ga0496104_0127665_74_1114 318
128 3300048913 Ga0496110_0244007 Ga0496110_0244007_501_1541 318
129 3300048920 Ga0496117_0159468 Ga0496117_0159468_12_983 318
130 3300050490 nmdc:mga03n38_181532_c1 nmdc:mga03n38_181532_c1_91_1062 318
131 3300005937 Ga0081455_10000029 Ga0081455_1000002968 319
132 3300048914 Ga0496111_0103750 Ga0496111_0103750_706_1734 320
133 3300050512 nmdc:mga0n895_22044_c1 nmdc:mga0n895_22044_c1_2204_3181 320
134 3300021320 Ga0214544_1000004 Ga0214544_100000492 321
135 3300025294 Ga0209025_1066051 Ga0209025_10660512 321
136 3300035171 Ga0373946_0044250 Ga0373946_0044250_50_1093 321
137 3300048918 Ga0496115_0136183 Ga0496115_0136183_417_1463 321
138 3300021321 Ga0214542_1027275 Ga0214542_10272752 322
139 3300021324 Ga0214545_1028004 Ga0214545_10280042 322
140 3300021327 Ga0214543_1029823 Ga0214543_10298232 322
141 3300039450 Ga0436363_0313348 Ga0436363_0313348_17335_18381 322
142 3300053142 Ga0500577_0002021 Ga0500577_0002021_3207_4235 322
143 3300006844 Ga0075428_100117413 Ga0075428_1001174132 323
144 3300006847 Ga0075431_100001007 Ga0075431_10000100723 323
145 3300031995 Ga0307409_100439824 Ga0307409_1004398242 323
146 3300037853 Ga0436364_0434654 Ga0436364_0434654_1510_2541 323
147 3300050510 nmdc:mga06r32_1227_c1 nmdc:mga06r32_1227_c1_7071_8111 323
148 3300005340 Ga0070689_100082543 Ga0070689_1000825432 324
149 3300005545 Ga0070695_100191255 Ga0070695_1001912551 324
150 3300005549 Ga0070704_100029961 Ga0070704_1000299612 324
151 3300005617 Ga0068859_100284152 Ga0068859_1002841522 324
152 3300006847 Ga0075431_100026130 Ga0075431_1000261303 324
153 3300006880 Ga0075429_100000183 Ga0075429_1000001839 324
154 3300006931 Ga0097620_100284153 Ga0097620_1002841532 324
155 3300009147 Ga0114129_10021657 Ga0114129_100216574 324
156 3300013100 Ga0157373_10022116 Ga0157373_100221164 324
157 3300025904 Ga0207647_10038482 Ga0207647_100384824 324
158 3300025936 Ga0207670_10091129 Ga0207670_100911292 324
159 3300026116 Ga0207674_10153745 Ga0207674_101537452 324
160 3300042115 Ga0450911_000064 Ga0450911_000064_11660_12700 324
161 3300046542 Ga0495597_0000256 Ga0495597_0000256_31059_32111 324
162 3300050507 nmdc:mga05p37_416_c1 nmdc:mga05p37_416_c1_17515_18495 324
163 3300050508 nmdc:mga09592_778_c1 nmdc:mga09592_778_c1_6287_7267 324
164 3300050510 nmdc:mga06r32_17258_c1 nmdc:mga06r32_17258_c1_2005_2985 324
165 3300026089 Ga0207648_10391202 Ga0207648_103912022 325
166 3300039438 Ga0436360_1076044 Ga0436360_1076044_98_1108 325
167 3300048909 Ga0496106_0343276 Ga0496106_0343276_71_1054 325
168 3300048911 Ga0496108_0378468 Ga0496108_0378468_241_1224 325
169 3300048912 Ga0496109_0187075 Ga0496109_0187075_838_1821 325
170 3300048913 Ga0496110_0387683 Ga0496110_0387683_116_1099 325
171 3300048915 Ga0496112_0130104 Ga0496112_0130104_990_1973 325
172 3300005983 Ga0081540_1000048 Ga0081540_100004822 326
173 3300021384 Ga0213876_10000816 Ga0213876_1000081620 326
174 3300027360 Ga0209969_1001317 Ga0209969_10013172 326
175 3300027364 Ga0209967_1002257 Ga0209967_10022572 326
176 3300027462 Ga0210000_1003297 Ga0210000_10032973 326
177 3300027876 Ga0209974_10020453 Ga0209974_100204533 326
178 3300032126 Ga0307415_100159664 Ga0307415_1001596642 326
179 3300039437 Ga0436365_0736793 Ga0436365_0736793_3238_4284 326
180 3300048928 Ga0496125_0013040 Ga0496125_0013040_931_1968 326
181 3300050515 nmdc:mga0a205_101761_c1 nmdc:mga0a205_101761_c1_549_1580 326
182 3300053090 Ga0500646_0033522 Ga0500646_0033522_395_1390 326
183 3300053157 Ga0500624_001594 Ga0500624_001594_690_1730 326
184 3300005336 Ga0070680_100011909 Ga0070680_1000119094 327
185 3300005366 Ga0070659_100060819 Ga0070659_1000608193 327
186 3300005458 Ga0070681_10066987 Ga0070681_100669872 327
187 3300005530 Ga0070679_100113019 Ga0070679_1001130193 327
188 3300005539 Ga0068853_100031522 Ga0068853_1000315223 327
189 3300005545 Ga0070695_100007706 Ga0070695_1000077065 327
190 3300005719 Ga0068861_100011419 Ga0068861_1000114195 327
191 3300013104 Ga0157370_10090695 Ga0157370_100906953 327
192 3300025919 Ga0207657_10013624 Ga0207657_100136246 327
193 3300048907 Ga0496104_0000064 Ga0496104_0000064_35921_36958 327
194 3300048908 Ga0496105_0004178 Ga0496105_0004178_95_1132 327
195 3300048911 Ga0496108_0015446 Ga0496108_0015446_3505_4542 327
196 3300048912 Ga0496109_0015519 Ga0496109_0015519_3158_4195 327
197 3300048913 Ga0496110_0224258 Ga0496110_0224258_121_1158 327
198 3300048914 Ga0496111_0000958 Ga0496111_0000958_14707_15744 327
199 3300048915 Ga0496112_0052980 Ga0496112_0052980_1235_2272 327
200 3300048916 Ga0496113_0001350 Ga0496113_0001350_357_1394 327
201 3300049575 Ga0501039_0031975 Ga0501039_0031975_1508_2545 327
202 3300054114 Ga0501084_0026969 Ga0501084_0026969_3209_4246 327
203 3300006852 Ga0075433_10000125 Ga0075433_100001258 328
204 3300006871 Ga0075434_100008387 Ga0075434_10000838710 328
205 3300014325 Ga0163163_10294721 Ga0163163_102947211 328
206 3300031728 Ga0316578_10020840 Ga0316578_100208403 328
207 3300035090 Ga0373949_0004068 Ga0373949_0004068_1033_2070 328
208 3300035121 Ga0373960_0009259 Ga0373960_0009259_1145_2182 328
209 3300035241 Ga0373961_0004701 Ga0373961_0004701_1931_2968 328
210 3300035241 Ga0373961_0020627 Ga0373961_0020627_473_1510 328
211 3300035398 Ga0316574_0003660 Ga0316574_0003660_6029_7072 328
212 3300035691 Ga0373931_0000199 Ga0373931_0000199_22288_23325 328
213 3300035691 Ga0373931_0001050 Ga0373931_0001050_9138_10175 328
214 3300050515 nmdc:mga0a205_335_c1 nmdc:mga0a205_335_c1_3155_4192 328
215 3300053117 Ga0500593_000284 Ga0500593_000284_9491_10552 328
216 3300005330 Ga0070690_100123144 Ga0070690_1001231442 329
217 3300005334 Ga0068869_100175633 Ga0068869_1001756332 329
218 3300005456 Ga0070678_100195659 Ga0070678_1001956592 329
219 3300006038 Ga0075365_10021126 Ga0075365_100211263 329
220 3300006844 Ga0075428_100053458 Ga0075428_1000534582 329
221 3300006844 Ga0075428_100058333 Ga0075428_1000583335 329
222 3300006852 Ga0075433_10075221 Ga0075433_100752213 329
223 3300007076 Ga0075435_100175503 Ga0075435_1001755032 329
224 3300014326 Ga0157380_10098758 Ga0157380_100987582 329
225 3300026121 Ga0207683_10260409 Ga0207683_102604092 329
226 3300035113 Ga0373936_0045182 Ga0373936_0045182_646_1689 329
227 3300035695 Ga0373927_0162364 Ga0373927_0162364_334_1374 329
228 3300048907 Ga0496104_0520479 Ga0496104_0520479_51_1091 329
229 3300048909 Ga0496106_0063359 Ga0496106_0063359_1507_2547 329
230 3300049578 Ga0501042_0146443 Ga0501042_0146443_591_1592 329
231 3300049824 Ga0501045_0078869 Ga0501045_0078869_498_1550 329
232 3300050492 nmdc:mga0yw44_20547_c1 nmdc:mga0yw44_20547_c1_835_1878 329
233 3300039437 Ga0436365_0940551 Ga0436365_0940551_3813_4856 330
234 3300048921 Ga0496118_0036135 Ga0496118_0036135_1814_2860 330
235 3300048922 Ga0496119_0049689 Ga0496119_0049689_372_1418 330
236 3300053119 Ga0500595_000176 Ga0500595_000176_21637_22671 330
237 3300005981 Ga0081538_10020850 Ga0081538_100208503 331
238 3300006038 Ga0075365_10039788 Ga0075365_100397884 331
239 3300006051 Ga0075364_10009955 Ga0075364_100099556 331
240 3300006186 Ga0075369_10008913 Ga0075369_100089135 331
241 3300036401 Ga0373937_0178249 Ga0373937_0178249_685_1728 331
242 3300048919 Ga0496116_0001099 Ga0496116_0001099_15530_16576 331
243 3300048920 Ga0496117_0041849 Ga0496117_0041849_732_1778 331
244 3300048921 Ga0496118_0023726 Ga0496118_0023726_1112_2158 331
245 3300048928 Ga0496125_0029663 Ga0496125_0029663_2343_3389 331
246 3300050491 nmdc:mga00v17_11124_c1 nmdc:mga00v17_11124_c1_878_1924 331
247 3300050491 nmdc:mga00v17_116283_c1 nmdc:mga00v17_116283_c1_610_1656 331
248 3300050507 nmdc:mga05p37_222666_c1 nmdc:mga05p37_222666_c1_559_1605 331
249 3300021384 Ga0213876_10024495 Ga0213876_100244953 332
250 3300039437 Ga0436365_0413923 Ga0436365_0413923_402_1427 332
251 3300005937 Ga0081455_10052904 Ga0081455_100529043 333
252 3300006871 Ga0075434_100377658 Ga0075434_1003776582 333
253 3300007076 Ga0075435_100006471 Ga0075435_1000064713 333
254 3300009553 Ga0105249_10108754 Ga0105249_101087542 333
255 3300048904 Ga0496101_0230071 Ga0496101_0230071_83_1120 333
256 3300048907 Ga0496104_0032361 Ga0496104_0032361_471_1508 333
257 3300048915 Ga0496112_0363335 Ga0496112_0363335_121_1158 333
258 3300050489 nmdc:mga03683_5781_c1 nmdc:mga03683_5781_c1_2424_3476 333
259 3300050512 nmdc:mga0n895_361535_c1 nmdc:mga0n895_361535_c1_348_1355 333
260 3300050513 nmdc:mga0rr50_6667_c1 nmdc:mga0rr50_6667_c1_2182_3189 333
261 3300054114 Ga0501084_0125048 Ga0501084_0125048_47_1099 333
262 iso_pu_bacteria 2551306089 2551714257 333
263 3300048910 Ga0496107_0089587 Ga0496107_0089587_1210_2220 334
264 3300048927 Ga0496124_0000004 Ga0496124_0000004_711816_712877 334
265 iso_pu_bacteria 2842698319 2842698929 334
266 iso_pu_bacteria 2871451962 2871456714 334
267 iso_pu_bacteria 2916000859 2916004327 334
268 iso_pu_bacteria 2916041962 2916047436 334
269 iso_pu_bacteria 2916076590 2916076684 334
270 iso_pu_bacteria 2921208531 2921208560 334
271 iso_pu_bacteria 2924179722 2924181742 334
272 iso_pu_bacteria 2924228884 2924231036 334
273 iso_pu_bacteria 2957408893 2957412676 334
274 iso_pu_bacteria 2960603979 2960606132 334
275 iso_pu_bacteria 2960687367 2960691200 334
276 iso_pu_bacteria 2967693043 2967693939 334
277 iso_pu_bacteria 2970095765 2970098140 334
278 iso_pu_bacteria 2970129317 2970130714 334
279 iso_pu_bacteria 2970164137 2970164198 334
280 iso_pu_bacteria 2970177841 2970180779 334
281 iso_pu_bacteria 8002285264 8002290610 334
282 3300005437 Ga0070710_10177003 Ga0070710_101770032 335
283 3300005458 Ga0070681_10152622 Ga0070681_101526223 335
284 3300006051 Ga0075364_10094586 Ga0075364_100945862 335
285 3300014497 Ga0182008_10053802 Ga0182008_100538022 335
286 3300025295 Ga0209564_1001626 Ga0209564_100162613 335
287 3300031548 Ga0307408_100053003 Ga0307408_1000530033 335
288 3300046514 Ga0495618_0166601 Ga0495618_0166601_296_1309 335
289 3300046516 Ga0495628_0003683 Ga0495628_0003683_2256_3269 335
290 3300046529 Ga0495652_0011271 Ga0495652_0011271_402_1415 335
291 3300046536 Ga0495587_0091556 Ga0495587_0091556_588_1601 335
292 3300046543 Ga0495645_0056473 Ga0495645_0056473_397_1410 335
293 3300046679 Ga0495623_0053390 Ga0495623_0053390_940_1953 335
294 3300046680 Ga0495646_0038638 Ga0495646_0038638_218_1231 335
295 3300047317 Ga0495604_0030809 Ga0495604_0030809_486_1499 335
296 3300047319 Ga0495674_0014695 Ga0495674_0014695_5518_6531 335
297 3300047444 Ga0495675_0003891 Ga0495675_0003891_276_1289 335
298 3300048088 Ga0495602_0012370 Ga0495602_0012370_578_1591 335
299 3300048907 Ga0496104_0477792 Ga0496104_0477792_118_1143 335
300 3300049571 Ga0501034_0026362 Ga0501034_0026362_3552_4565 335
301 3300049590 Ga0501074_0161020 Ga0501074_0161020_46_1098 335
302 3300049744 Ga0501083_0195204 Ga0501083_0195204_238_1290 335
303 3300049744 Ga0501083_0210194 Ga0501083_0210194_85_1098 335
304 3300050491 nmdc:mga00v17_117840_c1 nmdc:mga00v17_117840_c1_331_1374 335
305 3300053077 Ga0495601_0021412 Ga0495601_0021412_1545_2558 335
306 3300053078 Ga0495612_0007530 Ga0495612_0007530_647_1660 335
307 3300053084 Ga0495595_0058430 Ga0495595_0058430_183_1196 335
308 3300053118 Ga0500594_0003781 Ga0500594_0003781_1106_2152 335
309 iso_pu_bacteria 2595698237 2596372189 335
310 iso_pu_bacteria 2597490356 2599101796 335
311 iso_pu_bacteria 2842694124 2842697884 335
312 iso_pu_bacteria 2846952575 2846957940 335
313 iso_pu_bacteria 2848858292 2848864438 335
314 iso_pu_bacteria 2857542790 2857546215 335
315 iso_pu_bacteria 2889306138 2889309566 335
316 iso_pu_bacteria 2902405164 2902410493 335
317 iso_pu_bacteria 2928125067 2928129148 335
318 3300005356 Ga0070674_100060525 Ga0070674_1000605251 337
319 3300005564 Ga0070664_100043666 Ga0070664_1000436664 337
320 3300006042 Ga0075368_10007055 Ga0075368_100070553 337
321 3300006051 Ga0075364_10013926 Ga0075364_100139265 337
322 3300006178 Ga0075367_10035633 Ga0075367_100356332 337
323 3300006186 Ga0075369_10012833 Ga0075369_100128332 337
324 3300006237 Ga0097621_100145673 Ga0097621_1001456732 337
325 3300014968 Ga0157379_10046373 Ga0157379_100463733 337
326 3300025924 Ga0207694_10047081 Ga0207694_100470812 337
327 3300026078 Ga0207702_10140357 Ga0207702_101403572 337
328 3300030521 Ga0307511_10000014 Ga0307511_10000014125 337
329 3300039437 Ga0436365_1368008 Ga0436365_1368008_491_1522 337
330 3300048913 Ga0496110_0050899 Ga0496110_0050899_733_1767 337
331 3300048913 Ga0496110_0340113 Ga0496110_0340113_283_1302 337
332 3300048918 Ga0496115_0014496 Ga0496115_0014496_4627_5658 337
333 3300049570 Ga0501033_0161827 Ga0501033_0161827_462_1481 337
334 3300049576 Ga0501040_0038136 Ga0501040_0038136_757_1776 337
335 3300049577 Ga0501041_0038497 Ga0501041_0038497_181_1200 337
336 3300049578 Ga0501042_0029949 Ga0501042_0029949_1824_2843 337
337 3300049579 Ga0501043_0164793 Ga0501043_0164793_586_1605 337
338 3300049587 Ga0501071_0014840 Ga0501071_0014840_956_1975 337
339 3300049588 Ga0501072_0004729 Ga0501072_0004729_8650_9669 337
340 3300049591 Ga0501075_0003767 Ga0501075_0003767_8261_9280 337
341 3300049592 Ga0501076_0002632 Ga0501076_0002632_2716_3735 337
342 3300049741 Ga0501079_0019453 Ga0501079_0019453_962_1981 337
343 3300049743 Ga0501081_0044648 Ga0501081_0044648_181_1200 337
344 3300049744 Ga0501083_0039745 Ga0501083_0039745_1318_2337 337
345 3300049823 Ga0501044_0361345 Ga0501044_0361345_91_1110 337
346 3300049824 Ga0501045_0000328 Ga0501045_0000328_23002_24021 337
347 3300050493 nmdc:mga0k408_96679_c1 nmdc:mga0k408_96679_c1_209_1270 337
348 3300050494 nmdc:mga06z11_7243_c1 nmdc:mga06z11_7243_c1_627_1655 337
349 3300050496 nmdc:mga07m45_69736_c1 nmdc:mga07m45_69736_c1_628_1689 337
350 3300050512 nmdc:mga0n895_435585_c1 nmdc:mga0n895_435585_c1_106_1134 337
351 3300060353 Ga0501082_0053841 Ga0501082_0053841_618_1637 337
352 3300061734 Ga0530510_0027778 Ga0530510_0027778_2006_3025 337
353 iso_pu_bacteria 2545555834 2545675152 337
354 iso_pu_bacteria 2824617872 2824620292 337
355 iso_pu_bacteria 2824626560 2824629557 337
356 iso_pu_bacteria 2824635225 2824635877 337
357 iso_pu_bacteria 2824644064 2824645307 337
358 iso_pu_bacteria 2824714736 2824722957 337
359 iso_pu_bacteria 2824723954 2824725286 337
360 iso_pu_bacteria 2929199973 2929204031 337
361 iso_pu_bacteria 641522639 641645805 337
362 iso_pu_bacteria 8055909800 8055911439 337
363 3300005289 Ga0065704_10020805 Ga0065704_100208052 338
364 3300005328 Ga0070676_10035764 Ga0070676_100357642 338
365 3300005353 Ga0070669_100013682 Ga0070669_1000136825 338
366 3300005355 Ga0070671_100012862 Ga0070671_1000128627 338
367 3300005356 Ga0070674_100039243 Ga0070674_1000392433 338
368 3300005367 Ga0070667_100030529 Ga0070667_1000305295 338
369 3300005434 Ga0070709_10199039 Ga0070709_101990391 338
370 3300005435 Ga0070714_100464283 Ga0070714_1004642831 338
371 3300005436 Ga0070713_100002404 Ga0070713_1000024048 338
372 3300005439 Ga0070711_100028066 Ga0070711_1000280663 338
373 3300005441 Ga0070700_100115285 Ga0070700_1001152852 338
374 3300005457 Ga0070662_100081318 Ga0070662_1000813182 338
375 3300005459 Ga0068867_100045107 Ga0068867_1000451072 338
376 3300005466 Ga0070685_10076575 Ga0070685_100765751 338
377 3300005546 Ga0070696_100057255 Ga0070696_1000572552 338
378 3300005549 Ga0070704_100048479 Ga0070704_1000484793 338
379 3300005618 Ga0068864_100168521 Ga0068864_1001685212 338
380 3300005718 Ga0068866_10001554 Ga0068866_100015548 338
381 3300005841 Ga0068863_100082082 Ga0068863_1000820822 338
382 3300005843 Ga0068860_100049518 Ga0068860_1000495183 338
383 3300005983 Ga0081540_1015468 Ga0081540_10154682 338
384 3300006028 Ga0070717_10074371 Ga0070717_100743712 338
385 3300006173 Ga0070716_100013289 Ga0070716_1000132894 338
386 3300006881 Ga0068865_100067979 Ga0068865_1000679793 338
387 3300006946 Ga0079104_1000772 Ga0079104_10007723 338
388 3300009094 Ga0111539_10168777 Ga0111539_101687773 338
389 3300009148 Ga0105243_10027268 Ga0105243_100272685 338
390 3300009176 Ga0105242_10104545 Ga0105242_101045452 338
391 3300013102 Ga0157371_10285144 Ga0157371_102851442 338
392 3300013297 Ga0157378_10136986 Ga0157378_101369862 338
393 3300021388 Ga0213875_10000007 Ga0213875_10000007444 338
394 3300025893 Ga0207682_10001905 Ga0207682_100019057 338
395 3300025906 Ga0207699_10010277 Ga0207699_100102773 338
396 3300025907 Ga0207645_10010590 Ga0207645_100105903 338
397 3300025915 Ga0207693_10016959 Ga0207693_100169594 338
398 3300025928 Ga0207700_10217672 Ga0207700_102176722 338
399 3300025929 Ga0207664_10244199 Ga0207664_102441992 338
400 3300025933 Ga0207706_10126822 Ga0207706_101268222 338
401 3300025935 Ga0207709_10033632 Ga0207709_100336322 338
402 3300025936 Ga0207670_10290929 Ga0207670_102909292 338
403 3300025937 Ga0207669_10032407 Ga0207669_100324072 338
404 3300025938 Ga0207704_10068433 Ga0207704_100684333 338
405 3300025939 Ga0207665_10002581 Ga0207665_100025815 338
406 3300025940 Ga0207691_10024151 Ga0207691_100241517 338
407 3300025942 Ga0207689_10002991 Ga0207689_100029915 338
408 3300026035 Ga0207703_10084126 Ga0207703_100841262 338
409 3300026075 Ga0207708_10040488 Ga0207708_100404882 338
410 3300026088 Ga0207641_10111317 Ga0207641_101113172 338
411 3300026089 Ga0207648_10003243 Ga0207648_100032433 338
412 3300026118 Ga0207675_100072011 Ga0207675_1000720112 338
413 3300026121 Ga0207683_10048849 Ga0207683_100488493 338
414 3300026142 Ga0207698_10298476 Ga0207698_102984761 338
415 3300027111 Ga0209281_1000839 Ga0209281_10008393 338
416 3300037853 Ga0436364_0430154 Ga0436364_0430154_8231_9253 338
417 3300039437 Ga0436365_1187256 Ga0436365_1187256_83_1120 338
418 3300039438 Ga0436360_0504894 Ga0436360_0504894_3865_4899 338
419 3300039450 Ga0436363_0287186 Ga0436363_0287186_207_1223 338
420 3300045051 Ga0451576_0190182 Ga0451576_0190182_976_1998 338
421 3300047322 Ga0495680_0086176 Ga0495680_0086176_828_1865 338
422 3300048088 Ga0495602_0162233 Ga0495602_0162233_222_1259 338
423 3300053078 Ga0495612_0063384 Ga0495612_0063384_460_1497 338
424 iso_pu_bacteria 2511231028 2511399170 338
425 iso_pu_bacteria 2513237087 2513592593 338
426 iso_pu_bacteria 2513237098 2513674510 338
427 iso_pu_bacteria 2522572158 2523105686 338
428 iso_pu_bacteria 2524023210 2524465023 338
429 iso_pu_bacteria 2791355197 2793073773 338
430 iso_pu_bacteria 2885383462 2885383535 338
431 iso_pu_bacteria 2903768456 2903769419 338
432 iso_pu_bacteria 2906610324 2906611714 338
433 iso_pu_bacteria 2922425934 2922427648 338
434 iso_pu_bacteria 3005474847 3005477322 338
435 iso_pu_bacteria 8019555841 8019559808 338
436 iso_pu_bacteria 8019565922 8019569914 338
437 3300044735 Ga0466968_0009238 Ga0466968_0009238_1902_2936 339
438 3300048924 Ga0496121_0017759 Ga0496121_0017759_3087_4148 339
439 3300049572 Ga0501036_0165046 Ga0501036_0165046_391_1428 339
440 3300049586 Ga0501070_0140089 Ga0501070_0140089_48_1085 339
441 3300049588 Ga0501072_0069334 Ga0501072_0069334_1076_2113 339
442 3300049741 Ga0501079_0012771 Ga0501079_0012771_1856_2893 339
443 3300049742 Ga0501080_0007756 Ga0501080_0007756_6592_7629 339
444 3300053153 Ga0500616_0005912 Ga0500616_0005912_241_1278 339
445 3300054114 Ga0501084_0004628 Ga0501084_0004628_5151_6188 339
446 3300060353 Ga0501082_0018381 Ga0501082_0018381_2804_3841 339
447 3300061734 Ga0530510_0042778 Ga0530510_0042778_723_1760 339
448 iso_pu_bacteria 2508501128 2509146916 339
449 iso_pu_bacteria 2513237092 2513622213 339
450 iso_pu_bacteria 2513237095 2513647102 339
451 iso_pu_bacteria 2513237101 2513696629 339
452 iso_pu_bacteria 2513237102 2513699649 339
453 iso_pu_bacteria 2517093001 2517103706 339
454 iso_pu_bacteria 2602042107 2603861732 339
455 iso_pu_bacteria 2617270741 2617378463 339
456 iso_pu_bacteria 2816332527 2818236140 339
457 iso_pu_bacteria 2824679649 2824680393 339
458 iso_pu_bacteria 2824704595 2824706626 339
459 iso_pu_bacteria 2824732956 2824737525 339
460 iso_pu_bacteria 2824746037 2824752595 339
461 iso_pu_bacteria 2824753945 2824756567 339
462 iso_pu_bacteria 2824763712 2824766061 339
463 iso_pu_bacteria 2841957949 2841960124 339
464 iso_pu_bacteria 2847930680 2847936723 339
465 iso_pu_bacteria 2857509624 2857516201 339
466 iso_pu_bacteria 2857524615 2857525921 339
467 iso_pu_bacteria 2874604998 2874612363 339
468 iso_pu_bacteria 2874612657 2874617352 339
469 iso_pu_bacteria 2874628541 2874631697 339
470 iso_pu_bacteria 2876761206 2876770372 339
471 iso_pu_bacteria 2879083081 2879087933 339
472 iso_pu_bacteria 2879110137 2879116284 339
473 iso_pu_bacteria 2881364244 2881368241 339
474 iso_pu_bacteria 2885366525 2885367133 339
475 iso_pu_bacteria 2888378607 2888385028 339
476 iso_pu_bacteria 2889033259 2889040928 339
477 iso_pu_bacteria 2893066018 2893067798 339
478 iso_pu_bacteria 2904711408 2904715208 339
479 iso_pu_bacteria 2906626472 2906631271 339
480 iso_pu_bacteria 2906643746 2906646415 339
481 iso_pu_bacteria 2908775508 2908780708 339
482 iso_pu_bacteria 2919073203 2919074218 339
483 iso_pu_bacteria 2922393267 2922397521 339
484 iso_pu_bacteria 3005483717 3005485225 339
485 iso_pu_bacteria 3005506211 3005507906 339
486 iso_pu_bacteria 3005587118 3005587483 339
487 iso_pu_bacteria 8006964411 8006969966 339
488 iso_pu_bacteria 8006984368 8006989556 339
489 iso_pu_bacteria 8006994254 8006995182 339
490 iso_pu_bacteria 8016583857 8016593621 339
491 iso_pu_bacteria 8056681323 8056686898 339
492 3300006042 Ga0075368_10000671 Ga0075368_100006715 340
493 3300006048 Ga0075363_100013498 Ga0075363_1000134983 340
494 3300006178 Ga0075367_10002090 Ga0075367_100020907 340
495 3300006844 Ga0075428_100096916 Ga0075428_1000969163 340
496 3300006847 Ga0075431_100004487 Ga0075431_1000044876 340
497 3300009147 Ga0114129_10409322 Ga0114129_104093222 340
498 3300026118 Ga0207675_100379843 Ga0207675_1003798432 340
499 3300027866 Ga0209813_10000408 Ga0209813_100004083 340
500 3300049824 Ga0501045_0205484 Ga0501045_0205484_414_1448 340
501 3300050490 nmdc:mga03n38_21055_c1 nmdc:mga03n38_21055_c1_1230_2267 340
502 3300050494 nmdc:mga06z11_3902_c1 nmdc:mga06z11_3902_c1_4273_5310 340
503 3300050495 nmdc:mga04h51_1285_c1 nmdc:mga04h51_1285_c1_4379_5416 340
504 3300050510 nmdc:mga06r32_291121_c1 nmdc:mga06r32_291121_c1_449_1486 340
505 3300006847 Ga0075431_100258715 Ga0075431_1002587152 341
506 3300006880 Ga0075429_100050064 Ga0075429_1000500643 341
507 3300009094 Ga0111539_10003120 Ga0111539_1000312015 341
508 3300025297 Ga0209758_1002191 Ga0209758_10021913 341
509 3300044694 Ga0466963_0194984 Ga0466963_0194984_76_1107 341
510 3300044842 Ga0466957_0049790 Ga0466957_0049790_1331_2362 341
511 3300048912 Ga0496109_0381374 Ga0496109_0381374_210_1253 341
512 3300048924 Ga0496121_0017055 Ga0496121_0017055_5563_6600 341
513 3300048929 Ga0496126_0115348 Ga0496126_0115348_875_1912 341
514 3300049571 Ga0501034_0024944 Ga0501034_0024944_2324_3364 341
515 3300049587 Ga0501071_0249090 Ga0501071_0249090_52_1092 341
516 3300050510 nmdc:mga06r32_325079_c1 nmdc:mga06r32_325079_c1_127_1167 341
517 3300050511 nmdc:mga08y16_76324_c1 nmdc:mga08y16_76324_c1_2391_3431 341
518 3300053092 Ga0500583_0003885 Ga0500583_0003885_1220_2296 341
519 3300053093 Ga0500651_0023641 Ga0500651_0023641_2451_3488 341
520 3300053119 Ga0500595_002181 Ga0500595_002181_7397_8434 341
521 3300060353 Ga0501082_0079675 Ga0501082_0079675_1244_2284 341
522 3300003215 JGI25153J46596_10002675 JGI25153J46596_100026759 342
523 3300005435 Ga0070714_100429654 Ga0070714_1004296542 342
524 3300005437 Ga0070710_10004275 Ga0070710_100042756 342
525 3300005937 Ga0081455_10031199 Ga0081455_100311994 342
526 3300006048 Ga0075363_100000761 Ga0075363_1000007617 342
527 3300006173 Ga0070716_100011005 Ga0070716_1000110054 342
528 3300006175 Ga0070712_100064170 Ga0070712_1000641703 342
529 3300006844 Ga0075428_100204869 Ga0075428_1002048692 342
530 3300006846 Ga0075430_100014692 Ga0075430_1000146924 342
531 3300006847 Ga0075431_100002204 Ga0075431_1000022046 342
532 3300025915 Ga0207693_10024155 Ga0207693_100241554 342
533 3300025929 Ga0207664_10036615 Ga0207664_100366151 342
534 3300025939 Ga0207665_10024249 Ga0207665_100242492 342
535 3300028380 Ga0268265_10119178 Ga0268265_101191782 342
536 3300035086 Ga0373934_0003068 Ga0373934_0003068_5021_6055 342
537 3300035118 Ga0373954_0004828 Ga0373954_0004828_3684_4718 342
538 3300035119 Ga0373956_0009898 Ga0373956_0009898_74_1108 342
539 3300035724 Ga0373933_0001341 Ga0373933_0001341_3929_4963 342
540 3300037471 Ga0395905_0069896 Ga0395905_0069896_1926_2969 342
541 3300046462 Ga0495651_0130767 Ga0495651_0130767_512_1546 342
542 3300046533 Ga0495640_0022824 Ga0495640_0022824_3448_4482 342
543 3300046543 Ga0495645_0001496 Ga0495645_0001496_2577_3611 342
544 3300046559 Ga0495667_0018521 Ga0495667_0018521_410_1444 342
545 3300046663 Ga0495635_0054834 Ga0495635_0054834_833_1867 342
546 3300046679 Ga0495623_0004849 Ga0495623_0004849_3500_4534 342
547 3300046809 Ga0495600_0083000 Ga0495600_0083000_899_1933 342
548 3300047317 Ga0495604_0018955 Ga0495604_0018955_3185_4219 342
549 3300047320 Ga0495672_0097344 Ga0495672_0097344_193_1227 342
550 3300047444 Ga0495675_0009097 Ga0495675_0009097_3258_4292 342
551 3300047471 Ga0495684_0008620 Ga0495684_0008620_3185_4219 342
552 3300047673 Ga0495593_0105613 Ga0495593_0105613_301_1335 342
553 3300048088 Ga0495602_0119735 Ga0495602_0119735_640_1674 342
554 3300048909 Ga0496106_0130191 Ga0496106_0130191_338_1387 342
555 3300048911 Ga0496108_0051787 Ga0496108_0051787_906_1955 342
556 3300048915 Ga0496112_0106907 Ga0496112_0106907_1183_2232 342
557 3300048918 Ga0496115_0187546 Ga0496115_0187546_429_1478 342
558 3300048924 Ga0496121_0072659 Ga0496121_0072659_1081_2124 342
559 3300048929 Ga0496126_0022525 Ga0496126_0022525_3418_4461 342
560 3300048929 Ga0496126_0364539 Ga0496126_0364539_53_1096 342
561 3300049580 Ga0501046_0119377 Ga0501046_0119377_381_1439 342
562 3300049591 Ga0501075_0175249 Ga0501075_0175249_51_1094 342
563 3300049741 Ga0501079_0063679 Ga0501079_0063679_804_1847 342
564 3300050490 nmdc:mga03n38_4978_c1 nmdc:mga03n38_4978_c1_3130_4173 342
565 3300050507 nmdc:mga05p37_156332_c1 nmdc:mga05p37_156332_c1_747_1811 342
566 3300050509 nmdc:mga0qj67_12381_c1 nmdc:mga0qj67_12381_c1_2688_3752 342
567 3300050510 nmdc:mga06r32_2927_c1 nmdc:mga06r32_2927_c1_2339_3403 342
568 3300053078 Ga0495612_0015354 Ga0495612_0015354_347_1381 342
569 3300053151 Ga0500604_0000407 Ga0500604_0000407_5312_6400 342
570 iso_pu_bacteria 2643221623 2644130974 342
571 iso_pu_bacteria 2837651117 2837654353 342
572 3300005331 Ga0070670_100051718 Ga0070670_1000517183 343
573 3300005336 Ga0070680_100177071 Ga0070680_1001770712 343
574 3300005347 Ga0070668_100109997 Ga0070668_1001099972 343
575 3300005355 Ga0070671_100063572 Ga0070671_1000635723 343
576 3300005356 Ga0070674_100287504 Ga0070674_1002875041 343
577 3300005364 Ga0070673_100469065 Ga0070673_1004690651 343
578 3300005367 Ga0070667_100113122 Ga0070667_1001131222 343
579 3300005434 Ga0070709_10004866 Ga0070709_100048665 343
580 3300005435 Ga0070714_100001309 Ga0070714_10000130914 343
581 3300005435 Ga0070714_100204624 Ga0070714_1002046242 343
582 3300005439 Ga0070711_100000362 Ga0070711_1000003625 343
583 3300005441 Ga0070700_100215770 Ga0070700_1002157701 343
584 3300005455 Ga0070663_100021917 Ga0070663_1000219173 343
585 3300005455 Ga0070663_100029127 Ga0070663_1000291272 343
586 3300005456 Ga0070678_100042423 Ga0070678_1000424232 343
587 3300005457 Ga0070662_100175436 Ga0070662_1001754362 343
588 3300005458 Ga0070681_10020166 Ga0070681_100201666 343
589 3300005539 Ga0068853_100444590 Ga0068853_1004445901 343
590 3300005546 Ga0070696_100183914 Ga0070696_1001839141 343
591 3300005548 Ga0070665_100115402 Ga0070665_1001154023 343
592 3300005548 Ga0070665_100165949 Ga0070665_1001659493 343
593 3300005563 Ga0068855_100025399 Ga0068855_1000253995 343
594 3300005563 Ga0068855_100123173 Ga0068855_1001231732 343
595 3300005614 Ga0068856_100108101 Ga0068856_1001081012 343
596 3300005614 Ga0068856_100166670 Ga0068856_1001666702 343
597 3300005618 Ga0068864_100575089 Ga0068864_1005750891 343
598 3300005842 Ga0068858_100005194 Ga0068858_1000051943 343
599 3300005843 Ga0068860_100369935 Ga0068860_1003699352 343
600 3300005937 Ga0081455_10003782 Ga0081455_100037823 343
601 3300005983 Ga0081540_1000937 Ga0081540_10009374 343
602 3300005983 Ga0081540_1001679 Ga0081540_100167910 343
603 3300006028 Ga0070717_10002967 Ga0070717_100029675 343
604 3300006042 Ga0075368_10072004 Ga0075368_100720042 343
605 3300006048 Ga0075363_100153852 Ga0075363_1001538522 343
606 3300006163 Ga0070715_10011015 Ga0070715_100110155 343
607 3300006173 Ga0070716_100018949 Ga0070716_1000189493 343
608 3300006175 Ga0070712_100140922 Ga0070712_1001409222 343
609 3300006186 Ga0075369_10079228 Ga0075369_100792282 343
610 3300006195 Ga0075366_10022499 Ga0075366_100224993 343
611 3300006195 Ga0075366_10078135 Ga0075366_100781351 343
612 3300006353 Ga0075370_10041668 Ga0075370_100416682 343
613 3300006846 Ga0075430_100007063 Ga0075430_1000070637 343
614 3300006847 Ga0075431_100020866 Ga0075431_1000208663 343
615 3300006847 Ga0075431_100206039 Ga0075431_1002060392 343
616 3300006880 Ga0075429_100020360 Ga0075429_1000203603 343
617 3300009093 Ga0105240_10021211 Ga0105240_100212117 343
618 3300009098 Ga0105245_10003785 Ga0105245_1000378510 343
619 3300009101 Ga0105247_10006629 Ga0105247_100066296 343
620 3300009101 Ga0105247_10034192 Ga0105247_100341922 343
621 3300009148 Ga0105243_10115385 Ga0105243_101153852 343
622 3300009174 Ga0105241_10029956 Ga0105241_100299562 343
623 3300009177 Ga0105248_10260904 Ga0105248_102609042 343
624 3300009545 Ga0105237_10244619 Ga0105237_102446192 343
625 3300009551 Ga0105238_10072474 Ga0105238_100724744 343
626 3300009551 Ga0105238_10183534 Ga0105238_101835343 343
627 3300009553 Ga0105249_10256209 Ga0105249_102562092 343
628 3300010375 Ga0105239_10209072 Ga0105239_102090723 343
629 3300011119 Ga0105246_10006437 Ga0105246_100064373 343
630 3300011119 Ga0105246_10079580 Ga0105246_100795803 343
631 3300013104 Ga0157370_10034208 Ga0157370_100342082 343
632 3300013104 Ga0157370_10090185 Ga0157370_100901853 343
633 3300013105 Ga0157369_10259333 Ga0157369_102593332 343
634 3300013296 Ga0157374_10051941 Ga0157374_100519413 343
635 3300013296 Ga0157374_10262320 Ga0157374_102623202 343
636 3300013306 Ga0163162_10142417 Ga0163162_101424173 343
637 3300013306 Ga0163162_10541075 Ga0163162_105410751 343
638 3300014325 Ga0163163_10003696 Ga0163163_1000369612 343
639 3300014325 Ga0163163_10093806 Ga0163163_100938063 343
640 3300014745 Ga0157377_10226984 Ga0157377_102269841 343
641 3300014969 Ga0157376_10003716 Ga0157376_100037169 343
642 3300021384 Ga0213876_10000944 Ga0213876_100009448 343
643 3300025295 Ga0209564_1008466 Ga0209564_10084665 343
644 3300025898 Ga0207692_10010733 Ga0207692_100107335 343
645 3300025900 Ga0207710_10011889 Ga0207710_100118891 343
646 3300025901 Ga0207688_10019972 Ga0207688_100199723 343
647 3300025903 Ga0207680_10236359 Ga0207680_102363591 343
648 3300025904 Ga0207647_10011848 Ga0207647_100118484 343
649 3300025907 Ga0207645_10127742 Ga0207645_101277422 343
650 3300025911 Ga0207654_10252886 Ga0207654_102528861 343
651 3300025912 Ga0207707_10018781 Ga0207707_100187812 343
652 3300025915 Ga0207693_10001150 Ga0207693_100011505 343
653 3300025915 Ga0207693_10129223 Ga0207693_101292232 343
654 3300025916 Ga0207663_10002241 Ga0207663_100022412 343
655 3300025917 Ga0207660_10068232 Ga0207660_100682323 343
656 3300025921 Ga0207652_10125048 Ga0207652_101250481 343
657 3300025923 Ga0207681_10170299 Ga0207681_101702992 343
658 3300025924 Ga0207694_10156488 Ga0207694_101564882 343
659 3300025925 Ga0207650_10150214 Ga0207650_101502142 343
660 3300025927 Ga0207687_10001252 Ga0207687_100012528 343
661 3300025929 Ga0207664_10121412 Ga0207664_101214122 343
662 3300025933 Ga0207706_10030478 Ga0207706_100304782 343
663 3300025933 Ga0207706_10142460 Ga0207706_101424603 343
664 3300025935 Ga0207709_10039461 Ga0207709_100394612 343
665 3300025939 Ga0207665_10000775 Ga0207665_100007757 343
666 3300025940 Ga0207691_10163394 Ga0207691_101633942 343
667 3300025945 Ga0207679_10211038 Ga0207679_102110382 343
668 3300025972 Ga0207668_10237249 Ga0207668_102372492 343
669 3300026023 Ga0207677_10004452 Ga0207677_100044522 343
670 3300026035 Ga0207703_10007538 Ga0207703_100075388 343
671 3300026041 Ga0207639_10299097 Ga0207639_102990972 343
672 3300026067 Ga0207678_10057223 Ga0207678_100572232 343
673 3300026067 Ga0207678_10081798 Ga0207678_100817983 343
674 3300026075 Ga0207708_10131512 Ga0207708_101315122 343
675 3300026078 Ga0207702_10260362 Ga0207702_102603622 343
676 3300026078 Ga0207702_10375880 Ga0207702_103758802 343
677 3300026116 Ga0207674_10111536 Ga0207674_101115363 343
678 3300026118 Ga0207675_100061604 Ga0207675_1000616042 343
679 3300028379 Ga0268266_10022350 Ga0268266_100223501 343
680 3300028379 Ga0268266_10024247 Ga0268266_100242472 343
681 3300028381 Ga0268264_10100948 Ga0268264_101009482 343
682 3300031344 Ga0265316_10190919 Ga0265316_101909192 343
683 3300031711 Ga0265314_10004888 Ga0265314_100048882 343
684 3300032002 Ga0307416_100478923 Ga0307416_1004789232 343
685 3300032126 Ga0307415_100027417 Ga0307415_1000274175 343
686 3300033180 Ga0307510_10045817 Ga0307510_100458174 343
687 3300037853 Ga0436364_0207394 Ga0436364_0207394_11354_12400 343
688 3300037853 Ga0436364_0286306 Ga0436364_0286306_274_1311 343
689 3300039437 Ga0436365_0159339 Ga0436365_0159339_45831_46877 343
690 3300039450 Ga0436363_0703923 Ga0436363_0703923_207_1253 343
691 3300039453 Ga0436362_0274206 Ga0436362_0274206_91_1137 343
692 3300044684 Ga0466966_0041438 Ga0466966_0041438_649_1698 343
693 3300044765 Ga0466970_0183530 Ga0466970_0183530_100_1149 343
694 3300045049 Ga0466959_0018887 Ga0466959_0018887_2576_3625 343
695 3300046455 Ga0495603_0000815 Ga0495603_0000815_2977_4023 343
696 3300046460 Ga0495638_0002133 Ga0495638_0002133_14001_15047 343
697 3300046460 Ga0495638_0079907 Ga0495638_0079907_826_1872 343
698 3300046499 Ga0495594_0125454 Ga0495594_0125454_203_1249 343
699 3300046500 Ga0495596_0054852 Ga0495596_0054852_304_1350 343
700 3300046512 Ga0495610_0075765 Ga0495610_0075765_368_1414 343
701 3300046513 Ga0495616_0118733 Ga0495616_0118733_92_1138 343
702 3300046519 Ga0495632_0037042 Ga0495632_0037042_1387_2433 343
703 3300046519 Ga0495632_0098174 Ga0495632_0098174_15_1061 343
704 3300046522 Ga0495643_0047109 Ga0495643_0047109_876_1922 343
705 3300046524 Ga0495648_0111791 Ga0495648_0111791_21_1067 343
706 3300046530 Ga0495654_0078628 Ga0495654_0078628_28_1074 343
707 3300046557 Ga0495622_0003864 Ga0495622_0003864_5252_6298 343
708 3300046557 Ga0495622_0055459 Ga0495622_0055459_117_1163 343
709 3300046616 Ga0495668_0037199 Ga0495668_0037199_809_1864 343
710 3300046648 Ga0495611_0029563 Ga0495611_0029563_492_1538 343
711 3300046660 Ga0495625_0040647 Ga0495625_0040647_1975_3021 343
712 3300046665 Ga0495661_0079214 Ga0495661_0079214_736_1782 343
713 3300046674 Ga0495588_0049897 Ga0495588_0049897_153_1199 343
714 3300047315 Ga0495581_0052066 Ga0495581_0052066_658_1704 343
715 3300047472 Ga0495686_0036654 Ga0495686_0036654_676_1722 343
716 3300048091 Ga0495626_0033986 Ga0495626_0033986_137_1183 343
717 3300048903 Ga0496100_0022978 Ga0496100_0022978_1393_2424 343
718 3300048904 Ga0496101_0111578 Ga0496101_0111578_212_1258 343
719 3300048906 Ga0496103_0206902 Ga0496103_0206902_131_1177 343
720 3300048907 Ga0496104_0013698 Ga0496104_0013698_1864_2895 343
721 3300048907 Ga0496104_0157650 Ga0496104_0157650_217_1263 343
722 3300048908 Ga0496105_0033160 Ga0496105_0033160_2162_3208 343
723 3300048908 Ga0496105_0047746 Ga0496105_0047746_2113_3144 343
724 3300048911 Ga0496108_0001892 Ga0496108_0001892_1593_2624 343
725 3300048911 Ga0496108_0139622 Ga0496108_0139622_155_1201 343
726 3300048912 Ga0496109_0002039 Ga0496109_0002039_10420_11451 343
727 3300048912 Ga0496109_0075201 Ga0496109_0075201_1830_2876 343
728 3300048912 Ga0496109_0139178 Ga0496109_0139178_484_1530 343
729 3300048913 Ga0496110_0218178 Ga0496110_0218178_27_1073 343
730 3300048914 Ga0496111_0012151 Ga0496111_0012151_2686_3717 343
731 3300048914 Ga0496111_0052500 Ga0496111_0052500_870_1916 343
732 3300048915 Ga0496112_0003469 Ga0496112_0003469_1038_2069 343
733 3300048915 Ga0496112_0184408 Ga0496112_0184408_46_1092 343
734 3300048916 Ga0496113_0000597 Ga0496113_0000597_9022_10053 343
735 3300048916 Ga0496113_0057399 Ga0496113_0057399_694_1740 343
736 3300048921 Ga0496118_0043619 Ga0496118_0043619_2145_3191 343
737 3300048921 Ga0496118_0068161 Ga0496118_0068161_599_1645 343
738 3300048922 Ga0496119_0056562 Ga0496119_0056562_461_1507 343
739 3300048923 Ga0496120_0026457 Ga0496120_0026457_1680_2726 343
740 3300048924 Ga0496121_0017489 Ga0496121_0017489_133_1179 343
741 3300048924 Ga0496121_0019762 Ga0496121_0019762_3133_4179 343
742 3300048924 Ga0496121_0114106 Ga0496121_0114106_594_1640 343
743 3300048925 Ga0496122_0030398 Ga0496122_0030398_735_1781 343
744 3300048927 Ga0496124_0061900 Ga0496124_0061900_222_1268 343
745 3300048928 Ga0496125_0006164 Ga0496125_0006164_8090_9136 343
746 3300048929 Ga0496126_0001329 Ga0496126_0001329_430_1476 343
747 3300048929 Ga0496126_0007328 Ga0496126_0007328_763_1809 343
748 3300048929 Ga0496126_0083503 Ga0496126_0083503_1269_2315 343
749 3300049586 Ga0501070_0035967 Ga0501070_0035967_2801_3838 343
750 3300050495 nmdc:mga04h51_16333_c1 nmdc:mga04h51_16333_c1_971_2017 343
751 3300050508 nmdc:mga09592_40498_c1 nmdc:mga09592_40498_c1_1479_2561 343
752 3300050509 nmdc:mga0qj67_16699_c1 nmdc:mga0qj67_16699_c1_4305_5387 343
753 3300050509 nmdc:mga0qj67_304001_c1 nmdc:mga0qj67_304001_c1_206_1246 343
754 3300050510 nmdc:mga06r32_21619_c1 nmdc:mga06r32_21619_c1_4196_5278 343
755 3300053080 Ga0500635_0002895 Ga0500635_0002895_1741_2787 343
756 3300053087 Ga0500643_000040 Ga0500643_000040_106361_107407 343
757 3300053094 Ga0500566_0000005 Ga0500566_0000005_47590_48636 343
758 3300053094 Ga0500566_0001430 Ga0500566_0001430_12307_13353 343
759 3300053095 Ga0500640_004238 Ga0500640_004238_1646_2692 343
760 3300053095 Ga0500640_061145 Ga0500640_061145_303_1340 343
761 3300053096 Ga0500641_0017337 Ga0500641_0017337_826_1872 343
762 3300053096 Ga0500641_0071255 Ga0500641_0071255_27_1073 343
763 3300053098 Ga0500650_0008348 Ga0500650_0008348_1421_2467 343
764 3300053103 Ga0500555_008753 Ga0500555_008753_1376_2422 343
765 3300053104 Ga0500556_0000019 Ga0500556_0000019_137716_138762 343
766 3300053104 Ga0500556_0011374 Ga0500556_0011374_1315_2361 343
767 3300053108 Ga0500562_011024 Ga0500562_011024_555_1601 343
768 3300053111 Ga0500572_000164 Ga0500572_000164_20575_21621 343
769 3300053115 Ga0500591_002791 Ga0500591_002791_407_1453 343
770 3300053116 Ga0500592_000378 Ga0500592_000378_540_1586 343
771 3300053117 Ga0500593_043337 Ga0500593_043337_28_1074 343
772 3300053119 Ga0500595_003323 Ga0500595_003323_5612_6658 343
773 3300053121 Ga0500607_035679 Ga0500607_035679_761_1798 343
774 3300053122 Ga0500608_001003 Ga0500608_001003_897_1943 343
775 3300053122 Ga0500608_009518 Ga0500608_009518_464_1510 343
776 3300053123 Ga0500614_000629 Ga0500614_000629_3918_4964 343
777 3300053123 Ga0500614_007561 Ga0500614_007561_1010_2047 343
778 3300053130 Ga0500642_0000048 Ga0500642_0000048_34101_35147 343
779 3300053131 Ga0500652_000394 Ga0500652_000394_11544_12590 343
780 3300053136 Ga0500559_0000543 Ga0500559_0000543_11152_12198 343
781 3300053136 Ga0500559_0002490 Ga0500559_0002490_894_1940 343
782 3300053139 Ga0500568_0000242 Ga0500568_0000242_31668_32714 343
783 3300053139 Ga0500568_0052815 Ga0500568_0052815_188_1234 343
784 3300053145 Ga0500586_000115 Ga0500586_000115_5732_6778 343
785 3300053148 Ga0500590_051710 Ga0500590_051710_699_1745 343
786 3300053148 Ga0500590_097370 Ga0500590_097370_123_1160 343
787 3300053150 Ga0500603_000097 Ga0500603_000097_2553_3599 343
788 3300053153 Ga0500616_0000059 Ga0500616_0000059_123516_124562 343
789 3300053156 Ga0500622_0002088 Ga0500622_0002088_1045_2091 343
790 3300053158 Ga0500627_0008480 Ga0500627_0008480_2478_3524 343
791 3300053159 Ga0500630_000701 Ga0500630_000701_8468_9514 343
792 3300053160 Ga0500633_0050632 Ga0500633_0050632_255_1292 343
793 3300053162 Ga0500638_023788 Ga0500638_023788_772_1818 343
794 3300053162 Ga0500638_053497 Ga0500638_053497_745_1791 343
795 3300053163 Ga0500639_000106 Ga0500639_000106_3112_4158 343
796 3300053163 Ga0500639_068445 Ga0500639_068445_623_1669 343
797 3300053177 Ga0500636_0000028 Ga0500636_0000028_73164_74201 343
798 3300053177 Ga0500636_0001221 Ga0500636_0001221_2367_3413 343
799 3300053178 Ga0500637_0019087 Ga0500637_0019087_2027_3073 343
800 3300053730 Ga0500645_013099 Ga0500645_013099_124_1170 343
801 3300053730 Ga0500645_025474 Ga0500645_025474_605_1651 343
802 3300053737 Ga0500601_000137 Ga0500601_000137_1017_2054 343
803 3300005563 Ga0068855_100060100 Ga0068855_1000601005 344
804 3300006844 Ga0075428_100024125 Ga0075428_1000241256 344
805 3300026067 Ga0207678_10031893 Ga0207678_100318934 344
806 3300033180 Ga0307510_10047901 Ga0307510_100479013 344
807 3300037418 Ga0395900_0264308 Ga0395900_0264308_532_1572 344
808 3300037466 Ga0395898_0162622 Ga0395898_0162622_189_1229 344
809 3300038443 Ga0395901_0385679 Ga0395901_0385679_148_1188 344
810 3300046455 Ga0495603_0055846 Ga0495603_0055846_434_1483 344
811 3300048929 Ga0496126_0038938 Ga0496126_0038938_2392_3432 344
812 3300050507 nmdc:mga05p37_75754_c1 nmdc:mga05p37_75754_c1_565_1605 344
813 3300053134 Ga0500658_0096611 Ga0500658_0096611_218_1267 344
814 3300053150 Ga0500603_000900 Ga0500603_000900_5620_6669 344
815 3300053161 Ga0500634_0132287 Ga0500634_0132287_15_1064 344
816 3300053178 Ga0500637_0000119 Ga0500637_0000119_14456_15505 344
817 3300005981 Ga0081538_10006418 Ga0081538_100064184 345
818 3300005983 Ga0081540_1005784 Ga0081540_10057842 345
819 3300031995 Ga0307409_100107720 Ga0307409_1001077202 345
820 3300049570 Ga0501033_0017045 Ga0501033_0017045_3334_4377 345
821 3300049574 Ga0501038_0106917 Ga0501038_0106917_566_1609 345
822 3300049580 Ga0501046_0225932 Ga0501046_0225932_201_1244 345
823 3300049581 Ga0501047_0009379 Ga0501047_0009379_3459_4502 345
824 3300049586 Ga0501070_0061978 Ga0501070_0061978_2004_3047 345
825 3300049587 Ga0501071_0072383 Ga0501071_0072383_61_1104 345
826 3300049588 Ga0501072_0019484 Ga0501072_0019484_2178_3221 345
827 3300049590 Ga0501074_0072720 Ga0501074_0072720_709_1752 345
828 3300049591 Ga0501075_0035408 Ga0501075_0035408_1180_2223 345
829 3300049822 Ga0501035_0016279 Ga0501035_0016279_5731_6774 345
830 3300049823 Ga0501044_0087986 Ga0501044_0087986_1407_2450 345
831 3300049823 Ga0501044_0266397 Ga0501044_0266397_515_1558 345
832 3300060353 Ga0501082_0087894 Ga0501082_0087894_544_1587 345
833 3300061734 Ga0530510_0047342 Ga0530510_0047342_1812_2855 345
834 3300005334 Ga0068869_100119789 Ga0068869_1001197892 346
835 3300005335 Ga0070666_10147580 Ga0070666_101475802 346
836 3300005436 Ga0070713_100138447 Ga0070713_1001384472 346
837 3300005445 Ga0070708_100062084 Ga0070708_1000620843 346
838 3300005518 Ga0070699_100035875 Ga0070699_1000358754 346
839 3300005518 Ga0070699_100116591 Ga0070699_1001165912 346
840 3300005841 Ga0068863_100567432 Ga0068863_1005674321 346
841 3300005937 Ga0081455_10057782 Ga0081455_100577823 346
842 3300005981 Ga0081538_10017150 Ga0081538_100171502 346
843 3300006038 Ga0075365_10003935 Ga0075365_100039352 346
844 3300006058 Ga0075432_10020087 Ga0075432_100200872 346
845 3300006175 Ga0070712_100057934 Ga0070712_1000579342 346
846 3300009098 Ga0105245_10080471 Ga0105245_100804713 346
847 3300014325 Ga0163163_10312257 Ga0163163_103122572 346
848 3300014968 Ga0157379_10150442 Ga0157379_101504422 346
849 3300014969 Ga0157376_10226284 Ga0157376_102262842 346
850 3300025910 Ga0207684_10108773 Ga0207684_101087732 346
851 3300025915 Ga0207693_10027969 Ga0207693_100279693 346
852 3300025922 Ga0207646_10039558 Ga0207646_100395582 346
853 3300025927 Ga0207687_10021234 Ga0207687_100212343 346
854 3300025928 Ga0207700_10022348 Ga0207700_100223482 346
855 3300025960 Ga0207651_10157413 Ga0207651_101574132 346
856 3300026023 Ga0207677_10105099 Ga0207677_101050992 346
857 3300026075 Ga0207708_10095183 Ga0207708_100951833 346
858 3300026089 Ga0207648_10009198 Ga0207648_100091986 346
859 3300035089 Ga0373944_0005124 Ga0373944_0005124_1201_2241 346
860 3300035116 Ga0373945_0011192 Ga0373945_0011192_923_1963 346
861 3300035170 Ga0373943_0004642 Ga0373943_0004642_4583_5623 346
862 3300035171 Ga0373946_0016859 Ga0373946_0016859_578_1618 346
863 3300035692 Ga0373935_0158844 Ga0373935_0158844_316_1356 346
864 3300035695 Ga0373927_0105012 Ga0373927_0105012_472_1512 346
865 3300037068 Ga0373925_0048671 Ga0373925_0048671_589_1629 346
866 3300039447 Ga0436361_0905452 Ga0436361_0905452_4336_5382 346
867 3300046455 Ga0495603_0014909 Ga0495603_0014909_1728_2768 346
868 3300046517 Ga0495630_0051524 Ga0495630_0051524_1660_2700 346
869 3300046615 Ga0495656_0008757 Ga0495656_0008757_432_1478 346
870 3300046681 Ga0495647_0009849 Ga0495647_0009849_1348_2388 346
871 3300046690 Ga0495624_0046293 Ga0495624_0046293_1186_2226 346
872 3300048907 Ga0496104_0114237 Ga0496104_0114237_561_1607 346
873 3300048908 Ga0496105_0153677 Ga0496105_0153677_15_1061 346
874 3300048913 Ga0496110_0075637 Ga0496110_0075637_1157_2203 346
875 3300048917 Ga0496114_0091345 Ga0496114_0091345_1008_2054 346
876 3300049569 Ga0501032_0047451 Ga0501032_0047451_1075_2127 346
877 3300049570 Ga0501033_0056081 Ga0501033_0056081_1309_2361 346
878 3300049572 Ga0501036_0019499 Ga0501036_0019499_3699_4751 346
879 3300049574 Ga0501038_0204666 Ga0501038_0204666_400_1452 346
880 3300049576 Ga0501040_0149255 Ga0501040_0149255_45_1097 346
881 3300049577 Ga0501041_0020793 Ga0501041_0020793_1098_2150 346
882 3300049578 Ga0501042_0050955 Ga0501042_0050955_948_2000 346
883 3300049579 Ga0501043_0055748 Ga0501043_0055748_322_1374 346
884 3300049580 Ga0501046_0063080 Ga0501046_0063080_1550_2602 346
885 3300049588 Ga0501072_0008188 Ga0501072_0008188_5860_6912 346
886 3300049592 Ga0501076_0088720 Ga0501076_0088720_202_1254 346
887 3300049741 Ga0501079_0011381 Ga0501079_0011381_4096_5148 346
888 3300049742 Ga0501080_0256665 Ga0501080_0256665_440_1492 346
889 3300049822 Ga0501035_0033610 Ga0501035_0033610_582_1634 346
890 3300050492 nmdc:mga0yw44_11160_c1 nmdc:mga0yw44_11160_c1_416_1462 346
891 3300050512 nmdc:mga0n895_479237_c1 nmdc:mga0n895_479237_c1_141_1187 346
892 3300053077 Ga0495601_0162141 Ga0495601_0162141_373_1419 346
893 3300054114 Ga0501084_0065115 Ga0501084_0065115_1204_2256 346
894 3300060353 Ga0501082_0042663 Ga0501082_0042663_1919_2971 346
895 3300061734 Ga0530510_0005801 Ga0530510_0005801_1352_2404 346
896 3300001990 JGI24737J22298_10032906 JGI24737J22298_100329062 347
897 3300002077 JGI24744J21845_10002032 JGI24744J21845_100020324 347
898 3300002155 JGI24033J26618_1003073 JGI24033J26618_10030732 347
899 3300003659 JGI25404J52841_10000108 JGI25404J52841_100001089 347
900 3300005330 Ga0070690_100040155 Ga0070690_1000401551 347
901 3300005331 Ga0070670_100010874 Ga0070670_1000108744 347
902 3300005338 Ga0068868_100023511 Ga0068868_1000235114 347
903 3300005340 Ga0070689_100059991 Ga0070689_1000599912 347
904 3300005343 Ga0070687_100002478 Ga0070687_1000024788 347
905 3300005345 Ga0070692_10120819 Ga0070692_101208192 347
906 3300005353 Ga0070669_100060444 Ga0070669_1000604442 347
907 3300005354 Ga0070675_100003565 Ga0070675_1000035656 347
908 3300005355 Ga0070671_100053207 Ga0070671_1000532072 347
909 3300005364 Ga0070673_100084789 Ga0070673_1000847893 347
910 3300005365 Ga0070688_100002030 Ga0070688_1000020306 347
911 3300005366 Ga0070659_100032166 Ga0070659_1000321662 347
912 3300005367 Ga0070667_100004500 Ga0070667_1000045006 347
913 3300005439 Ga0070711_100015017 Ga0070711_1000150173 347
914 3300005441 Ga0070700_100018434 Ga0070700_1000184343 347
915 3300005455 Ga0070663_100031511 Ga0070663_1000315113 347
916 3300005456 Ga0070678_100071874 Ga0070678_1000718742 347
917 3300005459 Ga0068867_100033474 Ga0068867_1000334742 347
918 3300005466 Ga0070685_10029846 Ga0070685_100298463 347
919 3300005539 Ga0068853_100056742 Ga0068853_1000567422 347
920 3300005543 Ga0070672_100004369 Ga0070672_1000043693 347
921 3300005544 Ga0070686_100005070 Ga0070686_1000050703 347
922 3300005547 Ga0070693_100124044 Ga0070693_1001240442 347
923 3300005578 Ga0068854_100079306 Ga0068854_1000793063 347
924 3300005614 Ga0068856_100252217 Ga0068856_1002522171 347
925 3300005615 Ga0070702_100005145 Ga0070702_1000051451 347
926 3300005617 Ga0068859_100016683 Ga0068859_1000166832 347
927 3300005618 Ga0068864_100045321 Ga0068864_1000453212 347
928 3300005718 Ga0068866_10005088 Ga0068866_100050881 347
929 3300005840 Ga0068870_10064265 Ga0068870_100642652 347
930 3300005842 Ga0068858_100025390 Ga0068858_1000253903 347
931 3300005843 Ga0068860_100016382 Ga0068860_1000163822 347
932 3300005937 Ga0081455_10005788 Ga0081455_100057888 347
933 3300005983 Ga0081540_1008639 Ga0081540_10086395 347
934 3300005983 Ga0081540_1058933 Ga0081540_10589332 347
935 3300006163 Ga0070715_10076423 Ga0070715_100764232 347
936 3300006844 Ga0075428_100069932 Ga0075428_1000699323 347
937 3300006844 Ga0075428_100100255 Ga0075428_1001002553 347
938 3300006846 Ga0075430_100012474 Ga0075430_1000124743 347
939 3300006847 Ga0075431_100055261 Ga0075431_1000552613 347
940 3300006931 Ga0097620_100016683 Ga0097620_1000166838 347
941 3300009094 Ga0111539_10035947 Ga0111539_100359472 347
942 3300009098 Ga0105245_10039830 Ga0105245_100398304 347
943 3300009101 Ga0105247_10077134 Ga0105247_100771342 347
944 3300009147 Ga0114129_10005398 Ga0114129_100053985 347
945 3300009147 Ga0114129_10221736 Ga0114129_102217363 347
946 3300009148 Ga0105243_10138101 Ga0105243_101381012 347
947 3300009174 Ga0105241_10127258 Ga0105241_101272582 347
948 3300009177 Ga0105248_10043198 Ga0105248_100431983 347
949 3300009545 Ga0105237_10046888 Ga0105237_100468882 347
950 3300009551 Ga0105238_10201674 Ga0105238_102016743 347
951 3300009553 Ga0105249_10107666 Ga0105249_101076663 347
952 3300010375 Ga0105239_10147389 Ga0105239_101473892 347
953 3300011119 Ga0105246_10063443 Ga0105246_100634432 347
954 3300013306 Ga0163162_10103627 Ga0163162_101036272 347
955 3300013308 Ga0157375_10009111 Ga0157375_100091113 347
956 3300014325 Ga0163163_10008749 Ga0163163_100087496 347
957 3300014968 Ga0157379_10019887 Ga0157379_100198876 347
958 3300014969 Ga0157376_10196217 Ga0157376_101962172 347
959 3300025899 Ga0207642_10104134 Ga0207642_101041342 347
960 3300025901 Ga0207688_10001053 Ga0207688_100010537 347
961 3300025904 Ga0207647_10022689 Ga0207647_100226895 347
962 3300025905 Ga0207685_10025753 Ga0207685_100257532 347
963 3300025907 Ga0207645_10008189 Ga0207645_100081893 347
964 3300025908 Ga0207643_10003366 Ga0207643_100033668 347
965 3300025915 Ga0207693_10195953 Ga0207693_101959532 347
966 3300025918 Ga0207662_10002137 Ga0207662_100021374 347
967 3300025920 Ga0207649_10067228 Ga0207649_100672282 347
968 3300025925 Ga0207650_10039381 Ga0207650_100393813 347
969 3300025925 Ga0207650_10148324 Ga0207650_101483242 347
970 3300025926 Ga0207659_10194068 Ga0207659_101940682 347
971 3300025927 Ga0207687_10013163 Ga0207687_100131634 347
972 3300025931 Ga0207644_10040575 Ga0207644_100405754 347
973 3300025934 Ga0207686_10009550 Ga0207686_100095504 347
974 3300025936 Ga0207670_10003594 Ga0207670_100035943 347
975 3300025937 Ga0207669_10026195 Ga0207669_100261952 347
976 3300025940 Ga0207691_10022886 Ga0207691_100228865 347
977 3300025942 Ga0207689_10009502 Ga0207689_100095026 347
978 3300025945 Ga0207679_10061777 Ga0207679_100617773 347
979 3300025981 Ga0207640_10027914 Ga0207640_100279143 347
980 3300025986 Ga0207658_10010199 Ga0207658_100101992 347
981 3300026035 Ga0207703_10007965 Ga0207703_100079654 347
982 3300026041 Ga0207639_10096489 Ga0207639_100964893 347
983 3300026067 Ga0207678_10002455 Ga0207678_100024553 347
984 3300026075 Ga0207708_10002956 Ga0207708_100029567 347
985 3300026078 Ga0207702_10504217 Ga0207702_105042171 347
986 3300026088 Ga0207641_10010922 Ga0207641_100109224 347
987 3300026089 Ga0207648_10004365 Ga0207648_1000436510 347
988 3300026095 Ga0207676_10002494 Ga0207676_100024947 347
989 3300026116 Ga0207674_10026785 Ga0207674_100267853 347
990 3300026118 Ga0207675_100005260 Ga0207675_1000052606 347
991 3300027907 Ga0207428_10040114 Ga0207428_100401143 347
992 3300028379 Ga0268266_10040575 Ga0268266_100405754 347
993 3300035695 Ga0373927_0179206 Ga0373927_0179206_136_1179 347
994 3300046474 Ga0495605_0061752 Ga0495605_0061752_203_1246 347
995 3300046492 Ga0495585_0101648 Ga0495585_0101648_473_1516 347
996 3300046520 Ga0495637_0026576 Ga0495637_0026576_428_1471 347
997 3300046539 Ga0495621_0056061 Ga0495621_0056061_364_1407 347
998 3300046615 Ga0495656_0021968 Ga0495656_0021968_730_1773 347
999 3300046683 Ga0495658_0033412 Ga0495658_0033412_1295_2338 347
1000 3300046683 Ga0495658_0045587 Ga0495658_0045587_195_1238 347
1001 3300046692 Ga0495671_0052863 Ga0495671_0052863_729_1772 347
1002 3300047315 Ga0495581_0036050 Ga0495581_0036050_1712_2755 347
1003 3300048091 Ga0495626_0083870 Ga0495626_0083870_30_1073 347
1004 3300048904 Ga0496101_0011389 Ga0496101_0011389_2992_4035 347
1005 3300048905 Ga0496102_0004325 Ga0496102_0004325_9702_10745 347
1006 3300048905 Ga0496102_0009419 Ga0496102_0009419_3858_4901 347
1007 3300048906 Ga0496103_0006135 Ga0496103_0006135_3061_4104 347
1008 3300048906 Ga0496103_0007472 Ga0496103_0007472_297_1340 347
1009 3300048907 Ga0496104_0038719 Ga0496104_0038719_2992_4035 347
1010 3300048907 Ga0496104_0097120 Ga0496104_0097120_856_1899 347
1011 3300048908 Ga0496105_0004868 Ga0496105_0004868_1814_2857 347
1012 3300048908 Ga0496105_0007989 Ga0496105_0007989_6556_7599 347
1013 3300048909 Ga0496106_0009196 Ga0496106_0009196_3286_4329 347
1014 3300048910 Ga0496107_0003386 Ga0496107_0003386_6735_7778 347
1015 3300048910 Ga0496107_0015375 Ga0496107_0015375_2514_3557 347
1016 3300048911 Ga0496108_0000378 Ga0496108_0000378_27004_28047 347
1017 3300048911 Ga0496108_0023560 Ga0496108_0023560_1537_2580 347
1018 3300048911 Ga0496108_0164187 Ga0496108_0164187_461_1504 347
1019 3300048912 Ga0496109_0000386 Ga0496109_0000386_25120_26163 347
1020 3300048912 Ga0496109_0075800 Ga0496109_0075800_99_1142 347
1021 3300048913 Ga0496110_0001431 Ga0496110_0001431_10324_11367 347
1022 3300048914 Ga0496111_0000314 Ga0496111_0000314_21224_22267 347
1023 3300048914 Ga0496111_0010973 Ga0496111_0010973_2168_3211 347
1024 3300048915 Ga0496112_0000681 Ga0496112_0000681_1049_2092 347
1025 3300048916 Ga0496113_0000206 Ga0496113_0000206_14073_15116 347
1026 3300048916 Ga0496113_0013882 Ga0496113_0013882_1762_2805 347
1027 3300048917 Ga0496114_0007174 Ga0496114_0007174_6872_7915 347
1028 3300048918 Ga0496115_0040846 Ga0496115_0040846_1537_2580 347
1029 3300050492 nmdc:mga0yw44_5724_c1 nmdc:mga0yw44_5724_c1_1786_2829 347
1030 3300050507 nmdc:mga05p37_186566_c1 nmdc:mga05p37_186566_c1_1190_2233 347
1031 3300050508 nmdc:mga09592_52428_c1 nmdc:mga09592_52428_c1_2163_3212 347
1032 3300050509 nmdc:mga0qj67_25793_c1 nmdc:mga0qj67_25793_c1_763_1812 347
1033 3300050510 nmdc:mga06r32_22348_c1 nmdc:mga06r32_22348_c1_1952_3001 347
1034 3300050511 nmdc:mga08y16_173347_c1 nmdc:mga08y16_173347_c1_768_1811 347
1035 3300050511 nmdc:mga08y16_92306_c1 nmdc:mga08y16_92306_c1_1607_2650 347
1036 3300050512 nmdc:mga0n895_94511_c1 nmdc:mga0n895_94511_c1_1771_2814 347
1037 3300053077 Ga0495601_0013359 Ga0495601_0013359_422_1465 347
1038 3300053083 Ga0495655_0005107 Ga0495655_0005107_1169_2212 347
1039 3300053085 Ga0495619_0030201 Ga0495619_0030201_487_1530 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

24

310

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5093 28 314
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4984 28 314
1dow-assembly1.cif.gz_A crystal structure of a chimera of beta-catenin and alpha-catenin 0.3192 92 232
5mx5-assembly2.cif.gz_N mouse pa28alpha-beta 0.3079 59 244
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.3062 92 244
ID Description Score Start End Superfamily
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7869 26 309 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7867 27 308 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7844 25 309 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7791 25 309 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.779 26 309 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V6RLS7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9707 2 252 GO:0005886
GO:0015658
AF-A0A3B0RDG5-F1-model_v4 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) 0.9619 11 289 GO:0005886
GO:0015658
AF-A0A0Q4URT7-F1-model_v4 ABC transporter permease 0.9566 1 342 GO:0005886
GO:0015658
AF-A0A1F9D5E6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9529 2 326 GO:0005886
GO:0015658
AF-A0A086D618-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9518 2 316 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
85.98 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map