F488765

General Info

Members Datasets Scaffolds Average Seq Length
1038 301 2076 299

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10032488|Ga0207674_100324884
Length 340
Sequence MNQDPLFATADSLHAQHNRAHRFPITTARKAALIAAVLLPLLAFVFGSLVIATAALMLMPKPAADIDRRLEELTAPQGAEDTERKARLQSLIAFFKRVGEKAPHSTKEMGSLRLRLVQAGYRRPEALTIFFGVRVVMALALFSLFASSAVARPNMSLALGGLGFGYIAPGMILARMAKRRAHRIRLSLADALDLLVVSVEAGLGLDQALSRVGAELKFAYPELSDELKLINLELRAGKPRAEALRNLADRTGVDDLSSLVTMLIQTDKFGTSVAQSLRVYSETLRTKRRQRAEEAAAKTGVKMVFPLVFCIFPAIWVVTIGPAAIRFVTVLFPLMESTHR

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
217 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
218 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
275 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 3.08
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10032488 3300026116 Bacteria 5474
2 Ga0065714_10122997 3300005288 Bacteria 1326
3 Ga0065704_10088862 3300005289 Bacteria 2904
4 Ga0065712_10002342 3300005290 Bacteria 7707
5 Ga0065712_10020375 3300005290 Unclassified 1407
6 Ga0065712_10069274 3300005290 Bacteria 7617
7 Ga0065712_10105457 3300005290 Bacteria 1917
8 Ga0065715_10002917 3300005293 Bacteria 6813
9 Ga0065715_10003607 3300005293 Bacteria 5628
10 Ga0065715_10007509 3300005293 Bacteria 4762
11 Ga0065715_10010195 3300005293 Bacteria 4292
12 Ga0065715_10095903 3300005293 Bacteria 3983
13 Ga0065715_10151577 3300005293 Bacteria 1723
14 Ga0065707_10034665 3300005295 Bacteria 1334
15 Ga0065707_10086081 3300005295 Bacteria 5679
16 Ga0065707_10139699 3300005295 Bacteria 1789
17 Ga0065707_10152547 3300005295 Bacteria 1643
18 Ga0065707_10154439 3300005295 Bacteria 1623
19 Ga0070676_10054275 3300005328 Bacteria 2362
20 Ga0070690_100003728 3300005330 Bacteria 8392
21 Ga0070690_100020024 3300005330 Bacteria 4071
22 Ga0070690_100049071 3300005330 Bacteria 2690
23 Ga0070690_100102700 3300005330 Unclassified 1897
24 Ga0070690_100210287 3300005330 Bacteria 1358
25 Ga0070670_100001015 3300005331 Bacteria 22158
26 Ga0070670_100001833 3300005331 Bacteria 17306
27 Ga0070670_100006975 3300005331 Bacteria 9576
28 Ga0070670_100047108 3300005331 Bacteria 3708
29 Ga0070670_100109837 3300005331 Bacteria 2376
30 Ga0070677_10002936 3300005333 Bacteria 5479
31 Ga0068869_100010049 3300005334 Bacteria 6155
32 Ga0070666_10014565 3300005335 Bacteria 5009
33 Ga0070666_10043921 3300005335 Bacteria 2993
34 Ga0070666_10256315 3300005335 Bacteria 1239
35 Ga0070680_100139934 3300005336 Unclassified 2029
36 Ga0070682_100202480 3300005337 Bacteria 1401
37 Ga0068868_100004123 3300005338 Bacteria 10158
38 Ga0068868_100117018 3300005338 Bacteria 2171
39 Ga0068868_100232760 3300005338 Bacteria 1546
40 Ga0068868_100328548 3300005338 Unclassified 1305
41 Ga0070660_100062795 3300005339 Bacteria 2887
42 Ga0070660_100151344 3300005339 Unclassified 1866
43 Ga0070689_100019892 3300005340 Bacteria 4971
44 Ga0070689_100029122 3300005340 Bacteria 4177
45 Ga0070689_100048031 3300005340 Unclassified 3291
46 Ga0070689_100167407 3300005340 Bacteria 1779
47 Ga0070689_100239293 3300005340 Bacteria 1494
48 Ga0070689_100266835 3300005340 Bacteria 1416
49 Ga0070687_100021144 3300005343 Bacteria 3053
50 Ga0070687_100029403 3300005343 Bacteria 2676
51 Ga0070687_100061421 3300005343 Bacteria 1986
52 Ga0070661_100046902 3300005344 Bacteria 3161
53 Ga0070661_100407642 3300005344 Bacteria 1076
54 Ga0070692_10002119 3300005345 Bacteria 7586
55 Ga0070668_100021252 3300005347 Bacteria 4906
56 Ga0070668_100051961 3300005347 Bacteria 3159
57 Ga0070668_100101100 3300005347 Bacteria 2284
58 Ga0070668_100555535 3300005347 Bacteria 1000
59 Ga0070669_100008866 3300005353 Bacteria 7176
60 Ga0070669_100010039 3300005353 Bacteria 6730
61 Ga0070669_100018637 3300005353 Bacteria 4960
62 Ga0070669_100036230 3300005353 Bacteria 3574
63 Ga0070669_100043330 3300005353 Bacteria 3277
64 Ga0070675_100001854 3300005354 Bacteria 15588
65 Ga0070675_100004337 3300005354 Bacteria 10818
66 Ga0070675_100009646 3300005354 Bacteria 7514
67 Ga0070675_100011858 3300005354 Bacteria 6829
68 Ga0070675_100042732 3300005354 Bacteria 3704
69 Ga0070675_100044719 3300005354 Bacteria 3621
70 Ga0070675_100048397 3300005354 Bacteria 3486
71 Ga0070675_100050591 3300005354 Bacteria 3412
72 Ga0070675_100065982 3300005354 Bacteria 2993
73 Ga0070675_100076345 3300005354 Bacteria 2787
74 Ga0070675_100110992 3300005354 Bacteria 2320
75 Ga0070675_100132353 3300005354 Bacteria 2126
76 Ga0070675_100250134 3300005354 Bacteria 1551
77 Ga0070671_100017856 3300005355 Bacteria 5751
78 Ga0070671_100033900 3300005355 Bacteria 4225
79 Ga0070671_100381726 3300005355 Unclassified 1204
80 Ga0070674_100000165 3300005356 Bacteria 30575
81 Ga0070674_100051004 3300005356 Bacteria 2849
82 Ga0070674_100079828 3300005356 Bacteria 2335
83 Ga0070674_100091450 3300005356 Bacteria 2197
84 Ga0070674_100195540 3300005356 Unclassified 1558
85 Ga0070673_100003780 3300005364 Bacteria 9494
86 Ga0070673_100005719 3300005364 Bacteria 7995
87 Ga0070673_100013735 3300005364 Bacteria 5615
88 Ga0070673_100046214 3300005364 Bacteria 3381
89 Ga0070673_100122030 3300005364 Bacteria 2175
90 Ga0070673_100166825 3300005364 Bacteria 1877
91 Ga0070673_100188563 3300005364 Bacteria 1770
92 Ga0070673_100270023 3300005364 Unclassified 1488
93 Ga0070673_100270968 3300005364 Bacteria 1486
94 Ga0070673_100452250 3300005364 Bacteria 1155
95 Ga0070688_100001290 3300005365 Bacteria 12484
96 Ga0070688_100007794 3300005365 Bacteria 5784
97 Ga0070688_100020063 3300005365 Bacteria 3881
98 Ga0070688_100025607 3300005365 Bacteria 3494
99 Ga0070688_100061826 3300005365 Bacteria 2369
100 Ga0070688_100062404 3300005365 Bacteria 2359
101 Ga0070688_100065486 3300005365 Bacteria 2310
102 Ga0070688_100190304 3300005365 Bacteria 1429
103 Ga0070659_100023249 3300005366 Bacteria 4741
104 Ga0070667_100037292 3300005367 Bacteria 4076
105 Ga0070667_100077118 3300005367 Bacteria 2846
106 Ga0070667_100086166 3300005367 Bacteria 2694
107 Ga0070703_10029030 3300005406 Bacteria 1657
108 Ga0070703_10042205 3300005406 Bacteria 1425
109 Ga0070709_10059826 3300005434 Bacteria 2420
110 Ga0070714_100049126 3300005435 Bacteria 3590
111 Ga0070713_100116571 3300005436 Bacteria 2336
112 Ga0070713_100306192 3300005436 Bacteria 1464
113 Ga0070701_10017740 3300005438 Bacteria 3332
114 Ga0070701_10040735 3300005438 Bacteria 2363
115 Ga0070705_100022537 3300005440 Bacteria 3366
116 Ga0070705_100040672 3300005440 Bacteria 2645
117 Ga0070705_100072986 3300005440 Bacteria 2081
118 Ga0070700_100007083 3300005441 Bacteria 6028
119 Ga0070700_100065310 3300005441 Bacteria 2307
120 Ga0070700_100150197 3300005441 Bacteria 1593
121 Ga0070700_100198569 3300005441 Bacteria 1407
122 Ga0070700_100253310 3300005441 Unclassified 1264
123 Ga0070694_100000529 3300005444 Bacteria 21000
124 Ga0070694_100010135 3300005444 Bacteria 5800
125 Ga0070694_100061360 3300005444 Bacteria 2566
126 Ga0070694_100089796 3300005444 Bacteria 2153
127 Ga0070694_100093524 3300005444 Bacteria 2113
128 Ga0070663_100052680 3300005455 Bacteria 2903
129 Ga0070678_100032872 3300005456 Unclassified 3595
130 Ga0070678_100052131 3300005456 Bacteria 2969
131 Ga0070678_100054447 3300005456 Bacteria 2915
132 Ga0070678_100166336 3300005456 Bacteria 1792
133 Ga0070678_100180335 3300005456 Bacteria 1728
134 Ga0070678_100286874 3300005456 Bacteria 1394
135 Ga0070678_100334630 3300005456 Bacteria 1297
136 Ga0070678_100360311 3300005456 Bacteria 1253
137 Ga0070662_100045936 3300005457 Unclassified 3136
138 Ga0070662_100106280 3300005457 Unclassified 2132
139 Ga0068867_100004141 3300005459 Bacteria 10190
140 Ga0068867_100043254 3300005459 Bacteria 3297
141 Ga0068867_100070339 3300005459 Unclassified 2616
142 Ga0070685_10006586 3300005466 Bacteria 5924
143 Ga0070685_10013584 3300005466 Bacteria 4298
144 Ga0070707_100034445 3300005468 Bacteria 4829
145 Ga0070707_100100291 3300005468 Bacteria 2805
146 Ga0070707_100136308 3300005468 Bacteria 2388
147 Ga0070707_100168709 3300005468 Bacteria 2133
148 Ga0070707_100284395 3300005468 Bacteria 1607
149 Ga0070698_100006486 3300005471 Bacteria 12692
150 Ga0070698_100057161 3300005471 Bacteria 3949
151 Ga0070698_100243872 3300005471 Unclassified 1730
152 Ga0070699_100000475 3300005518 Bacteria 38225
153 Ga0070699_100008844 3300005518 Bacteria 8721
154 Ga0070699_100060409 3300005518 Bacteria 3284
155 Ga0070699_100067375 3300005518 Bacteria 3109
156 Ga0070699_100102185 3300005518 Bacteria 2513
157 Ga0070699_100352370 3300005518 Bacteria 1326
158 Ga0070679_100349572 3300005530 Unclassified 1426
159 Ga0070684_100039030 3300005535 Bacteria 4083
160 Ga0070697_100071045 3300005536 Bacteria 2855
161 Ga0070697_100155656 3300005536 Bacteria 1929
162 Ga0070697_100220096 3300005536 Bacteria 1618
163 Ga0070672_100004487 3300005543 Bacteria 9141
164 Ga0070672_100010205 3300005543 Bacteria 6506
165 Ga0070672_100030719 3300005543 Bacteria 4039
166 Ga0070672_100037326 3300005543 Bacteria 3706
167 Ga0070672_100092420 3300005543 Bacteria 2443
168 Ga0070672_100103255 3300005543 Bacteria 2315
169 Ga0070686_100003602 3300005544 Bacteria 8497
170 Ga0070686_100018775 3300005544 Bacteria 4065
171 Ga0070686_100051278 3300005544 Bacteria 2626
172 Ga0070686_100058309 3300005544 Bacteria 2484
173 Ga0070686_100081458 3300005544 Bacteria 2144
174 Ga0070686_100239027 3300005544 Bacteria 1321
175 Ga0070695_100001664 3300005545 Bacteria 12507
176 Ga0070695_100004647 3300005545 Bacteria 8071
177 Ga0070695_100014828 3300005545 Bacteria 4702
178 Ga0070695_100071154 3300005545 Bacteria 2277
179 Ga0070696_100006712 3300005546 Bacteria 7689
180 Ga0070696_100009119 3300005546 Bacteria 6645
181 Ga0070696_100013209 3300005546 Bacteria 5542
182 Ga0070696_100017397 3300005546 Bacteria 4851
183 Ga0070693_100281024 3300005547 Bacteria 1115
184 Ga0070665_100002633 3300005548 Bacteria 19558
185 Ga0070665_100008638 3300005548 Bacteria 10309
186 Ga0070665_100143040 3300005548 Bacteria 2395
187 Ga0070665_100191351 3300005548 Bacteria 2047
188 Ga0070665_100321908 3300005548 Bacteria 1550
189 Ga0070704_100001492 3300005549 Bacteria 12582
190 Ga0070704_100031241 3300005549 Unclassified 3580
191 Ga0070704_100061461 3300005549 Bacteria 2688
192 Ga0070704_100064708 3300005549 Bacteria 2629
193 Ga0070704_100125336 3300005549 Bacteria 1981
194 Ga0070704_100149505 3300005549 Bacteria 1834
195 Ga0070704_100197717 3300005549 Bacteria 1621
196 Ga0068855_100090370 3300005563 Bacteria 3534
197 Ga0070664_100002655 3300005564 Bacteria 14420
198 Ga0070664_100025568 3300005564 Bacteria 4896
199 Ga0070664_100052222 3300005564 Bacteria 3461
200 Ga0070664_100062565 3300005564 Bacteria 3173
201 Ga0070664_100109056 3300005564 Bacteria 2414
202 Ga0070664_100134620 3300005564 Bacteria 2172
203 Ga0068857_100042809 3300005577 Bacteria 4018
204 Ga0068857_100050923 3300005577 Bacteria 3673
205 Ga0068857_100106337 3300005577 Bacteria 2520
206 Ga0068857_100312876 3300005577 Bacteria 1449
207 Ga0070702_100057430 3300005615 Bacteria 2251
208 Ga0070702_100070590 3300005615 Bacteria 2062
209 Ga0070702_100107898 3300005615 Bacteria 1720
210 Ga0070702_100204273 3300005615 Unclassified 1310
211 Ga0070702_100243274 3300005615 Bacteria 1215
212 Ga0068852_100118838 3300005616 Bacteria 2416
213 Ga0068852_100125051 3300005616 Unclassified 2360
214 Ga0068852_100338364 3300005616 Bacteria 1466
215 Ga0068859_100008120 3300005617 Bacteria 10644
216 Ga0068859_100009537 3300005617 Bacteria 9801
217 Ga0068859_100041236 3300005617 Bacteria 4637
218 Ga0068859_100065424 3300005617 Bacteria 3670
219 Ga0068859_100125479 3300005617 Bacteria 2636
220 Ga0068859_100237011 3300005617 Bacteria 1913
221 Ga0068859_100249257 3300005617 Bacteria 1866
222 Ga0068859_100252928 3300005617 Bacteria 1852
223 Ga0068859_100262137 3300005617 Unclassified 1820
224 Ga0068864_100007441 3300005618 Bacteria 9016
225 Ga0068864_100021304 3300005618 Bacteria 5430
226 Ga0068864_100123661 3300005618 Bacteria 2316
227 Ga0068864_100168320 3300005618 Bacteria 1997
228 Ga0068864_100617893 3300005618 Bacteria 1053
229 Ga0068866_10005667 3300005718 Bacteria 5172
230 Ga0068861_100042313 3300005719 Bacteria 3414
231 Ga0068861_100045015 3300005719 Bacteria 3321
232 Ga0068861_100061876 3300005719 Bacteria 2874
233 Ga0068861_100180579 3300005719 Bacteria 1756
234 Ga0068861_100187947 3300005719 Bacteria 1724
235 Ga0068861_100399283 3300005719 Bacteria 1219
236 Ga0068851_10028836 3300005834 Bacteria 2744
237 Ga0068870_10021091 3300005840 Unclassified 3183
238 Ga0068870_10060531 3300005840 Bacteria 2033
239 Ga0068863_100002449 3300005841 Bacteria 18440
240 Ga0068863_100010642 3300005841 Bacteria 8930
241 Ga0068863_100015152 3300005841 Bacteria 7406
242 Ga0068863_100017014 3300005841 Bacteria 6973
243 Ga0068863_100145871 3300005841 Bacteria 2264
244 Ga0068863_100274589 3300005841 Bacteria 1632
245 Ga0068863_100390515 3300005841 Bacteria 1360
246 Ga0068858_100022608 3300005842 Bacteria 5864
247 Ga0068858_100032602 3300005842 Bacteria 4837
248 Ga0068858_100047643 3300005842 Bacteria 3973
249 Ga0068858_100066117 3300005842 Bacteria 3347
250 Ga0068858_100101095 3300005842 Bacteria 2689
251 Ga0068858_100348304 3300005842 Bacteria 1419
252 Ga0068860_100011122 3300005843 Bacteria 8865
253 Ga0068860_100017433 3300005843 Bacteria 6996
254 Ga0068860_100044816 3300005843 Bacteria 4215
255 Ga0068860_100410523 3300005843 Bacteria 1341
256 Ga0068862_100008460 3300005844 Bacteria 8509
257 Ga0068862_100048114 3300005844 Bacteria 3640
258 Ga0068862_100142548 3300005844 Bacteria 2128
259 Ga0068862_100286026 3300005844 Bacteria 1513
260 Ga0068862_100368888 3300005844 Bacteria 1336
261 Ga0068862_100411260 3300005844 Bacteria 1267
262 Ga0081455_10050373 3300005937 Bacteria 3582
263 Ga0075368_10010318 3300006042 Bacteria 3375
264 Ga0075364_10014105 3300006051 Bacteria 4931
265 Ga0070716_100046991 3300006173 Bacteria 2432
266 Ga0075362_10000473 3300006177 Bacteria 11679
267 Ga0075367_10037472 3300006178 Bacteria 2818
268 Ga0075427_10014829 3300006194 Bacteria 1198
269 Ga0075366_10034147 3300006195 Bacteria 2996
270 Ga0097621_100009175 3300006237 Bacteria 7170
271 Ga0097621_100033450 3300006237 Bacteria 4094
272 Ga0097621_100223552 3300006237 Bacteria 1641
273 Ga0075370_10001536 3300006353 Bacteria 10094
274 Ga0068871_100000886 3300006358 Bacteria 19951
275 Ga0068871_100016882 3300006358 Bacteria 5511
276 Ga0068871_100121010 3300006358 Bacteria 2211
277 Ga0068871_100176583 3300006358 Bacteria 1833
278 Ga0068871_100181754 3300006358 Bacteria 1808
279 Ga0068871_100261696 3300006358 Unclassified 1509
280 Ga0068871_100348167 3300006358 Bacteria 1310
281 Ga0075428_100000017 3300006844 Bacteria 147833
282 Ga0075428_100003466 3300006844 Bacteria 17256
283 Ga0075428_100014045 3300006844 Bacteria 8912
284 Ga0075428_100021988 3300006844 Bacteria 7062
285 Ga0075428_100026781 3300006844 Bacteria 6385
286 Ga0075428_100035381 3300006844 Bacteria 5505
287 Ga0075428_100051427 3300006844 Bacteria 4518
288 Ga0075428_100125684 3300006844 Bacteria 2791
289 Ga0075428_100171979 3300006844 Bacteria 2348
290 Ga0075428_100286135 3300006844 Bacteria 1773
291 Ga0075428_100329149 3300006844 Bacteria 1641
292 Ga0075428_100421212 3300006844 Bacteria 1430
293 Ga0075430_100000262 3300006846 Bacteria 36942
294 Ga0075430_100001294 3300006846 Bacteria 20188
295 Ga0075430_100016731 3300006846 Bacteria 6246
296 Ga0075430_100017001 3300006846 Bacteria 6194
297 Ga0075430_100031640 3300006846 Bacteria 4490
298 Ga0075430_100054024 3300006846 Bacteria 3380
299 Ga0075430_100086844 3300006846 Bacteria 2618
300 Ga0075430_100094111 3300006846 Bacteria 2505
301 Ga0075430_100356863 3300006846 Unclassified 1207
302 Ga0075431_100000517 3300006847 Bacteria 32332
303 Ga0075431_100004120 3300006847 Bacteria 14194
304 Ga0075431_100028475 3300006847 Bacteria 5742
305 Ga0075431_100035653 3300006847 Bacteria 5121
306 Ga0075431_100037503 3300006847 Bacteria 4993
307 Ga0075431_100066412 3300006847 Bacteria 3724
308 Ga0075431_100078070 3300006847 Bacteria 3418
309 Ga0075431_100084417 3300006847 Bacteria 3278
310 Ga0075431_100097894 3300006847 Bacteria 3029
311 Ga0075431_100176545 3300006847 Bacteria 2194
312 Ga0075431_100198616 3300006847 Bacteria 2053
313 Ga0075431_100554876 3300006847 Bacteria 1136
314 Ga0075433_10000668 3300006852 Bacteria 23233
315 Ga0075433_10001213 3300006852 Bacteria 18802
316 Ga0075433_10002563 3300006852 Bacteria 13835
317 Ga0075433_10003764 3300006852 Bacteria 11737
318 Ga0075433_10010816 3300006852 Bacteria 7340
319 Ga0075433_10035474 3300006852 Bacteria 4289
320 Ga0075433_10059806 3300006852 Bacteria 3334
321 Ga0075433_10059821 3300006852 Bacteria 3334
322 Ga0075433_10114498 3300006852 Bacteria 2392
323 Ga0075433_10123394 3300006852 Bacteria 2301
324 Ga0075433_10148752 3300006852 Bacteria 2083
325 Ga0075433_10209693 3300006852 Bacteria 1731
326 Ga0075434_100000776 3300006871 Bacteria 25295
327 Ga0075434_100002394 3300006871 Bacteria 16457
328 Ga0075434_100002772 3300006871 Bacteria 15506
329 Ga0075434_100004299 3300006871 Bacteria 12797
330 Ga0075434_100022059 3300006871 Bacteria 6199
331 Ga0075434_100023566 3300006871 Bacteria 6001
332 Ga0075434_100131844 3300006871 Bacteria 2519
333 Ga0075434_100142290 3300006871 Bacteria 2419
334 Ga0075434_100152430 3300006871 Bacteria 2332
335 Ga0075434_100369452 3300006871 Bacteria 1455
336 Ga0075434_100429952 3300006871 Bacteria 1341
337 Ga0075434_100711327 3300006871 Bacteria 1022
338 Ga0075429_100004563 3300006880 Bacteria 11904
339 Ga0075429_100011049 3300006880 Bacteria 7815
340 Ga0075429_100015702 3300006880 Bacteria 6561
341 Ga0075429_100022264 3300006880 Bacteria 5498
342 Ga0075429_100034776 3300006880 Bacteria 4379
343 Ga0075429_100050280 3300006880 Bacteria 3627
344 Ga0075429_100069942 3300006880 Bacteria 3055
345 Ga0075429_100360122 3300006880 Bacteria 1274
346 Ga0075429_100373731 3300006880 Bacteria 1248
347 Ga0075429_100412959 3300006880 Bacteria 1182
348 Ga0068865_100004376 3300006881 Bacteria 8511
349 Ga0068865_100040537 3300006881 Bacteria 3165
350 Ga0068865_100052300 3300006881 Bacteria 2830
351 Ga0068865_100123322 3300006881 Bacteria 1930
352 Ga0075436_100007465 3300006914 Bacteria 7478
353 Ga0075436_100012376 3300006914 Bacteria 5848
354 Ga0075436_100037825 3300006914 Bacteria 3332
355 Ga0075436_100072239 3300006914 Bacteria 2387
356 Ga0075436_100105620 3300006914 Bacteria 1964
357 Ga0097620_100008120 3300006931 Bacteria 10644
358 Ga0097620_100009538 3300006931 Bacteria 9801
359 Ga0097620_100041236 3300006931 Bacteria 4637
360 Ga0097620_100065424 3300006931 Bacteria 3670
361 Ga0097620_100125471 3300006931 Bacteria 2636
362 Ga0097620_100237022 3300006931 Bacteria 1913
363 Ga0097620_100249272 3300006931 Bacteria 1866
364 Ga0097620_100252928 3300006931 Bacteria 1852
365 Ga0097620_100262122 3300006931 Unclassified 1820
366 Ga0075435_100000189 3300007076 Bacteria 36888
367 Ga0075435_100003794 3300007076 Bacteria 10303
368 Ga0075435_100005360 3300007076 Bacteria 8944
369 Ga0075435_100014303 3300007076 Bacteria 5927
370 Ga0075435_100016466 3300007076 Bacteria 5575
371 Ga0075435_100025993 3300007076 Bacteria 4564
372 Ga0075435_100048549 3300007076 Bacteria 3411
373 Ga0075435_100052786 3300007076 Bacteria 3276
374 Ga0075435_100068479 3300007076 Bacteria 2891
375 Ga0075435_100256342 3300007076 Bacteria 1490
376 Ga0105240_10092439 3300009093 Bacteria 3694
377 Ga0105240_10201174 3300009093 Bacteria 2334
378 Ga0105240_10257184 3300009093 Bacteria 2016
379 Ga0111539_10000002 3300009094 Bacteria 983359
380 Ga0111539_10003233 3300009094 Bacteria 21543
381 Ga0111539_10006120 3300009094 Bacteria 15533
382 Ga0111539_10011717 3300009094 Bacteria 11001
383 Ga0111539_10020905 3300009094 Bacteria 8059
384 Ga0111539_10021013 3300009094 Bacteria 8039
385 Ga0111539_10038052 3300009094 Bacteria 5804
386 Ga0111539_10043698 3300009094 Bacteria 5371
387 Ga0111539_10100110 3300009094 Bacteria 3403
388 Ga0111539_10326652 3300009094 Bacteria 1785
389 Ga0111539_10574750 3300009094 Bacteria 1313
390 Ga0111539_10617803 3300009094 Unclassified 1262
391 Ga0111539_10782516 3300009094 Unclassified 1110
392 Ga0105245_10010625 3300009098 Bacteria 8010
393 Ga0105245_10028714 3300009098 Bacteria 4908
394 Ga0105245_10048265 3300009098 Bacteria 3808
395 Ga0105245_10453824 3300009098 Bacteria 1291
396 Ga0105247_10015859 3300009101 Bacteria 4511
397 Ga0114129_10001462 3300009147 Bacteria 31921
398 Ga0114129_10002879 3300009147 Bacteria 24086
399 Ga0114129_10004529 3300009147 Bacteria 19618
400 Ga0114129_10009284 3300009147 Bacteria 14024
401 Ga0114129_10010673 3300009147 Bacteria 13100
402 Ga0114129_10011026 3300009147 Bacteria 12877
403 Ga0114129_10013331 3300009147 Bacteria 11712
404 Ga0114129_10023606 3300009147 Bacteria 8716
405 Ga0114129_10029839 3300009147 Bacteria 7723
406 Ga0114129_10047764 3300009147 Bacteria 6013
407 Ga0114129_10050070 3300009147 Bacteria 5869
408 Ga0114129_10053753 3300009147 Bacteria 5649
409 Ga0114129_10080728 3300009147 Bacteria 4521
410 Ga0114129_10119920 3300009147 Bacteria 3622
411 Ga0114129_10130245 3300009147 Bacteria 3455
412 Ga0114129_10148275 3300009147 Bacteria 3212
413 Ga0114129_10164967 3300009147 Bacteria 3024
414 Ga0114129_10196624 3300009147 Bacteria 2734
415 Ga0114129_10211139 3300009147 Bacteria 2624
416 Ga0114129_10224852 3300009147 Bacteria 2530
417 Ga0114129_10325805 3300009147 Bacteria 2041
418 Ga0114129_10386193 3300009147 Bacteria 1848
419 Ga0114129_10668844 3300009147 Unclassified 1338
420 Ga0114129_10758676 3300009147 Bacteria 1241
421 Ga0105243_10019344 3300009148 Bacteria 5162
422 Ga0105243_10099842 3300009148 Bacteria 2407
423 Ga0105243_10203542 3300009148 Unclassified 1738
424 Ga0105243_10537123 3300009148 Bacteria 1115
425 Ga0105241_10069632 3300009174 Bacteria 2728
426 Ga0105242_10003085 3300009176 Bacteria 13001
427 Ga0105242_10009484 3300009176 Bacteria 7459
428 Ga0105242_10013588 3300009176 Bacteria 6299
429 Ga0105242_10203367 3300009176 Bacteria 1760
430 Ga0105248_10003756 3300009177 Bacteria 16830
431 Ga0105248_10017448 3300009177 Bacteria 7915
432 Ga0105248_10021665 3300009177 Bacteria 7119
433 Ga0105248_10022495 3300009177 Bacteria 6992
434 Ga0105248_10045029 3300009177 Bacteria 4948
435 Ga0105248_10070570 3300009177 Bacteria 3923
436 Ga0105248_10087068 3300009177 Bacteria 3515
437 Ga0105248_10362316 3300009177 Bacteria 1632
438 Ga0105238_10001078 3300009551 Bacteria 27577
439 Ga0105249_10008788 3300009553 Bacteria 8817
440 Ga0105249_10010840 3300009553 Bacteria 8009
441 Ga0105249_10053185 3300009553 Bacteria 3701
442 Ga0105249_10093185 3300009553 Unclassified 2821
443 Ga0105249_10170863 3300009553 Bacteria 2108
444 Ga0105249_10425066 3300009553 Bacteria 1363
445 Ga0105239_10025024 3300010375 Bacteria 6576
446 Ga0105246_10112942 3300011119 Bacteria 1999
447 Ga0105246_10124053 3300011119 Bacteria 1919
448 Ga0105246_10182448 3300011119 Bacteria 1617
449 Ga0157373_10220611 3300013100 Bacteria 1338
450 Ga0157370_10085788 3300013104 Bacteria 2958
451 Ga0157374_10083383 3300013296 Bacteria 3037
452 Ga0157374_10119850 3300013296 Bacteria 2538
453 Ga0157378_10357552 3300013297 Bacteria 1428
454 Ga0157378_10519162 3300013297 Bacteria 1192
455 Ga0163162_10006320 3300013306 Bacteria 11473
456 Ga0163162_10007209 3300013306 Bacteria 10796
457 Ga0163162_10034449 3300013306 Bacteria 5039
458 Ga0163162_10089617 3300013306 Bacteria 3157
459 Ga0163162_10499636 3300013306 Bacteria 1347
460 Ga0157375_10001117 3300013308 Bacteria 23252
461 Ga0157375_10039124 3300013308 Bacteria 4561
462 Ga0157375_10142243 3300013308 Bacteria 2527
463 Ga0157375_10180668 3300013308 Bacteria 2261
464 Ga0157375_10390940 3300013308 Bacteria 1557
465 Ga0163163_10015785 3300014325 Bacteria 6995
466 Ga0163163_10020310 3300014325 Bacteria 6252
467 Ga0163163_10024539 3300014325 Bacteria 5739
468 Ga0163163_10027274 3300014325 Bacteria 5470
469 Ga0163163_10074025 3300014325 Bacteria 3397
470 Ga0163163_10348679 3300014325 Bacteria 1536
471 Ga0157380_10001788 3300014326 Bacteria 14197
472 Ga0157380_10002539 3300014326 Bacteria 12321
473 Ga0157380_10022266 3300014326 Bacteria 4767
474 Ga0157380_10022914 3300014326 Bacteria 4709
475 Ga0157380_10026806 3300014326 Bacteria 4378
476 Ga0157380_10029789 3300014326 Bacteria 4174
477 Ga0157380_10084074 3300014326 Bacteria 2609
478 Ga0157380_10237393 3300014326 Bacteria 1641
479 Ga0157380_10618961 3300014326 Unclassified 1074
480 Ga0157377_10003051 3300014745 Bacteria 7509
481 Ga0157377_10004359 3300014745 Bacteria 6502
482 Ga0157377_10018084 3300014745 Bacteria 3658
483 Ga0157377_10143749 3300014745 Bacteria 1468
484 Ga0157377_10307311 3300014745 Bacteria 1049
485 Ga0157379_10004658 3300014968 Bacteria 11766
486 Ga0157379_10013418 3300014968 Bacteria 7176
487 Ga0157379_10090689 3300014968 Bacteria 2742
488 Ga0157379_10170689 3300014968 Bacteria 1964
489 Ga0157376_10023507 3300014969 Bacteria 4824
490 Ga0157376_10029697 3300014969 Bacteria 4357
491 Ga0157376_10159534 3300014969 Unclassified 2043
492 Ga0157376_10187581 3300014969 Bacteria 1894
493 Ga0163161_10004534 3300017792 Bacteria 9666
494 Ga0163161_10029212 3300017792 Bacteria 3919
495 Ga0207697_10000862 3300025315 Bacteria 17181
496 Ga0207697_10001902 3300025315 Bacteria 11133
497 Ga0207697_10018192 3300025315 Bacteria 2882
498 Ga0207682_10001500 3300025893 Bacteria 10777
499 Ga0207682_10007049 3300025893 Bacteria 4509
500 Ga0207642_10009690 3300025899 Bacteria 3361
501 Ga0207688_10000543 3300025901 Bacteria 18375
502 Ga0207688_10012246 3300025901 Bacteria 4664
503 Ga0207688_10028090 3300025901 Bacteria 3096
504 Ga0207680_10019011 3300025903 Bacteria 3668
505 Ga0207680_10027116 3300025903 Bacteria 3185
506 Ga0207680_10042448 3300025903 Bacteria 2660
507 Ga0207680_10064848 3300025903 Bacteria 2241
508 Ga0207680_10273082 3300025903 Bacteria 1173
509 Ga0207645_10001978 3300025907 Bacteria 16464
510 Ga0207645_10006408 3300025907 Bacteria 8451
511 Ga0207645_10080461 3300025907 Unclassified 2089
512 Ga0207645_10104028 3300025907 Unclassified 1833
513 Ga0207645_10117205 3300025907 Bacteria 1727
514 Ga0207645_10225854 3300025907 Bacteria 1235
515 Ga0207643_10003962 3300025908 Bacteria 7971
516 Ga0207643_10027047 3300025908 Bacteria 3179
517 Ga0207643_10091739 3300025908 Bacteria 1772
518 Ga0207695_10060721 3300025913 Bacteria 3912
519 Ga0207695_10066043 3300025913 Bacteria 3717
520 Ga0207695_10110184 3300025913 Bacteria 2733
521 Ga0207695_10205865 3300025913 Unclassified 1880
522 Ga0207662_10012484 3300025918 Bacteria 4730
523 Ga0207662_10055148 3300025918 Bacteria 2371
524 Ga0207657_10055845 3300025919 Bacteria 3409
525 Ga0207649_10071832 3300025920 Bacteria 2212
526 Ga0207649_10281354 3300025920 Unclassified 1209
527 Ga0207652_10169083 3300025921 Bacteria 1961
528 Ga0207652_10292699 3300025921 Unclassified 1469
529 Ga0207646_10062334 3300025922 Bacteria 3329
530 Ga0207646_10141906 3300025922 Bacteria 2164
531 Ga0207646_10155840 3300025922 Bacteria 2060
532 Ga0207646_10164608 3300025922 Bacteria 2002
533 Ga0207681_10020423 3300025923 Bacteria 4197
534 Ga0207681_10027331 3300025923 Bacteria 3688
535 Ga0207681_10034759 3300025923 Bacteria 3316
536 Ga0207681_10043045 3300025923 Bacteria 3020
537 Ga0207681_10067404 3300025923 Unclassified 2481
538 Ga0207681_10159080 3300025923 Bacteria 1700
539 Ga0207681_10164969 3300025923 Bacteria 1674
540 Ga0207694_10024267 3300025924 Bacteria 4604
541 Ga0207650_10004690 3300025925 Bacteria 9340
542 Ga0207650_10019843 3300025925 Bacteria 4730
543 Ga0207650_10044246 3300025925 Bacteria 3271
544 Ga0207650_10051418 3300025925 Bacteria 3049
545 Ga0207650_10069579 3300025925 Bacteria 2644
546 Ga0207659_10000116 3300025926 Bacteria 46654
547 Ga0207659_10000469 3300025926 Bacteria 24218
548 Ga0207659_10001398 3300025926 Bacteria 14369
549 Ga0207659_10002900 3300025926 Bacteria 10206
550 Ga0207659_10010561 3300025926 Bacteria 5807
551 Ga0207659_10015532 3300025926 Unclassified 4937
552 Ga0207659_10074017 3300025926 Bacteria 2496
553 Ga0207659_10079294 3300025926 Unclassified 2422
554 Ga0207659_10107682 3300025926 Bacteria 2113
555 Ga0207659_10130360 3300025926 Bacteria 1940
556 Ga0207659_10182048 3300025926 Bacteria 1665
557 Ga0207659_10215230 3300025926 Bacteria 1542
558 Ga0207659_10218651 3300025926 Bacteria 1530
559 Ga0207687_10020499 3300025927 Bacteria 4386
560 Ga0207687_10027394 3300025927 Bacteria 3823
561 Ga0207687_10031523 3300025927 Bacteria 3583
562 Ga0207687_10217871 3300025927 Bacteria 1501
563 Ga0207700_10134906 3300025928 Unclassified 2020
564 Ga0207700_10173757 3300025928 Unclassified 1799
565 Ga0207664_10074820 3300025929 Bacteria 2737
566 Ga0207644_10008708 3300025931 Bacteria 6643
567 Ga0207644_10016784 3300025931 Bacteria 4930
568 Ga0207644_10019197 3300025931 Bacteria 4635
569 Ga0207644_10056176 3300025931 Bacteria 2840
570 Ga0207644_10166652 3300025931 Bacteria 1717
571 Ga0207644_10343256 3300025931 Unclassified 1211
572 Ga0207690_10218661 3300025932 Bacteria 1456
573 Ga0207690_10318446 3300025932 Bacteria 1222
574 Ga0207706_10003430 3300025933 Bacteria 15140
575 Ga0207706_10035405 3300025933 Bacteria 4439
576 Ga0207706_10120305 3300025933 Unclassified 2309
577 Ga0207706_10292287 3300025933 Bacteria 1421
578 Ga0207686_10004769 3300025934 Bacteria 7275
579 Ga0207686_10008188 3300025934 Bacteria 5641
580 Ga0207686_10016272 3300025934 Bacteria 4172
581 Ga0207686_10029065 3300025934 Bacteria 3257
582 Ga0207686_10061342 3300025934 Bacteria 2384
583 Ga0207686_10126848 3300025934 Bacteria 1745
584 Ga0207686_10165973 3300025934 Bacteria 1552
585 Ga0207709_10004525 3300025935 Bacteria 8018
586 Ga0207670_10049855 3300025936 Unclassified 2803
587 Ga0207670_10061713 3300025936 Bacteria 2559
588 Ga0207670_10075151 3300025936 Bacteria 2348
589 Ga0207670_10141835 3300025936 Bacteria 1773
590 Ga0207670_10503345 3300025936 Bacteria 984
591 Ga0207669_10006700 3300025937 Bacteria 5282
592 Ga0207669_10033329 3300025937 Bacteria 2905
593 Ga0207669_10081019 3300025937 Bacteria 2078
594 Ga0207669_10157109 3300025937 Unclassified 1601
595 Ga0207704_10016685 3300025938 Bacteria 3782
596 Ga0207704_10030085 3300025938 Bacteria 3040
597 Ga0207665_10195912 3300025939 Unclassified 1470
598 Ga0207691_10005955 3300025940 Bacteria 11775
599 Ga0207691_10014125 3300025940 Bacteria 7618
600 Ga0207691_10018285 3300025940 Bacteria 6639
601 Ga0207691_10022035 3300025940 Bacteria 6011
602 Ga0207691_10040814 3300025940 Bacteria 4287
603 Ga0207691_10042225 3300025940 Bacteria 4204
604 Ga0207691_10101431 3300025940 Bacteria 2568
605 Ga0207691_10121296 3300025940 Bacteria 2317
606 Ga0207711_10015241 3300025941 Bacteria 6381
607 Ga0207711_10031188 3300025941 Bacteria 4498
608 Ga0207711_10091911 3300025941 Bacteria 2670
609 Ga0207711_10143320 3300025941 Bacteria 2151
610 Ga0207711_10333391 3300025941 Bacteria 1403
611 Ga0207711_10441453 3300025941 Unclassified 1211
612 Ga0207689_10001150 3300025942 Bacteria 25470
613 Ga0207689_10006771 3300025942 Bacteria 10087
614 Ga0207689_10036026 3300025942 Unclassified 4108
615 Ga0207689_10107789 3300025942 Bacteria 2289
616 Ga0207689_10139385 3300025942 Bacteria 1998
617 Ga0207689_10228734 3300025942 Bacteria 1537
618 Ga0207689_10327463 3300025942 Bacteria 1272
619 Ga0207661_10560609 3300025944 Bacteria 1047
620 Ga0207679_10007928 3300025945 Bacteria 6751
621 Ga0207679_10038592 3300025945 Bacteria 3404
622 Ga0207679_10250139 3300025945 Bacteria 1506
623 Ga0207651_10025462 3300025960 Bacteria 3677
624 Ga0207651_10026093 3300025960 Bacteria 3643
625 Ga0207651_10035443 3300025960 Bacteria 3245
626 Ga0207651_10035886 3300025960 Bacteria 3230
627 Ga0207651_10106394 3300025960 Bacteria 2094
628 Ga0207651_10126298 3300025960 Bacteria 1949
629 Ga0207651_10249470 3300025960 Bacteria 1451
630 Ga0207712_10026445 3300025961 Bacteria 3866
631 Ga0207712_10032026 3300025961 Bacteria 3546
632 Ga0207712_10110672 3300025961 Bacteria 2060
633 Ga0207668_10033423 3300025972 Bacteria 3407
634 Ga0207668_10040853 3300025972 Bacteria 3132
635 Ga0207668_10170471 3300025972 Bacteria 1706
636 Ga0207668_10251476 3300025972 Bacteria 1436
637 Ga0207668_10606864 3300025972 Bacteria 954
638 Ga0207658_10024322 3300025986 Bacteria 4237
639 Ga0207658_10031977 3300025986 Bacteria 3741
640 Ga0207658_10066995 3300025986 Bacteria 2703
641 Ga0207658_10130857 3300025986 Bacteria 2016
642 Ga0207658_10197418 3300025986 Bacteria 1677
643 Ga0207658_10399250 3300025986 Bacteria 1208
644 Ga0207677_10211051 3300026023 Bacteria 1551
645 Ga0207703_10018127 3300026035 Bacteria 5499
646 Ga0207703_10051427 3300026035 Bacteria 3339
647 Ga0207703_10146904 3300026035 Bacteria 2052
648 Ga0207678_10097732 3300026067 Unclassified 2509
649 Ga0207678_10192969 3300026067 Bacteria 1741
650 Ga0207678_10470735 3300026067 Bacteria 1093
651 Ga0207708_10001418 3300026075 Bacteria 17960
652 Ga0207708_10028691 3300026075 Bacteria 4214
653 Ga0207708_10047021 3300026075 Unclassified 3287
654 Ga0207708_10047142 3300026075 Bacteria 3282
655 Ga0207708_10060383 3300026075 Bacteria 2893
656 Ga0207708_10061172 3300026075 Bacteria 2875
657 Ga0207708_10065373 3300026075 Bacteria 2780
658 Ga0207708_10100204 3300026075 Bacteria 2241
659 Ga0207641_10047483 3300026088 Bacteria 3620
660 Ga0207641_10050626 3300026088 Bacteria 3515
661 Ga0207641_10156783 3300026088 Bacteria 2066
662 Ga0207641_10185372 3300026088 Bacteria 1909
663 Ga0207641_10255975 3300026088 Bacteria 1637
664 Ga0207641_10270155 3300026088 Bacteria 1595
665 Ga0207648_10006501 3300026089 Bacteria 11609
666 Ga0207648_10036800 3300026089 Bacteria 4311
667 Ga0207648_10042478 3300026089 Bacteria 3991
668 Ga0207648_10197628 3300026089 Bacteria 1783
669 Ga0207648_10372549 3300026089 Bacteria 1290
670 Ga0207676_10009849 3300026095 Bacteria 6799
671 Ga0207676_10400280 3300026095 Bacteria 1283
672 Ga0207676_10659067 3300026095 Bacteria 1011
673 Ga0207674_10138078 3300026116 Bacteria 2399
674 Ga0207674_10244786 3300026116 Unclassified 1740
675 Ga0207675_100005749 3300026118 Bacteria 11863
676 Ga0207675_100006207 3300026118 Bacteria 11348
677 Ga0207675_100021171 3300026118 Bacteria 6058
678 Ga0207675_100074064 3300026118 Bacteria 3186
679 Ga0207675_100076455 3300026118 Bacteria 3135
680 Ga0207675_100092619 3300026118 Bacteria 2842
681 Ga0207675_100124087 3300026118 Bacteria 2445
682 Ga0207675_100147926 3300026118 Bacteria 2234
683 Ga0207675_100471280 3300026118 Bacteria 1247
684 Ga0207675_100495031 3300026118 Bacteria 1216
685 Ga0207683_10002309 3300026121 Bacteria 16723
686 Ga0207683_10054319 3300026121 Bacteria 3513
687 Ga0207683_10079431 3300026121 Bacteria 2909
688 Ga0207683_10108733 3300026121 Bacteria 2481
689 Ga0207683_10146013 3300026121 Bacteria 2133
690 Ga0207683_10199460 3300026121 Bacteria 1818
691 Ga0207698_10152385 3300026142 Unclassified 2009
692 Ga0207698_10162123 3300026142 Bacteria 1957
693 Ga0207698_10190832 3300026142 Bacteria 1825
694 Ga0209983_1013224 3300027665 Bacteria 1697
695 Ga0209971_1036655 3300027682 Bacteria 1181
696 Ga0207428_10000004 3300027907 Bacteria 727800
697 Ga0207428_10000864 3300027907 Bacteria 34135
698 Ga0207428_10002617 3300027907 Bacteria 17956
699 Ga0207428_10006374 3300027907 Bacteria 10911
700 Ga0207428_10018190 3300027907 Bacteria 6009
701 Ga0207428_10024144 3300027907 Bacteria 5106
702 Ga0207428_10031001 3300027907 Bacteria 4417
703 Ga0207428_10049035 3300027907 Bacteria 3385
704 Ga0268266_10010915 3300028379 Bacteria 7908
705 Ga0268266_10076012 3300028379 Bacteria 2918
706 Ga0268266_10353092 3300028379 Unclassified 1382
707 Ga0268265_10014309 3300028380 Bacteria 5403
708 Ga0268265_10015569 3300028380 Bacteria 5206
709 Ga0268265_10073159 3300028380 Bacteria 2676
710 Ga0268265_10148428 3300028380 Unclassified 1974
711 Ga0268265_10183171 3300028380 Bacteria 1801
712 Ga0268265_10213502 3300028380 Bacteria 1683
713 Ga0268265_10229600 3300028380 Bacteria 1630
714 Ga0268264_10007779 3300028381 Bacteria 8925
715 Ga0268264_10054839 3300028381 Bacteria 3329
716 Ga0268264_10062989 3300028381 Bacteria 3116
717 Ga0307408_100010451 3300031548 Bacteria 6121
718 Ga0307408_100022297 3300031548 Bacteria 4301
719 Ga0307408_100032094 3300031548 Bacteria 3662
720 Ga0307408_100103484 3300031548 Bacteria 2173
721 Ga0307408_100192871 3300031548 Unclassified 1643
722 Ga0307408_100488893 3300031548 Bacteria 1075
723 Ga0307408_100533116 3300031548 Unclassified 1033
724 Ga0307405_10032566 3300031731 Bacteria 3082
725 Ga0307405_10088877 3300031731 Bacteria 2040
726 Ga0307405_10107996 3300031731 Bacteria 1879
727 Ga0307405_10178799 3300031731 Unclassified 1521
728 Ga0307405_10215258 3300031731 Bacteria 1406
729 Ga0307413_10059939 3300031824 Bacteria 2341
730 Ga0307410_10001023 3300031852 Bacteria 12126
731 Ga0307410_10035954 3300031852 Bacteria 3221
732 Ga0307410_10240947 3300031852 Bacteria 1401
733 Ga0307410_10354659 3300031852 Bacteria 1173
734 Ga0307406_10023635 3300031901 Bacteria 3660
735 Ga0307406_10108912 3300031901 Unclassified 1903
736 Ga0307407_10005601 3300031903 Bacteria 5471
737 Ga0307407_10012830 3300031903 Bacteria 4045
738 Ga0307407_10157060 3300031903 Bacteria 1485
739 Ga0307407_10192302 3300031903 Bacteria 1361
740 Ga0307407_10194208 3300031903 Bacteria 1355
741 Ga0307409_100027104 3300031995 Bacteria 4055
742 Ga0307409_100046491 3300031995 Bacteria 3286
743 Ga0307409_100084611 3300031995 Bacteria 2576
744 Ga0307409_100086384 3300031995 Unclassified 2553
745 Ga0307409_100159706 3300031995 Bacteria 1969
746 Ga0307409_100334618 3300031995 Bacteria 1422
747 Ga0307409_100364461 3300031995 Bacteria 1368
748 Ga0307409_100566130 3300031995 Bacteria 1118
749 Ga0307416_100002617 3300032002 Bacteria 10402
750 Ga0307416_100004324 3300032002 Bacteria 8538
751 Ga0307416_100013492 3300032002 Bacteria 5557
752 Ga0307416_100160452 3300032002 Bacteria 2077
753 Ga0307416_100237426 3300032002 Bacteria 1763
754 Ga0307416_100249198 3300032002 Bacteria 1727
755 Ga0307416_100291271 3300032002 Bacteria 1616
756 Ga0307414_10008759 3300032004 Bacteria 5767
757 Ga0307414_10031673 3300032004 Bacteria 3472
758 Ga0307414_10377767 3300032004 Bacteria 1224
759 Ga0307411_10014926 3300032005 Bacteria 4341
760 Ga0307411_10051758 3300032005 Bacteria 2681
761 Ga0307411_10055025 3300032005 Bacteria 2616
762 Ga0307411_10220961 3300032005 Unclassified 1470
763 Ga0307411_10548133 3300032005 Bacteria 986
764 Ga0307415_100008949 3300032126 Bacteria 5582
765 Ga0307415_100023002 3300032126 Bacteria 3860
766 Ga0307415_100166597 3300032126 Bacteria 1714
767 Ga0373930_0003255 3300034816 Bacteria 2568
768 Ga0373948_0003137 3300034817 Bacteria 2514
769 Ga0373958_0004608 3300034819 Unclassified 2049
770 Ga0373959_0001235 3300034820 Bacteria 4124
771 Ga0373938_0001273 3300034957 Bacteria 4048
772 Ga0373928_0002304 3300035084 Bacteria 3711
773 Ga0373929_0005265 3300035085 Bacteria 2326
774 Ga0373949_0001113 3300035090 Bacteria 8147
775 Ga0373951_0002359 3300035091 Bacteria 4787
776 Ga0373952_0000406 3300035092 Bacteria 7398
777 Ga0373932_0001419 3300035112 Bacteria 6718
778 Ga0373932_0031609 3300035112 Bacteria 1476
779 Ga0373939_0000596 3300035114 Bacteria 8983
780 Ga0373941_0001790 3300035115 Bacteria 4624
781 Ga0373960_0000967 3300035121 Bacteria 6177
782 Ga0373943_0018367 3300035170 Bacteria 3211
783 Ga0373946_0052790 3300035171 Bacteria 1706
784 Ga0373955_0052537 3300035172 Bacteria 2223
785 Ga0373942_0001095 3300035207 Bacteria 7252
786 Ga0373961_0002928 3300035241 Bacteria 4324
787 Ga0373962_0001237 3300035242 Bacteria 5982
788 Ga0373962_0020776 3300035242 Bacteria 1727
789 Ga0373931_0103804 3300035691 Unclassified 1603
790 Ga0373947_0018984 3300035725 Bacteria 3962
791 Ga0373937_0019618 3300036401 Bacteria 6052
792 Ga0373925_0004437 3300037068 Bacteria 10602
793 Ga0395900_0356830 3300037418 Bacteria 1434
794 Ga0395901_0556495 3300038443 Bacteria 1162
795 Ga0439453_0005028 3300041408 Bacteria 1997
796 Ga0439461_0031331 3300041410 Unclassified 1110
797 Ga0451853_4106301 3300041512 Bacteria 1755
798 Ga0439431_0014668 3300041997 Bacteria 1818
799 Ga0439431_0025348 3300041997 Bacteria 1448
800 Ga0439433_0029109 3300041999 Unclassified 1259
801 Ga0439441_010623 3300042001 Bacteria 1548
802 Ga0439448_0054253 3300042005 Unclassified 1317
803 Ga0450923_000398 3300042125 Bacteria 4638
804 Ga0450923_024637 3300042125 Bacteria 1194
805 Ga0450894_001887 3300042131 Bacteria 2901
806 Ga0450896_001512 3300042133 Bacteria 2879
807 Ga0450896_002478 3300042133 Bacteria 2384
808 Ga0450908_004693 3300042184 Bacteria 2633
809 Ga0439434_0049188 3300042435 Bacteria 1305
810 Ga0439434_0088363 3300042435 Bacteria 989
811 Ga0439435_0007666 3300042436 Bacteria 2479
812 Ga0439464_0030649 3300042439 Bacteria 1507
813 Ga0451577_0057462 3300042876 Bacteria 3468
814 Ga0439440_0013301 3300042993 Bacteria 1762
815 Ga0439440_0042545 3300042993 Bacteria 1112
816 Ga0466963_0104898 3300044694 Bacteria 1937
817 Ga0453684_0165264 3300044712 Unclassified 2613
818 Ga0451576_0010717 3300045051 Bacteria 10496
819 Ga0451576_0576313 3300045051 Bacteria 1182
820 Ga0466967_0232697 3300045976 Unclassified 1755
821 Ga0466967_0318946 3300045976 Bacteria 1498
822 Ga0466967_0572243 3300045976 Unclassified 1113
823 Ga0495629_0036688 3300046459 Bacteria 3458
824 Ga0495629_0171328 3300046459 Bacteria 1506
825 Ga0495653_0133743 3300046463 Bacteria 1752
826 Ga0495664_0127922 3300046477 Bacteria 1537
827 Ga0495584_0013157 3300046491 Bacteria 4221
828 Ga0495628_0119463 3300046516 Bacteria 2023
829 Ga0495663_0004895 3300046525 Bacteria 3743
830 Ga0495642_0039695 3300046528 Bacteria 1910
831 Ga0495642_0084060 3300046528 Bacteria 1343
832 Ga0495586_0007998 3300046535 Bacteria 5640
833 Ga0495598_0072455 3300046537 Unclassified 1088
834 Ga0495645_0007627 3300046543 Bacteria 7528
835 Ga0495656_0074536 3300046615 Bacteria 1516
836 Ga0495656_0115510 3300046615 Unclassified 1261
837 Ga0495659_0011642 3300046664 Bacteria 2834
838 Ga0495599_0151698 3300046678 Unclassified 1435
839 Ga0495647_0063306 3300046681 Unclassified 1464
840 Ga0495658_0010288 3300046683 Bacteria 4679
841 Ga0495658_0026658 3300046683 Bacteria 3100
842 Ga0495669_0084953 3300046684 Unclassified 1456
843 Ga0495669_0086544 3300046684 Bacteria 1443
844 Ga0495613_0251473 3300046689 Bacteria 1233
845 Ga0495600_0117398 3300046809 Bacteria 1731
846 Ga0495604_0237113 3300047317 Bacteria 1249
847 Ga0495636_0017995 3300047318 Bacteria 2833
848 Ga0495636_0083858 3300047318 Bacteria 1376
849 Ga0495677_0008003 3300047445 Bacteria 3929
850 Ga0495685_037491 3300047447 Bacteria 1662
851 Ga0495684_0215712 3300047471 Bacteria 1409
852 Ga0495593_0115845 3300047673 Unclassified 1366
853 Ga0496100_0251882 3300048903 Bacteria 1306
854 Ga0496101_0074961 3300048904 Bacteria 2490
855 Ga0496101_0311834 3300048904 Bacteria 1233
856 Ga0496101_0412717 3300048904 Unclassified 1064
857 Ga0496102_0057138 3300048905 Bacteria 3562
858 Ga0496104_0005233 3300048907 Bacteria 11342
859 Ga0496104_0015062 3300048907 Bacteria 6999
860 Ga0496104_0139227 3300048907 Bacteria 2332
861 Ga0496106_0025834 3300048909 Bacteria 4370
862 Ga0496106_0027282 3300048909 Bacteria 4253
863 Ga0496106_0059960 3300048909 Bacteria 2884
864 Ga0496106_0335151 3300048909 Bacteria 1215
865 Ga0496107_0079886 3300048910 Bacteria 2385
866 Ga0496107_0168516 3300048910 Bacteria 1625
867 Ga0496108_0018375 3300048911 Bacteria 5725
868 Ga0496108_0091012 3300048911 Bacteria 2593
869 Ga0496108_0197394 3300048911 Bacteria 1746
870 Ga0496108_0397099 3300048911 Bacteria 1204
871 Ga0496109_0009063 3300048912 Bacteria 8475
872 Ga0496109_0069911 3300048912 Bacteria 3221
873 Ga0496109_0070963 3300048912 Bacteria 3197
874 Ga0496109_0092585 3300048912 Bacteria 2796
875 Ga0496109_0311005 3300048912 Unclassified 1486
876 Ga0496109_0346085 3300048912 Bacteria 1404
877 Ga0496110_0055936 3300048913 Bacteria 3472
878 Ga0496112_0023492 3300048915 Bacteria 5892
879 Ga0496112_0051260 3300048915 Bacteria 4048
880 Ga0496112_0069036 3300048915 Bacteria 3491
881 Ga0496112_0137813 3300048915 Unclassified 2410
882 Ga0496112_0205729 3300048915 Bacteria 1926
883 Ga0496114_0009075 3300048917 Bacteria 7887
884 Ga0496114_0013501 3300048917 Bacteria 6550
885 Ga0501034_0072072 3300049571 Bacteria 3464
886 Ga0501036_0224126 3300049572 Bacteria 1578
887 Ga0501036_0273088 3300049572 Bacteria 1415
888 Ga0501042_0268846 3300049578 Bacteria 1231
889 Ga0501046_0298948 3300049580 Bacteria 1176
890 Ga0501047_0076643 3300049581 Bacteria 3218
891 Ga0501048_0316248 3300049582 Bacteria 1112
892 Ga0501048_0390038 3300049582 Bacteria 995
893 Ga0501067_0085818 3300049583 Unclassified 1747
894 Ga0501072_0063718 3300049588 Bacteria 2908
895 Ga0501072_0093520 3300049588 Bacteria 2388
896 Ga0501072_0242898 3300049588 Unclassified 1434
897 Ga0501072_0304802 3300049588 Bacteria 1266
898 Ga0501074_0257790 3300049590 Unclassified 1240
899 Ga0501075_0024456 3300049591 Bacteria 4430
900 Ga0501075_0305052 3300049591 Bacteria 1213
901 Ga0501076_0014348 3300049592 Bacteria 5967
902 Ga0501076_0295308 3300049592 Bacteria 1328
903 Ga0501198_018895 3300049649 Bacteria 1082
904 Ga0501209_078719 3300049656 Bacteria 948
905 Ga0501079_0085667 3300049741 Bacteria 2439
906 Ga0501080_0158022 3300049742 Bacteria 2094
907 Ga0501080_0305595 3300049742 Bacteria 1442
908 Ga0501080_0310609 3300049742 Bacteria 1429
909 Ga0501045_0192449 3300049824 Bacteria 1520
910 nmdc:mga03683_367_c1 3300050489 Bacteria 13025
911 nmdc:mga0yw44_37053_c1 3300050492 Bacteria 2878
912 nmdc:mga0k408_15798_c2 3300050493 Bacteria 2517
913 nmdc:mga0k408_3204_c1 3300050493 Bacteria 8665
914 nmdc:mga06z11_37090_c1 3300050494 Bacteria 2412
915 nmdc:mga06z11_5106_c1 3300050494 Bacteria 5233
916 nmdc:mga04h51_1638_c1 3300050495 Bacteria 5224
917 nmdc:mga07m45_3284_c1 3300050496 Bacteria 7780
918 nmdc:mga05p37_103885_c1 3300050507 Bacteria 3496
919 nmdc:mga05p37_11013_c1 3300050507 Bacteria 10740
920 nmdc:mga05p37_11953_c1 3300050507 Bacteria 10354
921 nmdc:mga05p37_123749_c1 3300050507 Bacteria 3177
922 nmdc:mga05p37_22313_c1 3300050507 Bacteria 7677
923 nmdc:mga05p37_223574_c1 3300050507 Bacteria 2271
924 nmdc:mga05p37_229311_c1 3300050507 Bacteria 2238
925 nmdc:mga05p37_23609_c1 3300050507 Bacteria 7464
926 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
927 nmdc:mga05p37_262566_c1 3300050507 Bacteria 2066
928 nmdc:mga05p37_37138_c1 3300050507 Bacteria 5975
929 nmdc:mga05p37_43348_c1 3300050507 Bacteria 5535
930 nmdc:mga05p37_43622_c1 3300050507 Bacteria 5517
931 nmdc:mga05p37_45079_c1 3300050507 Bacteria 5425
932 nmdc:mga05p37_47253_c1 3300050507 Unclassified 4219
933 nmdc:mga05p37_48294_c1 3300050507 Bacteria 5235
934 nmdc:mga05p37_488484_c1 3300050507 Bacteria 1416
935 nmdc:mga05p37_508512_c1 3300050507 Unclassified 1381
936 nmdc:mga05p37_51465_c1 3300050507 Bacteria 5065
937 nmdc:mga05p37_5466_c1 3300050507 Bacteria 14916
938 nmdc:mga05p37_56435_c1 3300050507 Bacteria 4836
939 nmdc:mga05p37_588905_c1 3300050507 Bacteria 1258
940 nmdc:mga05p37_80691_c1 3300050507 Bacteria 4007
941 nmdc:mga05p37_9128_c1 3300050507 Bacteria 11722
942 nmdc:mga05p37_96154_c1 3300050507 Bacteria 3649
943 nmdc:mga09592_101885_c1 3300050508 Bacteria 2460
944 nmdc:mga09592_13865_c1 3300050508 Bacteria 6587
945 nmdc:mga09592_152577_c1 3300050508 Bacteria 1993
946 nmdc:mga09592_17305_c1 3300050508 Bacteria 5905
947 nmdc:mga09592_236670_c1 3300050508 Bacteria 1582
948 nmdc:mga09592_290190_c1 3300050508 Bacteria 1418
949 nmdc:mga09592_31698_c1 3300050508 Bacteria 4405
950 nmdc:mga09592_7395_c1 3300050508 Bacteria 8929
951 nmdc:mga09592_9128_c1 3300050508 Bacteria 8065
952 nmdc:mga0qj67_1218_c1 3300050509 Bacteria 17904
953 nmdc:mga0qj67_149570_c1 3300050509 Bacteria 1498
954 nmdc:mga0qj67_150624_c1 3300050509 Unclassified 1887
955 nmdc:mga0qj67_21643_c1 3300050509 Bacteria 4933
956 nmdc:mga0qj67_258_c1 3300050509 Bacteria 36243
957 nmdc:mga0qj67_93293_c1 3300050509 Bacteria 2420
958 nmdc:mga0qj67_94105_c1 3300050509 Bacteria 2410
959 nmdc:mga06r32_110029_c1 3300050510 Bacteria 2710
960 nmdc:mga06r32_135319_c1 3300050510 Bacteria 2439
961 nmdc:mga06r32_1786_c1 3300050510 Bacteria 19309
962 nmdc:mga06r32_259683_c1 3300050510 Bacteria 1725
963 nmdc:mga06r32_28239_c1 3300050510 Bacteria 5246
964 nmdc:mga06r32_3672_c1 3300050510 Bacteria 13707
965 nmdc:mga06r32_372154_c1 3300050510 Bacteria 1412
966 nmdc:mga06r32_50749_c1 3300050510 Bacteria 3968
967 nmdc:mga06r32_618371_c1 3300050510 Bacteria 1053
968 nmdc:mga06r32_63360_c1 3300050510 Bacteria 3563
969 nmdc:mga06r32_63447_c1 3300050510 Bacteria 3561
970 nmdc:mga06r32_67587_c1 3300050510 Bacteria 3451
971 nmdc:mga08y16_123167_c1 3300050511 Bacteria 2698
972 nmdc:mga08y16_19705_c1 3300050511 Bacteria 7112
973 nmdc:mga08y16_20766_c1 3300050511 Bacteria 6933
974 nmdc:mga08y16_24508_c1 3300050511 Bacteria 6367
975 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
976 nmdc:mga08y16_3088_c1 3300050511 Bacteria 17226
977 nmdc:mga08y16_365827_c1 3300050511 Bacteria 1480
978 nmdc:mga08y16_402066_c1 3300050511 Unclassified 1402
979 nmdc:mga08y16_46004_c1 3300050511 Bacteria 4571
980 nmdc:mga08y16_585354_c1 3300050511 Unclassified 1126
981 nmdc:mga08y16_80229_c1 3300050511 Bacteria 3402
982 nmdc:mga0n895_11099_c1 3300050512 Bacteria 8017
983 nmdc:mga0n895_117311_c1 3300050512 Unclassified 2681
984 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
985 nmdc:mga0n895_179638_c1 3300050512 Bacteria 2148
986 nmdc:mga0n895_21582_c1 3300050512 Bacteria 6026
987 nmdc:mga0n895_220518_c1 3300050512 Bacteria 1926
988 nmdc:mga0n895_411_c1 3300050512 Bacteria 28740
989 nmdc:mga0n895_426415_c1 3300050512 Bacteria 1340
990 nmdc:mga0n895_47268_c1 3300050512 Bacteria 4208
991 nmdc:mga0n895_60891_c1 3300050512 Bacteria 3725
992 nmdc:mga0n895_74201_c1 3300050512 Bacteria 3379
993 nmdc:mga0n895_81179_c1 3300050512 Bacteria 3231
994 nmdc:mga0n895_82209_c1 3300050512 Bacteria 3210
995 nmdc:mga0n895_8256_c1 3300050512 Bacteria 9006
996 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
997 nmdc:mga0rr50_123144_c1 3300050513 Bacteria 2067
998 nmdc:mga0rr50_14528_c1 3300050513 Bacteria 5169
999 nmdc:mga0rr50_31768_c1 3300050513 Bacteria 3755
1000 nmdc:mga0rr50_41621_c1 3300050513 Bacteria 3349
1001 nmdc:mga0rr50_5261_c1 3300050513 Bacteria 7699
1002 nmdc:mga0rr50_64845_c1 3300050513 Bacteria 2765
1003 nmdc:mga0rr50_698_c1 3300050513 Bacteria 17989
1004 nmdc:mga08x19_117723_c1 3300050514 Bacteria 1778
1005 nmdc:mga08x19_12888_c1 3300050514 Bacteria 5044
1006 nmdc:mga08x19_810_c1 3300050514 Bacteria 19891
1007 nmdc:mga0a205_104667_c1 3300050515 Bacteria 2729
1008 nmdc:mga0a205_1204_c2 3300050515 Bacteria 12623
1009 nmdc:mga0a205_19178_c1 3300050515 Bacteria 6445
1010 nmdc:mga0a205_193437_c1 3300050515 Bacteria 1926
1011 nmdc:mga0a205_236013_c1 3300050515 Bacteria 1711
1012 nmdc:mga0a205_24831_c1 3300050515 Bacteria 5703
1013 nmdc:mga0a205_26289_c1 3300050515 Bacteria 5548
1014 nmdc:mga0a205_4049_c1 3300050515 Bacteria 13109
1015 nmdc:mga0a205_4615_c1 3300050515 Bacteria 10847
1016 nmdc:mga0a205_54296_c1 3300050515 Bacteria 3868
1017 nmdc:mga0a205_550694_c1 3300050515 Bacteria 1009
1018 nmdc:mga0a205_67034_c1 3300050515 Bacteria 3467
1019 nmdc:mga0a205_69191_c1 3300050515 Bacteria 3409
1020 nmdc:mga0a205_72665_c1 3300050515 Bacteria 3323
1021 nmdc:mga0a205_900_c1 3300050515 Bacteria 24469
1022 nmdc:mga0a205_99777_c1 3300050515 Bacteria 2802
1023 Ga0495601_0066854 3300053077 Bacteria 2288
1024 Ga0495619_0046720 3300053085 Bacteria 2848
1025 Ga0495619_0127847 3300053085 Bacteria 1745
1026 Ga0495619_0312639 3300053085 Bacteria 1088
1027 Ga0501084_0070132 3300054114 Bacteria 2935
1028 Ga0590071_000149 3300059421 Bacteria 20050
1029 Ga0590071_000396 3300059421 Bacteria 12810
1030 Ga0590071_017316 3300059421 Bacteria 1692
1031 Ga0590074_000025 3300059423 Bacteria 14748
1032 Ga0590075_000328 3300059424 Bacteria 13181
1033 Ga0590075_000785 3300059424 Bacteria 8371
1034 Ga0590075_013183 3300059424 Unclassified 2012
1035 Ga0590077_000260 3300059426 Bacteria 15106
1036 Ga0590077_001423 3300059426 Bacteria 5612
1037 Ga0590077_004448 3300059426 Bacteria 2877
1038 Ga0501082_0079679 3300060353 Bacteria 2826
1039 Ga0207674_10032488
1040 Ga0065714_10122997
1041 Ga0065704_10088862
1042 Ga0065712_10002342
1043 Ga0065712_10020375
1044 Ga0065712_10069274
1045 Ga0065712_10105457
1046 Ga0065715_10002917
1047 Ga0065715_10003607
1048 Ga0065715_10007509
1049 Ga0065715_10010195
1050 Ga0065715_10095903
1051 Ga0065715_10151577
1052 Ga0065707_10034665
1053 Ga0065707_10086081
1054 Ga0065707_10139699
1055 Ga0065707_10152547
1056 Ga0065707_10154439
1057 Ga0070676_10054275
1058 Ga0070690_100003728
1059 Ga0070690_100020024
1060 Ga0070690_100049071
1061 Ga0070690_100102700
1062 Ga0070690_100210287
1063 Ga0070670_100001015
1064 Ga0070670_100001833
1065 Ga0070670_100006975
1066 Ga0070670_100047108
1067 Ga0070670_100109837
1068 Ga0070677_10002936
1069 Ga0068869_100010049
1070 Ga0070666_10014565
1071 Ga0070666_10043921
1072 Ga0070666_10256315
1073 Ga0070680_100139934
1074 Ga0070682_100202480
1075 Ga0068868_100004123
1076 Ga0068868_100117018
1077 Ga0068868_100232760
1078 Ga0068868_100328548
1079 Ga0070660_100062795
1080 Ga0070660_100151344
1081 Ga0070689_100019892
1082 Ga0070689_100029122
1083 Ga0070689_100048031
1084 Ga0070689_100167407
1085 Ga0070689_100239293
1086 Ga0070689_100266835
1087 Ga0070687_100021144
1088 Ga0070687_100029403
1089 Ga0070687_100061421
1090 Ga0070661_100046902
1091 Ga0070661_100407642
1092 Ga0070692_10002119
1093 Ga0070668_100021252
1094 Ga0070668_100051961
1095 Ga0070668_100101100
1096 Ga0070668_100555535
1097 Ga0070669_100008866
1098 Ga0070669_100010039
1099 Ga0070669_100018637
1100 Ga0070669_100036230
1101 Ga0070669_100043330
1102 Ga0070675_100001854
1103 Ga0070675_100004337
1104 Ga0070675_100009646
1105 Ga0070675_100011858
1106 Ga0070675_100042732
1107 Ga0070675_100044719
1108 Ga0070675_100048397
1109 Ga0070675_100050591
1110 Ga0070675_100065982
1111 Ga0070675_100076345
1112 Ga0070675_100110992
1113 Ga0070675_100132353
1114 Ga0070675_100250134
1115 Ga0070671_100017856
1116 Ga0070671_100033900
1117 Ga0070671_100381726
1118 Ga0070674_100000165
1119 Ga0070674_100051004
1120 Ga0070674_100079828
1121 Ga0070674_100091450
1122 Ga0070674_100195540
1123 Ga0070673_100003780
1124 Ga0070673_100005719
1125 Ga0070673_100013735
1126 Ga0070673_100046214
1127 Ga0070673_100122030
1128 Ga0070673_100166825
1129 Ga0070673_100188563
1130 Ga0070673_100270023
1131 Ga0070673_100270968
1132 Ga0070673_100452250
1133 Ga0070688_100001290
1134 Ga0070688_100007794
1135 Ga0070688_100020063
1136 Ga0070688_100025607
1137 Ga0070688_100061826
1138 Ga0070688_100062404
1139 Ga0070688_100065486
1140 Ga0070688_100190304
1141 Ga0070659_100023249
1142 Ga0070667_100037292
1143 Ga0070667_100077118
1144 Ga0070667_100086166
1145 Ga0070703_10029030
1146 Ga0070703_10042205
1147 Ga0070709_10059826
1148 Ga0070714_100049126
1149 Ga0070713_100116571
1150 Ga0070713_100306192
1151 Ga0070701_10017740
1152 Ga0070701_10040735
1153 Ga0070705_100022537
1154 Ga0070705_100040672
1155 Ga0070705_100072986
1156 Ga0070700_100007083
1157 Ga0070700_100065310
1158 Ga0070700_100150197
1159 Ga0070700_100198569
1160 Ga0070700_100253310
1161 Ga0070694_100000529
1162 Ga0070694_100010135
1163 Ga0070694_100061360
1164 Ga0070694_100089796
1165 Ga0070694_100093524
1166 Ga0070663_100052680
1167 Ga0070678_100032872
1168 Ga0070678_100052131
1169 Ga0070678_100054447
1170 Ga0070678_100166336
1171 Ga0070678_100180335
1172 Ga0070678_100286874
1173 Ga0070678_100334630
1174 Ga0070678_100360311
1175 Ga0070662_100045936
1176 Ga0070662_100106280
1177 Ga0068867_100004141
1178 Ga0068867_100043254
1179 Ga0068867_100070339
1180 Ga0070685_10006586
1181 Ga0070685_10013584
1182 Ga0070707_100034445
1183 Ga0070707_100100291
1184 Ga0070707_100136308
1185 Ga0070707_100168709
1186 Ga0070707_100284395
1187 Ga0070698_100006486
1188 Ga0070698_100057161
1189 Ga0070698_100243872
1190 Ga0070699_100000475
1191 Ga0070699_100008844
1192 Ga0070699_100060409
1193 Ga0070699_100067375
1194 Ga0070699_100102185
1195 Ga0070699_100352370
1196 Ga0070679_100349572
1197 Ga0070684_100039030
1198 Ga0070697_100071045
1199 Ga0070697_100155656
1200 Ga0070697_100220096
1201 Ga0070672_100004487
1202 Ga0070672_100010205
1203 Ga0070672_100030719
1204 Ga0070672_100037326
1205 Ga0070672_100092420
1206 Ga0070672_100103255
1207 Ga0070686_100003602
1208 Ga0070686_100018775
1209 Ga0070686_100051278
1210 Ga0070686_100058309
1211 Ga0070686_100081458
1212 Ga0070686_100239027
1213 Ga0070695_100001664
1214 Ga0070695_100004647
1215 Ga0070695_100014828
1216 Ga0070695_100071154
1217 Ga0070696_100006712
1218 Ga0070696_100009119
1219 Ga0070696_100013209
1220 Ga0070696_100017397
1221 Ga0070693_100281024
1222 Ga0070665_100002633
1223 Ga0070665_100008638
1224 Ga0070665_100143040
1225 Ga0070665_100191351
1226 Ga0070665_100321908
1227 Ga0070704_100001492
1228 Ga0070704_100031241
1229 Ga0070704_100061461
1230 Ga0070704_100064708
1231 Ga0070704_100125336
1232 Ga0070704_100149505
1233 Ga0070704_100197717
1234 Ga0068855_100090370
1235 Ga0070664_100002655
1236 Ga0070664_100025568
1237 Ga0070664_100052222
1238 Ga0070664_100062565
1239 Ga0070664_100109056
1240 Ga0070664_100134620
1241 Ga0068857_100042809
1242 Ga0068857_100050923
1243 Ga0068857_100106337
1244 Ga0068857_100312876
1245 Ga0070702_100057430
1246 Ga0070702_100070590
1247 Ga0070702_100107898
1248 Ga0070702_100204273
1249 Ga0070702_100243274
1250 Ga0068852_100118838
1251 Ga0068852_100125051
1252 Ga0068852_100338364
1253 Ga0068859_100008120
1254 Ga0068859_100009537
1255 Ga0068859_100041236
1256 Ga0068859_100065424
1257 Ga0068859_100125479
1258 Ga0068859_100237011
1259 Ga0068859_100249257
1260 Ga0068859_100252928
1261 Ga0068859_100262137
1262 Ga0068864_100007441
1263 Ga0068864_100021304
1264 Ga0068864_100123661
1265 Ga0068864_100168320
1266 Ga0068864_100617893
1267 Ga0068866_10005667
1268 Ga0068861_100042313
1269 Ga0068861_100045015
1270 Ga0068861_100061876
1271 Ga0068861_100180579
1272 Ga0068861_100187947
1273 Ga0068861_100399283
1274 Ga0068851_10028836
1275 Ga0068870_10021091
1276 Ga0068870_10060531
1277 Ga0068863_100002449
1278 Ga0068863_100010642
1279 Ga0068863_100015152
1280 Ga0068863_100017014
1281 Ga0068863_100145871
1282 Ga0068863_100274589
1283 Ga0068863_100390515
1284 Ga0068858_100022608
1285 Ga0068858_100032602
1286 Ga0068858_100047643
1287 Ga0068858_100066117
1288 Ga0068858_100101095
1289 Ga0068858_100348304
1290 Ga0068860_100011122
1291 Ga0068860_100017433
1292 Ga0068860_100044816
1293 Ga0068860_100410523
1294 Ga0068862_100008460
1295 Ga0068862_100048114
1296 Ga0068862_100142548
1297 Ga0068862_100286026
1298 Ga0068862_100368888
1299 Ga0068862_100411260
1300 Ga0081455_10050373
1301 Ga0075368_10010318
1302 Ga0075364_10014105
1303 Ga0070716_100046991
1304 Ga0075362_10000473
1305 Ga0075367_10037472
1306 Ga0075427_10014829
1307 Ga0075366_10034147
1308 Ga0097621_100009175
1309 Ga0097621_100033450
1310 Ga0097621_100223552
1311 Ga0075370_10001536
1312 Ga0068871_100000886
1313 Ga0068871_100016882
1314 Ga0068871_100121010
1315 Ga0068871_100176583
1316 Ga0068871_100181754
1317 Ga0068871_100261696
1318 Ga0068871_100348167
1319 Ga0075428_100000017
1320 Ga0075428_100003466
1321 Ga0075428_100014045
1322 Ga0075428_100021988
1323 Ga0075428_100026781
1324 Ga0075428_100035381
1325 Ga0075428_100051427
1326 Ga0075428_100125684
1327 Ga0075428_100171979
1328 Ga0075428_100286135
1329 Ga0075428_100329149
1330 Ga0075428_100421212
1331 Ga0075430_100000262
1332 Ga0075430_100001294
1333 Ga0075430_100016731
1334 Ga0075430_100017001
1335 Ga0075430_100031640
1336 Ga0075430_100054024
1337 Ga0075430_100086844
1338 Ga0075430_100094111
1339 Ga0075430_100356863
1340 Ga0075431_100000517
1341 Ga0075431_100004120
1342 Ga0075431_100028475
1343 Ga0075431_100035653
1344 Ga0075431_100037503
1345 Ga0075431_100066412
1346 Ga0075431_100078070
1347 Ga0075431_100084417
1348 Ga0075431_100097894
1349 Ga0075431_100176545
1350 Ga0075431_100198616
1351 Ga0075431_100554876
1352 Ga0075433_10000668
1353 Ga0075433_10001213
1354 Ga0075433_10002563
1355 Ga0075433_10003764
1356 Ga0075433_10010816
1357 Ga0075433_10035474
1358 Ga0075433_10059806
1359 Ga0075433_10059821
1360 Ga0075433_10114498
1361 Ga0075433_10123394
1362 Ga0075433_10148752
1363 Ga0075433_10209693
1364 Ga0075434_100000776
1365 Ga0075434_100002394
1366 Ga0075434_100002772
1367 Ga0075434_100004299
1368 Ga0075434_100022059
1369 Ga0075434_100023566
1370 Ga0075434_100131844
1371 Ga0075434_100142290
1372 Ga0075434_100152430
1373 Ga0075434_100369452
1374 Ga0075434_100429952
1375 Ga0075434_100711327
1376 Ga0075429_100004563
1377 Ga0075429_100011049
1378 Ga0075429_100015702
1379 Ga0075429_100022264
1380 Ga0075429_100034776
1381 Ga0075429_100050280
1382 Ga0075429_100069942
1383 Ga0075429_100360122
1384 Ga0075429_100373731
1385 Ga0075429_100412959
1386 Ga0068865_100004376
1387 Ga0068865_100040537
1388 Ga0068865_100052300
1389 Ga0068865_100123322
1390 Ga0075436_100007465
1391 Ga0075436_100012376
1392 Ga0075436_100037825
1393 Ga0075436_100072239
1394 Ga0075436_100105620
1395 Ga0097620_100008120
1396 Ga0097620_100009538
1397 Ga0097620_100041236
1398 Ga0097620_100065424
1399 Ga0097620_100125471
1400 Ga0097620_100237022
1401 Ga0097620_100249272
1402 Ga0097620_100252928
1403 Ga0097620_100262122
1404 Ga0075435_100000189
1405 Ga0075435_100003794
1406 Ga0075435_100005360
1407 Ga0075435_100014303
1408 Ga0075435_100016466
1409 Ga0075435_100025993
1410 Ga0075435_100048549
1411 Ga0075435_100052786
1412 Ga0075435_100068479
1413 Ga0075435_100256342
1414 Ga0105240_10092439
1415 Ga0105240_10201174
1416 Ga0105240_10257184
1417 Ga0111539_10000002
1418 Ga0111539_10003233
1419 Ga0111539_10006120
1420 Ga0111539_10011717
1421 Ga0111539_10020905
1422 Ga0111539_10021013
1423 Ga0111539_10038052
1424 Ga0111539_10043698
1425 Ga0111539_10100110
1426 Ga0111539_10326652
1427 Ga0111539_10574750
1428 Ga0111539_10617803
1429 Ga0111539_10782516
1430 Ga0105245_10010625
1431 Ga0105245_10028714
1432 Ga0105245_10048265
1433 Ga0105245_10453824
1434 Ga0105247_10015859
1435 Ga0114129_10001462
1436 Ga0114129_10002879
1437 Ga0114129_10004529
1438 Ga0114129_10009284
1439 Ga0114129_10010673
1440 Ga0114129_10011026
1441 Ga0114129_10013331
1442 Ga0114129_10023606
1443 Ga0114129_10029839
1444 Ga0114129_10047764
1445 Ga0114129_10050070
1446 Ga0114129_10053753
1447 Ga0114129_10080728
1448 Ga0114129_10119920
1449 Ga0114129_10130245
1450 Ga0114129_10148275
1451 Ga0114129_10164967
1452 Ga0114129_10196624
1453 Ga0114129_10211139
1454 Ga0114129_10224852
1455 Ga0114129_10325805
1456 Ga0114129_10386193
1457 Ga0114129_10668844
1458 Ga0114129_10758676
1459 Ga0105243_10019344
1460 Ga0105243_10099842
1461 Ga0105243_10203542
1462 Ga0105243_10537123
1463 Ga0105241_10069632
1464 Ga0105242_10003085
1465 Ga0105242_10009484
1466 Ga0105242_10013588
1467 Ga0105242_10203367
1468 Ga0105248_10003756
1469 Ga0105248_10017448
1470 Ga0105248_10021665
1471 Ga0105248_10022495
1472 Ga0105248_10045029
1473 Ga0105248_10070570
1474 Ga0105248_10087068
1475 Ga0105248_10362316
1476 Ga0105238_10001078
1477 Ga0105249_10008788
1478 Ga0105249_10010840
1479 Ga0105249_10053185
1480 Ga0105249_10093185
1481 Ga0105249_10170863
1482 Ga0105249_10425066
1483 Ga0105239_10025024
1484 Ga0105246_10112942
1485 Ga0105246_10124053
1486 Ga0105246_10182448
1487 Ga0157373_10220611
1488 Ga0157370_10085788
1489 Ga0157374_10083383
1490 Ga0157374_10119850
1491 Ga0157378_10357552
1492 Ga0157378_10519162
1493 Ga0163162_10006320
1494 Ga0163162_10007209
1495 Ga0163162_10034449
1496 Ga0163162_10089617
1497 Ga0163162_10499636
1498 Ga0157375_10001117
1499 Ga0157375_10039124
1500 Ga0157375_10142243
1501 Ga0157375_10180668
1502 Ga0157375_10390940
1503 Ga0163163_10015785
1504 Ga0163163_10020310
1505 Ga0163163_10024539
1506 Ga0163163_10027274
1507 Ga0163163_10074025
1508 Ga0163163_10348679
1509 Ga0157380_10001788
1510 Ga0157380_10002539
1511 Ga0157380_10022266
1512 Ga0157380_10022914
1513 Ga0157380_10026806
1514 Ga0157380_10029789
1515 Ga0157380_10084074
1516 Ga0157380_10237393
1517 Ga0157380_10618961
1518 Ga0157377_10003051
1519 Ga0157377_10004359
1520 Ga0157377_10018084
1521 Ga0157377_10143749
1522 Ga0157377_10307311
1523 Ga0157379_10004658
1524 Ga0157379_10013418
1525 Ga0157379_10090689
1526 Ga0157379_10170689
1527 Ga0157376_10023507
1528 Ga0157376_10029697
1529 Ga0157376_10159534
1530 Ga0157376_10187581
1531 Ga0163161_10004534
1532 Ga0163161_10029212
1533 Ga0207697_10000862
1534 Ga0207697_10001902
1535 Ga0207697_10018192
1536 Ga0207682_10001500
1537 Ga0207682_10007049
1538 Ga0207642_10009690
1539 Ga0207688_10000543
1540 Ga0207688_10012246
1541 Ga0207688_10028090
1542 Ga0207680_10019011
1543 Ga0207680_10027116
1544 Ga0207680_10042448
1545 Ga0207680_10064848
1546 Ga0207680_10273082
1547 Ga0207645_10001978
1548 Ga0207645_10006408
1549 Ga0207645_10080461
1550 Ga0207645_10104028
1551 Ga0207645_10117205
1552 Ga0207645_10225854
1553 Ga0207643_10003962
1554 Ga0207643_10027047
1555 Ga0207643_10091739
1556 Ga0207695_10060721
1557 Ga0207695_10066043
1558 Ga0207695_10110184
1559 Ga0207695_10205865
1560 Ga0207662_10012484
1561 Ga0207662_10055148
1562 Ga0207657_10055845
1563 Ga0207649_10071832
1564 Ga0207649_10281354
1565 Ga0207652_10169083
1566 Ga0207652_10292699
1567 Ga0207646_10062334
1568 Ga0207646_10141906
1569 Ga0207646_10155840
1570 Ga0207646_10164608
1571 Ga0207681_10020423
1572 Ga0207681_10027331
1573 Ga0207681_10034759
1574 Ga0207681_10043045
1575 Ga0207681_10067404
1576 Ga0207681_10159080
1577 Ga0207681_10164969
1578 Ga0207694_10024267
1579 Ga0207650_10004690
1580 Ga0207650_10019843
1581 Ga0207650_10044246
1582 Ga0207650_10051418
1583 Ga0207650_10069579
1584 Ga0207659_10000116
1585 Ga0207659_10000469
1586 Ga0207659_10001398
1587 Ga0207659_10002900
1588 Ga0207659_10010561
1589 Ga0207659_10015532
1590 Ga0207659_10074017
1591 Ga0207659_10079294
1592 Ga0207659_10107682
1593 Ga0207659_10130360
1594 Ga0207659_10182048
1595 Ga0207659_10215230
1596 Ga0207659_10218651
1597 Ga0207687_10020499
1598 Ga0207687_10027394
1599 Ga0207687_10031523
1600 Ga0207687_10217871
1601 Ga0207700_10134906
1602 Ga0207700_10173757
1603 Ga0207664_10074820
1604 Ga0207644_10008708
1605 Ga0207644_10016784
1606 Ga0207644_10019197
1607 Ga0207644_10056176
1608 Ga0207644_10166652
1609 Ga0207644_10343256
1610 Ga0207690_10218661
1611 Ga0207690_10318446
1612 Ga0207706_10003430
1613 Ga0207706_10035405
1614 Ga0207706_10120305
1615 Ga0207706_10292287
1616 Ga0207686_10004769
1617 Ga0207686_10008188
1618 Ga0207686_10016272
1619 Ga0207686_10029065
1620 Ga0207686_10061342
1621 Ga0207686_10126848
1622 Ga0207686_10165973
1623 Ga0207709_10004525
1624 Ga0207670_10049855
1625 Ga0207670_10061713
1626 Ga0207670_10075151
1627 Ga0207670_10141835
1628 Ga0207670_10503345
1629 Ga0207669_10006700
1630 Ga0207669_10033329
1631 Ga0207669_10081019
1632 Ga0207669_10157109
1633 Ga0207704_10016685
1634 Ga0207704_10030085
1635 Ga0207665_10195912
1636 Ga0207691_10005955
1637 Ga0207691_10014125
1638 Ga0207691_10018285
1639 Ga0207691_10022035
1640 Ga0207691_10040814
1641 Ga0207691_10042225
1642 Ga0207691_10101431
1643 Ga0207691_10121296
1644 Ga0207711_10015241
1645 Ga0207711_10031188
1646 Ga0207711_10091911
1647 Ga0207711_10143320
1648 Ga0207711_10333391
1649 Ga0207711_10441453
1650 Ga0207689_10001150
1651 Ga0207689_10006771
1652 Ga0207689_10036026
1653 Ga0207689_10107789
1654 Ga0207689_10139385
1655 Ga0207689_10228734
1656 Ga0207689_10327463
1657 Ga0207661_10560609
1658 Ga0207679_10007928
1659 Ga0207679_10038592
1660 Ga0207679_10250139
1661 Ga0207651_10025462
1662 Ga0207651_10026093
1663 Ga0207651_10035443
1664 Ga0207651_10035886
1665 Ga0207651_10106394
1666 Ga0207651_10126298
1667 Ga0207651_10249470
1668 Ga0207712_10026445
1669 Ga0207712_10032026
1670 Ga0207712_10110672
1671 Ga0207668_10033423
1672 Ga0207668_10040853
1673 Ga0207668_10170471
1674 Ga0207668_10251476
1675 Ga0207668_10606864
1676 Ga0207658_10024322
1677 Ga0207658_10031977
1678 Ga0207658_10066995
1679 Ga0207658_10130857
1680 Ga0207658_10197418
1681 Ga0207658_10399250
1682 Ga0207677_10211051
1683 Ga0207703_10018127
1684 Ga0207703_10051427
1685 Ga0207703_10146904
1686 Ga0207678_10097732
1687 Ga0207678_10192969
1688 Ga0207678_10470735
1689 Ga0207708_10001418
1690 Ga0207708_10028691
1691 Ga0207708_10047021
1692 Ga0207708_10047142
1693 Ga0207708_10060383
1694 Ga0207708_10061172
1695 Ga0207708_10065373
1696 Ga0207708_10100204
1697 Ga0207641_10047483
1698 Ga0207641_10050626
1699 Ga0207641_10156783
1700 Ga0207641_10185372
1701 Ga0207641_10255975
1702 Ga0207641_10270155
1703 Ga0207648_10006501
1704 Ga0207648_10036800
1705 Ga0207648_10042478
1706 Ga0207648_10197628
1707 Ga0207648_10372549
1708 Ga0207676_10009849
1709 Ga0207676_10400280
1710 Ga0207676_10659067
1711 Ga0207674_10138078
1712 Ga0207674_10244786
1713 Ga0207675_100005749
1714 Ga0207675_100006207
1715 Ga0207675_100021171
1716 Ga0207675_100074064
1717 Ga0207675_100076455
1718 Ga0207675_100092619
1719 Ga0207675_100124087
1720 Ga0207675_100147926
1721 Ga0207675_100471280
1722 Ga0207675_100495031
1723 Ga0207683_10002309
1724 Ga0207683_10054319
1725 Ga0207683_10079431
1726 Ga0207683_10108733
1727 Ga0207683_10146013
1728 Ga0207683_10199460
1729 Ga0207698_10152385
1730 Ga0207698_10162123
1731 Ga0207698_10190832
1732 Ga0209983_1013224
1733 Ga0209971_1036655
1734 Ga0207428_10000004
1735 Ga0207428_10000864
1736 Ga0207428_10002617
1737 Ga0207428_10006374
1738 Ga0207428_10018190
1739 Ga0207428_10024144
1740 Ga0207428_10031001
1741 Ga0207428_10049035
1742 Ga0268266_10010915
1743 Ga0268266_10076012
1744 Ga0268266_10353092
1745 Ga0268265_10014309
1746 Ga0268265_10015569
1747 Ga0268265_10073159
1748 Ga0268265_10148428
1749 Ga0268265_10183171
1750 Ga0268265_10213502
1751 Ga0268265_10229600
1752 Ga0268264_10007779
1753 Ga0268264_10054839
1754 Ga0268264_10062989
1755 Ga0307408_100010451
1756 Ga0307408_100022297
1757 Ga0307408_100032094
1758 Ga0307408_100103484
1759 Ga0307408_100192871
1760 Ga0307408_100488893
1761 Ga0307408_100533116
1762 Ga0307405_10032566
1763 Ga0307405_10088877
1764 Ga0307405_10107996
1765 Ga0307405_10178799
1766 Ga0307405_10215258
1767 Ga0307413_10059939
1768 Ga0307410_10001023
1769 Ga0307410_10035954
1770 Ga0307410_10240947
1771 Ga0307410_10354659
1772 Ga0307406_10023635
1773 Ga0307406_10108912
1774 Ga0307407_10005601
1775 Ga0307407_10012830
1776 Ga0307407_10157060
1777 Ga0307407_10192302
1778 Ga0307407_10194208
1779 Ga0307409_100027104
1780 Ga0307409_100046491
1781 Ga0307409_100084611
1782 Ga0307409_100086384
1783 Ga0307409_100159706
1784 Ga0307409_100334618
1785 Ga0307409_100364461
1786 Ga0307409_100566130
1787 Ga0307416_100002617
1788 Ga0307416_100004324
1789 Ga0307416_100013492
1790 Ga0307416_100160452
1791 Ga0307416_100237426
1792 Ga0307416_100249198
1793 Ga0307416_100291271
1794 Ga0307414_10008759
1795 Ga0307414_10031673
1796 Ga0307414_10377767
1797 Ga0307411_10014926
1798 Ga0307411_10051758
1799 Ga0307411_10055025
1800 Ga0307411_10220961
1801 Ga0307411_10548133
1802 Ga0307415_100008949
1803 Ga0307415_100023002
1804 Ga0307415_100166597
1805 Ga0373930_0003255
1806 Ga0373948_0003137
1807 Ga0373958_0004608
1808 Ga0373959_0001235
1809 Ga0373938_0001273
1810 Ga0373928_0002304
1811 Ga0373929_0005265
1812 Ga0373949_0001113
1813 Ga0373951_0002359
1814 Ga0373952_0000406
1815 Ga0373932_0001419
1816 Ga0373932_0031609
1817 Ga0373939_0000596
1818 Ga0373941_0001790
1819 Ga0373960_0000967
1820 Ga0373943_0018367
1821 Ga0373946_0052790
1822 Ga0373955_0052537
1823 Ga0373942_0001095
1824 Ga0373961_0002928
1825 Ga0373962_0001237
1826 Ga0373962_0020776
1827 Ga0373931_0103804
1828 Ga0373947_0018984
1829 Ga0373937_0019618
1830 Ga0373925_0004437
1831 Ga0395900_0356830
1832 Ga0395901_0556495
1833 Ga0439453_0005028
1834 Ga0439461_0031331
1835 Ga0451853_4106301
1836 Ga0439431_0014668
1837 Ga0439431_0025348
1838 Ga0439433_0029109
1839 Ga0439441_010623
1840 Ga0439448_0054253
1841 Ga0450923_000398
1842 Ga0450923_024637
1843 Ga0450894_001887
1844 Ga0450896_001512
1845 Ga0450896_002478
1846 Ga0450908_004693
1847 Ga0439434_0049188
1848 Ga0439434_0088363
1849 Ga0439435_0007666
1850 Ga0439464_0030649
1851 Ga0451577_0057462
1852 Ga0439440_0013301
1853 Ga0439440_0042545
1854 Ga0466963_0104898
1855 Ga0453684_0165264
1856 Ga0451576_0010717
1857 Ga0451576_0576313
1858 Ga0466967_0232697
1859 Ga0466967_0318946
1860 Ga0466967_0572243
1861 Ga0495629_0036688
1862 Ga0495629_0171328
1863 Ga0495653_0133743
1864 Ga0495664_0127922
1865 Ga0495584_0013157
1866 Ga0495628_0119463
1867 Ga0495663_0004895
1868 Ga0495642_0039695
1869 Ga0495642_0084060
1870 Ga0495586_0007998
1871 Ga0495598_0072455
1872 Ga0495645_0007627
1873 Ga0495656_0074536
1874 Ga0495656_0115510
1875 Ga0495659_0011642
1876 Ga0495599_0151698
1877 Ga0495647_0063306
1878 Ga0495658_0010288
1879 Ga0495658_0026658
1880 Ga0495669_0084953
1881 Ga0495669_0086544
1882 Ga0495613_0251473
1883 Ga0495600_0117398
1884 Ga0495604_0237113
1885 Ga0495636_0017995
1886 Ga0495636_0083858
1887 Ga0495677_0008003
1888 Ga0495685_037491
1889 Ga0495684_0215712
1890 Ga0495593_0115845
1891 Ga0496100_0251882
1892 Ga0496101_0074961
1893 Ga0496101_0311834
1894 Ga0496101_0412717
1895 Ga0496102_0057138
1896 Ga0496104_0005233
1897 Ga0496104_0015062
1898 Ga0496104_0139227
1899 Ga0496106_0025834
1900 Ga0496106_0027282
1901 Ga0496106_0059960
1902 Ga0496106_0335151
1903 Ga0496107_0079886
1904 Ga0496107_0168516
1905 Ga0496108_0018375
1906 Ga0496108_0091012
1907 Ga0496108_0197394
1908 Ga0496108_0397099
1909 Ga0496109_0009063
1910 Ga0496109_0069911
1911 Ga0496109_0070963
1912 Ga0496109_0092585
1913 Ga0496109_0311005
1914 Ga0496109_0346085
1915 Ga0496110_0055936
1916 Ga0496112_0023492
1917 Ga0496112_0051260
1918 Ga0496112_0069036
1919 Ga0496112_0137813
1920 Ga0496112_0205729
1921 Ga0496114_0009075
1922 Ga0496114_0013501
1923 Ga0501034_0072072
1924 Ga0501036_0224126
1925 Ga0501036_0273088
1926 Ga0501042_0268846
1927 Ga0501046_0298948
1928 Ga0501047_0076643
1929 Ga0501048_0316248
1930 Ga0501048_0390038
1931 Ga0501067_0085818
1932 Ga0501072_0063718
1933 Ga0501072_0093520
1934 Ga0501072_0242898
1935 Ga0501072_0304802
1936 Ga0501074_0257790
1937 Ga0501075_0024456
1938 Ga0501075_0305052
1939 Ga0501076_0014348
1940 Ga0501076_0295308
1941 Ga0501198_018895
1942 Ga0501209_078719
1943 Ga0501079_0085667
1944 Ga0501080_0158022
1945 Ga0501080_0305595
1946 Ga0501080_0310609
1947 Ga0501045_0192449
1948 nmdc:mga03683_367_c1
1949 nmdc:mga0yw44_37053_c1
1950 nmdc:mga0k408_15798_c2
1951 nmdc:mga0k408_3204_c1
1952 nmdc:mga06z11_37090_c1
1953 nmdc:mga06z11_5106_c1
1954 nmdc:mga04h51_1638_c1
1955 nmdc:mga07m45_3284_c1
1956 nmdc:mga05p37_103885_c1
1957 nmdc:mga05p37_11013_c1
1958 nmdc:mga05p37_11953_c1
1959 nmdc:mga05p37_123749_c1
1960 nmdc:mga05p37_22313_c1
1961 nmdc:mga05p37_223574_c1
1962 nmdc:mga05p37_229311_c1
1963 nmdc:mga05p37_23609_c1
1964 nmdc:mga05p37_2382_c1
1965 nmdc:mga05p37_262566_c1
1966 nmdc:mga05p37_37138_c1
1967 nmdc:mga05p37_43348_c1
1968 nmdc:mga05p37_43622_c1
1969 nmdc:mga05p37_45079_c1
1970 nmdc:mga05p37_47253_c1
1971 nmdc:mga05p37_48294_c1
1972 nmdc:mga05p37_488484_c1
1973 nmdc:mga05p37_508512_c1
1974 nmdc:mga05p37_51465_c1
1975 nmdc:mga05p37_5466_c1
1976 nmdc:mga05p37_56435_c1
1977 nmdc:mga05p37_588905_c1
1978 nmdc:mga05p37_80691_c1
1979 nmdc:mga05p37_9128_c1
1980 nmdc:mga05p37_96154_c1
1981 nmdc:mga09592_101885_c1
1982 nmdc:mga09592_13865_c1
1983 nmdc:mga09592_152577_c1
1984 nmdc:mga09592_17305_c1
1985 nmdc:mga09592_236670_c1
1986 nmdc:mga09592_290190_c1
1987 nmdc:mga09592_31698_c1
1988 nmdc:mga09592_7395_c1
1989 nmdc:mga09592_9128_c1
1990 nmdc:mga0qj67_1218_c1
1991 nmdc:mga0qj67_149570_c1
1992 nmdc:mga0qj67_150624_c1
1993 nmdc:mga0qj67_21643_c1
1994 nmdc:mga0qj67_258_c1
1995 nmdc:mga0qj67_93293_c1
1996 nmdc:mga0qj67_94105_c1
1997 nmdc:mga06r32_110029_c1
1998 nmdc:mga06r32_135319_c1
1999 nmdc:mga06r32_1786_c1
2000 nmdc:mga06r32_259683_c1
2001 nmdc:mga06r32_28239_c1
2002 nmdc:mga06r32_3672_c1
2003 nmdc:mga06r32_372154_c1
2004 nmdc:mga06r32_50749_c1
2005 nmdc:mga06r32_618371_c1
2006 nmdc:mga06r32_63360_c1
2007 nmdc:mga06r32_63447_c1
2008 nmdc:mga06r32_67587_c1
2009 nmdc:mga08y16_123167_c1
2010 nmdc:mga08y16_19705_c1
2011 nmdc:mga08y16_20766_c1
2012 nmdc:mga08y16_24508_c1
2013 nmdc:mga08y16_2_c1
2014 nmdc:mga08y16_3088_c1
2015 nmdc:mga08y16_365827_c1
2016 nmdc:mga08y16_402066_c1
2017 nmdc:mga08y16_46004_c1
2018 nmdc:mga08y16_585354_c1
2019 nmdc:mga08y16_80229_c1
2020 nmdc:mga0n895_11099_c1
2021 nmdc:mga0n895_117311_c1
2022 nmdc:mga0n895_121_c1
2023 nmdc:mga0n895_179638_c1
2024 nmdc:mga0n895_21582_c1
2025 nmdc:mga0n895_220518_c1
2026 nmdc:mga0n895_411_c1
2027 nmdc:mga0n895_426415_c1
2028 nmdc:mga0n895_47268_c1
2029 nmdc:mga0n895_60891_c1
2030 nmdc:mga0n895_74201_c1
2031 nmdc:mga0n895_81179_c1
2032 nmdc:mga0n895_82209_c1
2033 nmdc:mga0n895_8256_c1
2034 nmdc:mga0rr50_107_c1
2035 nmdc:mga0rr50_123144_c1
2036 nmdc:mga0rr50_14528_c1
2037 nmdc:mga0rr50_31768_c1
2038 nmdc:mga0rr50_41621_c1
2039 nmdc:mga0rr50_5261_c1
2040 nmdc:mga0rr50_64845_c1
2041 nmdc:mga0rr50_698_c1
2042 nmdc:mga08x19_117723_c1
2043 nmdc:mga08x19_12888_c1
2044 nmdc:mga08x19_810_c1
2045 nmdc:mga0a205_104667_c1
2046 nmdc:mga0a205_1204_c2
2047 nmdc:mga0a205_19178_c1
2048 nmdc:mga0a205_193437_c1
2049 nmdc:mga0a205_236013_c1
2050 nmdc:mga0a205_24831_c1
2051 nmdc:mga0a205_26289_c1
2052 nmdc:mga0a205_4049_c1
2053 nmdc:mga0a205_4615_c1
2054 nmdc:mga0a205_54296_c1
2055 nmdc:mga0a205_550694_c1
2056 nmdc:mga0a205_67034_c1
2057 nmdc:mga0a205_69191_c1
2058 nmdc:mga0a205_72665_c1
2059 nmdc:mga0a205_900_c1
2060 nmdc:mga0a205_99777_c1
2061 Ga0495601_0066854
2062 Ga0495619_0046720
2063 Ga0495619_0127847
2064 Ga0495619_0312639
2065 Ga0501084_0070132
2066 Ga0590071_000149
2067 Ga0590071_000396
2068 Ga0590071_017316
2069 Ga0590074_000025
2070 Ga0590075_000328
2071 Ga0590075_000785
2072 Ga0590075_013183
2073 Ga0590077_000260
2074 Ga0590077_001423
2075 Ga0590077_004448
2076 Ga0501082_0079679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

191

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7416 147 264
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7154 147 264
5cdp-assembly1.cif.gz_A 2.45a structure of etoposide with s.aureus dna gyrase and dna 0.4427 112 252
6z1a-assembly1.cif.gz_B ternary complex of staphylococcus aureus dna gyrase with amk12 and dna 0.4386 113 252
5cdn-assembly2.cif.gz_R 2.8a structure of etoposide with s.aureus dna gyrase and dna 0.4189 112 249
ID Description Score Start End Superfamily
af_Q93483_1_234_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.4485 141 268 1.20.1270.60
af_I6XW38_19_102_1.10.268.10 Mainly Alpha;Orthogonal Bundle;Topoisomerase; domain 3;Topoisomerase, domain 3 0.4469 147 251 1.10.268.10
af_I6XW38_19_102_1.10.268.10 Mainly Alpha;Orthogonal Bundle;Topoisomerase; domain 3;Topoisomerase, domain 3 0.4231 147 251 1.10.268.10
3iqtA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.4225 129 240 1.20.120.160
af_Q9BIC4_29_113_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.4017 145 211 1.10.225.10
ID Description Score Start End GO Terms
AF-A0A4S0V8E1-F1-model_v4 Type II secretion system F family protein 0.9165 129 269 GO:0005886
AF-A0A2V8NTX0-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9086 135 299 GO:0005886
AF-A0A3C1YWP4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.906 77 258 GO:0005886
AF-A0A4S0V8E1-F1-model_v4 Type II secretion system F family protein 0.8982 129 269 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.885 133 271 GO:0005886

Map