F488752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 511 | 968 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300053133|Ga0500655_028009|Ga0500655_028009_422_1060 |
| Length | 169 |
| Sequence | LAAAFGQGAGRLARVKLLLVAVGQRQPAWAETAYDDFAKRFPPEMRLELKAVKAETRGSRTAEQMMAAEAARIEAALPKGVRRVVLDERGDRLTSVQLAARMKAWLPDGRDVAFVIGGPDGLDAGLKRSADETMRLSDLTLPHAFARVLLAEALYRAWTLTVNHPYHRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 11 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 12 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 13 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 14 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 15 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 18 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 19 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 20 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 21 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 22 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 23 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 24 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 25 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 26 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 27 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 28 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 29 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 30 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 31 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 32 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 33 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 34 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 35 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 36 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 37 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 38 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 39 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 40 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 41 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 42 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 43 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 44 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 45 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 46 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 47 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 48 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 49 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 50 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 51 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 52 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 53 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 54 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 55 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 56 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 57 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 58 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 59 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 60 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 61 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 62 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 63 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 64 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 65 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 66 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 67 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 68 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 69 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 72 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 73 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 74 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 75 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 76 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 77 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 78 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 79 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 80 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 81 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 82 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 83 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 103 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 107 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 124 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 129 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 137 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 138 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 139 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 140 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 141 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 142 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 143 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 144 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 145 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 146 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 147 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 148 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 149 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 150 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 151 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 152 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 153 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 154 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 156 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 157 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 158 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 160 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 161 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 185 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 269 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 273 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 274 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 275 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 276 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 277 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 278 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 279 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 280 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 281 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 286 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 287 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 290 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 292 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 293 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 294 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 295 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 296 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 297 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 298 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 299 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 300 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 301 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 302 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 303 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 304 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 307 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 309 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 311 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 313 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 316 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 317 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 318 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 319 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 320 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 321 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 322 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 323 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 324 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 325 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 326 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 327 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 328 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 332 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 333 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 334 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 335 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 336 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 337 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 338 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 339 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 340 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 341 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 342 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 343 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 344 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 345 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 346 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 347 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 348 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 349 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 350 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 351 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 352 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 353 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 354 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 355 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 356 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 357 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 358 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 359 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 360 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 361 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 362 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 363 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 364 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 365 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 366 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 367 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 368 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 369 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 370 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 371 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 372 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 373 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 374 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 375 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 376 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 377 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 378 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 379 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 380 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 381 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 382 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 383 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 384 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 385 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 386 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 387 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 388 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 389 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 443 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 444 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 445 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 446 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 454 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 460 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 461 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 476 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 477 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 478 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 487 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 491 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 492 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 504 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 505 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 508 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 510 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 511 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 0.58 |
| Isolates | 6.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.69 |
| Nodule | 0.68 |
| Rhizoplane | 2.31 |
| Rhizosphere | 60.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001987 | 3300001979 | Bacteria | 9350 |
| 2 | JGI24740J21852_10022496 | 3300001979 | Bacteria | 2169 |
| 3 | JGI24739J22299_10064426 | 3300001989 | Bacteria | 1152 |
| 4 | JGI25152J39213_1003563 | 3300002773 | Bacteria | 5269 |
| 5 | JGI25152J39213_1004322 | 3300002773 | Bacteria | 4519 |
| 6 | JGI25150J39212_1000611 | 3300002774 | Bacteria | 13763 |
| 7 | JGI25159J45721_1004613 | 3300002987 | Bacteria | 4520 |
| 8 | JGI25159J45721_1005744 | 3300002987 | Bacteria | 3840 |
| 9 | JGI25151J46595_10001037 | 3300003187 | Bacteria | 20781 |
| 10 | JGI25151J46595_10002554 | 3300003187 | Bacteria | 10797 |
| 11 | JGI25151J46595_10009062 | 3300003187 | Bacteria | 4742 |
| 12 | JGI25151J46595_10042257 | 3300003187 | Bacteria | 1644 |
| 13 | JGI25153J46596_10005629 | 3300003215 | Bacteria | 6547 |
| 14 | JGI25153J46596_10008890 | 3300003215 | Bacteria | 4742 |
| 15 | JGI25153J46596_10016584 | 3300003215 | Bacteria | 2941 |
| 16 | JGI25153J46596_10034724 | 3300003215 | Bacteria | 1644 |
| 17 | rootH1_10053737 | 3300003316 | Bacteria | 2438 |
| 18 | rootH2_10216731 | 3300003320 | Bacteria | 1662 |
| 19 | rootL2_10006742 | 3300003322 | Bacteria | 1816 |
| 20 | rootL2_10326548 | 3300003322 | Bacteria | 1322 |
| 21 | rootH1_10008734 | 3300003323 | Bacteria | 3606 |
| 22 | JGI25160J50197_1008977 | 3300003354 | Bacteria | 3752 |
| 23 | JGI25161J50226_1003069 | 3300003374 | Bacteria | 3993 |
| 24 | Ga0006562J51391_1072998 | 3300003578 | Bacteria | 5510 |
| 25 | Ga0006562J51391_1072999 | 3300003578 | Bacteria | 4080 |
| 26 | Ga0006562J51391_1109357 | 3300003578 | Bacteria | 4810 |
| 27 | Ga0006562J51391_1109361 | 3300003578 | Bacteria | 3100 |
| 28 | Ga0055527_1008925 | 3300003760 | Bacteria | 1187 |
| 29 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 30 | Ga0055526_1005340 | 3300003771 | Bacteria | 7422 |
| 31 | Ga0055526_1009890 | 3300003771 | Bacteria | 4520 |
| 32 | Ga0055526_1009910 | 3300003771 | Bacteria | 4514 |
| 33 | Ga0055537_1000296 | 3300003773 | Bacteria | 35117 |
| 34 | Ga0055537_1003601 | 3300003773 | Bacteria | 4718 |
| 35 | Ga0055537_1004830 | 3300003773 | Bacteria | 3746 |
| 36 | Ga0055524_1000302 | 3300003775 | Bacteria | 47410 |
| 37 | Ga0055524_1005397 | 3300003775 | Bacteria | 5716 |
| 38 | Ga0055524_1007817 | 3300003775 | Bacteria | 4507 |
| 39 | Ga0055536_1002464 | 3300003781 | Bacteria | 10393 |
| 40 | Ga0055536_1025110 | 3300003781 | Bacteria | 1707 |
| 41 | Ga0055536_1035294 | 3300003781 | Bacteria | 1253 |
| 42 | Ga0055534_1000092 | 3300003784 | Bacteria | 70082 |
| 43 | Ga0055534_1000506 | 3300003784 | Bacteria | 21227 |
| 44 | Ga0055534_1003706 | 3300003784 | Bacteria | 4718 |
| 45 | Ga0055534_1003774 | 3300003784 | Bacteria | 4660 |
| 46 | Ga0055528_1000190 | 3300003790 | Bacteria | 52365 |
| 47 | Ga0055528_1007713 | 3300003790 | Bacteria | 4718 |
| 48 | Ga0055528_1011213 | 3300003790 | Bacteria | 3580 |
| 49 | Ga0055530_10000214 | 3300003791 | Bacteria | 52165 |
| 50 | Ga0055530_10046040 | 3300003791 | Bacteria | 1038 |
| 51 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 52 | Ga0055540_1000035 | 3300003792 | Bacteria | 166843 |
| 53 | Ga0055540_1006272 | 3300003792 | Bacteria | 4758 |
| 54 | Ga0055540_1010662 | 3300003792 | Bacteria | 3037 |
| 55 | Ga0055531_10000317 | 3300003794 | Bacteria | 47389 |
| 56 | Ga0055531_10000612 | 3300003794 | Bacteria | 30958 |
| 57 | Ga0055531_10010027 | 3300003794 | Bacteria | 4764 |
| 58 | Ga0055531_10010039 | 3300003794 | Bacteria | 4758 |
| 59 | Ga0055531_10013011 | 3300003794 | Bacteria | 3869 |
| 60 | Ga0055543_1003575 | 3300004625 | Bacteria | 4503 |
| 61 | Ga0055543_1005529 | 3300004625 | Bacteria | 3207 |
| 62 | Ga0065165_1001409 | 3300005262 | Bacteria | 26197 |
| 63 | Ga0065165_1006920 | 3300005262 | Bacteria | 5754 |
| 64 | Ga0065165_1019442 | 3300005262 | Bacteria | 2425 |
| 65 | Ga0065165_1021156 | 3300005262 | Bacteria | 2267 |
| 66 | Ga0065714_10071185 | 3300005288 | Bacteria | 3641 |
| 67 | Ga0065714_10162009 | 3300005288 | Bacteria | 1047 |
| 68 | Ga0070658_10153664 | 3300005327 | Bacteria | 1928 |
| 69 | Ga0070676_10041207 | 3300005328 | Bacteria | 2677 |
| 70 | Ga0070676_10245308 | 3300005328 | Bacteria | 1193 |
| 71 | Ga0070690_100004296 | 3300005330 | Bacteria | 7896 |
| 72 | Ga0070670_100425081 | 3300005331 | Bacteria | 1175 |
| 73 | Ga0070670_100500835 | 3300005331 | Bacteria | 1080 |
| 74 | Ga0070670_100522989 | 3300005331 | Bacteria | 1056 |
| 75 | Ga0070677_10274327 | 3300005333 | Bacteria | 847 |
| 76 | Ga0068869_100028112 | 3300005334 | Bacteria | 3926 |
| 77 | Ga0068869_100324339 | 3300005334 | Bacteria | 1250 |
| 78 | Ga0070666_10002227 | 3300005335 | Bacteria | 11730 |
| 79 | Ga0070680_100180066 | 3300005336 | Bacteria | 1780 |
| 80 | Ga0070682_100051931 | 3300005337 | Bacteria | 2564 |
| 81 | Ga0068868_100000526 | 3300005338 | Bacteria | 25605 |
| 82 | Ga0068868_100203916 | 3300005338 | Bacteria | 1650 |
| 83 | Ga0068868_100349216 | 3300005338 | Bacteria | 1266 |
| 84 | Ga0070660_100106598 | 3300005339 | Bacteria | 2226 |
| 85 | Ga0070689_100268559 | 3300005340 | Bacteria | 1412 |
| 86 | Ga0070668_100077914 | 3300005347 | Bacteria | 2591 |
| 87 | Ga0070669_100012794 | 3300005353 | Bacteria | 5958 |
| 88 | Ga0070669_100150344 | 3300005353 | Bacteria | 1802 |
| 89 | Ga0070669_100366576 | 3300005353 | Bacteria | 1172 |
| 90 | Ga0070675_100001257 | 3300005354 | Bacteria | 18531 |
| 91 | Ga0070675_100907041 | 3300005354 | Bacteria | 808 |
| 92 | Ga0070671_100125518 | 3300005355 | Bacteria | 2160 |
| 93 | Ga0070671_100305998 | 3300005355 | Bacteria | 1353 |
| 94 | Ga0070671_100375628 | 3300005355 | Bacteria | 1214 |
| 95 | Ga0070671_100827308 | 3300005355 | Bacteria | 807 |
| 96 | Ga0070674_100349044 | 3300005356 | Bacteria | 1194 |
| 97 | Ga0070674_100532809 | 3300005356 | Bacteria | 983 |
| 98 | Ga0070673_100003204 | 3300005364 | Bacteria | 10140 |
| 99 | Ga0070673_100258085 | 3300005364 | Bacteria | 1521 |
| 100 | Ga0070673_100767072 | 3300005364 | Bacteria | 889 |
| 101 | Ga0070673_100778093 | 3300005364 | Bacteria | 883 |
| 102 | Ga0070688_100077097 | 3300005365 | Bacteria | 2147 |
| 103 | Ga0070688_100471911 | 3300005365 | Bacteria | 942 |
| 104 | Ga0070659_100000481 | 3300005366 | Bacteria | 29333 |
| 105 | Ga0070659_101011499 | 3300005366 | Bacteria | 730 |
| 106 | Ga0070667_100080720 | 3300005367 | Bacteria | 2782 |
| 107 | Ga0070700_100327988 | 3300005441 | Bacteria | 1127 |
| 108 | Ga0070663_100163635 | 3300005455 | Bacteria | 1714 |
| 109 | Ga0070663_100199411 | 3300005455 | Bacteria | 1561 |
| 110 | Ga0070663_100227984 | 3300005455 | Bacteria | 1466 |
| 111 | Ga0070663_100374548 | 3300005455 | Bacteria | 1158 |
| 112 | Ga0070663_101122346 | 3300005455 | Bacteria | 688 |
| 113 | Ga0070678_100025493 | 3300005456 | Bacteria | 3979 |
| 114 | Ga0070678_100113725 | 3300005456 | Bacteria | 2122 |
| 115 | Ga0070678_100224620 | 3300005456 | Bacteria | 1562 |
| 116 | Ga0070678_101879349 | 3300005456 | Bacteria | 565 |
| 117 | Ga0070662_100031047 | 3300005457 | Bacteria | 3746 |
| 118 | Ga0070662_100046139 | 3300005457 | Bacteria | 3130 |
| 119 | Ga0070662_100116974 | 3300005457 | Bacteria | 2038 |
| 120 | Ga0070662_100174632 | 3300005457 | Bacteria | 1690 |
| 121 | Ga0070662_100176844 | 3300005457 | Bacteria | 1680 |
| 122 | Ga0070662_100436768 | 3300005457 | Bacteria | 1085 |
| 123 | Ga0070681_10361019 | 3300005458 | Bacteria | 1363 |
| 124 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 125 | Ga0068867_100062751 | 3300005459 | Bacteria | 2761 |
| 126 | Ga0068867_100097766 | 3300005459 | Bacteria | 2237 |
| 127 | Ga0068867_100112722 | 3300005459 | Bacteria | 2091 |
| 128 | Ga0068867_101148495 | 3300005459 | Bacteria | 711 |
| 129 | Ga0070685_10250691 | 3300005466 | Bacteria | 1173 |
| 130 | Ga0070706_100001719 | 3300005467 | Bacteria | 22759 |
| 131 | Ga0070707_101368383 | 3300005468 | Bacteria | 674 |
| 132 | Ga0070679_100064787 | 3300005530 | Bacteria | 3642 |
| 133 | Ga0070679_100094911 | 3300005530 | Bacteria | 2970 |
| 134 | Ga0068853_100051725 | 3300005539 | Bacteria | 3537 |
| 135 | Ga0068853_100240813 | 3300005539 | Bacteria | 1658 |
| 136 | Ga0068853_100376107 | 3300005539 | Bacteria | 1326 |
| 137 | Ga0070672_100108731 | 3300005543 | Bacteria | 2258 |
| 138 | Ga0070672_100276294 | 3300005543 | Bacteria | 1419 |
| 139 | Ga0070672_100639082 | 3300005543 | Bacteria | 929 |
| 140 | Ga0070672_101355628 | 3300005543 | Bacteria | 636 |
| 141 | Ga0070665_100557805 | 3300005548 | Bacteria | 1158 |
| 142 | Ga0070704_100621411 | 3300005549 | Bacteria | 951 |
| 143 | Ga0068855_100014182 | 3300005563 | Bacteria | 9602 |
| 144 | Ga0068855_100025134 | 3300005563 | Bacteria | 7130 |
| 145 | Ga0068855_100813039 | 3300005563 | Bacteria | 993 |
| 146 | Ga0070664_100118860 | 3300005564 | Bacteria | 2312 |
| 147 | Ga0070664_100556684 | 3300005564 | Bacteria | 1061 |
| 148 | Ga0070664_100561635 | 3300005564 | Bacteria | 1056 |
| 149 | Ga0068857_100596251 | 3300005577 | Bacteria | 1044 |
| 150 | Ga0068854_100183933 | 3300005578 | Bacteria | 1634 |
| 151 | Ga0068854_100483848 | 3300005578 | Bacteria | 1040 |
| 152 | Ga0068854_100518381 | 3300005578 | Bacteria | 1006 |
| 153 | Ga0068854_100635519 | 3300005578 | Bacteria | 915 |
| 154 | Ga0068856_100036361 | 3300005614 | Bacteria | 4829 |
| 155 | Ga0068856_100341872 | 3300005614 | Bacteria | 1515 |
| 156 | Ga0068852_100002367 | 3300005616 | Bacteria | 12987 |
| 157 | Ga0068852_100123976 | 3300005616 | Bacteria | 2370 |
| 158 | Ga0068852_100383670 | 3300005616 | Bacteria | 1379 |
| 159 | Ga0068852_101481327 | 3300005616 | Bacteria | 701 |
| 160 | Ga0068859_100010093 | 3300005617 | Bacteria | 9518 |
| 161 | Ga0068859_100923527 | 3300005617 | Bacteria | 957 |
| 162 | Ga0068864_100000511 | 3300005618 | Bacteria | 33486 |
| 163 | Ga0068861_100144813 | 3300005719 | Bacteria | 1943 |
| 164 | Ga0068861_101090679 | 3300005719 | Bacteria | 767 |
| 165 | Ga0068851_10004317 | 3300005834 | Bacteria | 6400 |
| 166 | Ga0068851_10037551 | 3300005834 | Bacteria | 2429 |
| 167 | Ga0068870_10450785 | 3300005840 | Bacteria | 848 |
| 168 | Ga0068863_100007397 | 3300005841 | Bacteria | 10748 |
| 169 | Ga0068858_100000359 | 3300005842 | Bacteria | 48114 |
| 170 | Ga0068860_100072237 | 3300005843 | Bacteria | 3279 |
| 171 | Ga0075365_10013252 | 3300006038 | Bacteria | 4920 |
| 172 | Ga0075365_10915880 | 3300006038 | Bacteria | 618 |
| 173 | Ga0075363_100070021 | 3300006048 | Bacteria | 1904 |
| 174 | Ga0075363_100084488 | 3300006048 | Bacteria | 1740 |
| 175 | Ga0075363_100171471 | 3300006048 | Bacteria | 1232 |
| 176 | Ga0075364_10054684 | 3300006051 | Bacteria | 2611 |
| 177 | Ga0075364_10238777 | 3300006051 | Bacteria | 1234 |
| 178 | Ga0075364_10271956 | 3300006051 | Bacteria | 1152 |
| 179 | Ga0075432_10008843 | 3300006058 | Bacteria | 3437 |
| 180 | Ga0075432_10024139 | 3300006058 | Bacteria | 2083 |
| 181 | Ga0075362_10003584 | 3300006177 | Bacteria | 5455 |
| 182 | Ga0075362_10039489 | 3300006177 | Bacteria | 2075 |
| 183 | Ga0075362_10131550 | 3300006177 | Bacteria | 1191 |
| 184 | Ga0075362_10317351 | 3300006177 | Bacteria | 776 |
| 185 | Ga0075367_10147513 | 3300006178 | Bacteria | 1459 |
| 186 | Ga0075367_10362599 | 3300006178 | Bacteria | 915 |
| 187 | Ga0075369_10032362 | 3300006186 | Bacteria | 2212 |
| 188 | Ga0075369_10199483 | 3300006186 | Bacteria | 923 |
| 189 | Ga0075366_10002649 | 3300006195 | Bacteria | 9220 |
| 190 | Ga0075366_10006970 | 3300006195 | Bacteria | 6223 |
| 191 | Ga0075366_10009720 | 3300006195 | Bacteria | 5377 |
| 192 | Ga0075366_10013620 | 3300006195 | Bacteria | 4635 |
| 193 | Ga0075366_10033567 | 3300006195 | Bacteria | 3023 |
| 194 | Ga0075366_10145745 | 3300006195 | Bacteria | 1433 |
| 195 | Ga0075366_10172756 | 3300006195 | Bacteria | 1311 |
| 196 | Ga0075366_10623891 | 3300006195 | Bacteria | 669 |
| 197 | Ga0097621_100057282 | 3300006237 | Bacteria | 3186 |
| 198 | Ga0097621_100831982 | 3300006237 | Bacteria | 857 |
| 199 | Ga0075370_10000556 | 3300006353 | Bacteria | 14286 |
| 200 | Ga0075370_10014562 | 3300006353 | Bacteria | 4198 |
| 201 | Ga0075370_10016632 | 3300006353 | Bacteria | 3959 |
| 202 | Ga0075370_10022291 | 3300006353 | Bacteria | 3477 |
| 203 | Ga0075370_10023906 | 3300006353 | Bacteria | 3370 |
| 204 | Ga0075370_10034046 | 3300006353 | Bacteria | 2855 |
| 205 | Ga0075370_10048286 | 3300006353 | Bacteria | 2411 |
| 206 | Ga0075370_10183655 | 3300006353 | Bacteria | 1231 |
| 207 | Ga0075370_10351501 | 3300006353 | Bacteria | 881 |
| 208 | Ga0068871_100064447 | 3300006358 | Bacteria | 3000 |
| 209 | Ga0068865_100087270 | 3300006881 | Bacteria | 2254 |
| 210 | Ga0068865_100209277 | 3300006881 | Bacteria | 1518 |
| 211 | Ga0068865_100409664 | 3300006881 | Bacteria | 1112 |
| 212 | Ga0097620_100010093 | 3300006931 | Bacteria | 9518 |
| 213 | Ga0097620_100923533 | 3300006931 | Bacteria | 957 |
| 214 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 215 | Ga0099826_10000115 | 3300006948 | Bacteria | 36769 |
| 216 | Ga0099826_10159610 | 3300006948 | Bacteria | 1279 |
| 217 | Ga0105250_10034781 | 3300009092 | Bacteria | 2021 |
| 218 | Ga0105240_10003642 | 3300009093 | Bacteria | 23871 |
| 219 | Ga0105240_10625342 | 3300009093 | Bacteria | 1183 |
| 220 | Ga0111539_12743599 | 3300009094 | Bacteria | 571 |
| 221 | Ga0105245_10008806 | 3300009098 | Bacteria | 8802 |
| 222 | Ga0105245_10251226 | 3300009098 | Bacteria | 1718 |
| 223 | Ga0105245_10668587 | 3300009098 | Bacteria | 1070 |
| 224 | Ga0105245_11621319 | 3300009098 | Bacteria | 699 |
| 225 | Ga0105243_10000515 | 3300009148 | Bacteria | 39435 |
| 226 | Ga0105243_10001515 | 3300009148 | Bacteria | 20296 |
| 227 | Ga0105243_10003542 | 3300009148 | Bacteria | 12617 |
| 228 | Ga0105243_10132451 | 3300009148 | Bacteria | 2117 |
| 229 | Ga0105243_10134204 | 3300009148 | Bacteria | 2104 |
| 230 | Ga0105243_10340324 | 3300009148 | Bacteria | 1374 |
| 231 | Ga0105243_10427224 | 3300009148 | Bacteria | 1237 |
| 232 | Ga0105241_10143886 | 3300009174 | Bacteria | 1944 |
| 233 | Ga0105242_10004129 | 3300009176 | Bacteria | 11304 |
| 234 | Ga0105242_10908655 | 3300009176 | Bacteria | 881 |
| 235 | Ga0105248_10161343 | 3300009177 | Bacteria | 2528 |
| 236 | Ga0105248_10531646 | 3300009177 | Bacteria | 1326 |
| 237 | Ga0105237_10034393 | 3300009545 | Bacteria | 5132 |
| 238 | Ga0105237_10037398 | 3300009545 | Bacteria | 4906 |
| 239 | Ga0105238_10006811 | 3300009551 | Bacteria | 11412 |
| 240 | Ga0105238_10027040 | 3300009551 | Bacteria | 5847 |
| 241 | Ga0105238_11315528 | 3300009551 | Bacteria | 749 |
| 242 | Ga0105249_10467555 | 3300009553 | Bacteria | 1302 |
| 243 | Ga0105239_10216054 | 3300010375 | Bacteria | 2150 |
| 244 | Ga0105239_11519189 | 3300010375 | Bacteria | 774 |
| 245 | Ga0105246_10131195 | 3300011119 | Bacteria | 1872 |
| 246 | Ga0157373_10029757 | 3300013100 | Bacteria | 3931 |
| 247 | Ga0157371_10133807 | 3300013102 | Bacteria | 1765 |
| 248 | Ga0157370_10065472 | 3300013104 | Bacteria | 3438 |
| 249 | Ga0157369_10043021 | 3300013105 | Bacteria | 4925 |
| 250 | Ga0157378_10528330 | 3300013297 | Bacteria | 1182 |
| 251 | Ga0157378_11042396 | 3300013297 | Bacteria | 853 |
| 252 | Ga0163162_10123599 | 3300013306 | Bacteria | 2693 |
| 253 | Ga0163162_10239243 | 3300013306 | Bacteria | 1946 |
| 254 | Ga0163162_10284627 | 3300013306 | Bacteria | 1785 |
| 255 | Ga0163162_10973410 | 3300013306 | Bacteria | 959 |
| 256 | Ga0157372_10806654 | 3300013307 | Bacteria | 1090 |
| 257 | Ga0157375_10169716 | 3300013308 | Bacteria | 2329 |
| 258 | Ga0157375_11715030 | 3300013308 | Bacteria | 744 |
| 259 | Ga0163163_10010941 | 3300014325 | Bacteria | 8198 |
| 260 | Ga0163163_12441689 | 3300014325 | Bacteria | 581 |
| 261 | Ga0157380_10119485 | 3300014326 | Bacteria | 2230 |
| 262 | Ga0157380_10283257 | 3300014326 | Bacteria | 1518 |
| 263 | Ga0157380_10948435 | 3300014326 | Bacteria | 890 |
| 264 | Ga0157380_10961539 | 3300014326 | Bacteria | 885 |
| 265 | Ga0182008_10009236 | 3300014497 | Bacteria | 5331 |
| 266 | Ga0182008_10011067 | 3300014497 | Bacteria | 4812 |
| 267 | Ga0182008_10057326 | 3300014497 | Bacteria | 1923 |
| 268 | Ga0182008_10122108 | 3300014497 | Bacteria | 1295 |
| 269 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 270 | Ga0157377_10138874 | 3300014745 | Bacteria | 1491 |
| 271 | Ga0157379_10092454 | 3300014968 | Bacteria | 2714 |
| 272 | Ga0157379_10523405 | 3300014968 | Bacteria | 1101 |
| 273 | Ga0157376_10145094 | 3300014969 | Bacteria | 2134 |
| 274 | Ga0157376_10796496 | 3300014969 | Bacteria | 957 |
| 275 | Ga0182007_10000472 | 3300015262 | Bacteria | 24301 |
| 276 | Ga0182007_10053924 | 3300015262 | Bacteria | 1323 |
| 277 | Ga0182005_1042245 | 3300015265 | Bacteria | 1239 |
| 278 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 279 | Ga0163161_10001036 | 3300017792 | Bacteria | 21172 |
| 280 | Ga0163161_10031016 | 3300017792 | Bacteria | 3807 |
| 281 | Ga0163161_10051910 | 3300017792 | Bacteria | 2972 |
| 282 | Ga0163161_10503808 | 3300017792 | Bacteria | 986 |
| 283 | Ga0209436_108139 | 3300025208 | Bacteria | 2120 |
| 284 | Ga0209672_101250 | 3300025228 | Bacteria | 10173 |
| 285 | Ga0209147_102210 | 3300025229 | Bacteria | 5234 |
| 286 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 287 | Ga0207425_1000239 | 3300025245 | Bacteria | 42732 |
| 288 | Ga0207425_1001642 | 3300025245 | Bacteria | 9004 |
| 289 | Ga0207425_1004428 | 3300025245 | Bacteria | 4215 |
| 290 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 291 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 292 | Ga0209129_1000144 | 3300025258 | Bacteria | 115999 |
| 293 | Ga0209129_1001130 | 3300025258 | Bacteria | 15446 |
| 294 | Ga0209129_1004500 | 3300025258 | Bacteria | 5411 |
| 295 | Ga0209565_1000073 | 3300025263 | Bacteria | 164695 |
| 296 | Ga0209565_1000199 | 3300025263 | Bacteria | 71613 |
| 297 | Ga0209565_1003122 | 3300025263 | Bacteria | 5556 |
| 298 | Ga0209673_1000127 | 3300025273 | Bacteria | 164695 |
| 299 | Ga0209673_1000128 | 3300025273 | Bacteria | 164482 |
| 300 | Ga0209673_1001078 | 3300025273 | Bacteria | 30774 |
| 301 | Ga0209673_1001619 | 3300025273 | Bacteria | 19616 |
| 302 | Ga0209673_1003135 | 3300025273 | Bacteria | 10101 |
| 303 | Ga0209673_1013295 | 3300025273 | Bacteria | 3256 |
| 304 | Ga0209130_1000471 | 3300025284 | Bacteria | 41439 |
| 305 | Ga0209130_1000898 | 3300025284 | Bacteria | 24052 |
| 306 | Ga0209130_1000914 | 3300025284 | Bacteria | 23751 |
| 307 | Ga0209130_1002188 | 3300025284 | Bacteria | 10305 |
| 308 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 309 | Ga0209675_1000114 | 3300025291 | Bacteria | 112118 |
| 310 | Ga0209675_1000723 | 3300025291 | Bacteria | 22450 |
| 311 | Ga0209675_1000976 | 3300025291 | Bacteria | 18068 |
| 312 | Ga0209675_1002630 | 3300025291 | Bacteria | 9079 |
| 313 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 314 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 315 | Ga0209676_1002710 | 3300025292 | Bacteria | 11948 |
| 316 | Ga0209676_1003298 | 3300025292 | Bacteria | 10107 |
| 317 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 318 | Ga0209025_1000248 | 3300025294 | Bacteria | 126818 |
| 319 | Ga0209025_1000491 | 3300025294 | Bacteria | 75913 |
| 320 | Ga0209025_1006463 | 3300025294 | Bacteria | 9087 |
| 321 | Ga0209025_1026508 | 3300025294 | Bacteria | 2907 |
| 322 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 323 | Ga0209564_1000360 | 3300025295 | Bacteria | 84454 |
| 324 | Ga0209564_1001537 | 3300025295 | Bacteria | 22864 |
| 325 | Ga0209564_1042300 | 3300025295 | Bacteria | 1211 |
| 326 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 327 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 328 | Ga0209758_1000434 | 3300025297 | Bacteria | 70561 |
| 329 | Ga0209050_1000197 | 3300025298 | Bacteria | 135303 |
| 330 | Ga0209050_1000433 | 3300025298 | Bacteria | 76499 |
| 331 | Ga0209050_1000488 | 3300025298 | Bacteria | 68812 |
| 332 | Ga0209050_1007621 | 3300025298 | Bacteria | 6010 |
| 333 | Ga0209050_1007861 | 3300025298 | Bacteria | 5856 |
| 334 | Ga0209050_1011027 | 3300025298 | Bacteria | 4355 |
| 335 | Ga0209050_1042750 | 3300025298 | Bacteria | 1233 |
| 336 | Ga0209050_1042975 | 3300025298 | Bacteria | 1227 |
| 337 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 338 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 339 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 340 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 341 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 342 | Ga0207426_1001556 | 3300025302 | Bacteria | 18611 |
| 343 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 344 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 345 | Ga0209051_1000542 | 3300025303 | Bacteria | 46577 |
| 346 | Ga0209051_1001159 | 3300025303 | Bacteria | 23972 |
| 347 | Ga0209051_1002010 | 3300025303 | Bacteria | 15519 |
| 348 | Ga0209051_1004650 | 3300025303 | Bacteria | 8360 |
| 349 | Ga0209051_1007504 | 3300025303 | Bacteria | 5950 |
| 350 | Ga0209051_1023776 | 3300025303 | Bacteria | 2539 |
| 351 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 352 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 353 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 354 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 355 | Ga0209257_1006647 | 3300025304 | Bacteria | 7347 |
| 356 | Ga0209257_1007736 | 3300025304 | Bacteria | 6401 |
| 357 | Ga0207656_10052949 | 3300025321 | Bacteria | 1759 |
| 358 | Ga0207656_10060956 | 3300025321 | Bacteria | 1655 |
| 359 | Ga0207696_1036136 | 3300025711 | Bacteria | 1467 |
| 360 | Ga0207682_10075079 | 3300025893 | Bacteria | 1438 |
| 361 | Ga0207682_10167125 | 3300025893 | Bacteria | 999 |
| 362 | Ga0207680_10005639 | 3300025903 | Bacteria | 5989 |
| 363 | Ga0207680_10263764 | 3300025903 | Bacteria | 1193 |
| 364 | Ga0207645_10018276 | 3300025907 | Bacteria | 4617 |
| 365 | Ga0207645_10035636 | 3300025907 | Bacteria | 3194 |
| 366 | Ga0207645_10100201 | 3300025907 | Bacteria | 1869 |
| 367 | Ga0207645_10532092 | 3300025907 | Bacteria | 797 |
| 368 | Ga0207705_10141578 | 3300025909 | Bacteria | 1797 |
| 369 | Ga0207684_10001654 | 3300025910 | Bacteria | 23687 |
| 370 | Ga0207654_10111296 | 3300025911 | Bacteria | 1704 |
| 371 | Ga0207707_10310318 | 3300025912 | Bacteria | 1363 |
| 372 | Ga0207695_10347517 | 3300025913 | Bacteria | 1371 |
| 373 | Ga0207695_11112823 | 3300025913 | Bacteria | 670 |
| 374 | Ga0207671_10071283 | 3300025914 | Bacteria | 2592 |
| 375 | Ga0207671_11036626 | 3300025914 | Bacteria | 646 |
| 376 | Ga0207660_10138485 | 3300025917 | Bacteria | 1859 |
| 377 | Ga0207657_10016829 | 3300025919 | Bacteria | 7039 |
| 378 | Ga0207657_10625583 | 3300025919 | Bacteria | 839 |
| 379 | Ga0207657_11079679 | 3300025919 | Bacteria | 614 |
| 380 | Ga0207649_10006892 | 3300025920 | Bacteria | 6174 |
| 381 | Ga0207649_11137242 | 3300025920 | Bacteria | 616 |
| 382 | Ga0207652_10032924 | 3300025921 | Bacteria | 4362 |
| 383 | Ga0207646_10085820 | 3300025922 | Bacteria | 2816 |
| 384 | Ga0207681_10343261 | 3300025923 | Bacteria | 1193 |
| 385 | Ga0207681_10603020 | 3300025923 | Bacteria | 907 |
| 386 | Ga0207694_10043334 | 3300025924 | Bacteria | 3473 |
| 387 | Ga0207694_10103673 | 3300025924 | Bacteria | 2256 |
| 388 | Ga0207694_11257370 | 3300025924 | Bacteria | 626 |
| 389 | Ga0207650_10356242 | 3300025925 | Bacteria | 1205 |
| 390 | Ga0207650_10565955 | 3300025925 | Bacteria | 954 |
| 391 | Ga0207650_10948396 | 3300025925 | Bacteria | 731 |
| 392 | Ga0207659_10003030 | 3300025926 | Bacteria | 10024 |
| 393 | Ga0207659_10258615 | 3300025926 | Bacteria | 1415 |
| 394 | Ga0207659_10295076 | 3300025926 | Bacteria | 1329 |
| 395 | Ga0207659_10479979 | 3300025926 | Bacteria | 1050 |
| 396 | Ga0207687_10034029 | 3300025927 | Bacteria | 3458 |
| 397 | Ga0207687_10481755 | 3300025927 | Bacteria | 1033 |
| 398 | Ga0207687_10783030 | 3300025927 | Bacteria | 813 |
| 399 | Ga0207644_10105561 | 3300025931 | Bacteria | 2122 |
| 400 | Ga0207644_10120978 | 3300025931 | Bacteria | 1993 |
| 401 | Ga0207644_10154722 | 3300025931 | Bacteria | 1777 |
| 402 | Ga0207690_10000428 | 3300025932 | Bacteria | 27395 |
| 403 | Ga0207690_10722352 | 3300025932 | Bacteria | 820 |
| 404 | Ga0207706_10039894 | 3300025933 | Bacteria | 4162 |
| 405 | Ga0207706_10098221 | 3300025933 | Bacteria | 2575 |
| 406 | Ga0207706_10192746 | 3300025933 | Bacteria | 1788 |
| 407 | Ga0207706_10211544 | 3300025933 | Bacteria | 1700 |
| 408 | Ga0207706_10452262 | 3300025933 | Bacteria | 1111 |
| 409 | Ga0207686_10007355 | 3300025934 | Bacteria | 5927 |
| 410 | Ga0207709_10000245 | 3300025935 | Bacteria | 66704 |
| 411 | Ga0207709_10000522 | 3300025935 | Bacteria | 33464 |
| 412 | Ga0207709_10001057 | 3300025935 | Bacteria | 20345 |
| 413 | Ga0207709_10578054 | 3300025935 | Bacteria | 887 |
| 414 | Ga0207670_10290321 | 3300025936 | Bacteria | 1277 |
| 415 | Ga0207669_10767268 | 3300025937 | Bacteria | 797 |
| 416 | Ga0207704_10265032 | 3300025938 | Bacteria | 1297 |
| 417 | Ga0207691_10193218 | 3300025940 | Bacteria | 1774 |
| 418 | Ga0207691_10228240 | 3300025940 | Bacteria | 1613 |
| 419 | Ga0207691_10355654 | 3300025940 | Bacteria | 1253 |
| 420 | Ga0207711_10199470 | 3300025941 | Bacteria | 1826 |
| 421 | Ga0207711_10509761 | 3300025941 | Bacteria | 1121 |
| 422 | Ga0207689_10040791 | 3300025942 | Bacteria | 3841 |
| 423 | Ga0207689_10079678 | 3300025942 | Bacteria | 2691 |
| 424 | Ga0207679_10023501 | 3300025945 | Bacteria | 4217 |
| 425 | Ga0207679_10026952 | 3300025945 | Bacteria | 3968 |
| 426 | Ga0207679_10358199 | 3300025945 | Bacteria | 1273 |
| 427 | Ga0207667_10089432 | 3300025949 | Bacteria | 3183 |
| 428 | Ga0207667_11139411 | 3300025949 | Bacteria | 762 |
| 429 | Ga0207651_10001269 | 3300025960 | Bacteria | 11360 |
| 430 | Ga0207651_10115784 | 3300025960 | Bacteria | 2022 |
| 431 | Ga0207651_10182500 | 3300025960 | Bacteria | 1666 |
| 432 | Ga0207651_10238065 | 3300025960 | Bacteria | 1482 |
| 433 | Ga0207651_10396106 | 3300025960 | Bacteria | 1173 |
| 434 | Ga0207712_10033531 | 3300025961 | Bacteria | 3472 |
| 435 | Ga0207668_10151952 | 3300025972 | Bacteria | 1793 |
| 436 | Ga0207668_11011088 | 3300025972 | Bacteria | 743 |
| 437 | Ga0207640_10121792 | 3300025981 | Bacteria | 1870 |
| 438 | Ga0207640_10154690 | 3300025981 | Bacteria | 1689 |
| 439 | Ga0207640_10384754 | 3300025981 | Bacteria | 1138 |
| 440 | Ga0207658_10088021 | 3300025986 | Bacteria | 2399 |
| 441 | Ga0207658_10097808 | 3300025986 | Bacteria | 2292 |
| 442 | Ga0207677_10008077 | 3300026023 | Bacteria | 5857 |
| 443 | Ga0207677_10012869 | 3300026023 | Bacteria | 4830 |
| 444 | Ga0207677_10420136 | 3300026023 | Bacteria | 1139 |
| 445 | Ga0207703_10002190 | 3300026035 | Bacteria | 17149 |
| 446 | Ga0207703_10716627 | 3300026035 | Bacteria | 952 |
| 447 | Ga0207639_10070642 | 3300026041 | Bacteria | 2728 |
| 448 | Ga0207639_10165441 | 3300026041 | Bacteria | 1868 |
| 449 | Ga0207639_10339936 | 3300026041 | Bacteria | 1338 |
| 450 | Ga0207678_10059926 | 3300026067 | Bacteria | 3275 |
| 451 | Ga0207678_10086891 | 3300026067 | Bacteria | 2672 |
| 452 | Ga0207678_10385440 | 3300026067 | Bacteria | 1212 |
| 453 | Ga0207678_10386594 | 3300026067 | Bacteria | 1210 |
| 454 | Ga0207708_10156192 | 3300026075 | Bacteria | 1799 |
| 455 | Ga0207702_10046176 | 3300026078 | Bacteria | 3666 |
| 456 | Ga0207702_11078602 | 3300026078 | Bacteria | 797 |
| 457 | Ga0207702_11107518 | 3300026078 | Bacteria | 786 |
| 458 | Ga0207641_10001726 | 3300026088 | Bacteria | 21102 |
| 459 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 460 | Ga0207648_10017579 | 3300026089 | Bacteria | 6497 |
| 461 | Ga0207648_10032114 | 3300026089 | Bacteria | 4638 |
| 462 | Ga0207648_10205864 | 3300026089 | Bacteria | 1746 |
| 463 | Ga0207648_10368277 | 3300026089 | Bacteria | 1297 |
| 464 | Ga0207648_10583581 | 3300026089 | Bacteria | 1029 |
| 465 | Ga0207648_10696885 | 3300026089 | Bacteria | 941 |
| 466 | Ga0207676_10003149 | 3300026095 | Bacteria | 11781 |
| 467 | Ga0207674_10349962 | 3300026116 | Bacteria | 1428 |
| 468 | Ga0207674_10540395 | 3300026116 | Bacteria | 1126 |
| 469 | Ga0207674_11276771 | 3300026116 | Bacteria | 704 |
| 470 | Ga0207675_100109629 | 3300026118 | Bacteria | 2605 |
| 471 | Ga0207683_10010783 | 3300026121 | Bacteria | 7793 |
| 472 | Ga0207683_10030115 | 3300026121 | Bacteria | 4702 |
| 473 | Ga0207683_10032771 | 3300026121 | Bacteria | 4513 |
| 474 | Ga0207683_10558013 | 3300026121 | Bacteria | 1059 |
| 475 | Ga0207698_10004168 | 3300026142 | Bacteria | 8790 |
| 476 | Ga0207698_10022533 | 3300026142 | Bacteria | 4380 |
| 477 | Ga0207698_10024501 | 3300026142 | Bacteria | 4237 |
| 478 | Ga0207698_10060126 | 3300026142 | Bacteria | 2953 |
| 479 | Ga0207698_10329259 | 3300026142 | Bacteria | 1434 |
| 480 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 481 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 482 | Ga0209983_1051536 | 3300027665 | Bacteria | 901 |
| 483 | Ga0209282_1000109 | 3300027666 | Bacteria | 53813 |
| 484 | Ga0209974_10005579 | 3300027876 | Bacteria | 4421 |
| 485 | Ga0209974_10091046 | 3300027876 | Bacteria | 1058 |
| 486 | Ga0209974_10146591 | 3300027876 | Bacteria | 850 |
| 487 | Ga0207428_10102987 | 3300027907 | Bacteria | 2204 |
| 488 | Ga0268266_10107424 | 3300028379 | Bacteria | 2468 |
| 489 | Ga0268266_11581600 | 3300028379 | Bacteria | 631 |
| 490 | Ga0268265_10029913 | 3300028380 | Bacteria | 3918 |
| 491 | Ga0268265_10204653 | 3300028380 | Bacteria | 1715 |
| 492 | Ga0268265_11174997 | 3300028380 | Bacteria | 764 |
| 493 | Ga0268264_10065396 | 3300028381 | Bacteria | 3064 |
| 494 | Ga0268264_10195084 | 3300028381 | Bacteria | 1848 |
| 495 | Ga0307515_10000842 | 3300028794 | Bacteria | 70481 |
| 496 | Ga0307515_10001088 | 3300028794 | Bacteria | 62228 |
| 497 | Ga0307515_10001640 | 3300028794 | Bacteria | 49762 |
| 498 | Ga0307515_10020481 | 3300028794 | Bacteria | 11796 |
| 499 | Ga0307515_10064179 | 3300028794 | Bacteria | 5138 |
| 500 | Ga0307515_10109248 | 3300028794 | Bacteria | 3250 |
| 501 | Ga0307515_10127705 | 3300028794 | Bacteria | 2826 |
| 502 | Ga0307515_10166309 | 3300028794 | Bacteria | 2221 |
| 503 | Ga0307515_10233339 | 3300028794 | Bacteria | 1627 |
| 504 | Ga0307512_10045218 | 3300030522 | Bacteria | 3609 |
| 505 | Ga0307512_10065075 | 3300030522 | Bacteria | 2769 |
| 506 | Ga0316177_1071860 | 3300030731 | Bacteria | 4227 |
| 507 | Ga0316177_1155855 | 3300030731 | Bacteria | 3185 |
| 508 | Ga0316176_1148086 | 3300030732 | Bacteria | 2630 |
| 509 | Ga0314311_1122598 | 3300030733 | Bacteria | 1910 |
| 510 | Ga0316178_1138608 | 3300030735 | Bacteria | 6199 |
| 511 | Ga0316180_1073464 | 3300030736 | Bacteria | 1165 |
| 512 | Ga0316183_1020296 | 3300030742 | Bacteria | 4775 |
| 513 | Ga0316181_1106329 | 3300030744 | Bacteria | 3528 |
| 514 | Ga0265332_10008074 | 3300031238 | Bacteria | 4735 |
| 515 | Ga0265332_10291341 | 3300031238 | Bacteria | 674 |
| 516 | Ga0265329_10036582 | 3300031242 | Bacteria | 1582 |
| 517 | Ga0265331_10058291 | 3300031250 | Bacteria | 1829 |
| 518 | Ga0265327_10000814 | 3300031251 | Bacteria | 47176 |
| 519 | Ga0265327_10006291 | 3300031251 | Bacteria | 9563 |
| 520 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 521 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 522 | Ga0307513_10003449 | 3300031456 | Bacteria | 21402 |
| 523 | Ga0307513_10026043 | 3300031456 | Bacteria | 6753 |
| 524 | Ga0307513_10217505 | 3300031456 | Bacteria | 1735 |
| 525 | Ga0307513_10438385 | 3300031456 | Bacteria | 1033 |
| 526 | Ga0307513_10467479 | 3300031456 | Bacteria | 983 |
| 527 | Ga0307509_10094623 | 3300031507 | Bacteria | 3046 |
| 528 | Ga0307408_100000099 | 3300031548 | Bacteria | 95526 |
| 529 | Ga0307408_100000193 | 3300031548 | Bacteria | 65882 |
| 530 | Ga0307408_100019885 | 3300031548 | Bacteria | 4523 |
| 531 | Ga0307408_100028902 | 3300031548 | Bacteria | 3835 |
| 532 | Ga0307408_100040951 | 3300031548 | Bacteria | 3282 |
| 533 | Ga0307408_100318652 | 3300031548 | Bacteria | 1309 |
| 534 | Ga0307408_100430099 | 3300031548 | Bacteria | 1140 |
| 535 | Ga0307408_100544456 | 3300031548 | Bacteria | 1023 |
| 536 | Ga0307508_10002774 | 3300031616 | Bacteria | 18247 |
| 537 | Ga0307514_10002956 | 3300031649 | Bacteria | 16887 |
| 538 | Ga0307514_10013325 | 3300031649 | Bacteria | 6822 |
| 539 | Ga0265314_10013361 | 3300031711 | Bacteria | 6636 |
| 540 | Ga0265314_10049626 | 3300031711 | Bacteria | 2937 |
| 541 | Ga0307516_10004540 | 3300031730 | Bacteria | 17080 |
| 542 | Ga0307516_10006152 | 3300031730 | Bacteria | 14142 |
| 543 | Ga0307516_10222875 | 3300031730 | Bacteria | 1594 |
| 544 | Ga0307516_10266001 | 3300031730 | Bacteria | 1403 |
| 545 | Ga0307516_10271164 | 3300031730 | Bacteria | 1383 |
| 546 | Ga0307405_10314292 | 3300031731 | Bacteria | 1194 |
| 547 | Ga0307405_11084002 | 3300031731 | Bacteria | 688 |
| 548 | Ga0307413_11076597 | 3300031824 | Bacteria | 693 |
| 549 | Ga0307410_10741619 | 3300031852 | Bacteria | 831 |
| 550 | Ga0307406_10009579 | 3300031901 | Bacteria | 5441 |
| 551 | Ga0307406_10016378 | 3300031901 | Bacteria | 4307 |
| 552 | Ga0307406_10188553 | 3300031901 | Bacteria | 1508 |
| 553 | Ga0307406_10514283 | 3300031901 | Bacteria | 973 |
| 554 | Ga0307406_10822053 | 3300031901 | Bacteria | 786 |
| 555 | Ga0307407_10047314 | 3300031903 | Bacteria | 2440 |
| 556 | Ga0307407_10426950 | 3300031903 | Bacteria | 957 |
| 557 | Ga0307412_10037116 | 3300031911 | Bacteria | 3128 |
| 558 | Ga0307412_10057816 | 3300031911 | Bacteria | 2590 |
| 559 | Ga0307412_10065081 | 3300031911 | Bacteria | 2465 |
| 560 | Ga0307412_10480906 | 3300031911 | Bacteria | 1030 |
| 561 | Ga0307412_11115782 | 3300031911 | Bacteria | 703 |
| 562 | Ga0307409_100183715 | 3300031995 | Bacteria | 1854 |
| 563 | Ga0307409_101749225 | 3300031995 | Bacteria | 651 |
| 564 | Ga0307416_100023015 | 3300032002 | Bacteria | 4512 |
| 565 | Ga0307416_100068689 | 3300032002 | Bacteria | 2929 |
| 566 | Ga0307416_100312658 | 3300032002 | Bacteria | 1568 |
| 567 | Ga0307414_10008085 | 3300032004 | Bacteria | 5943 |
| 568 | Ga0307414_10321315 | 3300032004 | Bacteria | 1317 |
| 569 | Ga0307414_10482254 | 3300032004 | Bacteria | 1094 |
| 570 | Ga0307414_10968353 | 3300032004 | Bacteria | 782 |
| 571 | Ga0307414_11013262 | 3300032004 | Bacteria | 765 |
| 572 | Ga0307411_10000548 | 3300032005 | Bacteria | 13322 |
| 573 | Ga0307411_10077498 | 3300032005 | Bacteria | 2275 |
| 574 | Ga0307411_10232700 | 3300032005 | Bacteria | 1437 |
| 575 | Ga0307411_10262288 | 3300032005 | Bacteria | 1365 |
| 576 | Ga0307411_10421808 | 3300032005 | Bacteria | 1108 |
| 577 | Ga0307415_101103417 | 3300032126 | Bacteria | 743 |
| 578 | Ga0316583_10017125 | 3300032133 | Bacteria | 2606 |
| 579 | Ga0316593_10009836 | 3300032168 | Bacteria | 2718 |
| 580 | Ga0307510_10000311 | 3300033180 | Bacteria | 44908 |
| 581 | Ga0373950_0003412 | 3300034818 | Bacteria | 2264 |
| 582 | Ga0373959_0058069 | 3300034820 | Bacteria | 850 |
| 583 | Ga0373944_0058770 | 3300035089 | Bacteria | 1229 |
| 584 | Ga0373951_0029584 | 3300035091 | Bacteria | 1287 |
| 585 | Ga0373939_0000006 | 3300035114 | Bacteria | 78721 |
| 586 | Ga0373960_0000041 | 3300035121 | Bacteria | 16652 |
| 587 | Ga0373946_0107776 | 3300035171 | Bacteria | 1257 |
| 588 | Ga0373931_0000514 | 3300035691 | Bacteria | 15835 |
| 589 | Ga0373937_0265951 | 3300036401 | Bacteria | 1618 |
| 590 | Ga0395899_0003079 | 3300037312 | Bacteria | 13283 |
| 591 | Ga0395899_0008624 | 3300037312 | Bacteria | 7843 |
| 592 | Ga0395899_0111358 | 3300037312 | Bacteria | 1968 |
| 593 | Ga0395899_0260826 | 3300037312 | Bacteria | 1185 |
| 594 | Ga0395900_0000054 | 3300037418 | Bacteria | 220487 |
| 595 | Ga0395900_0026485 | 3300037418 | Bacteria | 5937 |
| 596 | Ga0395900_0064720 | 3300037418 | Bacteria | 3757 |
| 597 | Ga0395900_0111316 | 3300037418 | Bacteria | 2812 |
| 598 | Ga0395900_0411167 | 3300037418 | Bacteria | 1315 |
| 599 | Ga0395900_0572708 | 3300037418 | Bacteria | 1072 |
| 600 | Ga0395898_0000798 | 3300037466 | Bacteria | 53358 |
| 601 | Ga0395898_0425136 | 3300037466 | Bacteria | 1266 |
| 602 | Ga0395898_0472253 | 3300037466 | Bacteria | 1193 |
| 603 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 604 | Ga0395905_0001062 | 3300037471 | Bacteria | 34652 |
| 605 | Ga0395905_0002549 | 3300037471 | Bacteria | 20091 |
| 606 | Ga0395905_0003187 | 3300037471 | Bacteria | 17661 |
| 607 | Ga0395905_0016333 | 3300037471 | Bacteria | 7053 |
| 608 | Ga0395905_0030153 | 3300037471 | Bacteria | 5112 |
| 609 | Ga0395905_0049497 | 3300037471 | Bacteria | 3938 |
| 610 | Ga0395905_0049955 | 3300037471 | Bacteria | 3919 |
| 611 | Ga0395905_0101793 | 3300037471 | Bacteria | 2696 |
| 612 | Ga0395905_0323338 | 3300037471 | Bacteria | 1432 |
| 613 | Ga0395905_0388293 | 3300037471 | Bacteria | 1290 |
| 614 | Ga0395905_0695531 | 3300037471 | Bacteria | 919 |
| 615 | Ga0395905_1294698 | 3300037471 | Bacteria | 633 |
| 616 | Ga0395901_0012708 | 3300038443 | Bacteria | 8540 |
| 617 | Ga0395901_0085741 | 3300038443 | Bacteria | 3292 |
| 618 | Ga0395901_0119190 | 3300038443 | Bacteria | 2773 |
| 619 | Ga0395901_0121303 | 3300038443 | Bacteria | 2747 |
| 620 | Ga0395901_0173517 | 3300038443 | Bacteria | 2262 |
| 621 | Ga0395901_0176105 | 3300038443 | Bacteria | 2244 |
| 622 | Ga0395901_0187430 | 3300038443 | Bacteria | 2170 |
| 623 | Ga0395901_0266367 | 3300038443 | Bacteria | 1783 |
| 624 | Ga0395901_0311735 | 3300038443 | Bacteria | 1629 |
| 625 | Ga0400483_098478 | 3300039062 | Bacteria | 11916 |
| 626 | Ga0436365_0161847 | 3300039437 | Bacteria | 516 |
| 627 | Ga0436365_0872657 | 3300039437 | Bacteria | 673 |
| 628 | Ga0439436_0000392 | 3300041404 | Bacteria | 10907 |
| 629 | Ga0439436_0002953 | 3300041404 | Bacteria | 5159 |
| 630 | Ga0439436_0013763 | 3300041404 | Bacteria | 2446 |
| 631 | Ga0439439_0013953 | 3300041406 | Bacteria | 1952 |
| 632 | Ga0439439_0051148 | 3300041406 | Bacteria | 1083 |
| 633 | Ga0439439_0114708 | 3300041406 | Bacteria | 749 |
| 634 | Ga0439439_0138768 | 3300041406 | Bacteria | 685 |
| 635 | Ga0439447_009228 | 3300041407 | Bacteria | 3004 |
| 636 | Ga0439447_032624 | 3300041407 | Bacteria | 1301 |
| 637 | Ga0439461_0001378 | 3300041410 | Bacteria | 3750 |
| 638 | Ga0439461_0007060 | 3300041410 | Bacteria | 1977 |
| 639 | Ga0439466_0008881 | 3300041411 | Bacteria | 3779 |
| 640 | Ga0439466_0015610 | 3300041411 | Bacteria | 2758 |
| 641 | Ga0439465_0000387 | 3300041413 | Bacteria | 12738 |
| 642 | Ga0439465_0094931 | 3300041413 | Bacteria | 1024 |
| 643 | Ga0451791_1261760 | 3300041451 | Bacteria | 724 |
| 644 | Ga0451802_0405913 | 3300041460 | Bacteria | 537 |
| 645 | Ga0451804_0865208 | 3300041463 | Bacteria | 624 |
| 646 | Ga0451833_1215784 | 3300041491 | Bacteria | 1154 |
| 647 | Ga0451833_1425945 | 3300041491 | Bacteria | 1012 |
| 648 | Ga0451841_0537712 | 3300041498 | Bacteria | 756 |
| 649 | Ga0451841_0963024 | 3300041498 | Bacteria | 575 |
| 650 | Ga0451855_0271653 | 3300041511 | Bacteria | 769 |
| 651 | Ga0451853_1667522 | 3300041512 | Bacteria | 595 |
| 652 | Ga0439431_0001219 | 3300041997 | Bacteria | 5622 |
| 653 | Ga0439433_0000473 | 3300041999 | Bacteria | 7421 |
| 654 | Ga0439437_005415 | 3300042000 | Bacteria | 1404 |
| 655 | Ga0439437_019870 | 3300042000 | Bacteria | 809 |
| 656 | Ga0439442_004083 | 3300042002 | Bacteria | 2896 |
| 657 | Ga0439443_032008 | 3300042003 | Bacteria | 870 |
| 658 | Ga0439445_0000712 | 3300042004 | Bacteria | 6928 |
| 659 | Ga0439445_0027176 | 3300042004 | Bacteria | 1469 |
| 660 | Ga0439445_0047170 | 3300042004 | Bacteria | 1156 |
| 661 | Ga0439432_002602 | 3300042006 | Bacteria | 6790 |
| 662 | Ga0439432_019440 | 3300042006 | Bacteria | 2262 |
| 663 | Ga0439449_0002379 | 3300042007 | Bacteria | 7363 |
| 664 | Ga0439449_0003757 | 3300042007 | Bacteria | 5880 |
| 665 | Ga0439449_0005865 | 3300042007 | Bacteria | 4695 |
| 666 | Ga0439449_0006097 | 3300042007 | Bacteria | 4607 |
| 667 | Ga0439449_0010161 | 3300042007 | Bacteria | 3559 |
| 668 | Ga0439449_0049957 | 3300042007 | Bacteria | 1547 |
| 669 | Ga0439452_000611 | 3300042010 | Bacteria | 18092 |
| 670 | Ga0439452_062410 | 3300042010 | Bacteria | 832 |
| 671 | Ga0439454_068024 | 3300042011 | Bacteria | 628 |
| 672 | Ga0439457_002909 | 3300042014 | Bacteria | 4772 |
| 673 | Ga0439457_013201 | 3300042014 | Bacteria | 1857 |
| 674 | Ga0439462_0004945 | 3300042015 | Bacteria | 3270 |
| 675 | Ga0439462_0123858 | 3300042015 | Bacteria | 720 |
| 676 | Ga0450912_024875 | 3300042116 | Bacteria | 597 |
| 677 | Ga0450913_001575 | 3300042117 | Bacteria | 1279 |
| 678 | Ga0450919_000992 | 3300042121 | Bacteria | 3676 |
| 679 | Ga0450920_009242 | 3300042122 | Bacteria | 1811 |
| 680 | Ga0450920_025575 | 3300042122 | Bacteria | 1150 |
| 681 | Ga0450921_000320 | 3300042123 | Bacteria | 2143 |
| 682 | Ga0450923_001819 | 3300042125 | Bacteria | 2925 |
| 683 | Ga0450888_000719 | 3300042126 | Bacteria | 3153 |
| 684 | Ga0450890_006388 | 3300042127 | Bacteria | 1508 |
| 685 | Ga0450890_019152 | 3300042127 | Bacteria | 920 |
| 686 | Ga0450891_000123 | 3300042129 | Bacteria | 6931 |
| 687 | Ga0450892_001446 | 3300042130 | Bacteria | 2312 |
| 688 | Ga0450895_021983 | 3300042132 | Bacteria | 595 |
| 689 | Ga0450896_008927 | 3300042133 | Bacteria | 1393 |
| 690 | Ga0450896_012842 | 3300042133 | Bacteria | 1187 |
| 691 | Ga0450898_004928 | 3300042134 | Bacteria | 1995 |
| 692 | Ga0450902_008791 | 3300042137 | Bacteria | 1582 |
| 693 | Ga0450889_000176 | 3300042144 | Bacteria | 6865 |
| 694 | Ga0450906_007423 | 3300042145 | Bacteria | 2166 |
| 695 | Ga0450906_009590 | 3300042145 | Bacteria | 1843 |
| 696 | Ga0450907_014618 | 3300042146 | Bacteria | 1310 |
| 697 | Ga0450910_005526 | 3300042147 | Bacteria | 1726 |
| 698 | Ga0439446_0029700 | 3300042156 | Bacteria | 1577 |
| 699 | Ga0450908_004328 | 3300042184 | Bacteria | 2737 |
| 700 | Ga0450908_004926 | 3300042184 | Bacteria | 2564 |
| 701 | Ga0450909_004479 | 3300042185 | Bacteria | 1994 |
| 702 | Ga0439434_0003045 | 3300042435 | Bacteria | 4916 |
| 703 | Ga0439434_0004381 | 3300042435 | Bacteria | 4128 |
| 704 | Ga0439434_0038955 | 3300042435 | Bacteria | 1457 |
| 705 | Ga0439435_0124557 | 3300042436 | Bacteria | 810 |
| 706 | Ga0439464_0010780 | 3300042439 | Bacteria | 2416 |
| 707 | Ga0450916_067619 | 3300042530 | Bacteria | 591 |
| 708 | Ga0450918_000264 | 3300042531 | Bacteria | 11804 |
| 709 | Ga0450918_001423 | 3300042531 | Bacteria | 4755 |
| 710 | Ga0450893_0010771 | 3300042532 | Bacteria | 1506 |
| 711 | Ga0450893_0020353 | 3300042532 | Bacteria | 1139 |
| 712 | Ga0451577_0019186 | 3300042876 | Bacteria | 6289 |
| 713 | Ga0451577_0144388 | 3300042876 | Bacteria | 2139 |
| 714 | Ga0451577_0191062 | 3300042876 | Bacteria | 1847 |
| 715 | Ga0466969_0000054 | 3300044656 | Bacteria | 59867 |
| 716 | Ga0466969_0010663 | 3300044656 | Bacteria | 4869 |
| 717 | Ga0453683_0002845 | 3300044673 | Bacteria | 13126 |
| 718 | Ga0466965_0088633 | 3300044683 | Bacteria | 1571 |
| 719 | Ga0466965_0094149 | 3300044683 | Bacteria | 1526 |
| 720 | Ga0466965_0405699 | 3300044683 | Bacteria | 753 |
| 721 | Ga0466966_0002469 | 3300044684 | Bacteria | 12104 |
| 722 | Ga0466966_0011535 | 3300044684 | Bacteria | 5863 |
| 723 | Ga0466961_0059317 | 3300044693 | Bacteria | 2433 |
| 724 | Ga0466961_0226434 | 3300044693 | Bacteria | 1151 |
| 725 | Ga0466964_0005457 | 3300044706 | Bacteria | 4721 |
| 726 | Ga0453684_0361044 | 3300044712 | Bacteria | 1635 |
| 727 | Ga0453684_0370975 | 3300044712 | Bacteria | 1609 |
| 728 | Ga0453684_1601680 | 3300044712 | Bacteria | 668 |
| 729 | Ga0466971_0007746 | 3300044719 | Bacteria | 4679 |
| 730 | Ga0466971_0326792 | 3300044719 | Bacteria | 740 |
| 731 | Ga0466970_0009993 | 3300044765 | Bacteria | 4806 |
| 732 | Ga0466970_0047180 | 3300044765 | Bacteria | 2295 |
| 733 | Ga0466957_0099067 | 3300044842 | Bacteria | 1835 |
| 734 | Ga0466957_0184812 | 3300044842 | Bacteria | 1363 |
| 735 | Ga0466957_0668137 | 3300044842 | Bacteria | 731 |
| 736 | Ga0466960_0028787 | 3300044901 | Bacteria | 2544 |
| 737 | Ga0466960_0239453 | 3300044901 | Bacteria | 1004 |
| 738 | Ga0466959_0000528 | 3300045049 | Bacteria | 22186 |
| 739 | Ga0466959_0104843 | 3300045049 | Bacteria | 2022 |
| 740 | Ga0451576_0072525 | 3300045051 | Bacteria | 3583 |
| 741 | Ga0451576_0099477 | 3300045051 | Bacteria | 3026 |
| 742 | Ga0451576_0146107 | 3300045051 | Bacteria | 2465 |
| 743 | Ga0451576_0269778 | 3300045051 | Bacteria | 1779 |
| 744 | Ga0451576_1148854 | 3300045051 | Bacteria | 812 |
| 745 | Ga0466967_0627724 | 3300045976 | Bacteria | 1061 |
| 746 | Ga0466967_2472295 | 3300045976 | Bacteria | 514 |
| 747 | Ga0495627_007791 | 3300046453 | Bacteria | 4077 |
| 748 | Ga0495627_020910 | 3300046453 | Bacteria | 2174 |
| 749 | Ga0495629_0104012 | 3300046459 | Bacteria | 1981 |
| 750 | Ga0495629_0717846 | 3300046459 | Bacteria | 663 |
| 751 | Ga0495638_0043532 | 3300046460 | Bacteria | 2832 |
| 752 | Ga0495638_0063325 | 3300046460 | Bacteria | 2280 |
| 753 | Ga0495651_0070658 | 3300046462 | Bacteria | 2656 |
| 754 | Ga0495653_0133775 | 3300046463 | Bacteria | 1752 |
| 755 | Ga0495639_0122426 | 3300046475 | Bacteria | 1241 |
| 756 | Ga0495610_0010849 | 3300046512 | Bacteria | 5626 |
| 757 | Ga0495610_0020359 | 3300046512 | Bacteria | 3685 |
| 758 | Ga0495610_0085259 | 3300046512 | Bacteria | 1442 |
| 759 | Ga0495610_0392893 | 3300046512 | Bacteria | 513 |
| 760 | Ga0495616_0000722 | 3300046513 | Bacteria | 24406 |
| 761 | Ga0495618_0138797 | 3300046514 | Bacteria | 1555 |
| 762 | Ga0495618_0345519 | 3300046514 | Bacteria | 918 |
| 763 | Ga0495620_0021122 | 3300046515 | Bacteria | 3166 |
| 764 | Ga0495628_1035681 | 3300046516 | Bacteria | 563 |
| 765 | Ga0495631_0000446 | 3300046518 | Bacteria | 28333 |
| 766 | Ga0495632_0117942 | 3300046519 | Bacteria | 1242 |
| 767 | Ga0495637_0028290 | 3300046520 | Bacteria | 2504 |
| 768 | Ga0495643_0064789 | 3300046522 | Bacteria | 1930 |
| 769 | Ga0495663_0095586 | 3300046525 | Bacteria | 973 |
| 770 | Ga0495663_0099688 | 3300046525 | Bacteria | 955 |
| 771 | Ga0495642_0038373 | 3300046528 | Bacteria | 1941 |
| 772 | Ga0495654_0014862 | 3300046530 | Bacteria | 4136 |
| 773 | Ga0495654_0016539 | 3300046530 | Bacteria | 3896 |
| 774 | Ga0495609_0248669 | 3300046538 | Bacteria | 732 |
| 775 | Ga0495621_0009160 | 3300046539 | Bacteria | 2996 |
| 776 | Ga0495621_0100588 | 3300046539 | Bacteria | 1100 |
| 777 | Ga0495621_0109254 | 3300046539 | Bacteria | 1059 |
| 778 | Ga0495621_0346171 | 3300046539 | Bacteria | 623 |
| 779 | Ga0495597_0001135 | 3300046542 | Bacteria | 20086 |
| 780 | Ga0495622_0232948 | 3300046557 | Bacteria | 813 |
| 781 | Ga0495633_0002529 | 3300046558 | Bacteria | 12851 |
| 782 | Ga0495633_0157967 | 3300046558 | Bacteria | 1046 |
| 783 | Ga0495656_0001008 | 3300046615 | Bacteria | 9110 |
| 784 | Ga0495656_0021519 | 3300046615 | Bacteria | 2512 |
| 785 | Ga0495634_0352510 | 3300046642 | Bacteria | 881 |
| 786 | Ga0495625_0000396 | 3300046660 | Bacteria | 66627 |
| 787 | Ga0495625_0020614 | 3300046660 | Bacteria | 5085 |
| 788 | Ga0495635_0230945 | 3300046663 | Bacteria | 1250 |
| 789 | Ga0495661_0101423 | 3300046665 | Bacteria | 1619 |
| 790 | Ga0495588_0008771 | 3300046674 | Bacteria | 4646 |
| 791 | Ga0495588_0017519 | 3300046674 | Bacteria | 3481 |
| 792 | Ga0495588_0022794 | 3300046674 | Bacteria | 3096 |
| 793 | Ga0495599_0210546 | 3300046678 | Bacteria | 1192 |
| 794 | Ga0495658_0097627 | 3300046683 | Bacteria | 1749 |
| 795 | Ga0495658_0263080 | 3300046683 | Bacteria | 1086 |
| 796 | Ga0495670_0069830 | 3300046691 | Bacteria | 1777 |
| 797 | Ga0495671_0006709 | 3300046692 | Bacteria | 6631 |
| 798 | Ga0495600_0115925 | 3300046809 | Bacteria | 1744 |
| 799 | Ga0495600_0207404 | 3300046809 | Bacteria | 1257 |
| 800 | Ga0495600_0622530 | 3300046809 | Bacteria | 654 |
| 801 | Ga0495660_0044178 | 3300046810 | Bacteria | 2453 |
| 802 | Ga0495581_0296453 | 3300047315 | Bacteria | 945 |
| 803 | Ga0495676_0050590 | 3300047321 | Bacteria | 3331 |
| 804 | Ga0495687_203076 | 3300047443 | Bacteria | 628 |
| 805 | Ga0495681_0113426 | 3300047470 | Bacteria | 1171 |
| 806 | Ga0495686_0005856 | 3300047472 | Bacteria | 9583 |
| 807 | Ga0495593_0005694 | 3300047673 | Bacteria | 7351 |
| 808 | Ga0495593_0098558 | 3300047673 | Bacteria | 1501 |
| 809 | Ga0495593_0631470 | 3300047673 | Bacteria | 538 |
| 810 | Ga0495602_0459912 | 3300048088 | Bacteria | 897 |
| 811 | Ga0495614_0008498 | 3300048089 | Bacteria | 4565 |
| 812 | Ga0495615_0023364 | 3300048090 | Bacteria | 1416 |
| 813 | Ga0495615_0172772 | 3300048090 | Bacteria | 655 |
| 814 | Ga0496100_0078272 | 3300048903 | Bacteria | 2225 |
| 815 | Ga0496100_1402725 | 3300048903 | Bacteria | 551 |
| 816 | Ga0496101_0042961 | 3300048904 | Bacteria | 3228 |
| 817 | Ga0496102_0032292 | 3300048905 | Bacteria | 4703 |
| 818 | Ga0496102_0032877 | 3300048905 | Bacteria | 4662 |
| 819 | Ga0496102_0036331 | 3300048905 | Bacteria | 4437 |
| 820 | Ga0496103_0211580 | 3300048906 | Bacteria | 1247 |
| 821 | Ga0496104_0464865 | 3300048907 | Bacteria | 1177 |
| 822 | Ga0496105_0028533 | 3300048908 | Bacteria | 4563 |
| 823 | Ga0496105_0197976 | 3300048908 | Bacteria | 1640 |
| 824 | Ga0496106_0047925 | 3300048909 | Bacteria | 3217 |
| 825 | Ga0496107_0248541 | 3300048910 | Bacteria | 1323 |
| 826 | Ga0496112_0345553 | 3300048915 | Bacteria | 1431 |
| 827 | Ga0496113_1385750 | 3300048916 | Bacteria | 545 |
| 828 | Ga0496113_1591987 | 3300048916 | Bacteria | 503 |
| 829 | Ga0496114_0056546 | 3300048917 | Bacteria | 3275 |
| 830 | Ga0496114_0368850 | 3300048917 | Bacteria | 1270 |
| 831 | Ga0496114_0472552 | 3300048917 | Bacteria | 1109 |
| 832 | Ga0496116_0025554 | 3300048919 | Bacteria | 4340 |
| 833 | Ga0496117_0044176 | 3300048920 | Bacteria | 3230 |
| 834 | Ga0496117_0045056 | 3300048920 | Bacteria | 3190 |
| 835 | Ga0496118_0050037 | 3300048921 | Bacteria | 3211 |
| 836 | Ga0496118_0325976 | 3300048921 | Bacteria | 831 |
| 837 | Ga0496121_0022936 | 3300048924 | Bacteria | 6032 |
| 838 | Ga0496121_0244409 | 3300048924 | Bacteria | 1248 |
| 839 | Ga0496122_0000688 | 3300048925 | Bacteria | 67392 |
| 840 | Ga0496122_0069209 | 3300048925 | Bacteria | 2529 |
| 841 | Ga0496122_0101496 | 3300048925 | Bacteria | 1922 |
| 842 | Ga0496122_0110935 | 3300048925 | Bacteria | 1800 |
| 843 | Ga0496122_0293218 | 3300048925 | Bacteria | 882 |
| 844 | Ga0496122_0371799 | 3300048925 | Bacteria | 737 |
| 845 | Ga0496123_0001158 | 3300048926 | Bacteria | 39125 |
| 846 | Ga0496123_0038770 | 3300048926 | Bacteria | 3343 |
| 847 | Ga0496123_0057248 | 3300048926 | Bacteria | 2539 |
| 848 | Ga0496123_0131922 | 3300048926 | Bacteria | 1382 |
| 849 | Ga0496123_0161827 | 3300048926 | Bacteria | 1192 |
| 850 | Ga0496124_0052228 | 3300048927 | Bacteria | 3473 |
| 851 | Ga0496124_0059351 | 3300048927 | Bacteria | 3214 |
| 852 | Ga0496124_0077403 | 3300048927 | Bacteria | 2743 |
| 853 | Ga0496124_0196762 | 3300048927 | Bacteria | 1537 |
| 854 | Ga0496125_0006625 | 3300048928 | Bacteria | 12466 |
| 855 | Ga0496125_0017065 | 3300048928 | Bacteria | 6937 |
| 856 | Ga0496125_0290512 | 3300048928 | Bacteria | 1007 |
| 857 | Ga0496125_0341143 | 3300048928 | Bacteria | 899 |
| 858 | Ga0496125_0510420 | 3300048928 | Bacteria | 674 |
| 859 | Ga0496126_0035110 | 3300048929 | Bacteria | 4702 |
| 860 | Ga0496126_0234437 | 3300048929 | Bacteria | 1536 |
| 861 | Ga0496126_0932713 | 3300048929 | Bacteria | 656 |
| 862 | Ga0501301_010670 | 3300049524 | Bacteria | 756 |
| 863 | Ga0501315_019643 | 3300049531 | Bacteria | 901 |
| 864 | Ga0501034_0247677 | 3300049571 | Bacteria | 1727 |
| 865 | Ga0501037_0244588 | 3300049573 | Bacteria | 1257 |
| 866 | Ga0501038_0606296 | 3300049574 | Bacteria | 828 |
| 867 | Ga0501043_0641387 | 3300049579 | Bacteria | 781 |
| 868 | Ga0501198_000044 | 3300049649 | Bacteria | 43232 |
| 869 | Ga0501222_000017 | 3300049662 | Bacteria | 75770 |
| 870 | Ga0501253_003212 | 3300049683 | Bacteria | 1935 |
| 871 | Ga0501035_0048271 | 3300049822 | Bacteria | 3818 |
| 872 | Ga0501044_0278341 | 3300049823 | Bacteria | 1607 |
| 873 | nmdc:mga03683_132966_c1 | 3300050489 | Bacteria | 1114 |
| 874 | nmdc:mga03683_252889_c1 | 3300050489 | Bacteria | 819 |
| 875 | nmdc:mga03683_32250_c1 | 3300050489 | Bacteria | 2107 |
| 876 | nmdc:mga03683_60337_c1 | 3300050489 | Bacteria | 1602 |
| 877 | nmdc:mga03n38_139021_c1 | 3300050490 | Bacteria | 1211 |
| 878 | nmdc:mga03n38_850629_c1 | 3300050490 | Bacteria | 533 |
| 879 | nmdc:mga03n38_90616_c1 | 3300050490 | Bacteria | 1455 |
| 880 | nmdc:mga00v17_10018_c1 | 3300050491 | Bacteria | 5158 |
| 881 | nmdc:mga00v17_665279_c1 | 3300050491 | Bacteria | 669 |
| 882 | nmdc:mga00v17_99525_c1 | 3300050491 | Bacteria | 1834 |
| 883 | nmdc:mga0yw44_14269_c1 | 3300050492 | Bacteria | 4214 |
| 884 | nmdc:mga0yw44_309247_c1 | 3300050492 | Bacteria | 1060 |
| 885 | nmdc:mga0k408_14275_c2 | 3300050493 | Bacteria | 1995 |
| 886 | nmdc:mga0k408_157357_c1 | 3300050493 | Bacteria | 1353 |
| 887 | nmdc:mga0k408_23067_c1 | 3300050493 | Bacteria | 3507 |
| 888 | nmdc:mga0k408_28627_c1 | 3300050493 | Bacteria | 3168 |
| 889 | nmdc:mga0k408_351820_c1 | 3300050493 | Bacteria | 878 |
| 890 | nmdc:mga0k408_36399_c1 | 3300050493 | Bacteria | 2825 |
| 891 | nmdc:mga0k408_38912_c1 | 3300050493 | Bacteria | 2731 |
| 892 | nmdc:mga0k408_445271_c1 | 3300050493 | Bacteria | 769 |
| 893 | nmdc:mga06z11_295078_c1 | 3300050494 | Bacteria | 963 |
| 894 | nmdc:mga06z11_556810_c1 | 3300050494 | Bacteria | 696 |
| 895 | nmdc:mga06z11_581398_c1 | 3300050494 | Bacteria | 681 |
| 896 | nmdc:mga07m45_11241_c1 | 3300050496 | Bacteria | 4700 |
| 897 | nmdc:mga07m45_13172_c1 | 3300050496 | Bacteria | 4381 |
| 898 | nmdc:mga07m45_21825_c1 | 3300050496 | Bacteria | 3490 |
| 899 | nmdc:mga07m45_249894_c1 | 3300050496 | Bacteria | 1032 |
| 900 | nmdc:mga07m45_27154_c1 | 3300050496 | Bacteria | 3151 |
| 901 | nmdc:mga07m45_312083_c1 | 3300050496 | Bacteria | 914 |
| 902 | nmdc:mga07m45_533_c1 | 3300050496 | Bacteria | 16098 |
| 903 | nmdc:mga07m45_58332_c1 | 3300050496 | Bacteria | 2184 |
| 904 | nmdc:mga07m45_9770_c1 | 3300050496 | Bacteria | 4990 |
| 905 | Ga0500610_0005849 | 3300053079 | Bacteria | 5088 |
| 906 | Ga0500610_0007392 | 3300053079 | Bacteria | 4702 |
| 907 | Ga0500578_0000926 | 3300053086 | Bacteria | 32927 |
| 908 | Ga0500643_010390 | 3300053087 | Bacteria | 3468 |
| 909 | Ga0500644_0004370 | 3300053088 | Bacteria | 3534 |
| 910 | Ga0500644_0008346 | 3300053088 | Bacteria | 2732 |
| 911 | Ga0500644_0215805 | 3300053088 | Bacteria | 798 |
| 912 | Ga0500646_0022004 | 3300053090 | Bacteria | 1702 |
| 913 | Ga0500647_0069700 | 3300053091 | Bacteria | 1691 |
| 914 | Ga0500651_0000063 | 3300053093 | Bacteria | 70772 |
| 915 | Ga0500651_0037817 | 3300053093 | Bacteria | 3042 |
| 916 | Ga0500641_0082765 | 3300053096 | Bacteria | 1364 |
| 917 | Ga0500641_0167280 | 3300053096 | Bacteria | 947 |
| 918 | Ga0500650_0037746 | 3300053098 | Bacteria | 2221 |
| 919 | Ga0500562_027216 | 3300053108 | Bacteria | 1500 |
| 920 | Ga0500562_049118 | 3300053108 | Bacteria | 1127 |
| 921 | Ga0500571_008126 | 3300053110 | Bacteria | 5741 |
| 922 | Ga0500592_009925 | 3300053116 | Bacteria | 1515 |
| 923 | Ga0500593_000487 | 3300053117 | Bacteria | 15665 |
| 924 | Ga0500593_001737 | 3300053117 | Bacteria | 7855 |
| 925 | Ga0500593_004766 | 3300053117 | Bacteria | 5281 |
| 926 | Ga0500594_0000905 | 3300053118 | Bacteria | 6359 |
| 927 | Ga0500597_113615 | 3300053120 | Bacteria | 1175 |
| 928 | Ga0500607_001614 | 3300053121 | Bacteria | 19910 |
| 929 | Ga0500607_095498 | 3300053121 | Bacteria | 1487 |
| 930 | Ga0500608_008503 | 3300053122 | Bacteria | 4320 |
| 931 | Ga0500608_083300 | 3300053122 | Bacteria | 1506 |
| 932 | Ga0500618_035370 | 3300053125 | Bacteria | 1160 |
| 933 | Ga0500618_045103 | 3300053125 | Bacteria | 1006 |
| 934 | Ga0500626_105204 | 3300053128 | Bacteria | 1225 |
| 935 | Ga0500642_0013135 | 3300053130 | Bacteria | 3032 |
| 936 | Ga0500652_004429 | 3300053131 | Bacteria | 4350 |
| 937 | Ga0500652_031259 | 3300053131 | Bacteria | 2087 |
| 938 | Ga0500655_028009 | 3300053133 | Bacteria | 1077 |
| 939 | Ga0500658_0002954 | 3300053134 | Bacteria | 6529 |
| 940 | Ga0500658_0002955 | 3300053134 | Bacteria | 6529 |
| 941 | Ga0500559_0000260 | 3300053136 | Bacteria | 41596 |
| 942 | Ga0500559_0006663 | 3300053136 | Bacteria | 5193 |
| 943 | Ga0500559_0008325 | 3300053136 | Bacteria | 4555 |
| 944 | Ga0500559_0023456 | 3300053136 | Bacteria | 2619 |
| 945 | Ga0500568_0003245 | 3300053139 | Bacteria | 9191 |
| 946 | Ga0500568_0145526 | 3300053139 | Bacteria | 878 |
| 947 | Ga0500574_031804 | 3300053141 | Bacteria | 1424 |
| 948 | Ga0500577_0073196 | 3300053142 | Bacteria | 1348 |
| 949 | Ga0500590_034903 | 3300053148 | Bacteria | 2603 |
| 950 | Ga0500604_0021837 | 3300053151 | Bacteria | 1812 |
| 951 | Ga0500604_0055885 | 3300053151 | Bacteria | 1228 |
| 952 | Ga0500604_0248720 | 3300053151 | Bacteria | 615 |
| 953 | Ga0500616_0025494 | 3300053153 | Bacteria | 3279 |
| 954 | Ga0500619_000059 | 3300053154 | Bacteria | 33814 |
| 955 | Ga0500619_113521 | 3300053154 | Bacteria | 923 |
| 956 | Ga0500622_0001479 | 3300053156 | Bacteria | 18702 |
| 957 | Ga0500622_0004445 | 3300053156 | Bacteria | 8803 |
| 958 | Ga0500633_0032144 | 3300053160 | Bacteria | 1702 |
| 959 | Ga0500634_0038376 | 3300053161 | Bacteria | 2604 |
| 960 | Ga0500638_029064 | 3300053162 | Bacteria | 2658 |
| 961 | Ga0500636_0165370 | 3300053177 | Bacteria | 1202 |
| 962 | Ga0500570_083918 | 3300053724 | Bacteria | 1420 |
| 963 | Ga0500645_000198 | 3300053730 | Bacteria | 46701 |
| 964 | Ga0500645_004925 | 3300053730 | Bacteria | 5019 |
| 965 | Ga0500645_015380 | 3300053730 | Bacteria | 2424 |
| 966 | Ga0500587_000969 | 3300053739 | Bacteria | 3862 |
| 967 | Ga0500587_006774 | 3300053739 | Bacteria | 1509 |
| 968 | Ga0466962_0407838 | 3300061719 | Bacteria | 681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025986 | Ga0207658_10097808 | Ga0207658_100978084 | 138 |
| 2 | 3300006058 | Ga0075432_10008843 | Ga0075432_100088432 | 143 |
| 3 | 3300027907 | Ga0207428_10102987 | Ga0207428_101029872 | 143 |
| 4 | 3300005467 | Ga0070706_100001719 | Ga0070706_10000171918 | 144 |
| 5 | 3300025910 | Ga0207684_10001654 | Ga0207684_1000165423 | 144 |
| 6 | 3300025922 | Ga0207646_10085820 | Ga0207646_100858204 | 144 |
| 7 | 3300046516 | Ga0495628_1035681 | Ga0495628_1035681_13_447 | 144 |
| 8 | 3300046525 | Ga0495663_0095586 | Ga0495663_0095586_13_447 | 144 |
| 9 | 3300048916 | Ga0496113_1591987 | Ga0496113_1591987_10_444 | 144 |
| 10 | 3300050490 | nmdc:mga03n38_139021_c1 | nmdc:mga03n38_139021_c1_34_468 | 144 |
| 11 | 3300050490 | nmdc:mga03n38_850629_c1 | nmdc:mga03n38_850629_c1_77_511 | 144 |
| 12 | iso_pu_bacteria | 2547132374 | 2548497415 | 151 |
| 13 | iso_pu_bacteria | 2585428057 | 2587726267 | 151 |
| 14 | iso_pu_bacteria | 2585428058 | 2587734438 | 151 |
| 15 | iso_pu_bacteria | 2585428062 | 2587756326 | 151 |
| 16 | iso_pu_bacteria | 2588253510 | 2588293853 | 151 |
| 17 | iso_pu_bacteria | 2599185214 | 2599623674 | 151 |
| 18 | iso_pu_bacteria | 2599185226 | 2599671707 | 151 |
| 19 | iso_pu_bacteria | 2599185227 | 2599681280 | 151 |
| 20 | iso_pu_bacteria | 2599185229 | 2599693317 | 151 |
| 21 | iso_pu_bacteria | 2643221544 | 2643746347 | 151 |
| 22 | iso_pu_bacteria | 2643221570 | 2643866551 | 151 |
| 23 | iso_pu_bacteria | 2643221585 | 2643933180 | 151 |
| 24 | iso_pu_bacteria | 2643221592 | 2643970942 | 151 |
| 25 | iso_pu_bacteria | 2643221596 | 2643993303 | 151 |
| 26 | iso_pu_bacteria | 2643221625 | 2644138803 | 151 |
| 27 | iso_pu_bacteria | 2643221628 | 2644159608 | 151 |
| 28 | iso_pu_bacteria | 2643221644 | 2644243609 | 151 |
| 29 | iso_pu_bacteria | 2643221646 | 2644258899 | 151 |
| 30 | iso_pu_bacteria | 2643221648 | 2644273961 | 151 |
| 31 | iso_pu_bacteria | 2643221652 | 2644294092 | 151 |
| 32 | iso_pu_bacteria | 2643221656 | 2644314429 | 151 |
| 33 | iso_pu_bacteria | 2643221658 | 2644327631 | 151 |
| 34 | iso_pu_bacteria | 2643221683 | 2644468176 | 151 |
| 35 | iso_pu_bacteria | 2643221717 | 2644646095 | 151 |
| 36 | iso_pu_bacteria | 2721755523 | 2722883941 | 151 |
| 37 | iso_pu_bacteria | 2738541277 | 2738717743 | 151 |
| 38 | iso_pu_bacteria | 2738541307 | 2738879354 | 151 |
| 39 | iso_pu_bacteria | 2738541337 | 2739055646 | 151 |
| 40 | iso_pu_bacteria | 2738543012 | 2739242693 | 151 |
| 41 | iso_pu_bacteria | 2738543013 | 2739250710 | 151 |
| 42 | iso_pu_bacteria | 2738543019 | 2739278429 | 151 |
| 43 | iso_pu_bacteria | 2816332133 | 2816472990 | 151 |
| 44 | iso_pu_bacteria | 2818991446 | 2819597227 | 151 |
| 45 | iso_pu_bacteria | 2831265667 | 2831266352 | 151 |
| 46 | iso_pu_bacteria | 2838054893 | 2838057536 | 151 |
| 47 | iso_pu_bacteria | 2839138175 | 2839140286 | 151 |
| 48 | iso_pu_bacteria | 2842677519 | 2842679865 | 151 |
| 49 | iso_pu_bacteria | 2842718218 | 2842719553 | 151 |
| 50 | iso_pu_bacteria | 2842733646 | 2842736780 | 151 |
| 51 | iso_pu_bacteria | 2842747753 | 2842747851 | 151 |
| 52 | iso_pu_bacteria | 2881101125 | 2881101844 | 151 |
| 53 | iso_pu_bacteria | 2885192300 | 2885192687 | 151 |
| 54 | iso_pu_bacteria | 2885198086 | 2885204476 | 151 |
| 55 | iso_pu_bacteria | 2885211737 | 2885218129 | 151 |
| 56 | iso_pu_bacteria | 2899924645 | 2899924731 | 151 |
| 57 | iso_pu_bacteria | 2904449895 | 2904454420 | 151 |
| 58 | iso_pu_bacteria | 2904456579 | 2904461137 | 151 |
| 59 | iso_pu_bacteria | 2904541872 | 2904548182 | 151 |
| 60 | iso_pu_bacteria | 2916178963 | 2916180132 | 151 |
| 61 | iso_pu_bacteria | 2919462493 | 2919466014 | 151 |
| 62 | iso_pu_bacteria | 2919704043 | 2919704600 | 151 |
| 63 | iso_pu_bacteria | 2928037797 | 2928039142 | 151 |
| 64 | iso_pu_bacteria | 2928044640 | 2928045253 | 151 |
| 65 | iso_pu_bacteria | 2928051484 | 2928053058 | 151 |
| 66 | iso_pu_bacteria | 2928064002 | 2928064270 | 151 |
| 67 | iso_pu_bacteria | 2928070936 | 2928071707 | 151 |
| 68 | iso_pu_bacteria | 2928084124 | 2928084348 | 151 |
| 69 | iso_pu_bacteria | 2928115317 | 2928118544 | 151 |
| 70 | iso_pu_bacteria | 2929160207 | 2929163111 | 151 |
| 71 | iso_pu_bacteria | 2929520902 | 2929527019 | 151 |
| 72 | iso_pu_bacteria | 2932422444 | 2932425891 | 151 |
| 73 | iso_pu_bacteria | 2945909444 | 2945911615 | 151 |
| 74 | iso_pu_bacteria | 2945945610 | 2945948177 | 151 |
| 75 | iso_pu_bacteria | 2945972063 | 2945977178 | 151 |
| 76 | iso_pu_bacteria | 2945984333 | 2945986043 | 151 |
| 77 | iso_pu_bacteria | 2954767861 | 2954772295 | 151 |
| 78 | iso_pu_bacteria | 2974320154 | 2974323387 | 151 |
| 79 | iso_pu_bacteria | 2990710928 | 2990712263 | 151 |
| 80 | iso_pu_bacteria | 8054357960 | 8054359813 | 151 |
| 81 | 3300005543 | Ga0070672_100639082 | Ga0070672_1006390822 | 152 |
| 82 | 3300025926 | Ga0207659_10258615 | Ga0207659_102586152 | 152 |
| 83 | 3300025935 | Ga0207709_10578054 | Ga0207709_105780542 | 152 |
| 84 | 3300028794 | Ga0307515_10127705 | Ga0307515_101277054 | 154 |
| 85 | 3300031456 | Ga0307513_10003449 | Ga0307513_100034499 | 154 |
| 86 | 3300032133 | Ga0316583_10017125 | Ga0316583_100171252 | 154 |
| 87 | 3300039062 | Ga0400483_098478 | Ga0400483_098478_1876_2343 | 154 |
| 88 | 3300042876 | Ga0451577_0019186 | Ga0451577_0019186_3927_4394 | 154 |
| 89 | 3300001979 | JGI24740J21852_10001987 | JGI24740J21852_100019872 | 155 |
| 90 | 3300001979 | JGI24740J21852_10022496 | JGI24740J21852_100224964 | 155 |
| 91 | 3300001989 | JGI24739J22299_10064426 | JGI24739J22299_100644261 | 155 |
| 92 | 3300002773 | JGI25152J39213_1003563 | JGI25152J39213_10035633 | 155 |
| 93 | 3300002773 | JGI25152J39213_1004322 | JGI25152J39213_10043225 | 155 |
| 94 | 3300002774 | JGI25150J39212_1000611 | JGI25150J39212_100061112 | 155 |
| 95 | 3300002987 | JGI25159J45721_1004613 | JGI25159J45721_10046135 | 155 |
| 96 | 3300002987 | JGI25159J45721_1005744 | JGI25159J45721_10057443 | 155 |
| 97 | 3300003187 | JGI25151J46595_10001037 | JGI25151J46595_100010376 | 155 |
| 98 | 3300003187 | JGI25151J46595_10002554 | JGI25151J46595_100025547 | 155 |
| 99 | 3300003187 | JGI25151J46595_10009062 | JGI25151J46595_100090624 | 155 |
| 100 | 3300003187 | JGI25151J46595_10042257 | JGI25151J46595_100422571 | 155 |
| 101 | 3300003215 | JGI25153J46596_10005629 | JGI25153J46596_100056294 | 155 |
| 102 | 3300003215 | JGI25153J46596_10008890 | JGI25153J46596_100088904 | 155 |
| 103 | 3300003215 | JGI25153J46596_10016584 | JGI25153J46596_100165844 | 155 |
| 104 | 3300003215 | JGI25153J46596_10034724 | JGI25153J46596_100347241 | 155 |
| 105 | 3300003316 | rootH1_10053737 | rootH1_100537373 | 155 |
| 106 | 3300003320 | rootH2_10216731 | rootH2_102167312 | 155 |
| 107 | 3300003322 | rootL2_10006742 | rootL2_100067422 | 155 |
| 108 | 3300003322 | rootL2_10326548 | rootL2_103265482 | 155 |
| 109 | 3300003323 | rootH1_10008734 | rootH1_100087343 | 155 |
| 110 | 3300003354 | JGI25160J50197_1008977 | JGI25160J50197_10089774 | 155 |
| 111 | 3300003374 | JGI25161J50226_1003069 | JGI25161J50226_10030694 | 155 |
| 112 | 3300003578 | Ga0006562J51391_1072998 | Ga0006562J51391_10729984 | 155 |
| 113 | 3300003578 | Ga0006562J51391_1072999 | Ga0006562J51391_10729993 | 155 |
| 114 | 3300003578 | Ga0006562J51391_1109357 | Ga0006562J51391_11093574 | 155 |
| 115 | 3300003578 | Ga0006562J51391_1109361 | Ga0006562J51391_11093614 | 155 |
| 116 | 3300003760 | Ga0055527_1008925 | Ga0055527_10089252 | 155 |
| 117 | 3300003762 | Ga0055542_1000039 | Ga0055542_100003987 | 155 |
| 118 | 3300003771 | Ga0055526_1005340 | Ga0055526_10053402 | 155 |
| 119 | 3300003771 | Ga0055526_1009890 | Ga0055526_10098905 | 155 |
| 120 | 3300003771 | Ga0055526_1009910 | Ga0055526_10099105 | 155 |
| 121 | 3300003773 | Ga0055537_1000296 | Ga0055537_10002966 | 155 |
| 122 | 3300003773 | Ga0055537_1003601 | Ga0055537_10036014 | 155 |
| 123 | 3300003773 | Ga0055537_1004830 | Ga0055537_10048303 | 155 |
| 124 | 3300003775 | Ga0055524_1000302 | Ga0055524_100030239 | 155 |
| 125 | 3300003775 | Ga0055524_1005397 | Ga0055524_10053974 | 155 |
| 126 | 3300003775 | Ga0055524_1007817 | Ga0055524_10078174 | 155 |
| 127 | 3300003781 | Ga0055536_1002464 | Ga0055536_10024645 | 155 |
| 128 | 3300003781 | Ga0055536_1025110 | Ga0055536_10251102 | 155 |
| 129 | 3300003781 | Ga0055536_1035294 | Ga0055536_10352942 | 155 |
| 130 | 3300003784 | Ga0055534_1000092 | Ga0055534_100009238 | 155 |
| 131 | 3300003784 | Ga0055534_1000506 | Ga0055534_100050615 | 155 |
| 132 | 3300003784 | Ga0055534_1003706 | Ga0055534_10037064 | 155 |
| 133 | 3300003784 | Ga0055534_1003774 | Ga0055534_10037742 | 155 |
| 134 | 3300003790 | Ga0055528_1000190 | Ga0055528_100019026 | 155 |
| 135 | 3300003790 | Ga0055528_1007713 | Ga0055528_10077134 | 155 |
| 136 | 3300003790 | Ga0055528_1011213 | Ga0055528_10112134 | 155 |
| 137 | 3300003791 | Ga0055530_10000214 | Ga0055530_1000021422 | 155 |
| 138 | 3300003791 | Ga0055530_10046040 | Ga0055530_100460402 | 155 |
| 139 | 3300003792 | Ga0055540_1000004 | Ga0055540_100000473 | 155 |
| 140 | 3300003792 | Ga0055540_1000035 | Ga0055540_100003562 | 155 |
| 141 | 3300003792 | Ga0055540_1006272 | Ga0055540_10062724 | 155 |
| 142 | 3300003792 | Ga0055540_1010662 | Ga0055540_10106622 | 155 |
| 143 | 3300003794 | Ga0055531_10000317 | Ga0055531_100003173 | 155 |
| 144 | 3300003794 | Ga0055531_10000612 | Ga0055531_1000061222 | 155 |
| 145 | 3300003794 | Ga0055531_10010027 | Ga0055531_100100275 | 155 |
| 146 | 3300003794 | Ga0055531_10010039 | Ga0055531_100100394 | 155 |
| 147 | 3300003794 | Ga0055531_10013011 | Ga0055531_100130111 | 155 |
| 148 | 3300004625 | Ga0055543_1003575 | Ga0055543_10035754 | 155 |
| 149 | 3300004625 | Ga0055543_1005529 | Ga0055543_10055291 | 155 |
| 150 | 3300005262 | Ga0065165_1001409 | Ga0065165_100140914 | 155 |
| 151 | 3300005262 | Ga0065165_1006920 | Ga0065165_10069204 | 155 |
| 152 | 3300005262 | Ga0065165_1019442 | Ga0065165_10194422 | 155 |
| 153 | 3300005262 | Ga0065165_1021156 | Ga0065165_10211562 | 155 |
| 154 | 3300005288 | Ga0065714_10071185 | Ga0065714_100711854 | 155 |
| 155 | 3300005288 | Ga0065714_10162009 | Ga0065714_101620092 | 155 |
| 156 | 3300005327 | Ga0070658_10153664 | Ga0070658_101536642 | 155 |
| 157 | 3300005328 | Ga0070676_10041207 | Ga0070676_100412072 | 155 |
| 158 | 3300005328 | Ga0070676_10245308 | Ga0070676_102453082 | 155 |
| 159 | 3300005330 | Ga0070690_100004296 | Ga0070690_1000042962 | 155 |
| 160 | 3300005331 | Ga0070670_100425081 | Ga0070670_1004250812 | 155 |
| 161 | 3300005331 | Ga0070670_100500835 | Ga0070670_1005008352 | 155 |
| 162 | 3300005331 | Ga0070670_100522989 | Ga0070670_1005229892 | 155 |
| 163 | 3300005333 | Ga0070677_10274327 | Ga0070677_102743272 | 155 |
| 164 | 3300005334 | Ga0068869_100028112 | Ga0068869_1000281124 | 155 |
| 165 | 3300005334 | Ga0068869_100324339 | Ga0068869_1003243392 | 155 |
| 166 | 3300005335 | Ga0070666_10002227 | Ga0070666_100022271 | 155 |
| 167 | 3300005336 | Ga0070680_100180066 | Ga0070680_1001800663 | 155 |
| 168 | 3300005337 | Ga0070682_100051931 | Ga0070682_1000519312 | 155 |
| 169 | 3300005338 | Ga0068868_100000526 | Ga0068868_10000052623 | 155 |
| 170 | 3300005338 | Ga0068868_100203916 | Ga0068868_1002039163 | 155 |
| 171 | 3300005338 | Ga0068868_100349216 | Ga0068868_1003492162 | 155 |
| 172 | 3300005339 | Ga0070660_100106598 | Ga0070660_1001065984 | 155 |
| 173 | 3300005340 | Ga0070689_100268559 | Ga0070689_1002685593 | 155 |
| 174 | 3300005347 | Ga0070668_100077914 | Ga0070668_1000779144 | 155 |
| 175 | 3300005353 | Ga0070669_100012794 | Ga0070669_1000127942 | 155 |
| 176 | 3300005353 | Ga0070669_100150344 | Ga0070669_1001503442 | 155 |
| 177 | 3300005353 | Ga0070669_100366576 | Ga0070669_1003665762 | 155 |
| 178 | 3300005354 | Ga0070675_100001257 | Ga0070675_1000012574 | 155 |
| 179 | 3300005354 | Ga0070675_100907041 | Ga0070675_1009070412 | 155 |
| 180 | 3300005355 | Ga0070671_100125518 | Ga0070671_1001255182 | 155 |
| 181 | 3300005355 | Ga0070671_100305998 | Ga0070671_1003059982 | 155 |
| 182 | 3300005355 | Ga0070671_100375628 | Ga0070671_1003756282 | 155 |
| 183 | 3300005355 | Ga0070671_100827308 | Ga0070671_1008273081 | 155 |
| 184 | 3300005356 | Ga0070674_100349044 | Ga0070674_1003490442 | 155 |
| 185 | 3300005356 | Ga0070674_100532809 | Ga0070674_1005328091 | 155 |
| 186 | 3300005364 | Ga0070673_100003204 | Ga0070673_1000032049 | 155 |
| 187 | 3300005364 | Ga0070673_100258085 | Ga0070673_1002580851 | 155 |
| 188 | 3300005364 | Ga0070673_100767072 | Ga0070673_1007670722 | 155 |
| 189 | 3300005364 | Ga0070673_100778093 | Ga0070673_1007780932 | 155 |
| 190 | 3300005365 | Ga0070688_100077097 | Ga0070688_1000770972 | 155 |
| 191 | 3300005365 | Ga0070688_100471911 | Ga0070688_1004719112 | 155 |
| 192 | 3300005366 | Ga0070659_100000481 | Ga0070659_10000048110 | 155 |
| 193 | 3300005366 | Ga0070659_101011499 | Ga0070659_1010114991 | 155 |
| 194 | 3300005367 | Ga0070667_100080720 | Ga0070667_1000807203 | 155 |
| 195 | 3300005441 | Ga0070700_100327988 | Ga0070700_1003279882 | 155 |
| 196 | 3300005455 | Ga0070663_100163635 | Ga0070663_1001636352 | 155 |
| 197 | 3300005455 | Ga0070663_100199411 | Ga0070663_1001994112 | 155 |
| 198 | 3300005455 | Ga0070663_100227984 | Ga0070663_1002279843 | 155 |
| 199 | 3300005455 | Ga0070663_100374548 | Ga0070663_1003745481 | 155 |
| 200 | 3300005455 | Ga0070663_101122346 | Ga0070663_1011223461 | 155 |
| 201 | 3300005456 | Ga0070678_100025493 | Ga0070678_1000254933 | 155 |
| 202 | 3300005456 | Ga0070678_100113725 | Ga0070678_1001137252 | 155 |
| 203 | 3300005456 | Ga0070678_100224620 | Ga0070678_1002246202 | 155 |
| 204 | 3300005456 | Ga0070678_101879349 | Ga0070678_1018793491 | 155 |
| 205 | 3300005457 | Ga0070662_100031047 | Ga0070662_1000310473 | 155 |
| 206 | 3300005457 | Ga0070662_100046139 | Ga0070662_1000461393 | 155 |
| 207 | 3300005457 | Ga0070662_100116974 | Ga0070662_1001169743 | 155 |
| 208 | 3300005457 | Ga0070662_100174632 | Ga0070662_1001746322 | 155 |
| 209 | 3300005457 | Ga0070662_100176844 | Ga0070662_1001768442 | 155 |
| 210 | 3300005457 | Ga0070662_100436768 | Ga0070662_1004367682 | 155 |
| 211 | 3300005458 | Ga0070681_10361019 | Ga0070681_103610192 | 155 |
| 212 | 3300005459 | Ga0068867_100000005 | Ga0068867_10000000586 | 155 |
| 213 | 3300005459 | Ga0068867_100062751 | Ga0068867_1000627512 | 155 |
| 214 | 3300005459 | Ga0068867_100097766 | Ga0068867_1000977662 | 155 |
| 215 | 3300005459 | Ga0068867_100112722 | Ga0068867_1001127222 | 155 |
| 216 | 3300005459 | Ga0068867_101148495 | Ga0068867_1011484952 | 155 |
| 217 | 3300005466 | Ga0070685_10250691 | Ga0070685_102506911 | 155 |
| 218 | 3300005468 | Ga0070707_101368383 | Ga0070707_1013683831 | 155 |
| 219 | 3300005530 | Ga0070679_100064787 | Ga0070679_1000647872 | 155 |
| 220 | 3300005530 | Ga0070679_100094911 | Ga0070679_1000949113 | 155 |
| 221 | 3300005539 | Ga0068853_100051725 | Ga0068853_1000517255 | 155 |
| 222 | 3300005539 | Ga0068853_100240813 | Ga0068853_1002408132 | 155 |
| 223 | 3300005539 | Ga0068853_100376107 | Ga0068853_1003761072 | 155 |
| 224 | 3300005543 | Ga0070672_100108731 | Ga0070672_1001087312 | 155 |
| 225 | 3300005543 | Ga0070672_100276294 | Ga0070672_1002762942 | 155 |
| 226 | 3300005543 | Ga0070672_101355628 | Ga0070672_1013556281 | 155 |
| 227 | 3300005548 | Ga0070665_100557805 | Ga0070665_1005578052 | 155 |
| 228 | 3300005549 | Ga0070704_100621411 | Ga0070704_1006214112 | 155 |
| 229 | 3300005563 | Ga0068855_100014182 | Ga0068855_1000141822 | 155 |
| 230 | 3300005563 | Ga0068855_100025134 | Ga0068855_1000251342 | 155 |
| 231 | 3300005563 | Ga0068855_100813039 | Ga0068855_1008130392 | 155 |
| 232 | 3300005564 | Ga0070664_100118860 | Ga0070664_1001188602 | 155 |
| 233 | 3300005564 | Ga0070664_100556684 | Ga0070664_1005566842 | 155 |
| 234 | 3300005564 | Ga0070664_100561635 | Ga0070664_1005616352 | 155 |
| 235 | 3300005577 | Ga0068857_100596251 | Ga0068857_1005962512 | 155 |
| 236 | 3300005578 | Ga0068854_100183933 | Ga0068854_1001839333 | 155 |
| 237 | 3300005578 | Ga0068854_100483848 | Ga0068854_1004838482 | 155 |
| 238 | 3300005578 | Ga0068854_100518381 | Ga0068854_1005183812 | 155 |
| 239 | 3300005578 | Ga0068854_100635519 | Ga0068854_1006355192 | 155 |
| 240 | 3300005614 | Ga0068856_100036361 | Ga0068856_1000363613 | 155 |
| 241 | 3300005614 | Ga0068856_100341872 | Ga0068856_1003418722 | 155 |
| 242 | 3300005616 | Ga0068852_100002367 | Ga0068852_1000023674 | 155 |
| 243 | 3300005616 | Ga0068852_100123976 | Ga0068852_1001239763 | 155 |
| 244 | 3300005616 | Ga0068852_100383670 | Ga0068852_1003836702 | 155 |
| 245 | 3300005616 | Ga0068852_101481327 | Ga0068852_1014813272 | 155 |
| 246 | 3300005617 | Ga0068859_100010093 | Ga0068859_1000100938 | 155 |
| 247 | 3300005617 | Ga0068859_100923527 | Ga0068859_1009235271 | 155 |
| 248 | 3300005618 | Ga0068864_100000511 | Ga0068864_10000051131 | 155 |
| 249 | 3300005719 | Ga0068861_100144813 | Ga0068861_1001448132 | 155 |
| 250 | 3300005719 | Ga0068861_101090679 | Ga0068861_1010906792 | 155 |
| 251 | 3300005834 | Ga0068851_10004317 | Ga0068851_100043175 | 155 |
| 252 | 3300005834 | Ga0068851_10037551 | Ga0068851_100375514 | 155 |
| 253 | 3300005840 | Ga0068870_10450785 | Ga0068870_104507852 | 155 |
| 254 | 3300005841 | Ga0068863_100007397 | Ga0068863_1000073973 | 155 |
| 255 | 3300005842 | Ga0068858_100000359 | Ga0068858_10000035933 | 155 |
| 256 | 3300005843 | Ga0068860_100072237 | Ga0068860_1000722372 | 155 |
| 257 | 3300006038 | Ga0075365_10013252 | Ga0075365_100132524 | 155 |
| 258 | 3300006038 | Ga0075365_10915880 | Ga0075365_109158801 | 155 |
| 259 | 3300006048 | Ga0075363_100070021 | Ga0075363_1000700212 | 155 |
| 260 | 3300006048 | Ga0075363_100084488 | Ga0075363_1000844882 | 155 |
| 261 | 3300006048 | Ga0075363_100171471 | Ga0075363_1001714712 | 155 |
| 262 | 3300006051 | Ga0075364_10054684 | Ga0075364_100546843 | 155 |
| 263 | 3300006051 | Ga0075364_10238777 | Ga0075364_102387771 | 155 |
| 264 | 3300006051 | Ga0075364_10271956 | Ga0075364_102719561 | 155 |
| 265 | 3300006058 | Ga0075432_10024139 | Ga0075432_100241393 | 155 |
| 266 | 3300006177 | Ga0075362_10003584 | Ga0075362_100035842 | 155 |
| 267 | 3300006177 | Ga0075362_10039489 | Ga0075362_100394893 | 155 |
| 268 | 3300006177 | Ga0075362_10131550 | Ga0075362_101315502 | 155 |
| 269 | 3300006177 | Ga0075362_10317351 | Ga0075362_103173512 | 155 |
| 270 | 3300006178 | Ga0075367_10147513 | Ga0075367_101475132 | 155 |
| 271 | 3300006178 | Ga0075367_10362599 | Ga0075367_103625992 | 155 |
| 272 | 3300006186 | Ga0075369_10032362 | Ga0075369_100323624 | 155 |
| 273 | 3300006186 | Ga0075369_10199483 | Ga0075369_101994832 | 155 |
| 274 | 3300006195 | Ga0075366_10002649 | Ga0075366_100026493 | 155 |
| 275 | 3300006195 | Ga0075366_10006970 | Ga0075366_100069704 | 155 |
| 276 | 3300006195 | Ga0075366_10009720 | Ga0075366_100097203 | 155 |
| 277 | 3300006195 | Ga0075366_10013620 | Ga0075366_100136206 | 155 |
| 278 | 3300006195 | Ga0075366_10033567 | Ga0075366_100335672 | 155 |
| 279 | 3300006195 | Ga0075366_10145745 | Ga0075366_101457452 | 155 |
| 280 | 3300006195 | Ga0075366_10172756 | Ga0075366_101727562 | 155 |
| 281 | 3300006195 | Ga0075366_10623891 | Ga0075366_106238911 | 155 |
| 282 | 3300006237 | Ga0097621_100057282 | Ga0097621_1000572822 | 155 |
| 283 | 3300006237 | Ga0097621_100831982 | Ga0097621_1008319822 | 155 |
| 284 | 3300006353 | Ga0075370_10000556 | Ga0075370_100005562 | 155 |
| 285 | 3300006353 | Ga0075370_10014562 | Ga0075370_100145623 | 155 |
| 286 | 3300006353 | Ga0075370_10016632 | Ga0075370_100166325 | 155 |
| 287 | 3300006353 | Ga0075370_10022291 | Ga0075370_100222914 | 155 |
| 288 | 3300006353 | Ga0075370_10023906 | Ga0075370_100239063 | 155 |
| 289 | 3300006353 | Ga0075370_10034046 | Ga0075370_100340464 | 155 |
| 290 | 3300006353 | Ga0075370_10048286 | Ga0075370_100482862 | 155 |
| 291 | 3300006353 | Ga0075370_10183655 | Ga0075370_101836552 | 155 |
| 292 | 3300006353 | Ga0075370_10351501 | Ga0075370_103515012 | 155 |
| 293 | 3300006358 | Ga0068871_100064447 | Ga0068871_1000644473 | 155 |
| 294 | 3300006881 | Ga0068865_100087270 | Ga0068865_1000872702 | 155 |
| 295 | 3300006881 | Ga0068865_100209277 | Ga0068865_1002092772 | 155 |
| 296 | 3300006881 | Ga0068865_100409664 | Ga0068865_1004096642 | 155 |
| 297 | 3300006931 | Ga0097620_100010093 | Ga0097620_1000100938 | 155 |
| 298 | 3300006931 | Ga0097620_100923533 | Ga0097620_1009235331 | 155 |
| 299 | 3300006946 | Ga0079104_1000024 | Ga0079104_100002441 | 155 |
| 300 | 3300006948 | Ga0099826_10000115 | Ga0099826_1000011532 | 155 |
| 301 | 3300006948 | Ga0099826_10159610 | Ga0099826_101596102 | 155 |
| 302 | 3300009092 | Ga0105250_10034781 | Ga0105250_100347812 | 155 |
| 303 | 3300009093 | Ga0105240_10003642 | Ga0105240_1000364222 | 155 |
| 304 | 3300009093 | Ga0105240_10625342 | Ga0105240_106253422 | 155 |
| 305 | 3300009094 | Ga0111539_12743599 | Ga0111539_127435991 | 155 |
| 306 | 3300009098 | Ga0105245_10008806 | Ga0105245_100088065 | 155 |
| 307 | 3300009098 | Ga0105245_10251226 | Ga0105245_102512262 | 155 |
| 308 | 3300009098 | Ga0105245_10668587 | Ga0105245_106685872 | 155 |
| 309 | 3300009098 | Ga0105245_11621319 | Ga0105245_116213192 | 155 |
| 310 | 3300009148 | Ga0105243_10000515 | Ga0105243_1000051530 | 155 |
| 311 | 3300009148 | Ga0105243_10001515 | Ga0105243_1000151522 | 155 |
| 312 | 3300009148 | Ga0105243_10003542 | Ga0105243_100035427 | 155 |
| 313 | 3300009148 | Ga0105243_10132451 | Ga0105243_101324514 | 155 |
| 314 | 3300009148 | Ga0105243_10134204 | Ga0105243_101342042 | 155 |
| 315 | 3300009148 | Ga0105243_10340324 | Ga0105243_103403242 | 155 |
| 316 | 3300009148 | Ga0105243_10427224 | Ga0105243_104272241 | 155 |
| 317 | 3300009174 | Ga0105241_10143886 | Ga0105241_101438862 | 155 |
| 318 | 3300009176 | Ga0105242_10004129 | Ga0105242_100041293 | 155 |
| 319 | 3300009176 | Ga0105242_10908655 | Ga0105242_109086552 | 155 |
| 320 | 3300009177 | Ga0105248_10161343 | Ga0105248_101613434 | 155 |
| 321 | 3300009177 | Ga0105248_10531646 | Ga0105248_105316462 | 155 |
| 322 | 3300009545 | Ga0105237_10034393 | Ga0105237_100343933 | 155 |
| 323 | 3300009545 | Ga0105237_10037398 | Ga0105237_100373983 | 155 |
| 324 | 3300009551 | Ga0105238_10006811 | Ga0105238_100068118 | 155 |
| 325 | 3300009551 | Ga0105238_10027040 | Ga0105238_100270407 | 155 |
| 326 | 3300009551 | Ga0105238_11315528 | Ga0105238_113155281 | 155 |
| 327 | 3300009553 | Ga0105249_10467555 | Ga0105249_104675552 | 155 |
| 328 | 3300010375 | Ga0105239_10216054 | Ga0105239_102160543 | 155 |
| 329 | 3300010375 | Ga0105239_11519189 | Ga0105239_115191891 | 155 |
| 330 | 3300011119 | Ga0105246_10131195 | Ga0105246_101311953 | 155 |
| 331 | 3300013100 | Ga0157373_10029757 | Ga0157373_100297573 | 155 |
| 332 | 3300013102 | Ga0157371_10133807 | Ga0157371_101338072 | 155 |
| 333 | 3300013104 | Ga0157370_10065472 | Ga0157370_100654722 | 155 |
| 334 | 3300013105 | Ga0157369_10043021 | Ga0157369_100430215 | 155 |
| 335 | 3300013297 | Ga0157378_10528330 | Ga0157378_105283302 | 155 |
| 336 | 3300013297 | Ga0157378_11042396 | Ga0157378_110423962 | 155 |
| 337 | 3300013306 | Ga0163162_10123599 | Ga0163162_101235992 | 155 |
| 338 | 3300013306 | Ga0163162_10239243 | Ga0163162_102392433 | 155 |
| 339 | 3300013306 | Ga0163162_10284627 | Ga0163162_102846272 | 155 |
| 340 | 3300013306 | Ga0163162_10973410 | Ga0163162_109734101 | 155 |
| 341 | 3300013307 | Ga0157372_10806654 | Ga0157372_108066542 | 155 |
| 342 | 3300013308 | Ga0157375_10169716 | Ga0157375_101697162 | 155 |
| 343 | 3300013308 | Ga0157375_11715030 | Ga0157375_117150302 | 155 |
| 344 | 3300014325 | Ga0163163_10010941 | Ga0163163_100109413 | 155 |
| 345 | 3300014325 | Ga0163163_12441689 | Ga0163163_124416891 | 155 |
| 346 | 3300014326 | Ga0157380_10119485 | Ga0157380_101194853 | 155 |
| 347 | 3300014326 | Ga0157380_10283257 | Ga0157380_102832573 | 155 |
| 348 | 3300014326 | Ga0157380_10948435 | Ga0157380_109484351 | 155 |
| 349 | 3300014326 | Ga0157380_10961539 | Ga0157380_109615392 | 155 |
| 350 | 3300014497 | Ga0182008_10009236 | Ga0182008_100092363 | 155 |
| 351 | 3300014497 | Ga0182008_10011067 | Ga0182008_100110674 | 155 |
| 352 | 3300014497 | Ga0182008_10057326 | Ga0182008_100573262 | 155 |
| 353 | 3300014497 | Ga0182008_10122108 | Ga0182008_101221082 | 155 |
| 354 | 3300014745 | Ga0157377_10000022 | Ga0157377_1000002288 | 155 |
| 355 | 3300014745 | Ga0157377_10138874 | Ga0157377_101388742 | 155 |
| 356 | 3300014968 | Ga0157379_10092454 | Ga0157379_100924543 | 155 |
| 357 | 3300014968 | Ga0157379_10523405 | Ga0157379_105234052 | 155 |
| 358 | 3300014969 | Ga0157376_10145094 | Ga0157376_101450943 | 155 |
| 359 | 3300014969 | Ga0157376_10796496 | Ga0157376_107964962 | 155 |
| 360 | 3300015262 | Ga0182007_10000472 | Ga0182007_1000047218 | 155 |
| 361 | 3300015262 | Ga0182007_10053924 | Ga0182007_100539242 | 155 |
| 362 | 3300015265 | Ga0182005_1042245 | Ga0182005_10422452 | 155 |
| 363 | 3300015683 | Ga0183362_10001 | Ga0183362_100011323 | 155 |
| 364 | 3300017792 | Ga0163161_10001036 | Ga0163161_100010362 | 155 |
| 365 | 3300017792 | Ga0163161_10031016 | Ga0163161_100310163 | 155 |
| 366 | 3300017792 | Ga0163161_10051910 | Ga0163161_100519103 | 155 |
| 367 | 3300017792 | Ga0163161_10503808 | Ga0163161_105038082 | 155 |
| 368 | 3300025208 | Ga0209436_108139 | Ga0209436_1081393 | 155 |
| 369 | 3300025228 | Ga0209672_101250 | Ga0209672_1012508 | 155 |
| 370 | 3300025229 | Ga0209147_102210 | Ga0209147_1022102 | 155 |
| 371 | 3300025242 | Ga0209258_100099 | Ga0209258_100099126 | 155 |
| 372 | 3300025245 | Ga0207425_1000239 | Ga0207425_100023930 | 155 |
| 373 | 3300025245 | Ga0207425_1001642 | Ga0207425_10016425 | 155 |
| 374 | 3300025245 | Ga0207425_1004428 | Ga0207425_10044284 | 155 |
| 375 | 3300025254 | Ga0209148_1000103 | Ga0209148_1000103126 | 155 |
| 376 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007470 | 155 |
| 377 | 3300025258 | Ga0209129_1000144 | Ga0209129_100014462 | 155 |
| 378 | 3300025258 | Ga0209129_1001130 | Ga0209129_100113017 | 155 |
| 379 | 3300025258 | Ga0209129_1004500 | Ga0209129_10045004 | 155 |
| 380 | 3300025263 | Ga0209565_1000073 | Ga0209565_100007344 | 155 |
| 381 | 3300025263 | Ga0209565_1000199 | Ga0209565_10001994 | 155 |
| 382 | 3300025263 | Ga0209565_1003122 | Ga0209565_10031224 | 155 |
| 383 | 3300025273 | Ga0209673_1000127 | Ga0209673_1000127123 | 155 |
| 384 | 3300025273 | Ga0209673_1000128 | Ga0209673_100012888 | 155 |
| 385 | 3300025273 | Ga0209673_1001078 | Ga0209673_10010784 | 155 |
| 386 | 3300025273 | Ga0209673_1001619 | Ga0209673_10016192 | 155 |
| 387 | 3300025273 | Ga0209673_1003135 | Ga0209673_10031354 | 155 |
| 388 | 3300025273 | Ga0209673_1013295 | Ga0209673_10132953 | 155 |
| 389 | 3300025284 | Ga0209130_1000471 | Ga0209130_100047127 | 155 |
| 390 | 3300025284 | Ga0209130_1000898 | Ga0209130_100089815 | 155 |
| 391 | 3300025284 | Ga0209130_1000914 | Ga0209130_100091412 | 155 |
| 392 | 3300025284 | Ga0209130_1002188 | Ga0209130_10021888 | 155 |
| 393 | 3300025291 | Ga0209675_1000029 | Ga0209675_1000029123 | 155 |
| 394 | 3300025291 | Ga0209675_1000114 | Ga0209675_100011428 | 155 |
| 395 | 3300025291 | Ga0209675_1000723 | Ga0209675_10007236 | 155 |
| 396 | 3300025291 | Ga0209675_1000976 | Ga0209675_10009767 | 155 |
| 397 | 3300025291 | Ga0209675_1002630 | Ga0209675_10026308 | 155 |
| 398 | 3300025292 | Ga0209676_1000122 | Ga0209676_100012248 | 155 |
| 399 | 3300025292 | Ga0209676_1000301 | Ga0209676_100030122 | 155 |
| 400 | 3300025292 | Ga0209676_1002710 | Ga0209676_10027106 | 155 |
| 401 | 3300025292 | Ga0209676_1003298 | Ga0209676_100329812 | 155 |
| 402 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073108 | 155 |
| 403 | 3300025294 | Ga0209025_1000248 | Ga0209025_100024857 | 155 |
| 404 | 3300025294 | Ga0209025_1000491 | Ga0209025_100049144 | 155 |
| 405 | 3300025294 | Ga0209025_1006463 | Ga0209025_100646310 | 155 |
| 406 | 3300025294 | Ga0209025_1026508 | Ga0209025_10265084 | 155 |
| 407 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029106 | 155 |
| 408 | 3300025295 | Ga0209564_1000360 | Ga0209564_100036018 | 155 |
| 409 | 3300025295 | Ga0209564_1001537 | Ga0209564_100153710 | 155 |
| 410 | 3300025295 | Ga0209564_1042300 | Ga0209564_10423002 | 155 |
| 411 | 3300025297 | Ga0209758_1000025 | Ga0209758_100002556 | 155 |
| 412 | 3300025297 | Ga0209758_1000043 | Ga0209758_1000043334 | 155 |
| 413 | 3300025297 | Ga0209758_1000434 | Ga0209758_100043415 | 155 |
| 414 | 3300025298 | Ga0209050_1000197 | Ga0209050_100019796 | 155 |
| 415 | 3300025298 | Ga0209050_1000433 | Ga0209050_100043322 | 155 |
| 416 | 3300025298 | Ga0209050_1000488 | Ga0209050_100048843 | 155 |
| 417 | 3300025298 | Ga0209050_1007621 | Ga0209050_10076215 | 155 |
| 418 | 3300025298 | Ga0209050_1007861 | Ga0209050_10078612 | 155 |
| 419 | 3300025298 | Ga0209050_1011027 | Ga0209050_10110273 | 155 |
| 420 | 3300025298 | Ga0209050_1042750 | Ga0209050_10427502 | 155 |
| 421 | 3300025298 | Ga0209050_1042975 | Ga0209050_10429752 | 155 |
| 422 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011172 | 155 |
| 423 | 3300025299 | Ga0209256_1000050 | Ga0209256_1000050122 | 155 |
| 424 | 3300025299 | Ga0209256_1000063 | Ga0209256_1000063186 | 155 |
| 425 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001581 | 155 |
| 426 | 3300025302 | Ga0207426_1000028 | Ga0207426_1000028404 | 155 |
| 427 | 3300025302 | Ga0207426_1001556 | Ga0207426_100155611 | 155 |
| 428 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021491 | 155 |
| 429 | 3300025303 | Ga0209051_1000016 | Ga0209051_1000016165 | 155 |
| 430 | 3300025303 | Ga0209051_1000542 | Ga0209051_100054214 | 155 |
| 431 | 3300025303 | Ga0209051_1001159 | Ga0209051_10011596 | 155 |
| 432 | 3300025303 | Ga0209051_1002010 | Ga0209051_10020106 | 155 |
| 433 | 3300025303 | Ga0209051_1004650 | Ga0209051_10046503 | 155 |
| 434 | 3300025303 | Ga0209051_1007504 | Ga0209051_10075044 | 155 |
| 435 | 3300025303 | Ga0209051_1023776 | Ga0209051_10237762 | 155 |
| 436 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021632 | 155 |
| 437 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012594 | 155 |
| 438 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021584 | 155 |
| 439 | 3300025304 | Ga0209257_1000102 | Ga0209257_1000102128 | 155 |
| 440 | 3300025304 | Ga0209257_1006647 | Ga0209257_10066476 | 155 |
| 441 | 3300025304 | Ga0209257_1007736 | Ga0209257_10077366 | 155 |
| 442 | 3300025321 | Ga0207656_10052949 | Ga0207656_100529492 | 155 |
| 443 | 3300025321 | Ga0207656_10060956 | Ga0207656_100609562 | 155 |
| 444 | 3300025711 | Ga0207696_1036136 | Ga0207696_10361362 | 155 |
| 445 | 3300025893 | Ga0207682_10075079 | Ga0207682_100750793 | 155 |
| 446 | 3300025893 | Ga0207682_10167125 | Ga0207682_101671252 | 155 |
| 447 | 3300025903 | Ga0207680_10005639 | Ga0207680_100056393 | 155 |
| 448 | 3300025903 | Ga0207680_10263764 | Ga0207680_102637642 | 155 |
| 449 | 3300025907 | Ga0207645_10018276 | Ga0207645_100182763 | 155 |
| 450 | 3300025907 | Ga0207645_10035636 | Ga0207645_100356363 | 155 |
| 451 | 3300025907 | Ga0207645_10100201 | Ga0207645_101002013 | 155 |
| 452 | 3300025907 | Ga0207645_10532092 | Ga0207645_105320922 | 155 |
| 453 | 3300025909 | Ga0207705_10141578 | Ga0207705_101415782 | 155 |
| 454 | 3300025911 | Ga0207654_10111296 | Ga0207654_101112963 | 155 |
| 455 | 3300025912 | Ga0207707_10310318 | Ga0207707_103103183 | 155 |
| 456 | 3300025913 | Ga0207695_10347517 | Ga0207695_103475172 | 155 |
| 457 | 3300025913 | Ga0207695_11112823 | Ga0207695_111128232 | 155 |
| 458 | 3300025914 | Ga0207671_10071283 | Ga0207671_100712831 | 155 |
| 459 | 3300025914 | Ga0207671_11036626 | Ga0207671_110366262 | 155 |
| 460 | 3300025917 | Ga0207660_10138485 | Ga0207660_101384852 | 155 |
| 461 | 3300025919 | Ga0207657_10016829 | Ga0207657_100168296 | 155 |
| 462 | 3300025919 | Ga0207657_10625583 | Ga0207657_106255832 | 155 |
| 463 | 3300025919 | Ga0207657_11079679 | Ga0207657_110796791 | 155 |
| 464 | 3300025920 | Ga0207649_10006892 | Ga0207649_100068924 | 155 |
| 465 | 3300025920 | Ga0207649_11137242 | Ga0207649_111372421 | 155 |
| 466 | 3300025921 | Ga0207652_10032924 | Ga0207652_100329244 | 155 |
| 467 | 3300025923 | Ga0207681_10343261 | Ga0207681_103432612 | 155 |
| 468 | 3300025923 | Ga0207681_10603020 | Ga0207681_106030201 | 155 |
| 469 | 3300025924 | Ga0207694_10043334 | Ga0207694_100433344 | 155 |
| 470 | 3300025924 | Ga0207694_10103673 | Ga0207694_101036732 | 155 |
| 471 | 3300025924 | Ga0207694_11257370 | Ga0207694_112573702 | 155 |
| 472 | 3300025925 | Ga0207650_10356242 | Ga0207650_103562422 | 155 |
| 473 | 3300025925 | Ga0207650_10565955 | Ga0207650_105659552 | 155 |
| 474 | 3300025925 | Ga0207650_10948396 | Ga0207650_109483962 | 155 |
| 475 | 3300025926 | Ga0207659_10003030 | Ga0207659_100030309 | 155 |
| 476 | 3300025926 | Ga0207659_10295076 | Ga0207659_102950762 | 155 |
| 477 | 3300025926 | Ga0207659_10479979 | Ga0207659_104799792 | 155 |
| 478 | 3300025927 | Ga0207687_10034029 | Ga0207687_100340293 | 155 |
| 479 | 3300025927 | Ga0207687_10481755 | Ga0207687_104817552 | 155 |
| 480 | 3300025927 | Ga0207687_10783030 | Ga0207687_107830302 | 155 |
| 481 | 3300025931 | Ga0207644_10105561 | Ga0207644_101055612 | 155 |
| 482 | 3300025931 | Ga0207644_10120978 | Ga0207644_101209782 | 155 |
| 483 | 3300025931 | Ga0207644_10154722 | Ga0207644_101547222 | 155 |
| 484 | 3300025932 | Ga0207690_10000428 | Ga0207690_1000042818 | 155 |
| 485 | 3300025932 | Ga0207690_10722352 | Ga0207690_107223521 | 155 |
| 486 | 3300025933 | Ga0207706_10039894 | Ga0207706_100398945 | 155 |
| 487 | 3300025933 | Ga0207706_10098221 | Ga0207706_100982212 | 155 |
| 488 | 3300025933 | Ga0207706_10192746 | Ga0207706_101927462 | 155 |
| 489 | 3300025933 | Ga0207706_10211544 | Ga0207706_102115442 | 155 |
| 490 | 3300025933 | Ga0207706_10452262 | Ga0207706_104522622 | 155 |
| 491 | 3300025934 | Ga0207686_10007355 | Ga0207686_100073553 | 155 |
| 492 | 3300025935 | Ga0207709_10000245 | Ga0207709_1000024513 | 155 |
| 493 | 3300025935 | Ga0207709_10000522 | Ga0207709_1000052210 | 155 |
| 494 | 3300025935 | Ga0207709_10001057 | Ga0207709_100010572 | 155 |
| 495 | 3300025936 | Ga0207670_10290321 | Ga0207670_102903212 | 155 |
| 496 | 3300025937 | Ga0207669_10767268 | Ga0207669_107672681 | 155 |
| 497 | 3300025938 | Ga0207704_10265032 | Ga0207704_102650322 | 155 |
| 498 | 3300025940 | Ga0207691_10193218 | Ga0207691_101932182 | 155 |
| 499 | 3300025940 | Ga0207691_10228240 | Ga0207691_102282401 | 155 |
| 500 | 3300025940 | Ga0207691_10355654 | Ga0207691_103556542 | 155 |
| 501 | 3300025941 | Ga0207711_10199470 | Ga0207711_101994702 | 155 |
| 502 | 3300025941 | Ga0207711_10509761 | Ga0207711_105097612 | 155 |
| 503 | 3300025942 | Ga0207689_10040791 | Ga0207689_100407911 | 155 |
| 504 | 3300025942 | Ga0207689_10079678 | Ga0207689_100796783 | 155 |
| 505 | 3300025945 | Ga0207679_10023501 | Ga0207679_100235013 | 155 |
| 506 | 3300025945 | Ga0207679_10026952 | Ga0207679_100269524 | 155 |
| 507 | 3300025945 | Ga0207679_10358199 | Ga0207679_103581992 | 155 |
| 508 | 3300025949 | Ga0207667_10089432 | Ga0207667_100894322 | 155 |
| 509 | 3300025949 | Ga0207667_11139411 | Ga0207667_111394112 | 155 |
| 510 | 3300025960 | Ga0207651_10001269 | Ga0207651_100012696 | 155 |
| 511 | 3300025960 | Ga0207651_10115784 | Ga0207651_101157841 | 155 |
| 512 | 3300025960 | Ga0207651_10182500 | Ga0207651_101825003 | 155 |
| 513 | 3300025960 | Ga0207651_10238065 | Ga0207651_102380652 | 155 |
| 514 | 3300025960 | Ga0207651_10396106 | Ga0207651_103961062 | 155 |
| 515 | 3300025961 | Ga0207712_10033531 | Ga0207712_100335313 | 155 |
| 516 | 3300025972 | Ga0207668_10151952 | Ga0207668_101519523 | 155 |
| 517 | 3300025972 | Ga0207668_11011088 | Ga0207668_110110882 | 155 |
| 518 | 3300025981 | Ga0207640_10121792 | Ga0207640_101217922 | 155 |
| 519 | 3300025981 | Ga0207640_10154690 | Ga0207640_101546902 | 155 |
| 520 | 3300025981 | Ga0207640_10384754 | Ga0207640_103847542 | 155 |
| 521 | 3300025986 | Ga0207658_10088021 | Ga0207658_100880213 | 155 |
| 522 | 3300026023 | Ga0207677_10008077 | Ga0207677_100080772 | 155 |
| 523 | 3300026023 | Ga0207677_10012869 | Ga0207677_100128692 | 155 |
| 524 | 3300026023 | Ga0207677_10420136 | Ga0207677_104201362 | 155 |
| 525 | 3300026035 | Ga0207703_10002190 | Ga0207703_1000219019 | 155 |
| 526 | 3300026035 | Ga0207703_10716627 | Ga0207703_107166272 | 155 |
| 527 | 3300026041 | Ga0207639_10070642 | Ga0207639_100706423 | 155 |
| 528 | 3300026041 | Ga0207639_10165441 | Ga0207639_101654413 | 155 |
| 529 | 3300026041 | Ga0207639_10339936 | Ga0207639_103399362 | 155 |
| 530 | 3300026067 | Ga0207678_10059926 | Ga0207678_100599262 | 155 |
| 531 | 3300026067 | Ga0207678_10086891 | Ga0207678_100868912 | 155 |
| 532 | 3300026067 | Ga0207678_10385440 | Ga0207678_103854402 | 155 |
| 533 | 3300026067 | Ga0207678_10386594 | Ga0207678_103865942 | 155 |
| 534 | 3300026075 | Ga0207708_10156192 | Ga0207708_101561923 | 155 |
| 535 | 3300026078 | Ga0207702_10046176 | Ga0207702_100461763 | 155 |
| 536 | 3300026078 | Ga0207702_11078602 | Ga0207702_110786022 | 155 |
| 537 | 3300026078 | Ga0207702_11107518 | Ga0207702_111075182 | 155 |
| 538 | 3300026088 | Ga0207641_10001726 | Ga0207641_100017269 | 155 |
| 539 | 3300026089 | Ga0207648_10000032 | Ga0207648_1000003246 | 155 |
| 540 | 3300026089 | Ga0207648_10017579 | Ga0207648_100175796 | 155 |
| 541 | 3300026089 | Ga0207648_10032114 | Ga0207648_100321145 | 155 |
| 542 | 3300026089 | Ga0207648_10205864 | Ga0207648_102058642 | 155 |
| 543 | 3300026089 | Ga0207648_10368277 | Ga0207648_103682772 | 155 |
| 544 | 3300026089 | Ga0207648_10583581 | Ga0207648_105835811 | 155 |
| 545 | 3300026089 | Ga0207648_10696885 | Ga0207648_106968852 | 155 |
| 546 | 3300026095 | Ga0207676_10003149 | Ga0207676_100031492 | 155 |
| 547 | 3300026116 | Ga0207674_10349962 | Ga0207674_103499621 | 155 |
| 548 | 3300026116 | Ga0207674_10540395 | Ga0207674_105403952 | 155 |
| 549 | 3300026116 | Ga0207674_11276771 | Ga0207674_112767712 | 155 |
| 550 | 3300026118 | Ga0207675_100109629 | Ga0207675_1001096293 | 155 |
| 551 | 3300026121 | Ga0207683_10010783 | Ga0207683_100107833 | 155 |
| 552 | 3300026121 | Ga0207683_10030115 | Ga0207683_100301153 | 155 |
| 553 | 3300026121 | Ga0207683_10032771 | Ga0207683_100327713 | 155 |
| 554 | 3300026121 | Ga0207683_10558013 | Ga0207683_105580132 | 155 |
| 555 | 3300026142 | Ga0207698_10004168 | Ga0207698_100041684 | 155 |
| 556 | 3300026142 | Ga0207698_10022533 | Ga0207698_100225335 | 155 |
| 557 | 3300026142 | Ga0207698_10024501 | Ga0207698_100245013 | 155 |
| 558 | 3300026142 | Ga0207698_10060126 | Ga0207698_100601264 | 155 |
| 559 | 3300026142 | Ga0207698_10329259 | Ga0207698_103292592 | 155 |
| 560 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005884 | 155 |
| 561 | 3300027111 | Ga0209281_1000104 | Ga0209281_1000104161 | 155 |
| 562 | 3300027665 | Ga0209983_1051536 | Ga0209983_10515361 | 155 |
| 563 | 3300027666 | Ga0209282_1000109 | Ga0209282_100010922 | 155 |
| 564 | 3300027876 | Ga0209974_10005579 | Ga0209974_100055795 | 155 |
| 565 | 3300027876 | Ga0209974_10091046 | Ga0209974_100910462 | 155 |
| 566 | 3300027876 | Ga0209974_10146591 | Ga0209974_101465912 | 155 |
| 567 | 3300028379 | Ga0268266_10107424 | Ga0268266_101074242 | 155 |
| 568 | 3300028379 | Ga0268266_11581600 | Ga0268266_115816002 | 155 |
| 569 | 3300028380 | Ga0268265_10029913 | Ga0268265_100299135 | 155 |
| 570 | 3300028380 | Ga0268265_10204653 | Ga0268265_102046532 | 155 |
| 571 | 3300028380 | Ga0268265_11174997 | Ga0268265_111749972 | 155 |
| 572 | 3300028381 | Ga0268264_10065396 | Ga0268264_100653964 | 155 |
| 573 | 3300028381 | Ga0268264_10195084 | Ga0268264_101950842 | 155 |
| 574 | 3300028794 | Ga0307515_10000842 | Ga0307515_1000084250 | 155 |
| 575 | 3300028794 | Ga0307515_10001088 | Ga0307515_1000108838 | 155 |
| 576 | 3300028794 | Ga0307515_10001640 | Ga0307515_1000164028 | 155 |
| 577 | 3300028794 | Ga0307515_10020481 | Ga0307515_100204814 | 155 |
| 578 | 3300028794 | Ga0307515_10064179 | Ga0307515_100641795 | 155 |
| 579 | 3300028794 | Ga0307515_10109248 | Ga0307515_101092483 | 155 |
| 580 | 3300028794 | Ga0307515_10166309 | Ga0307515_101663092 | 155 |
| 581 | 3300028794 | Ga0307515_10233339 | Ga0307515_102333392 | 155 |
| 582 | 3300030522 | Ga0307512_10045218 | Ga0307512_100452184 | 155 |
| 583 | 3300030522 | Ga0307512_10065075 | Ga0307512_100650752 | 155 |
| 584 | 3300030731 | Ga0316177_1071860 | Ga0316177_10718603 | 155 |
| 585 | 3300030731 | Ga0316177_1155855 | Ga0316177_11558552 | 155 |
| 586 | 3300030732 | Ga0316176_1148086 | Ga0316176_11480863 | 155 |
| 587 | 3300030733 | Ga0314311_1122598 | Ga0314311_11225982 | 155 |
| 588 | 3300030735 | Ga0316178_1138608 | Ga0316178_11386084 | 155 |
| 589 | 3300030736 | Ga0316180_1073464 | Ga0316180_10734642 | 155 |
| 590 | 3300030742 | Ga0316183_1020296 | Ga0316183_10202963 | 155 |
| 591 | 3300030744 | Ga0316181_1106329 | Ga0316181_11063292 | 155 |
| 592 | 3300031238 | Ga0265332_10008074 | Ga0265332_100080744 | 155 |
| 593 | 3300031238 | Ga0265332_10291341 | Ga0265332_102913412 | 155 |
| 594 | 3300031242 | Ga0265329_10036582 | Ga0265329_100365822 | 155 |
| 595 | 3300031250 | Ga0265331_10058291 | Ga0265331_100582913 | 155 |
| 596 | 3300031251 | Ga0265327_10000814 | Ga0265327_1000081410 | 155 |
| 597 | 3300031251 | Ga0265327_10006291 | Ga0265327_100062917 | 155 |
| 598 | 3300031456 | Ga0307513_10000019 | Ga0307513_1000001916 | 155 |
| 599 | 3300031456 | Ga0307513_10000051 | Ga0307513_10000051112 | 155 |
| 600 | 3300031456 | Ga0307513_10026043 | Ga0307513_100260432 | 155 |
| 601 | 3300031456 | Ga0307513_10217505 | Ga0307513_102175052 | 155 |
| 602 | 3300031456 | Ga0307513_10438385 | Ga0307513_104383851 | 155 |
| 603 | 3300031456 | Ga0307513_10467479 | Ga0307513_104674792 | 155 |
| 604 | 3300031507 | Ga0307509_10094623 | Ga0307509_100946233 | 155 |
| 605 | 3300031548 | Ga0307408_100000099 | Ga0307408_10000009931 | 155 |
| 606 | 3300031548 | Ga0307408_100000193 | Ga0307408_10000019347 | 155 |
| 607 | 3300031548 | Ga0307408_100019885 | Ga0307408_1000198854 | 155 |
| 608 | 3300031548 | Ga0307408_100028902 | Ga0307408_1000289025 | 155 |
| 609 | 3300031548 | Ga0307408_100040951 | Ga0307408_1000409513 | 155 |
| 610 | 3300031548 | Ga0307408_100318652 | Ga0307408_1003186522 | 155 |
| 611 | 3300031548 | Ga0307408_100430099 | Ga0307408_1004300992 | 155 |
| 612 | 3300031548 | Ga0307408_100544456 | Ga0307408_1005444562 | 155 |
| 613 | 3300031616 | Ga0307508_10002774 | Ga0307508_1000277416 | 155 |
| 614 | 3300031649 | Ga0307514_10002956 | Ga0307514_100029563 | 155 |
| 615 | 3300031649 | Ga0307514_10013325 | Ga0307514_100133256 | 155 |
| 616 | 3300031711 | Ga0265314_10013361 | Ga0265314_100133614 | 155 |
| 617 | 3300031711 | Ga0265314_10049626 | Ga0265314_100496263 | 155 |
| 618 | 3300031730 | Ga0307516_10004540 | Ga0307516_100045403 | 155 |
| 619 | 3300031730 | Ga0307516_10006152 | Ga0307516_100061523 | 155 |
| 620 | 3300031730 | Ga0307516_10222875 | Ga0307516_102228751 | 155 |
| 621 | 3300031730 | Ga0307516_10266001 | Ga0307516_102660011 | 155 |
| 622 | 3300031730 | Ga0307516_10271164 | Ga0307516_102711641 | 155 |
| 623 | 3300031731 | Ga0307405_10314292 | Ga0307405_103142922 | 155 |
| 624 | 3300031731 | Ga0307405_11084002 | Ga0307405_110840021 | 155 |
| 625 | 3300031824 | Ga0307413_11076597 | Ga0307413_110765971 | 155 |
| 626 | 3300031852 | Ga0307410_10741619 | Ga0307410_107416192 | 155 |
| 627 | 3300031901 | Ga0307406_10009579 | Ga0307406_100095793 | 155 |
| 628 | 3300031901 | Ga0307406_10016378 | Ga0307406_100163782 | 155 |
| 629 | 3300031901 | Ga0307406_10188553 | Ga0307406_101885532 | 155 |
| 630 | 3300031901 | Ga0307406_10514283 | Ga0307406_105142832 | 155 |
| 631 | 3300031901 | Ga0307406_10822053 | Ga0307406_108220532 | 155 |
| 632 | 3300031903 | Ga0307407_10047314 | Ga0307407_100473143 | 155 |
| 633 | 3300031903 | Ga0307407_10426950 | Ga0307407_104269502 | 155 |
| 634 | 3300031911 | Ga0307412_10037116 | Ga0307412_100371164 | 155 |
| 635 | 3300031911 | Ga0307412_10057816 | Ga0307412_100578163 | 155 |
| 636 | 3300031911 | Ga0307412_10065081 | Ga0307412_100650813 | 155 |
| 637 | 3300031911 | Ga0307412_10480906 | Ga0307412_104809062 | 155 |
| 638 | 3300031911 | Ga0307412_11115782 | Ga0307412_111157821 | 155 |
| 639 | 3300031995 | Ga0307409_100183715 | Ga0307409_1001837153 | 155 |
| 640 | 3300031995 | Ga0307409_101749225 | Ga0307409_1017492251 | 155 |
| 641 | 3300032002 | Ga0307416_100023015 | Ga0307416_1000230154 | 155 |
| 642 | 3300032002 | Ga0307416_100068689 | Ga0307416_1000686892 | 155 |
| 643 | 3300032002 | Ga0307416_100312658 | Ga0307416_1003126582 | 155 |
| 644 | 3300032004 | Ga0307414_10008085 | Ga0307414_100080855 | 155 |
| 645 | 3300032004 | Ga0307414_10321315 | Ga0307414_103213152 | 155 |
| 646 | 3300032004 | Ga0307414_10482254 | Ga0307414_104822542 | 155 |
| 647 | 3300032004 | Ga0307414_10968353 | Ga0307414_109683532 | 155 |
| 648 | 3300032004 | Ga0307414_11013262 | Ga0307414_110132622 | 155 |
| 649 | 3300032005 | Ga0307411_10000548 | Ga0307411_100005487 | 155 |
| 650 | 3300032005 | Ga0307411_10077498 | Ga0307411_100774984 | 155 |
| 651 | 3300032005 | Ga0307411_10232700 | Ga0307411_102327002 | 155 |
| 652 | 3300032005 | Ga0307411_10262288 | Ga0307411_102622882 | 155 |
| 653 | 3300032005 | Ga0307411_10421808 | Ga0307411_104218082 | 155 |
| 654 | 3300032126 | Ga0307415_101103417 | Ga0307415_1011034172 | 155 |
| 655 | 3300032168 | Ga0316593_10009836 | Ga0316593_100098362 | 155 |
| 656 | 3300033180 | Ga0307510_10000311 | Ga0307510_100003119 | 155 |
| 657 | 3300034818 | Ga0373950_0003412 | Ga0373950_0003412_1434_1901 | 155 |
| 658 | 3300034820 | Ga0373959_0058069 | Ga0373959_0058069_182_649 | 155 |
| 659 | 3300035089 | Ga0373944_0058770 | Ga0373944_0058770_664_1131 | 155 |
| 660 | 3300035091 | Ga0373951_0029584 | Ga0373951_0029584_35_502 | 155 |
| 661 | 3300035114 | Ga0373939_0000006 | Ga0373939_0000006_49556_50023 | 155 |
| 662 | 3300035121 | Ga0373960_0000041 | Ga0373960_0000041_433_900 | 155 |
| 663 | 3300035171 | Ga0373946_0107776 | Ga0373946_0107776_564_1031 | 155 |
| 664 | 3300035691 | Ga0373931_0000514 | Ga0373931_0000514_11261_11728 | 155 |
| 665 | 3300036401 | Ga0373937_0265951 | Ga0373937_0265951_126_593 | 155 |
| 666 | 3300037312 | Ga0395899_0003079 | Ga0395899_0003079_12301_12768 | 155 |
| 667 | 3300037312 | Ga0395899_0008624 | Ga0395899_0008624_3414_3881 | 155 |
| 668 | 3300037312 | Ga0395899_0111358 | Ga0395899_0111358_735_1202 | 155 |
| 669 | 3300037312 | Ga0395899_0260826 | Ga0395899_0260826_662_1129 | 155 |
| 670 | 3300037418 | Ga0395900_0000054 | Ga0395900_0000054_48489_48956 | 155 |
| 671 | 3300037418 | Ga0395900_0026485 | Ga0395900_0026485_1839_2306 | 155 |
| 672 | 3300037418 | Ga0395900_0064720 | Ga0395900_0064720_1799_2266 | 155 |
| 673 | 3300037418 | Ga0395900_0111316 | Ga0395900_0111316_1870_2337 | 155 |
| 674 | 3300037418 | Ga0395900_0411167 | Ga0395900_0411167_223_690 | 155 |
| 675 | 3300037418 | Ga0395900_0572708 | Ga0395900_0572708_591_1058 | 155 |
| 676 | 3300037466 | Ga0395898_0000798 | Ga0395898_0000798_31806_32273 | 155 |
| 677 | 3300037466 | Ga0395898_0425136 | Ga0395898_0425136_291_758 | 155 |
| 678 | 3300037466 | Ga0395898_0472253 | Ga0395898_0472253_382_849 | 155 |
| 679 | 3300037471 | Ga0395905_0000148 | Ga0395905_0000148_17645_18112 | 155 |
| 680 | 3300037471 | Ga0395905_0001062 | Ga0395905_0001062_10121_10588 | 155 |
| 681 | 3300037471 | Ga0395905_0002549 | Ga0395905_0002549_7497_7967 | 155 |
| 682 | 3300037471 | Ga0395905_0003187 | Ga0395905_0003187_8005_8472 | 155 |
| 683 | 3300037471 | Ga0395905_0016333 | Ga0395905_0016333_709_1176 | 155 |
| 684 | 3300037471 | Ga0395905_0030153 | Ga0395905_0030153_1957_2424 | 155 |
| 685 | 3300037471 | Ga0395905_0049497 | Ga0395905_0049497_2041_2508 | 155 |
| 686 | 3300037471 | Ga0395905_0049955 | Ga0395905_0049955_1784_2251 | 155 |
| 687 | 3300037471 | Ga0395905_0101793 | Ga0395905_0101793_1144_1611 | 155 |
| 688 | 3300037471 | Ga0395905_0323338 | Ga0395905_0323338_202_669 | 155 |
| 689 | 3300037471 | Ga0395905_0388293 | Ga0395905_0388293_656_1126 | 155 |
| 690 | 3300037471 | Ga0395905_0695531 | Ga0395905_0695531_292_759 | 155 |
| 691 | 3300037471 | Ga0395905_1294698 | Ga0395905_1294698_65_532 | 155 |
| 692 | 3300038443 | Ga0395901_0012708 | Ga0395901_0012708_2709_3176 | 155 |
| 693 | 3300038443 | Ga0395901_0085741 | Ga0395901_0085741_1679_2146 | 155 |
| 694 | 3300038443 | Ga0395901_0119190 | Ga0395901_0119190_2274_2741 | 155 |
| 695 | 3300038443 | Ga0395901_0121303 | Ga0395901_0121303_169_636 | 155 |
| 696 | 3300038443 | Ga0395901_0173517 | Ga0395901_0173517_1445_1912 | 155 |
| 697 | 3300038443 | Ga0395901_0176105 | Ga0395901_0176105_667_1134 | 155 |
| 698 | 3300038443 | Ga0395901_0187430 | Ga0395901_0187430_1322_1789 | 155 |
| 699 | 3300038443 | Ga0395901_0266367 | Ga0395901_0266367_608_1075 | 155 |
| 700 | 3300038443 | Ga0395901_0311735 | Ga0395901_0311735_273_740 | 155 |
| 701 | 3300039437 | Ga0436365_0161847 | Ga0436365_0161847_14_481 | 155 |
| 702 | 3300039437 | Ga0436365_0872657 | Ga0436365_0872657_157_624 | 155 |
| 703 | 3300041404 | Ga0439436_0000392 | Ga0439436_0000392_1738_2205 | 155 |
| 704 | 3300041404 | Ga0439436_0002953 | Ga0439436_0002953_1879_2346 | 155 |
| 705 | 3300041404 | Ga0439436_0013763 | Ga0439436_0013763_1742_2209 | 155 |
| 706 | 3300041406 | Ga0439439_0013953 | Ga0439439_0013953_672_1139 | 155 |
| 707 | 3300041406 | Ga0439439_0051148 | Ga0439439_0051148_450_917 | 155 |
| 708 | 3300041406 | Ga0439439_0114708 | Ga0439439_0114708_203_670 | 155 |
| 709 | 3300041406 | Ga0439439_0138768 | Ga0439439_0138768_28_495 | 155 |
| 710 | 3300041407 | Ga0439447_009228 | Ga0439447_009228_1234_1701 | 155 |
| 711 | 3300041407 | Ga0439447_032624 | Ga0439447_032624_618_1085 | 155 |
| 712 | 3300041410 | Ga0439461_0001378 | Ga0439461_0001378_1555_2022 | 155 |
| 713 | 3300041410 | Ga0439461_0007060 | Ga0439461_0007060_47_514 | 155 |
| 714 | 3300041411 | Ga0439466_0008881 | Ga0439466_0008881_1978_2445 | 155 |
| 715 | 3300041411 | Ga0439466_0015610 | Ga0439466_0015610_361_828 | 155 |
| 716 | 3300041413 | Ga0439465_0000387 | Ga0439465_0000387_12083_12550 | 155 |
| 717 | 3300041413 | Ga0439465_0094931 | Ga0439465_0094931_280_747 | 155 |
| 718 | 3300041451 | Ga0451791_1261760 | Ga0451791_1261760_246_713 | 155 |
| 719 | 3300041460 | Ga0451802_0405913 | Ga0451802_0405913_19_486 | 155 |
| 720 | 3300041463 | Ga0451804_0865208 | Ga0451804_0865208_69_536 | 155 |
| 721 | 3300041491 | Ga0451833_1215784 | Ga0451833_1215784_247_714 | 155 |
| 722 | 3300041491 | Ga0451833_1425945 | Ga0451833_1425945_153_620 | 155 |
| 723 | 3300041498 | Ga0451841_0537712 | Ga0451841_0537712_148_615 | 155 |
| 724 | 3300041498 | Ga0451841_0963024 | Ga0451841_0963024_43_510 | 155 |
| 725 | 3300041511 | Ga0451855_0271653 | Ga0451855_0271653_174_641 | 155 |
| 726 | 3300041512 | Ga0451853_1667522 | Ga0451853_1667522_56_523 | 155 |
| 727 | 3300041997 | Ga0439431_0001219 | Ga0439431_0001219_3516_3983 | 155 |
| 728 | 3300041999 | Ga0439433_0000473 | Ga0439433_0000473_4077_4544 | 155 |
| 729 | 3300042000 | Ga0439437_005415 | Ga0439437_005415_37_504 | 155 |
| 730 | 3300042000 | Ga0439437_019870 | Ga0439437_019870_33_500 | 155 |
| 731 | 3300042002 | Ga0439442_004083 | Ga0439442_004083_1182_1649 | 155 |
| 732 | 3300042003 | Ga0439443_032008 | Ga0439443_032008_110_577 | 155 |
| 733 | 3300042004 | Ga0439445_0000712 | Ga0439445_0000712_2652_3119 | 155 |
| 734 | 3300042004 | Ga0439445_0027176 | Ga0439445_0027176_593_1060 | 155 |
| 735 | 3300042004 | Ga0439445_0047170 | Ga0439445_0047170_158_625 | 155 |
| 736 | 3300042006 | Ga0439432_002602 | Ga0439432_002602_1291_1758 | 155 |
| 737 | 3300042006 | Ga0439432_019440 | Ga0439432_019440_175_642 | 155 |
| 738 | 3300042007 | Ga0439449_0002379 | Ga0439449_0002379_5373_5840 | 155 |
| 739 | 3300042007 | Ga0439449_0003757 | Ga0439449_0003757_1714_2181 | 155 |
| 740 | 3300042007 | Ga0439449_0005865 | Ga0439449_0005865_1618_2085 | 155 |
| 741 | 3300042007 | Ga0439449_0006097 | Ga0439449_0006097_3760_4227 | 155 |
| 742 | 3300042007 | Ga0439449_0010161 | Ga0439449_0010161_285_752 | 155 |
| 743 | 3300042007 | Ga0439449_0049957 | Ga0439449_0049957_408_875 | 155 |
| 744 | 3300042010 | Ga0439452_000611 | Ga0439452_000611_11393_11860 | 155 |
| 745 | 3300042010 | Ga0439452_062410 | Ga0439452_062410_324_791 | 155 |
| 746 | 3300042011 | Ga0439454_068024 | Ga0439454_068024_26_493 | 155 |
| 747 | 3300042014 | Ga0439457_002909 | Ga0439457_002909_2876_3343 | 155 |
| 748 | 3300042014 | Ga0439457_013201 | Ga0439457_013201_1157_1624 | 155 |
| 749 | 3300042015 | Ga0439462_0004945 | Ga0439462_0004945_644_1111 | 155 |
| 750 | 3300042015 | Ga0439462_0123858 | Ga0439462_0123858_139_606 | 155 |
| 751 | 3300042116 | Ga0450912_024875 | Ga0450912_024875_17_484 | 155 |
| 752 | 3300042117 | Ga0450913_001575 | Ga0450913_001575_511_978 | 155 |
| 753 | 3300042121 | Ga0450919_000992 | Ga0450919_000992_347_814 | 155 |
| 754 | 3300042122 | Ga0450920_009242 | Ga0450920_009242_840_1307 | 155 |
| 755 | 3300042122 | Ga0450920_025575 | Ga0450920_025575_607_1074 | 155 |
| 756 | 3300042123 | Ga0450921_000320 | Ga0450921_000320_1611_2078 | 155 |
| 757 | 3300042125 | Ga0450923_001819 | Ga0450923_001819_607_1074 | 155 |
| 758 | 3300042126 | Ga0450888_000719 | Ga0450888_000719_1158_1625 | 155 |
| 759 | 3300042127 | Ga0450890_006388 | Ga0450890_006388_80_547 | 155 |
| 760 | 3300042127 | Ga0450890_019152 | Ga0450890_019152_346_813 | 155 |
| 761 | 3300042129 | Ga0450891_000123 | Ga0450891_000123_3321_3788 | 155 |
| 762 | 3300042130 | Ga0450892_001446 | Ga0450892_001446_1030_1497 | 155 |
| 763 | 3300042132 | Ga0450895_021983 | Ga0450895_021983_45_512 | 155 |
| 764 | 3300042133 | Ga0450896_008927 | Ga0450896_008927_302_769 | 155 |
| 765 | 3300042133 | Ga0450896_012842 | Ga0450896_012842_442_909 | 155 |
| 766 | 3300042134 | Ga0450898_004928 | Ga0450898_004928_399_866 | 155 |
| 767 | 3300042137 | Ga0450902_008791 | Ga0450902_008791_879_1346 | 155 |
| 768 | 3300042144 | Ga0450889_000176 | Ga0450889_000176_5073_5540 | 155 |
| 769 | 3300042145 | Ga0450906_007423 | Ga0450906_007423_1130_1597 | 155 |
| 770 | 3300042145 | Ga0450906_009590 | Ga0450906_009590_73_540 | 155 |
| 771 | 3300042146 | Ga0450907_014618 | Ga0450907_014618_514_981 | 155 |
| 772 | 3300042147 | Ga0450910_005526 | Ga0450910_005526_1060_1527 | 155 |
| 773 | 3300042156 | Ga0439446_0029700 | Ga0439446_0029700_190_657 | 155 |
| 774 | 3300042184 | Ga0450908_004328 | Ga0450908_004328_1139_1606 | 155 |
| 775 | 3300042184 | Ga0450908_004926 | Ga0450908_004926_1130_1597 | 155 |
| 776 | 3300042185 | Ga0450909_004479 | Ga0450909_004479_837_1304 | 155 |
| 777 | 3300042435 | Ga0439434_0003045 | Ga0439434_0003045_2842_3309 | 155 |
| 778 | 3300042435 | Ga0439434_0004381 | Ga0439434_0004381_1656_2123 | 155 |
| 779 | 3300042435 | Ga0439434_0038955 | Ga0439434_0038955_338_805 | 155 |
| 780 | 3300042436 | Ga0439435_0124557 | Ga0439435_0124557_232_699 | 155 |
| 781 | 3300042439 | Ga0439464_0010780 | Ga0439464_0010780_1342_1809 | 155 |
| 782 | 3300042530 | Ga0450916_067619 | Ga0450916_067619_79_546 | 155 |
| 783 | 3300042531 | Ga0450918_000264 | Ga0450918_000264_2049_2516 | 155 |
| 784 | 3300042531 | Ga0450918_001423 | Ga0450918_001423_4004_4471 | 155 |
| 785 | 3300042532 | Ga0450893_0010771 | Ga0450893_0010771_328_795 | 155 |
| 786 | 3300042532 | Ga0450893_0020353 | Ga0450893_0020353_39_506 | 155 |
| 787 | 3300042876 | Ga0451577_0144388 | Ga0451577_0144388_992_1459 | 155 |
| 788 | 3300042876 | Ga0451577_0191062 | Ga0451577_0191062_757_1224 | 155 |
| 789 | 3300044656 | Ga0466969_0000054 | Ga0466969_0000054_43474_43944 | 155 |
| 790 | 3300044656 | Ga0466969_0010663 | Ga0466969_0010663_3846_4313 | 155 |
| 791 | 3300044673 | Ga0453683_0002845 | Ga0453683_0002845_12618_13085 | 155 |
| 792 | 3300044683 | Ga0466965_0088633 | Ga0466965_0088633_221_688 | 155 |
| 793 | 3300044683 | Ga0466965_0094149 | Ga0466965_0094149_597_1067 | 155 |
| 794 | 3300044683 | Ga0466965_0405699 | Ga0466965_0405699_173_640 | 155 |
| 795 | 3300044684 | Ga0466966_0002469 | Ga0466966_0002469_928_1395 | 155 |
| 796 | 3300044684 | Ga0466966_0011535 | Ga0466966_0011535_1569_2036 | 155 |
| 797 | 3300044693 | Ga0466961_0059317 | Ga0466961_0059317_320_787 | 155 |
| 798 | 3300044693 | Ga0466961_0226434 | Ga0466961_0226434_268_735 | 155 |
| 799 | 3300044706 | Ga0466964_0005457 | Ga0466964_0005457_2815_3282 | 155 |
| 800 | 3300044712 | Ga0453684_0361044 | Ga0453684_0361044_899_1366 | 155 |
| 801 | 3300044712 | Ga0453684_0370975 | Ga0453684_0370975_723_1190 | 155 |
| 802 | 3300044712 | Ga0453684_1601680 | Ga0453684_1601680_179_646 | 155 |
| 803 | 3300044719 | Ga0466971_0007746 | Ga0466971_0007746_365_832 | 155 |
| 804 | 3300044719 | Ga0466971_0326792 | Ga0466971_0326792_47_514 | 155 |
| 805 | 3300044765 | Ga0466970_0009993 | Ga0466970_0009993_3605_4072 | 155 |
| 806 | 3300044765 | Ga0466970_0047180 | Ga0466970_0047180_156_626 | 155 |
| 807 | 3300044842 | Ga0466957_0099067 | Ga0466957_0099067_642_1109 | 155 |
| 808 | 3300044842 | Ga0466957_0184812 | Ga0466957_0184812_589_1056 | 155 |
| 809 | 3300044842 | Ga0466957_0668137 | Ga0466957_0668137_184_651 | 155 |
| 810 | 3300044901 | Ga0466960_0028787 | Ga0466960_0028787_525_992 | 155 |
| 811 | 3300044901 | Ga0466960_0239453 | Ga0466960_0239453_476_943 | 155 |
| 812 | 3300045049 | Ga0466959_0000528 | Ga0466959_0000528_2821_3288 | 155 |
| 813 | 3300045049 | Ga0466959_0104843 | Ga0466959_0104843_442_909 | 155 |
| 814 | 3300045051 | Ga0451576_0072525 | Ga0451576_0072525_2172_2639 | 155 |
| 815 | 3300045051 | Ga0451576_0099477 | Ga0451576_0099477_1143_1610 | 155 |
| 816 | 3300045051 | Ga0451576_0146107 | Ga0451576_0146107_1239_1706 | 155 |
| 817 | 3300045051 | Ga0451576_0269778 | Ga0451576_0269778_532_999 | 155 |
| 818 | 3300045051 | Ga0451576_1148854 | Ga0451576_1148854_83_550 | 155 |
| 819 | 3300045976 | Ga0466967_0627724 | Ga0466967_0627724_119_586 | 155 |
| 820 | 3300045976 | Ga0466967_2472295 | Ga0466967_2472295_27_494 | 155 |
| 821 | 3300046453 | Ga0495627_007791 | Ga0495627_007791_2274_2741 | 155 |
| 822 | 3300046453 | Ga0495627_020910 | Ga0495627_020910_968_1435 | 155 |
| 823 | 3300046459 | Ga0495629_0104012 | Ga0495629_0104012_995_1462 | 155 |
| 824 | 3300046459 | Ga0495629_0717846 | Ga0495629_0717846_95_562 | 155 |
| 825 | 3300046460 | Ga0495638_0043532 | Ga0495638_0043532_2301_2768 | 155 |
| 826 | 3300046460 | Ga0495638_0063325 | Ga0495638_0063325_1650_2117 | 155 |
| 827 | 3300046462 | Ga0495651_0070658 | Ga0495651_0070658_305_772 | 155 |
| 828 | 3300046463 | Ga0495653_0133775 | Ga0495653_0133775_1078_1545 | 155 |
| 829 | 3300046475 | Ga0495639_0122426 | Ga0495639_0122426_602_1069 | 155 |
| 830 | 3300046512 | Ga0495610_0010849 | Ga0495610_0010849_725_1192 | 155 |
| 831 | 3300046512 | Ga0495610_0020359 | Ga0495610_0020359_3036_3503 | 155 |
| 832 | 3300046512 | Ga0495610_0085259 | Ga0495610_0085259_387_854 | 155 |
| 833 | 3300046512 | Ga0495610_0392893 | Ga0495610_0392893_10_477 | 155 |
| 834 | 3300046513 | Ga0495616_0000722 | Ga0495616_0000722_21120_21587 | 155 |
| 835 | 3300046514 | Ga0495618_0138797 | Ga0495618_0138797_698_1165 | 155 |
| 836 | 3300046514 | Ga0495618_0345519 | Ga0495618_0345519_170_637 | 155 |
| 837 | 3300046515 | Ga0495620_0021122 | Ga0495620_0021122_740_1207 | 155 |
| 838 | 3300046518 | Ga0495631_0000446 | Ga0495631_0000446_24940_25407 | 155 |
| 839 | 3300046519 | Ga0495632_0117942 | Ga0495632_0117942_646_1113 | 155 |
| 840 | 3300046520 | Ga0495637_0028290 | Ga0495637_0028290_752_1219 | 155 |
| 841 | 3300046522 | Ga0495643_0064789 | Ga0495643_0064789_832_1299 | 155 |
| 842 | 3300046525 | Ga0495663_0099688 | Ga0495663_0099688_444_911 | 155 |
| 843 | 3300046528 | Ga0495642_0038373 | Ga0495642_0038373_827_1294 | 155 |
| 844 | 3300046530 | Ga0495654_0014862 | Ga0495654_0014862_927_1394 | 155 |
| 845 | 3300046530 | Ga0495654_0016539 | Ga0495654_0016539_375_842 | 155 |
| 846 | 3300046538 | Ga0495609_0248669 | Ga0495609_0248669_186_653 | 155 |
| 847 | 3300046539 | Ga0495621_0009160 | Ga0495621_0009160_221_688 | 155 |
| 848 | 3300046539 | Ga0495621_0100588 | Ga0495621_0100588_263_730 | 155 |
| 849 | 3300046539 | Ga0495621_0109254 | Ga0495621_0109254_35_502 | 155 |
| 850 | 3300046539 | Ga0495621_0346171 | Ga0495621_0346171_96_563 | 155 |
| 851 | 3300046542 | Ga0495597_0001135 | Ga0495597_0001135_17037_17504 | 155 |
| 852 | 3300046557 | Ga0495622_0232948 | Ga0495622_0232948_146_613 | 155 |
| 853 | 3300046558 | Ga0495633_0002529 | Ga0495633_0002529_5782_6249 | 155 |
| 854 | 3300046558 | Ga0495633_0157967 | Ga0495633_0157967_175_642 | 155 |
| 855 | 3300046615 | Ga0495656_0001008 | Ga0495656_0001008_7359_7826 | 155 |
| 856 | 3300046615 | Ga0495656_0021519 | Ga0495656_0021519_1327_1794 | 155 |
| 857 | 3300046642 | Ga0495634_0352510 | Ga0495634_0352510_395_862 | 155 |
| 858 | 3300046660 | Ga0495625_0000396 | Ga0495625_0000396_43799_44266 | 155 |
| 859 | 3300046660 | Ga0495625_0020614 | Ga0495625_0020614_605_1072 | 155 |
| 860 | 3300046663 | Ga0495635_0230945 | Ga0495635_0230945_660_1127 | 155 |
| 861 | 3300046665 | Ga0495661_0101423 | Ga0495661_0101423_1075_1542 | 155 |
| 862 | 3300046674 | Ga0495588_0008771 | Ga0495588_0008771_2857_3324 | 155 |
| 863 | 3300046674 | Ga0495588_0017519 | Ga0495588_0017519_1442_1909 | 155 |
| 864 | 3300046674 | Ga0495588_0022794 | Ga0495588_0022794_1765_2232 | 155 |
| 865 | 3300046678 | Ga0495599_0210546 | Ga0495599_0210546_24_491 | 155 |
| 866 | 3300046683 | Ga0495658_0097627 | Ga0495658_0097627_264_731 | 155 |
| 867 | 3300046683 | Ga0495658_0263080 | Ga0495658_0263080_95_562 | 155 |
| 868 | 3300046691 | Ga0495670_0069830 | Ga0495670_0069830_263_730 | 155 |
| 869 | 3300046692 | Ga0495671_0006709 | Ga0495671_0006709_3728_4195 | 155 |
| 870 | 3300046809 | Ga0495600_0115925 | Ga0495600_0115925_1256_1723 | 155 |
| 871 | 3300046809 | Ga0495600_0207404 | Ga0495600_0207404_611_1078 | 155 |
| 872 | 3300046809 | Ga0495600_0622530 | Ga0495600_0622530_150_617 | 155 |
| 873 | 3300046810 | Ga0495660_0044178 | Ga0495660_0044178_447_914 | 155 |
| 874 | 3300047315 | Ga0495581_0296453 | Ga0495581_0296453_337_804 | 155 |
| 875 | 3300047321 | Ga0495676_0050590 | Ga0495676_0050590_548_1015 | 155 |
| 876 | 3300047443 | Ga0495687_203076 | Ga0495687_203076_136_603 | 155 |
| 877 | 3300047470 | Ga0495681_0113426 | Ga0495681_0113426_400_867 | 155 |
| 878 | 3300047472 | Ga0495686_0005856 | Ga0495686_0005856_7253_7720 | 155 |
| 879 | 3300047673 | Ga0495593_0005694 | Ga0495593_0005694_4821_5288 | 155 |
| 880 | 3300047673 | Ga0495593_0098558 | Ga0495593_0098558_664_1131 | 155 |
| 881 | 3300047673 | Ga0495593_0631470 | Ga0495593_0631470_10_477 | 155 |
| 882 | 3300048088 | Ga0495602_0459912 | Ga0495602_0459912_280_747 | 155 |
| 883 | 3300048089 | Ga0495614_0008498 | Ga0495614_0008498_4019_4486 | 155 |
| 884 | 3300048090 | Ga0495615_0023364 | Ga0495615_0023364_511_978 | 155 |
| 885 | 3300048090 | Ga0495615_0172772 | Ga0495615_0172772_46_513 | 155 |
| 886 | 3300048903 | Ga0496100_0078272 | Ga0496100_0078272_652_1119 | 155 |
| 887 | 3300048903 | Ga0496100_1402725 | Ga0496100_1402725_29_496 | 155 |
| 888 | 3300048904 | Ga0496101_0042961 | Ga0496101_0042961_938_1405 | 155 |
| 889 | 3300048905 | Ga0496102_0032292 | Ga0496102_0032292_1643_2110 | 155 |
| 890 | 3300048905 | Ga0496102_0032877 | Ga0496102_0032877_1111_1578 | 155 |
| 891 | 3300048905 | Ga0496102_0036331 | Ga0496102_0036331_162_629 | 155 |
| 892 | 3300048906 | Ga0496103_0211580 | Ga0496103_0211580_583_1050 | 155 |
| 893 | 3300048907 | Ga0496104_0464865 | Ga0496104_0464865_249_716 | 155 |
| 894 | 3300048908 | Ga0496105_0028533 | Ga0496105_0028533_3117_3584 | 155 |
| 895 | 3300048908 | Ga0496105_0197976 | Ga0496105_0197976_152_619 | 155 |
| 896 | 3300048909 | Ga0496106_0047925 | Ga0496106_0047925_711_1178 | 155 |
| 897 | 3300048910 | Ga0496107_0248541 | Ga0496107_0248541_158_625 | 155 |
| 898 | 3300048915 | Ga0496112_0345553 | Ga0496112_0345553_93_560 | 155 |
| 899 | 3300048916 | Ga0496113_1385750 | Ga0496113_1385750_44_511 | 155 |
| 900 | 3300048917 | Ga0496114_0056546 | Ga0496114_0056546_393_860 | 155 |
| 901 | 3300048917 | Ga0496114_0368850 | Ga0496114_0368850_399_866 | 155 |
| 902 | 3300048917 | Ga0496114_0472552 | Ga0496114_0472552_310_777 | 155 |
| 903 | 3300048919 | Ga0496116_0025554 | Ga0496116_0025554_3701_4168 | 155 |
| 904 | 3300048920 | Ga0496117_0044176 | Ga0496117_0044176_286_753 | 155 |
| 905 | 3300048920 | Ga0496117_0045056 | Ga0496117_0045056_1533_2000 | 155 |
| 906 | 3300048921 | Ga0496118_0050037 | Ga0496118_0050037_431_898 | 155 |
| 907 | 3300048921 | Ga0496118_0325976 | Ga0496118_0325976_81_548 | 155 |
| 908 | 3300048924 | Ga0496121_0022936 | Ga0496121_0022936_1585_2052 | 155 |
| 909 | 3300048924 | Ga0496121_0244409 | Ga0496121_0244409_147_614 | 155 |
| 910 | 3300048925 | Ga0496122_0000688 | Ga0496122_0000688_63002_63469 | 155 |
| 911 | 3300048925 | Ga0496122_0069209 | Ga0496122_0069209_760_1227 | 155 |
| 912 | 3300048925 | Ga0496122_0101496 | Ga0496122_0101496_224_691 | 155 |
| 913 | 3300048925 | Ga0496122_0110935 | Ga0496122_0110935_401_868 | 155 |
| 914 | 3300048925 | Ga0496122_0293218 | Ga0496122_0293218_199_666 | 155 |
| 915 | 3300048925 | Ga0496122_0371799 | Ga0496122_0371799_116_583 | 155 |
| 916 | 3300048926 | Ga0496123_0001158 | Ga0496123_0001158_34531_34998 | 155 |
| 917 | 3300048926 | Ga0496123_0038770 | Ga0496123_0038770_569_1036 | 155 |
| 918 | 3300048926 | Ga0496123_0057248 | Ga0496123_0057248_58_525 | 155 |
| 919 | 3300048926 | Ga0496123_0131922 | Ga0496123_0131922_768_1235 | 155 |
| 920 | 3300048926 | Ga0496123_0161827 | Ga0496123_0161827_673_1140 | 155 |
| 921 | 3300048927 | Ga0496124_0052228 | Ga0496124_0052228_2620_3087 | 155 |
| 922 | 3300048927 | Ga0496124_0059351 | Ga0496124_0059351_1059_1526 | 155 |
| 923 | 3300048927 | Ga0496124_0077403 | Ga0496124_0077403_1793_2260 | 155 |
| 924 | 3300048927 | Ga0496124_0196762 | Ga0496124_0196762_629_1096 | 155 |
| 925 | 3300048928 | Ga0496125_0006625 | Ga0496125_0006625_3198_3665 | 155 |
| 926 | 3300048928 | Ga0496125_0017065 | Ga0496125_0017065_2406_2873 | 155 |
| 927 | 3300048928 | Ga0496125_0290512 | Ga0496125_0290512_128_595 | 155 |
| 928 | 3300048928 | Ga0496125_0341143 | Ga0496125_0341143_367_834 | 155 |
| 929 | 3300048928 | Ga0496125_0510420 | Ga0496125_0510420_11_478 | 155 |
| 930 | 3300048929 | Ga0496126_0035110 | Ga0496126_0035110_2153_2620 | 155 |
| 931 | 3300048929 | Ga0496126_0234437 | Ga0496126_0234437_962_1429 | 155 |
| 932 | 3300048929 | Ga0496126_0932713 | Ga0496126_0932713_149_616 | 155 |
| 933 | 3300049524 | Ga0501301_010670 | Ga0501301_010670_76_543 | 155 |
| 934 | 3300049531 | Ga0501315_019643 | Ga0501315_019643_313_780 | 155 |
| 935 | 3300049571 | Ga0501034_0247677 | Ga0501034_0247677_334_801 | 155 |
| 936 | 3300049573 | Ga0501037_0244588 | Ga0501037_0244588_150_617 | 155 |
| 937 | 3300049574 | Ga0501038_0606296 | Ga0501038_0606296_67_534 | 155 |
| 938 | 3300049579 | Ga0501043_0641387 | Ga0501043_0641387_239_706 | 155 |
| 939 | 3300049649 | Ga0501198_000044 | Ga0501198_000044_39170_39637 | 155 |
| 940 | 3300049662 | Ga0501222_000017 | Ga0501222_000017_36134_36601 | 155 |
| 941 | 3300049683 | Ga0501253_003212 | Ga0501253_003212_1351_1818 | 155 |
| 942 | 3300049822 | Ga0501035_0048271 | Ga0501035_0048271_2895_3362 | 155 |
| 943 | 3300049823 | Ga0501044_0278341 | Ga0501044_0278341_577_1044 | 155 |
| 944 | 3300050489 | nmdc:mga03683_132966_c1 | nmdc:mga03683_132966_c1_495_962 | 155 |
| 945 | 3300050489 | nmdc:mga03683_252889_c1 | nmdc:mga03683_252889_c1_98_565 | 155 |
| 946 | 3300050489 | nmdc:mga03683_32250_c1 | nmdc:mga03683_32250_c1_18_485 | 155 |
| 947 | 3300050489 | nmdc:mga03683_60337_c1 | nmdc:mga03683_60337_c1_113_580 | 155 |
| 948 | 3300050490 | nmdc:mga03n38_90616_c1 | nmdc:mga03n38_90616_c1_615_1082 | 155 |
| 949 | 3300050491 | nmdc:mga00v17_10018_c1 | nmdc:mga00v17_10018_c1_4120_4587 | 155 |
| 950 | 3300050491 | nmdc:mga00v17_665279_c1 | nmdc:mga00v17_665279_c1_183_650 | 155 |
| 951 | 3300050491 | nmdc:mga00v17_99525_c1 | nmdc:mga00v17_99525_c1_1315_1782 | 155 |
| 952 | 3300050492 | nmdc:mga0yw44_14269_c1 | nmdc:mga0yw44_14269_c1_1733_2200 | 155 |
| 953 | 3300050492 | nmdc:mga0yw44_309247_c1 | nmdc:mga0yw44_309247_c1_257_724 | 155 |
| 954 | 3300050493 | nmdc:mga0k408_14275_c2 | nmdc:mga0k408_14275_c2_1481_1948 | 155 |
| 955 | 3300050493 | nmdc:mga0k408_157357_c1 | nmdc:mga0k408_157357_c1_749_1216 | 155 |
| 956 | 3300050493 | nmdc:mga0k408_23067_c1 | nmdc:mga0k408_23067_c1_2819_3286 | 155 |
| 957 | 3300050493 | nmdc:mga0k408_28627_c1 | nmdc:mga0k408_28627_c1_1480_1947 | 155 |
| 958 | 3300050493 | nmdc:mga0k408_351820_c1 | nmdc:mga0k408_351820_c1_17_484 | 155 |
| 959 | 3300050493 | nmdc:mga0k408_36399_c1 | nmdc:mga0k408_36399_c1_129_596 | 155 |
| 960 | 3300050493 | nmdc:mga0k408_38912_c1 | nmdc:mga0k408_38912_c1_1283_1750 | 155 |
| 961 | 3300050493 | nmdc:mga0k408_445271_c1 | nmdc:mga0k408_445271_c1_285_752 | 155 |
| 962 | 3300050494 | nmdc:mga06z11_295078_c1 | nmdc:mga06z11_295078_c1_341_808 | 155 |
| 963 | 3300050494 | nmdc:mga06z11_556810_c1 | nmdc:mga06z11_556810_c1_170_637 | 155 |
| 964 | 3300050494 | nmdc:mga06z11_581398_c1 | nmdc:mga06z11_581398_c1_137_604 | 155 |
| 965 | 3300050496 | nmdc:mga07m45_11241_c1 | nmdc:mga07m45_11241_c1_4035_4502 | 155 |
| 966 | 3300050496 | nmdc:mga07m45_13172_c1 | nmdc:mga07m45_13172_c1_1698_2165 | 155 |
| 967 | 3300050496 | nmdc:mga07m45_21825_c1 | nmdc:mga07m45_21825_c1_2922_3389 | 155 |
| 968 | 3300050496 | nmdc:mga07m45_249894_c1 | nmdc:mga07m45_249894_c1_12_479 | 155 |
| 969 | 3300050496 | nmdc:mga07m45_27154_c1 | nmdc:mga07m45_27154_c1_2590_3057 | 155 |
| 970 | 3300050496 | nmdc:mga07m45_312083_c1 | nmdc:mga07m45_312083_c1_331_798 | 155 |
| 971 | 3300050496 | nmdc:mga07m45_533_c1 | nmdc:mga07m45_533_c1_3797_4264 | 155 |
| 972 | 3300050496 | nmdc:mga07m45_58332_c1 | nmdc:mga07m45_58332_c1_716_1183 | 155 |
| 973 | 3300050496 | nmdc:mga07m45_9770_c1 | nmdc:mga07m45_9770_c1_4235_4702 | 155 |
| 974 | 3300053079 | Ga0500610_0005849 | Ga0500610_0005849_4596_5063 | 155 |
| 975 | 3300053079 | Ga0500610_0007392 | Ga0500610_0007392_4210_4677 | 155 |
| 976 | 3300053086 | Ga0500578_0000926 | Ga0500578_0000926_4968_5435 | 155 |
| 977 | 3300053087 | Ga0500643_010390 | Ga0500643_010390_1160_1627 | 155 |
| 978 | 3300053088 | Ga0500644_0004370 | Ga0500644_0004370_1503_1970 | 155 |
| 979 | 3300053088 | Ga0500644_0008346 | Ga0500644_0008346_216_683 | 155 |
| 980 | 3300053088 | Ga0500644_0215805 | Ga0500644_0215805_113_580 | 155 |
| 981 | 3300053090 | Ga0500646_0022004 | Ga0500646_0022004_628_1095 | 155 |
| 982 | 3300053091 | Ga0500647_0069700 | Ga0500647_0069700_900_1367 | 155 |
| 983 | 3300053093 | Ga0500651_0000063 | Ga0500651_0000063_50035_50502 | 155 |
| 984 | 3300053093 | Ga0500651_0037817 | Ga0500651_0037817_146_613 | 155 |
| 985 | 3300053096 | Ga0500641_0082765 | Ga0500641_0082765_209_676 | 155 |
| 986 | 3300053096 | Ga0500641_0167280 | Ga0500641_0167280_199_666 | 155 |
| 987 | 3300053098 | Ga0500650_0037746 | Ga0500650_0037746_106_573 | 155 |
| 988 | 3300053108 | Ga0500562_027216 | Ga0500562_027216_379_846 | 155 |
| 989 | 3300053108 | Ga0500562_049118 | Ga0500562_049118_386_853 | 155 |
| 990 | 3300053110 | Ga0500571_008126 | Ga0500571_008126_2215_2682 | 155 |
| 991 | 3300053116 | Ga0500592_009925 | Ga0500592_009925_118_585 | 155 |
| 992 | 3300053117 | Ga0500593_000487 | Ga0500593_000487_2278_2745 | 155 |
| 993 | 3300053117 | Ga0500593_001737 | Ga0500593_001737_1720_2187 | 155 |
| 994 | 3300053117 | Ga0500593_004766 | Ga0500593_004766_3354_3821 | 155 |
| 995 | 3300053118 | Ga0500594_0000905 | Ga0500594_0000905_706_1173 | 155 |
| 996 | 3300053120 | Ga0500597_113615 | Ga0500597_113615_462_929 | 155 |
| 997 | 3300053121 | Ga0500607_001614 | Ga0500607_001614_6927_7394 | 155 |
| 998 | 3300053121 | Ga0500607_095498 | Ga0500607_095498_544_1011 | 155 |
| 999 | 3300053122 | Ga0500608_008503 | Ga0500608_008503_2596_3063 | 155 |
| 1000 | 3300053122 | Ga0500608_083300 | Ga0500608_083300_634_1101 | 155 |
| 1001 | 3300053125 | Ga0500618_035370 | Ga0500618_035370_531_998 | 155 |
| 1002 | 3300053125 | Ga0500618_045103 | Ga0500618_045103_408_875 | 155 |
| 1003 | 3300053128 | Ga0500626_105204 | Ga0500626_105204_174_641 | 155 |
| 1004 | 3300053130 | Ga0500642_0013135 | Ga0500642_0013135_1984_2451 | 155 |
| 1005 | 3300053131 | Ga0500652_004429 | Ga0500652_004429_2127_2594 | 155 |
| 1006 | 3300053131 | Ga0500652_031259 | Ga0500652_031259_152_619 | 155 |
| 1007 | 3300053133 | Ga0500655_028009 | Ga0500655_028009_422_1060 | 155 |
| 1008 | 3300053134 | Ga0500658_0002954 | Ga0500658_0002954_5365_5832 | 155 |
| 1009 | 3300053134 | Ga0500658_0002955 | Ga0500658_0002955_698_1165 | 155 |
| 1010 | 3300053136 | Ga0500559_0000260 | Ga0500559_0000260_30424_30891 | 155 |
| 1011 | 3300053136 | Ga0500559_0006663 | Ga0500559_0006663_1611_2078 | 155 |
| 1012 | 3300053136 | Ga0500559_0008325 | Ga0500559_0008325_1749_2216 | 155 |
| 1013 | 3300053136 | Ga0500559_0023456 | Ga0500559_0023456_1684_2151 | 155 |
| 1014 | 3300053139 | Ga0500568_0003245 | Ga0500568_0003245_6194_6661 | 155 |
| 1015 | 3300053139 | Ga0500568_0145526 | Ga0500568_0145526_31_498 | 155 |
| 1016 | 3300053141 | Ga0500574_031804 | Ga0500574_031804_845_1312 | 155 |
| 1017 | 3300053142 | Ga0500577_0073196 | Ga0500577_0073196_823_1290 | 155 |
| 1018 | 3300053148 | Ga0500590_034903 | Ga0500590_034903_1697_2164 | 155 |
| 1019 | 3300053151 | Ga0500604_0021837 | Ga0500604_0021837_653_1120 | 155 |
| 1020 | 3300053151 | Ga0500604_0055885 | Ga0500604_0055885_151_618 | 155 |
| 1021 | 3300053151 | Ga0500604_0248720 | Ga0500604_0248720_62_529 | 155 |
| 1022 | 3300053153 | Ga0500616_0025494 | Ga0500616_0025494_1473_1940 | 155 |
| 1023 | 3300053154 | Ga0500619_000059 | Ga0500619_000059_28613_29080 | 155 |
| 1024 | 3300053154 | Ga0500619_113521 | Ga0500619_113521_369_836 | 155 |
| 1025 | 3300053156 | Ga0500622_0001479 | Ga0500622_0001479_7587_8054 | 155 |
| 1026 | 3300053156 | Ga0500622_0004445 | Ga0500622_0004445_6509_6976 | 155 |
| 1027 | 3300053160 | Ga0500633_0032144 | Ga0500633_0032144_1203_1670 | 155 |
| 1028 | 3300053161 | Ga0500634_0038376 | Ga0500634_0038376_2040_2507 | 155 |
| 1029 | 3300053162 | Ga0500638_029064 | Ga0500638_029064_98_565 | 155 |
| 1030 | 3300053177 | Ga0500636_0165370 | Ga0500636_0165370_538_1005 | 155 |
| 1031 | 3300053724 | Ga0500570_083918 | Ga0500570_083918_362_829 | 155 |
| 1032 | 3300053730 | Ga0500645_000198 | Ga0500645_000198_8537_9004 | 155 |
| 1033 | 3300053730 | Ga0500645_004925 | Ga0500645_004925_651_1118 | 155 |
| 1034 | 3300053730 | Ga0500645_015380 | Ga0500645_015380_382_849 | 155 |
| 1035 | 3300053739 | Ga0500587_000969 | Ga0500587_000969_1867_2334 | 155 |
| 1036 | 3300053739 | Ga0500587_006774 | Ga0500587_006774_474_941 | 155 |
| 1037 | 3300061719 | Ga0466962_0407838 | Ga0466962_0407838_136_603 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ns5-assembly1.cif.gz_A | x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 | 0.9644 | 1 | 153 |
| 5twj-assembly2.cif.gz_A | crystal structure of rlmh in complex with s-adenosylmethionine | 0.9582 | 2 | 155 |
| 1ns5-assembly1.cif.gz_A | x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 | 0.9582 | 1 | 153 |
| 5twj-assembly2.cif.gz_A | crystal structure of rlmh in complex with s-adenosylmethionine | 0.9462 | 2 | 155 |
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9429 | 1 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ns5A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9567 | 3 | 153 | 3.40.1280.10 |
| 1ns5A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9443 | 3 | 153 | 3.40.1280.10 |
| 1to0F00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9272 | 3 | 147 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9226 | 1 | 154 | 3.40.1280.10 |
| 1o6dA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9125 | 1 | 150 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7RW46-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9829 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A5C7JE22-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9821 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A7J6JSI1-F1-model_v4 | deleted | 0.9813 | 27 | 147 |
|
| AF-A0A7W8HHK5-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9802 | 1 | 155 |
GO:0005737
GO:0070038 |
| AF-A0A2E2R6H6-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.9779 | 1 | 155 |
GO:0005737
GO:0070038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar