F488752

General Info

Members Datasets Scaffolds Average Seq Length
1037 511 968 155

Family's Representative Sequence

Representative Sequence 3300053133|Ga0500655_028009|Ga0500655_028009_422_1060
Length 169
Sequence LAAAFGQGAGRLARVKLLLVAVGQRQPAWAETAYDDFAKRFPPEMRLELKAVKAETRGSRTAEQMMAAEAARIEAALPKGVRRVVLDERGDRLTSVQLAARMKAWLPDGRDVAFVIGGPDGLDAGLKRSADETMRLSDLTLPHAFARVLLAEALYRAWTLTVNHPYHRE

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
14 2643221596 Acidovorax sp. Root70 Isolate Unclassified
15 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
18 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
19 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
20 2643221652 Acidovorax sp. Root402 Isolate Unclassified
21 2643221656 Pelomonas sp. Root405 Isolate Unclassified
22 2643221658 Variovorax sp. Root411 Isolate Unclassified
23 2643221683 Variovorax sp. Root473 Isolate Unclassified
24 2643221717 Acidovorax sp. Root267 Isolate Unclassified
25 2721755523 Delftia sp. HK171 Isolate Unclassified
26 2738541277 Variovorax sp. GV051 Isolate Unclassified
27 2738541307 Variovorax sp. GV008 Isolate Unclassified
28 2738541337 Pelomonas sp. BT06 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2738543013 Variovorax sp. BT01 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2816332133 Acidovorax radicis 2721A Isolate Unclassified
33 2818991446 Variovorax sp. 1180 Isolate Unclassified
34 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
35 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
36 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
37 2842677519 Variovorax sp. R-72495 Isolate Unclassified
38 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
39 2842733646 Variovorax sp. R-72446 Isolate Unclassified
40 2842747753 Variovorax sp. R-72060 Isolate Unclassified
41 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
42 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
43 2885198086 Variovorax sp. 679 Isolate Unclassified
44 2885211737 Variovorax sp. 553 Isolate Unclassified
45 2899924645 Variovorax sp. 369 Isolate Unclassified
46 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
47 2904456579 Variovorax sp. 2002 Isolate Unclassified
48 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
49 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
50 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
51 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
52 2928037797 Variovorax sp. 1126 Isolate Unclassified
53 2928044640 Variovorax sp. 1128 Isolate Unclassified
54 2928051484 Variovorax sp. 1133 Isolate Unclassified
55 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
56 2928070936 Variovorax gossypii 1167 Isolate Unclassified
57 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
58 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
59 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
60 2929520902 Variovorax beijingensis 502 Isolate Unclassified
61 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
62 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
63 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
64 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
65 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
66 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
67 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
68 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
72 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
82 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
83 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
84 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
90 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
91 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
92 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
97 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
98 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
113 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
124 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
125 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
126 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
129 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
137 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
138 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
139 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
140 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
141 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
142 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
150 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
151 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
152 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
153 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
154 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
161 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
190 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
197 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
265 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
267 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
269 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
274 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
275 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
276 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
277 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
278 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
279 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
280 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
281 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
282 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
283 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
284 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
285 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
286 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
293 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
294 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
295 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
296 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
297 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
298 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
299 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
300 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
301 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
302 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
303 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
304 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
307 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
308 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
309 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
310 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
311 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
312 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
316 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
317 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
318 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
319 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
320 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
321 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
322 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
323 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
324 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
325 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
326 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
327 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
328 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
331 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
332 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
333 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
334 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
335 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
336 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
337 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
338 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
339 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
340 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
341 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
342 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
343 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
344 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
345 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
346 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
347 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
348 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
349 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
350 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
351 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
352 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
353 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
354 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
355 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
356 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
357 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
358 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
359 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
360 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
361 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
362 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
363 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
364 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
365 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
366 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
367 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
368 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
369 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
370 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
371 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
372 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
373 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
374 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
375 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
376 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
377 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
378 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
379 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
380 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
381 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
382 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
383 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
384 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
385 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
386 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
387 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
388 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
389 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
398 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
401 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
402 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
403 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
404 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
405 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
406 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
409 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
410 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
411 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
412 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
413 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
414 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
415 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
416 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
417 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
420 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
421 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
422 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
424 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
425 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
426 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
427 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
428 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
429 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
430 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
431 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
432 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
433 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
446 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
454 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
460 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
461 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
471 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
472 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
477 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
478 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
479 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
480 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
481 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
482 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
483 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
484 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
485 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
486 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
487 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
488 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
489 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
490 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
504 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
505 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
506 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
507 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
508 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
509 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
510 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
511 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0.58
Isolates 6.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.69
Nodule 0.68
Rhizoplane 2.31
Rhizosphere 60.95
Stem 0
Stem Tuber 0
Unclassified 11.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001987 3300001979 Bacteria 9350
2 JGI24740J21852_10022496 3300001979 Bacteria 2169
3 JGI24739J22299_10064426 3300001989 Bacteria 1152
4 JGI25152J39213_1003563 3300002773 Bacteria 5269
5 JGI25152J39213_1004322 3300002773 Bacteria 4519
6 JGI25150J39212_1000611 3300002774 Bacteria 13763
7 JGI25159J45721_1004613 3300002987 Bacteria 4520
8 JGI25159J45721_1005744 3300002987 Bacteria 3840
9 JGI25151J46595_10001037 3300003187 Bacteria 20781
10 JGI25151J46595_10002554 3300003187 Bacteria 10797
11 JGI25151J46595_10009062 3300003187 Bacteria 4742
12 JGI25151J46595_10042257 3300003187 Bacteria 1644
13 JGI25153J46596_10005629 3300003215 Bacteria 6547
14 JGI25153J46596_10008890 3300003215 Bacteria 4742
15 JGI25153J46596_10016584 3300003215 Bacteria 2941
16 JGI25153J46596_10034724 3300003215 Bacteria 1644
17 rootH1_10053737 3300003316 Bacteria 2438
18 rootH2_10216731 3300003320 Bacteria 1662
19 rootL2_10006742 3300003322 Bacteria 1816
20 rootL2_10326548 3300003322 Bacteria 1322
21 rootH1_10008734 3300003323 Bacteria 3606
22 JGI25160J50197_1008977 3300003354 Bacteria 3752
23 JGI25161J50226_1003069 3300003374 Bacteria 3993
24 Ga0006562J51391_1072998 3300003578 Bacteria 5510
25 Ga0006562J51391_1072999 3300003578 Bacteria 4080
26 Ga0006562J51391_1109357 3300003578 Bacteria 4810
27 Ga0006562J51391_1109361 3300003578 Bacteria 3100
28 Ga0055527_1008925 3300003760 Bacteria 1187
29 Ga0055542_1000039 3300003762 Bacteria 215126
30 Ga0055526_1005340 3300003771 Bacteria 7422
31 Ga0055526_1009890 3300003771 Bacteria 4520
32 Ga0055526_1009910 3300003771 Bacteria 4514
33 Ga0055537_1000296 3300003773 Bacteria 35117
34 Ga0055537_1003601 3300003773 Bacteria 4718
35 Ga0055537_1004830 3300003773 Bacteria 3746
36 Ga0055524_1000302 3300003775 Bacteria 47410
37 Ga0055524_1005397 3300003775 Bacteria 5716
38 Ga0055524_1007817 3300003775 Bacteria 4507
39 Ga0055536_1002464 3300003781 Bacteria 10393
40 Ga0055536_1025110 3300003781 Bacteria 1707
41 Ga0055536_1035294 3300003781 Bacteria 1253
42 Ga0055534_1000092 3300003784 Bacteria 70082
43 Ga0055534_1000506 3300003784 Bacteria 21227
44 Ga0055534_1003706 3300003784 Bacteria 4718
45 Ga0055534_1003774 3300003784 Bacteria 4660
46 Ga0055528_1000190 3300003790 Bacteria 52365
47 Ga0055528_1007713 3300003790 Bacteria 4718
48 Ga0055528_1011213 3300003790 Bacteria 3580
49 Ga0055530_10000214 3300003791 Bacteria 52165
50 Ga0055530_10046040 3300003791 Bacteria 1038
51 Ga0055540_1000004 3300003792 Bacteria 395545
52 Ga0055540_1000035 3300003792 Bacteria 166843
53 Ga0055540_1006272 3300003792 Bacteria 4758
54 Ga0055540_1010662 3300003792 Bacteria 3037
55 Ga0055531_10000317 3300003794 Bacteria 47389
56 Ga0055531_10000612 3300003794 Bacteria 30958
57 Ga0055531_10010027 3300003794 Bacteria 4764
58 Ga0055531_10010039 3300003794 Bacteria 4758
59 Ga0055531_10013011 3300003794 Bacteria 3869
60 Ga0055543_1003575 3300004625 Bacteria 4503
61 Ga0055543_1005529 3300004625 Bacteria 3207
62 Ga0065165_1001409 3300005262 Bacteria 26197
63 Ga0065165_1006920 3300005262 Bacteria 5754
64 Ga0065165_1019442 3300005262 Bacteria 2425
65 Ga0065165_1021156 3300005262 Bacteria 2267
66 Ga0065714_10071185 3300005288 Bacteria 3641
67 Ga0065714_10162009 3300005288 Bacteria 1047
68 Ga0070658_10153664 3300005327 Bacteria 1928
69 Ga0070676_10041207 3300005328 Bacteria 2677
70 Ga0070676_10245308 3300005328 Bacteria 1193
71 Ga0070690_100004296 3300005330 Bacteria 7896
72 Ga0070670_100425081 3300005331 Bacteria 1175
73 Ga0070670_100500835 3300005331 Bacteria 1080
74 Ga0070670_100522989 3300005331 Bacteria 1056
75 Ga0070677_10274327 3300005333 Bacteria 847
76 Ga0068869_100028112 3300005334 Bacteria 3926
77 Ga0068869_100324339 3300005334 Bacteria 1250
78 Ga0070666_10002227 3300005335 Bacteria 11730
79 Ga0070680_100180066 3300005336 Bacteria 1780
80 Ga0070682_100051931 3300005337 Bacteria 2564
81 Ga0068868_100000526 3300005338 Bacteria 25605
82 Ga0068868_100203916 3300005338 Bacteria 1650
83 Ga0068868_100349216 3300005338 Bacteria 1266
84 Ga0070660_100106598 3300005339 Bacteria 2226
85 Ga0070689_100268559 3300005340 Bacteria 1412
86 Ga0070668_100077914 3300005347 Bacteria 2591
87 Ga0070669_100012794 3300005353 Bacteria 5958
88 Ga0070669_100150344 3300005353 Bacteria 1802
89 Ga0070669_100366576 3300005353 Bacteria 1172
90 Ga0070675_100001257 3300005354 Bacteria 18531
91 Ga0070675_100907041 3300005354 Bacteria 808
92 Ga0070671_100125518 3300005355 Bacteria 2160
93 Ga0070671_100305998 3300005355 Bacteria 1353
94 Ga0070671_100375628 3300005355 Bacteria 1214
95 Ga0070671_100827308 3300005355 Bacteria 807
96 Ga0070674_100349044 3300005356 Bacteria 1194
97 Ga0070674_100532809 3300005356 Bacteria 983
98 Ga0070673_100003204 3300005364 Bacteria 10140
99 Ga0070673_100258085 3300005364 Bacteria 1521
100 Ga0070673_100767072 3300005364 Bacteria 889
101 Ga0070673_100778093 3300005364 Bacteria 883
102 Ga0070688_100077097 3300005365 Bacteria 2147
103 Ga0070688_100471911 3300005365 Bacteria 942
104 Ga0070659_100000481 3300005366 Bacteria 29333
105 Ga0070659_101011499 3300005366 Bacteria 730
106 Ga0070667_100080720 3300005367 Bacteria 2782
107 Ga0070700_100327988 3300005441 Bacteria 1127
108 Ga0070663_100163635 3300005455 Bacteria 1714
109 Ga0070663_100199411 3300005455 Bacteria 1561
110 Ga0070663_100227984 3300005455 Bacteria 1466
111 Ga0070663_100374548 3300005455 Bacteria 1158
112 Ga0070663_101122346 3300005455 Bacteria 688
113 Ga0070678_100025493 3300005456 Bacteria 3979
114 Ga0070678_100113725 3300005456 Bacteria 2122
115 Ga0070678_100224620 3300005456 Bacteria 1562
116 Ga0070678_101879349 3300005456 Bacteria 565
117 Ga0070662_100031047 3300005457 Bacteria 3746
118 Ga0070662_100046139 3300005457 Bacteria 3130
119 Ga0070662_100116974 3300005457 Bacteria 2038
120 Ga0070662_100174632 3300005457 Bacteria 1690
121 Ga0070662_100176844 3300005457 Bacteria 1680
122 Ga0070662_100436768 3300005457 Bacteria 1085
123 Ga0070681_10361019 3300005458 Bacteria 1363
124 Ga0068867_100000005 3300005459 Bacteria 174097
125 Ga0068867_100062751 3300005459 Bacteria 2761
126 Ga0068867_100097766 3300005459 Bacteria 2237
127 Ga0068867_100112722 3300005459 Bacteria 2091
128 Ga0068867_101148495 3300005459 Bacteria 711
129 Ga0070685_10250691 3300005466 Bacteria 1173
130 Ga0070706_100001719 3300005467 Bacteria 22759
131 Ga0070707_101368383 3300005468 Bacteria 674
132 Ga0070679_100064787 3300005530 Bacteria 3642
133 Ga0070679_100094911 3300005530 Bacteria 2970
134 Ga0068853_100051725 3300005539 Bacteria 3537
135 Ga0068853_100240813 3300005539 Bacteria 1658
136 Ga0068853_100376107 3300005539 Bacteria 1326
137 Ga0070672_100108731 3300005543 Bacteria 2258
138 Ga0070672_100276294 3300005543 Bacteria 1419
139 Ga0070672_100639082 3300005543 Bacteria 929
140 Ga0070672_101355628 3300005543 Bacteria 636
141 Ga0070665_100557805 3300005548 Bacteria 1158
142 Ga0070704_100621411 3300005549 Bacteria 951
143 Ga0068855_100014182 3300005563 Bacteria 9602
144 Ga0068855_100025134 3300005563 Bacteria 7130
145 Ga0068855_100813039 3300005563 Bacteria 993
146 Ga0070664_100118860 3300005564 Bacteria 2312
147 Ga0070664_100556684 3300005564 Bacteria 1061
148 Ga0070664_100561635 3300005564 Bacteria 1056
149 Ga0068857_100596251 3300005577 Bacteria 1044
150 Ga0068854_100183933 3300005578 Bacteria 1634
151 Ga0068854_100483848 3300005578 Bacteria 1040
152 Ga0068854_100518381 3300005578 Bacteria 1006
153 Ga0068854_100635519 3300005578 Bacteria 915
154 Ga0068856_100036361 3300005614 Bacteria 4829
155 Ga0068856_100341872 3300005614 Bacteria 1515
156 Ga0068852_100002367 3300005616 Bacteria 12987
157 Ga0068852_100123976 3300005616 Bacteria 2370
158 Ga0068852_100383670 3300005616 Bacteria 1379
159 Ga0068852_101481327 3300005616 Bacteria 701
160 Ga0068859_100010093 3300005617 Bacteria 9518
161 Ga0068859_100923527 3300005617 Bacteria 957
162 Ga0068864_100000511 3300005618 Bacteria 33486
163 Ga0068861_100144813 3300005719 Bacteria 1943
164 Ga0068861_101090679 3300005719 Bacteria 767
165 Ga0068851_10004317 3300005834 Bacteria 6400
166 Ga0068851_10037551 3300005834 Bacteria 2429
167 Ga0068870_10450785 3300005840 Bacteria 848
168 Ga0068863_100007397 3300005841 Bacteria 10748
169 Ga0068858_100000359 3300005842 Bacteria 48114
170 Ga0068860_100072237 3300005843 Bacteria 3279
171 Ga0075365_10013252 3300006038 Bacteria 4920
172 Ga0075365_10915880 3300006038 Bacteria 618
173 Ga0075363_100070021 3300006048 Bacteria 1904
174 Ga0075363_100084488 3300006048 Bacteria 1740
175 Ga0075363_100171471 3300006048 Bacteria 1232
176 Ga0075364_10054684 3300006051 Bacteria 2611
177 Ga0075364_10238777 3300006051 Bacteria 1234
178 Ga0075364_10271956 3300006051 Bacteria 1152
179 Ga0075432_10008843 3300006058 Bacteria 3437
180 Ga0075432_10024139 3300006058 Bacteria 2083
181 Ga0075362_10003584 3300006177 Bacteria 5455
182 Ga0075362_10039489 3300006177 Bacteria 2075
183 Ga0075362_10131550 3300006177 Bacteria 1191
184 Ga0075362_10317351 3300006177 Bacteria 776
185 Ga0075367_10147513 3300006178 Bacteria 1459
186 Ga0075367_10362599 3300006178 Bacteria 915
187 Ga0075369_10032362 3300006186 Bacteria 2212
188 Ga0075369_10199483 3300006186 Bacteria 923
189 Ga0075366_10002649 3300006195 Bacteria 9220
190 Ga0075366_10006970 3300006195 Bacteria 6223
191 Ga0075366_10009720 3300006195 Bacteria 5377
192 Ga0075366_10013620 3300006195 Bacteria 4635
193 Ga0075366_10033567 3300006195 Bacteria 3023
194 Ga0075366_10145745 3300006195 Bacteria 1433
195 Ga0075366_10172756 3300006195 Bacteria 1311
196 Ga0075366_10623891 3300006195 Bacteria 669
197 Ga0097621_100057282 3300006237 Bacteria 3186
198 Ga0097621_100831982 3300006237 Bacteria 857
199 Ga0075370_10000556 3300006353 Bacteria 14286
200 Ga0075370_10014562 3300006353 Bacteria 4198
201 Ga0075370_10016632 3300006353 Bacteria 3959
202 Ga0075370_10022291 3300006353 Bacteria 3477
203 Ga0075370_10023906 3300006353 Bacteria 3370
204 Ga0075370_10034046 3300006353 Bacteria 2855
205 Ga0075370_10048286 3300006353 Bacteria 2411
206 Ga0075370_10183655 3300006353 Bacteria 1231
207 Ga0075370_10351501 3300006353 Bacteria 881
208 Ga0068871_100064447 3300006358 Bacteria 3000
209 Ga0068865_100087270 3300006881 Bacteria 2254
210 Ga0068865_100209277 3300006881 Bacteria 1518
211 Ga0068865_100409664 3300006881 Bacteria 1112
212 Ga0097620_100010093 3300006931 Bacteria 9518
213 Ga0097620_100923533 3300006931 Bacteria 957
214 Ga0079104_1000024 3300006946 Bacteria 219543
215 Ga0099826_10000115 3300006948 Bacteria 36769
216 Ga0099826_10159610 3300006948 Bacteria 1279
217 Ga0105250_10034781 3300009092 Bacteria 2021
218 Ga0105240_10003642 3300009093 Bacteria 23871
219 Ga0105240_10625342 3300009093 Bacteria 1183
220 Ga0111539_12743599 3300009094 Bacteria 571
221 Ga0105245_10008806 3300009098 Bacteria 8802
222 Ga0105245_10251226 3300009098 Bacteria 1718
223 Ga0105245_10668587 3300009098 Bacteria 1070
224 Ga0105245_11621319 3300009098 Bacteria 699
225 Ga0105243_10000515 3300009148 Bacteria 39435
226 Ga0105243_10001515 3300009148 Bacteria 20296
227 Ga0105243_10003542 3300009148 Bacteria 12617
228 Ga0105243_10132451 3300009148 Bacteria 2117
229 Ga0105243_10134204 3300009148 Bacteria 2104
230 Ga0105243_10340324 3300009148 Bacteria 1374
231 Ga0105243_10427224 3300009148 Bacteria 1237
232 Ga0105241_10143886 3300009174 Bacteria 1944
233 Ga0105242_10004129 3300009176 Bacteria 11304
234 Ga0105242_10908655 3300009176 Bacteria 881
235 Ga0105248_10161343 3300009177 Bacteria 2528
236 Ga0105248_10531646 3300009177 Bacteria 1326
237 Ga0105237_10034393 3300009545 Bacteria 5132
238 Ga0105237_10037398 3300009545 Bacteria 4906
239 Ga0105238_10006811 3300009551 Bacteria 11412
240 Ga0105238_10027040 3300009551 Bacteria 5847
241 Ga0105238_11315528 3300009551 Bacteria 749
242 Ga0105249_10467555 3300009553 Bacteria 1302
243 Ga0105239_10216054 3300010375 Bacteria 2150
244 Ga0105239_11519189 3300010375 Bacteria 774
245 Ga0105246_10131195 3300011119 Bacteria 1872
246 Ga0157373_10029757 3300013100 Bacteria 3931
247 Ga0157371_10133807 3300013102 Bacteria 1765
248 Ga0157370_10065472 3300013104 Bacteria 3438
249 Ga0157369_10043021 3300013105 Bacteria 4925
250 Ga0157378_10528330 3300013297 Bacteria 1182
251 Ga0157378_11042396 3300013297 Bacteria 853
252 Ga0163162_10123599 3300013306 Bacteria 2693
253 Ga0163162_10239243 3300013306 Bacteria 1946
254 Ga0163162_10284627 3300013306 Bacteria 1785
255 Ga0163162_10973410 3300013306 Bacteria 959
256 Ga0157372_10806654 3300013307 Bacteria 1090
257 Ga0157375_10169716 3300013308 Bacteria 2329
258 Ga0157375_11715030 3300013308 Bacteria 744
259 Ga0163163_10010941 3300014325 Bacteria 8198
260 Ga0163163_12441689 3300014325 Bacteria 581
261 Ga0157380_10119485 3300014326 Bacteria 2230
262 Ga0157380_10283257 3300014326 Bacteria 1518
263 Ga0157380_10948435 3300014326 Bacteria 890
264 Ga0157380_10961539 3300014326 Bacteria 885
265 Ga0182008_10009236 3300014497 Bacteria 5331
266 Ga0182008_10011067 3300014497 Bacteria 4812
267 Ga0182008_10057326 3300014497 Bacteria 1923
268 Ga0182008_10122108 3300014497 Bacteria 1295
269 Ga0157377_10000022 3300014745 Bacteria 146702
270 Ga0157377_10138874 3300014745 Bacteria 1491
271 Ga0157379_10092454 3300014968 Bacteria 2714
272 Ga0157379_10523405 3300014968 Bacteria 1101
273 Ga0157376_10145094 3300014969 Bacteria 2134
274 Ga0157376_10796496 3300014969 Bacteria 957
275 Ga0182007_10000472 3300015262 Bacteria 24301
276 Ga0182007_10053924 3300015262 Bacteria 1323
277 Ga0182005_1042245 3300015265 Bacteria 1239
278 Ga0183362_10001 3300015683 Bacteria 2046624
279 Ga0163161_10001036 3300017792 Bacteria 21172
280 Ga0163161_10031016 3300017792 Bacteria 3807
281 Ga0163161_10051910 3300017792 Bacteria 2972
282 Ga0163161_10503808 3300017792 Bacteria 986
283 Ga0209436_108139 3300025208 Bacteria 2120
284 Ga0209672_101250 3300025228 Bacteria 10173
285 Ga0209147_102210 3300025229 Bacteria 5234
286 Ga0209258_100099 3300025242 Bacteria 214924
287 Ga0207425_1000239 3300025245 Bacteria 42732
288 Ga0207425_1001642 3300025245 Bacteria 9004
289 Ga0207425_1004428 3300025245 Bacteria 4215
290 Ga0209148_1000103 3300025254 Bacteria 215356
291 Ga0209129_1000007 3300025258 Bacteria 771325
292 Ga0209129_1000144 3300025258 Bacteria 115999
293 Ga0209129_1001130 3300025258 Bacteria 15446
294 Ga0209129_1004500 3300025258 Bacteria 5411
295 Ga0209565_1000073 3300025263 Bacteria 164695
296 Ga0209565_1000199 3300025263 Bacteria 71613
297 Ga0209565_1003122 3300025263 Bacteria 5556
298 Ga0209673_1000127 3300025273 Bacteria 164695
299 Ga0209673_1000128 3300025273 Bacteria 164482
300 Ga0209673_1001078 3300025273 Bacteria 30774
301 Ga0209673_1001619 3300025273 Bacteria 19616
302 Ga0209673_1003135 3300025273 Bacteria 10101
303 Ga0209673_1013295 3300025273 Bacteria 3256
304 Ga0209130_1000471 3300025284 Bacteria 41439
305 Ga0209130_1000898 3300025284 Bacteria 24052
306 Ga0209130_1000914 3300025284 Bacteria 23751
307 Ga0209130_1002188 3300025284 Bacteria 10305
308 Ga0209675_1000029 3300025291 Bacteria 281053
309 Ga0209675_1000114 3300025291 Bacteria 112118
310 Ga0209675_1000723 3300025291 Bacteria 22450
311 Ga0209675_1000976 3300025291 Bacteria 18068
312 Ga0209675_1002630 3300025291 Bacteria 9079
313 Ga0209676_1000122 3300025292 Bacteria 195510
314 Ga0209676_1000301 3300025292 Bacteria 99952
315 Ga0209676_1002710 3300025292 Bacteria 11948
316 Ga0209676_1003298 3300025292 Bacteria 10107
317 Ga0209025_1000073 3300025294 Bacteria 282133
318 Ga0209025_1000248 3300025294 Bacteria 126818
319 Ga0209025_1000491 3300025294 Bacteria 75913
320 Ga0209025_1006463 3300025294 Bacteria 9087
321 Ga0209025_1026508 3300025294 Bacteria 2907
322 Ga0209564_1000029 3300025295 Bacteria 505995
323 Ga0209564_1000360 3300025295 Bacteria 84454
324 Ga0209564_1001537 3300025295 Bacteria 22864
325 Ga0209564_1042300 3300025295 Bacteria 1211
326 Ga0209758_1000025 3300025297 Bacteria 586687
327 Ga0209758_1000043 3300025297 Bacteria 402310
328 Ga0209758_1000434 3300025297 Bacteria 70561
329 Ga0209050_1000197 3300025298 Bacteria 135303
330 Ga0209050_1000433 3300025298 Bacteria 76499
331 Ga0209050_1000488 3300025298 Bacteria 68812
332 Ga0209050_1007621 3300025298 Bacteria 6010
333 Ga0209050_1007861 3300025298 Bacteria 5856
334 Ga0209050_1011027 3300025298 Bacteria 4355
335 Ga0209050_1042750 3300025298 Bacteria 1233
336 Ga0209050_1042975 3300025298 Bacteria 1227
337 Ga0209256_1000011 3300025299 Bacteria 865309
338 Ga0209256_1000050 3300025299 Bacteria 308622
339 Ga0209256_1000063 3300025299 Bacteria 252716
340 Ga0207426_1000001 3300025302 Bacteria 1341301
341 Ga0207426_1000028 3300025302 Bacteria 483955
342 Ga0207426_1001556 3300025302 Bacteria 18611
343 Ga0209051_1000002 3300025303 Bacteria 1631846
344 Ga0209051_1000016 3300025303 Bacteria 541891
345 Ga0209051_1000542 3300025303 Bacteria 46577
346 Ga0209051_1001159 3300025303 Bacteria 23972
347 Ga0209051_1002010 3300025303 Bacteria 15519
348 Ga0209051_1004650 3300025303 Bacteria 8360
349 Ga0209051_1007504 3300025303 Bacteria 5950
350 Ga0209051_1023776 3300025303 Bacteria 2539
351 Ga0209257_1000002 3300025304 Bacteria 1767052
352 Ga0209257_1000012 3300025304 Bacteria 1111138
353 Ga0209257_1000021 3300025304 Bacteria 771986
354 Ga0209257_1000102 3300025304 Bacteria 251074
355 Ga0209257_1006647 3300025304 Bacteria 7347
356 Ga0209257_1007736 3300025304 Bacteria 6401
357 Ga0207656_10052949 3300025321 Bacteria 1759
358 Ga0207656_10060956 3300025321 Bacteria 1655
359 Ga0207696_1036136 3300025711 Bacteria 1467
360 Ga0207682_10075079 3300025893 Bacteria 1438
361 Ga0207682_10167125 3300025893 Bacteria 999
362 Ga0207680_10005639 3300025903 Bacteria 5989
363 Ga0207680_10263764 3300025903 Bacteria 1193
364 Ga0207645_10018276 3300025907 Bacteria 4617
365 Ga0207645_10035636 3300025907 Bacteria 3194
366 Ga0207645_10100201 3300025907 Bacteria 1869
367 Ga0207645_10532092 3300025907 Bacteria 797
368 Ga0207705_10141578 3300025909 Bacteria 1797
369 Ga0207684_10001654 3300025910 Bacteria 23687
370 Ga0207654_10111296 3300025911 Bacteria 1704
371 Ga0207707_10310318 3300025912 Bacteria 1363
372 Ga0207695_10347517 3300025913 Bacteria 1371
373 Ga0207695_11112823 3300025913 Bacteria 670
374 Ga0207671_10071283 3300025914 Bacteria 2592
375 Ga0207671_11036626 3300025914 Bacteria 646
376 Ga0207660_10138485 3300025917 Bacteria 1859
377 Ga0207657_10016829 3300025919 Bacteria 7039
378 Ga0207657_10625583 3300025919 Bacteria 839
379 Ga0207657_11079679 3300025919 Bacteria 614
380 Ga0207649_10006892 3300025920 Bacteria 6174
381 Ga0207649_11137242 3300025920 Bacteria 616
382 Ga0207652_10032924 3300025921 Bacteria 4362
383 Ga0207646_10085820 3300025922 Bacteria 2816
384 Ga0207681_10343261 3300025923 Bacteria 1193
385 Ga0207681_10603020 3300025923 Bacteria 907
386 Ga0207694_10043334 3300025924 Bacteria 3473
387 Ga0207694_10103673 3300025924 Bacteria 2256
388 Ga0207694_11257370 3300025924 Bacteria 626
389 Ga0207650_10356242 3300025925 Bacteria 1205
390 Ga0207650_10565955 3300025925 Bacteria 954
391 Ga0207650_10948396 3300025925 Bacteria 731
392 Ga0207659_10003030 3300025926 Bacteria 10024
393 Ga0207659_10258615 3300025926 Bacteria 1415
394 Ga0207659_10295076 3300025926 Bacteria 1329
395 Ga0207659_10479979 3300025926 Bacteria 1050
396 Ga0207687_10034029 3300025927 Bacteria 3458
397 Ga0207687_10481755 3300025927 Bacteria 1033
398 Ga0207687_10783030 3300025927 Bacteria 813
399 Ga0207644_10105561 3300025931 Bacteria 2122
400 Ga0207644_10120978 3300025931 Bacteria 1993
401 Ga0207644_10154722 3300025931 Bacteria 1777
402 Ga0207690_10000428 3300025932 Bacteria 27395
403 Ga0207690_10722352 3300025932 Bacteria 820
404 Ga0207706_10039894 3300025933 Bacteria 4162
405 Ga0207706_10098221 3300025933 Bacteria 2575
406 Ga0207706_10192746 3300025933 Bacteria 1788
407 Ga0207706_10211544 3300025933 Bacteria 1700
408 Ga0207706_10452262 3300025933 Bacteria 1111
409 Ga0207686_10007355 3300025934 Bacteria 5927
410 Ga0207709_10000245 3300025935 Bacteria 66704
411 Ga0207709_10000522 3300025935 Bacteria 33464
412 Ga0207709_10001057 3300025935 Bacteria 20345
413 Ga0207709_10578054 3300025935 Bacteria 887
414 Ga0207670_10290321 3300025936 Bacteria 1277
415 Ga0207669_10767268 3300025937 Bacteria 797
416 Ga0207704_10265032 3300025938 Bacteria 1297
417 Ga0207691_10193218 3300025940 Bacteria 1774
418 Ga0207691_10228240 3300025940 Bacteria 1613
419 Ga0207691_10355654 3300025940 Bacteria 1253
420 Ga0207711_10199470 3300025941 Bacteria 1826
421 Ga0207711_10509761 3300025941 Bacteria 1121
422 Ga0207689_10040791 3300025942 Bacteria 3841
423 Ga0207689_10079678 3300025942 Bacteria 2691
424 Ga0207679_10023501 3300025945 Bacteria 4217
425 Ga0207679_10026952 3300025945 Bacteria 3968
426 Ga0207679_10358199 3300025945 Bacteria 1273
427 Ga0207667_10089432 3300025949 Bacteria 3183
428 Ga0207667_11139411 3300025949 Bacteria 762
429 Ga0207651_10001269 3300025960 Bacteria 11360
430 Ga0207651_10115784 3300025960 Bacteria 2022
431 Ga0207651_10182500 3300025960 Bacteria 1666
432 Ga0207651_10238065 3300025960 Bacteria 1482
433 Ga0207651_10396106 3300025960 Bacteria 1173
434 Ga0207712_10033531 3300025961 Bacteria 3472
435 Ga0207668_10151952 3300025972 Bacteria 1793
436 Ga0207668_11011088 3300025972 Bacteria 743
437 Ga0207640_10121792 3300025981 Bacteria 1870
438 Ga0207640_10154690 3300025981 Bacteria 1689
439 Ga0207640_10384754 3300025981 Bacteria 1138
440 Ga0207658_10088021 3300025986 Bacteria 2399
441 Ga0207658_10097808 3300025986 Bacteria 2292
442 Ga0207677_10008077 3300026023 Bacteria 5857
443 Ga0207677_10012869 3300026023 Bacteria 4830
444 Ga0207677_10420136 3300026023 Bacteria 1139
445 Ga0207703_10002190 3300026035 Bacteria 17149
446 Ga0207703_10716627 3300026035 Bacteria 952
447 Ga0207639_10070642 3300026041 Bacteria 2728
448 Ga0207639_10165441 3300026041 Bacteria 1868
449 Ga0207639_10339936 3300026041 Bacteria 1338
450 Ga0207678_10059926 3300026067 Bacteria 3275
451 Ga0207678_10086891 3300026067 Bacteria 2672
452 Ga0207678_10385440 3300026067 Bacteria 1212
453 Ga0207678_10386594 3300026067 Bacteria 1210
454 Ga0207708_10156192 3300026075 Bacteria 1799
455 Ga0207702_10046176 3300026078 Bacteria 3666
456 Ga0207702_11078602 3300026078 Bacteria 797
457 Ga0207702_11107518 3300026078 Bacteria 786
458 Ga0207641_10001726 3300026088 Bacteria 21102
459 Ga0207648_10000032 3300026089 Bacteria 128009
460 Ga0207648_10017579 3300026089 Bacteria 6497
461 Ga0207648_10032114 3300026089 Bacteria 4638
462 Ga0207648_10205864 3300026089 Bacteria 1746
463 Ga0207648_10368277 3300026089 Bacteria 1297
464 Ga0207648_10583581 3300026089 Bacteria 1029
465 Ga0207648_10696885 3300026089 Bacteria 941
466 Ga0207676_10003149 3300026095 Bacteria 11781
467 Ga0207674_10349962 3300026116 Bacteria 1428
468 Ga0207674_10540395 3300026116 Bacteria 1126
469 Ga0207674_11276771 3300026116 Bacteria 704
470 Ga0207675_100109629 3300026118 Bacteria 2605
471 Ga0207683_10010783 3300026121 Bacteria 7793
472 Ga0207683_10030115 3300026121 Bacteria 4702
473 Ga0207683_10032771 3300026121 Bacteria 4513
474 Ga0207683_10558013 3300026121 Bacteria 1059
475 Ga0207698_10004168 3300026142 Bacteria 8790
476 Ga0207698_10022533 3300026142 Bacteria 4380
477 Ga0207698_10024501 3300026142 Bacteria 4237
478 Ga0207698_10060126 3300026142 Bacteria 2953
479 Ga0207698_10329259 3300026142 Bacteria 1434
480 Ga0209281_1000005 3300027111 Bacteria 1242284
481 Ga0209281_1000104 3300027111 Bacteria 221056
482 Ga0209983_1051536 3300027665 Bacteria 901
483 Ga0209282_1000109 3300027666 Bacteria 53813
484 Ga0209974_10005579 3300027876 Bacteria 4421
485 Ga0209974_10091046 3300027876 Bacteria 1058
486 Ga0209974_10146591 3300027876 Bacteria 850
487 Ga0207428_10102987 3300027907 Bacteria 2204
488 Ga0268266_10107424 3300028379 Bacteria 2468
489 Ga0268266_11581600 3300028379 Bacteria 631
490 Ga0268265_10029913 3300028380 Bacteria 3918
491 Ga0268265_10204653 3300028380 Bacteria 1715
492 Ga0268265_11174997 3300028380 Bacteria 764
493 Ga0268264_10065396 3300028381 Bacteria 3064
494 Ga0268264_10195084 3300028381 Bacteria 1848
495 Ga0307515_10000842 3300028794 Bacteria 70481
496 Ga0307515_10001088 3300028794 Bacteria 62228
497 Ga0307515_10001640 3300028794 Bacteria 49762
498 Ga0307515_10020481 3300028794 Bacteria 11796
499 Ga0307515_10064179 3300028794 Bacteria 5138
500 Ga0307515_10109248 3300028794 Bacteria 3250
501 Ga0307515_10127705 3300028794 Bacteria 2826
502 Ga0307515_10166309 3300028794 Bacteria 2221
503 Ga0307515_10233339 3300028794 Bacteria 1627
504 Ga0307512_10045218 3300030522 Bacteria 3609
505 Ga0307512_10065075 3300030522 Bacteria 2769
506 Ga0316177_1071860 3300030731 Bacteria 4227
507 Ga0316177_1155855 3300030731 Bacteria 3185
508 Ga0316176_1148086 3300030732 Bacteria 2630
509 Ga0314311_1122598 3300030733 Bacteria 1910
510 Ga0316178_1138608 3300030735 Bacteria 6199
511 Ga0316180_1073464 3300030736 Bacteria 1165
512 Ga0316183_1020296 3300030742 Bacteria 4775
513 Ga0316181_1106329 3300030744 Bacteria 3528
514 Ga0265332_10008074 3300031238 Bacteria 4735
515 Ga0265332_10291341 3300031238 Bacteria 674
516 Ga0265329_10036582 3300031242 Bacteria 1582
517 Ga0265331_10058291 3300031250 Bacteria 1829
518 Ga0265327_10000814 3300031251 Bacteria 47176
519 Ga0265327_10006291 3300031251 Bacteria 9563
520 Ga0307513_10000019 3300031456 Bacteria 231194
521 Ga0307513_10000051 3300031456 Bacteria 149733
522 Ga0307513_10003449 3300031456 Bacteria 21402
523 Ga0307513_10026043 3300031456 Bacteria 6753
524 Ga0307513_10217505 3300031456 Bacteria 1735
525 Ga0307513_10438385 3300031456 Bacteria 1033
526 Ga0307513_10467479 3300031456 Bacteria 983
527 Ga0307509_10094623 3300031507 Bacteria 3046
528 Ga0307408_100000099 3300031548 Bacteria 95526
529 Ga0307408_100000193 3300031548 Bacteria 65882
530 Ga0307408_100019885 3300031548 Bacteria 4523
531 Ga0307408_100028902 3300031548 Bacteria 3835
532 Ga0307408_100040951 3300031548 Bacteria 3282
533 Ga0307408_100318652 3300031548 Bacteria 1309
534 Ga0307408_100430099 3300031548 Bacteria 1140
535 Ga0307408_100544456 3300031548 Bacteria 1023
536 Ga0307508_10002774 3300031616 Bacteria 18247
537 Ga0307514_10002956 3300031649 Bacteria 16887
538 Ga0307514_10013325 3300031649 Bacteria 6822
539 Ga0265314_10013361 3300031711 Bacteria 6636
540 Ga0265314_10049626 3300031711 Bacteria 2937
541 Ga0307516_10004540 3300031730 Bacteria 17080
542 Ga0307516_10006152 3300031730 Bacteria 14142
543 Ga0307516_10222875 3300031730 Bacteria 1594
544 Ga0307516_10266001 3300031730 Bacteria 1403
545 Ga0307516_10271164 3300031730 Bacteria 1383
546 Ga0307405_10314292 3300031731 Bacteria 1194
547 Ga0307405_11084002 3300031731 Bacteria 688
548 Ga0307413_11076597 3300031824 Bacteria 693
549 Ga0307410_10741619 3300031852 Bacteria 831
550 Ga0307406_10009579 3300031901 Bacteria 5441
551 Ga0307406_10016378 3300031901 Bacteria 4307
552 Ga0307406_10188553 3300031901 Bacteria 1508
553 Ga0307406_10514283 3300031901 Bacteria 973
554 Ga0307406_10822053 3300031901 Bacteria 786
555 Ga0307407_10047314 3300031903 Bacteria 2440
556 Ga0307407_10426950 3300031903 Bacteria 957
557 Ga0307412_10037116 3300031911 Bacteria 3128
558 Ga0307412_10057816 3300031911 Bacteria 2590
559 Ga0307412_10065081 3300031911 Bacteria 2465
560 Ga0307412_10480906 3300031911 Bacteria 1030
561 Ga0307412_11115782 3300031911 Bacteria 703
562 Ga0307409_100183715 3300031995 Bacteria 1854
563 Ga0307409_101749225 3300031995 Bacteria 651
564 Ga0307416_100023015 3300032002 Bacteria 4512
565 Ga0307416_100068689 3300032002 Bacteria 2929
566 Ga0307416_100312658 3300032002 Bacteria 1568
567 Ga0307414_10008085 3300032004 Bacteria 5943
568 Ga0307414_10321315 3300032004 Bacteria 1317
569 Ga0307414_10482254 3300032004 Bacteria 1094
570 Ga0307414_10968353 3300032004 Bacteria 782
571 Ga0307414_11013262 3300032004 Bacteria 765
572 Ga0307411_10000548 3300032005 Bacteria 13322
573 Ga0307411_10077498 3300032005 Bacteria 2275
574 Ga0307411_10232700 3300032005 Bacteria 1437
575 Ga0307411_10262288 3300032005 Bacteria 1365
576 Ga0307411_10421808 3300032005 Bacteria 1108
577 Ga0307415_101103417 3300032126 Bacteria 743
578 Ga0316583_10017125 3300032133 Bacteria 2606
579 Ga0316593_10009836 3300032168 Bacteria 2718
580 Ga0307510_10000311 3300033180 Bacteria 44908
581 Ga0373950_0003412 3300034818 Bacteria 2264
582 Ga0373959_0058069 3300034820 Bacteria 850
583 Ga0373944_0058770 3300035089 Bacteria 1229
584 Ga0373951_0029584 3300035091 Bacteria 1287
585 Ga0373939_0000006 3300035114 Bacteria 78721
586 Ga0373960_0000041 3300035121 Bacteria 16652
587 Ga0373946_0107776 3300035171 Bacteria 1257
588 Ga0373931_0000514 3300035691 Bacteria 15835
589 Ga0373937_0265951 3300036401 Bacteria 1618
590 Ga0395899_0003079 3300037312 Bacteria 13283
591 Ga0395899_0008624 3300037312 Bacteria 7843
592 Ga0395899_0111358 3300037312 Bacteria 1968
593 Ga0395899_0260826 3300037312 Bacteria 1185
594 Ga0395900_0000054 3300037418 Bacteria 220487
595 Ga0395900_0026485 3300037418 Bacteria 5937
596 Ga0395900_0064720 3300037418 Bacteria 3757
597 Ga0395900_0111316 3300037418 Bacteria 2812
598 Ga0395900_0411167 3300037418 Bacteria 1315
599 Ga0395900_0572708 3300037418 Bacteria 1072
600 Ga0395898_0000798 3300037466 Bacteria 53358
601 Ga0395898_0425136 3300037466 Bacteria 1266
602 Ga0395898_0472253 3300037466 Bacteria 1193
603 Ga0395905_0000148 3300037471 Bacteria 116301
604 Ga0395905_0001062 3300037471 Bacteria 34652
605 Ga0395905_0002549 3300037471 Bacteria 20091
606 Ga0395905_0003187 3300037471 Bacteria 17661
607 Ga0395905_0016333 3300037471 Bacteria 7053
608 Ga0395905_0030153 3300037471 Bacteria 5112
609 Ga0395905_0049497 3300037471 Bacteria 3938
610 Ga0395905_0049955 3300037471 Bacteria 3919
611 Ga0395905_0101793 3300037471 Bacteria 2696
612 Ga0395905_0323338 3300037471 Bacteria 1432
613 Ga0395905_0388293 3300037471 Bacteria 1290
614 Ga0395905_0695531 3300037471 Bacteria 919
615 Ga0395905_1294698 3300037471 Bacteria 633
616 Ga0395901_0012708 3300038443 Bacteria 8540
617 Ga0395901_0085741 3300038443 Bacteria 3292
618 Ga0395901_0119190 3300038443 Bacteria 2773
619 Ga0395901_0121303 3300038443 Bacteria 2747
620 Ga0395901_0173517 3300038443 Bacteria 2262
621 Ga0395901_0176105 3300038443 Bacteria 2244
622 Ga0395901_0187430 3300038443 Bacteria 2170
623 Ga0395901_0266367 3300038443 Bacteria 1783
624 Ga0395901_0311735 3300038443 Bacteria 1629
625 Ga0400483_098478 3300039062 Bacteria 11916
626 Ga0436365_0161847 3300039437 Bacteria 516
627 Ga0436365_0872657 3300039437 Bacteria 673
628 Ga0439436_0000392 3300041404 Bacteria 10907
629 Ga0439436_0002953 3300041404 Bacteria 5159
630 Ga0439436_0013763 3300041404 Bacteria 2446
631 Ga0439439_0013953 3300041406 Bacteria 1952
632 Ga0439439_0051148 3300041406 Bacteria 1083
633 Ga0439439_0114708 3300041406 Bacteria 749
634 Ga0439439_0138768 3300041406 Bacteria 685
635 Ga0439447_009228 3300041407 Bacteria 3004
636 Ga0439447_032624 3300041407 Bacteria 1301
637 Ga0439461_0001378 3300041410 Bacteria 3750
638 Ga0439461_0007060 3300041410 Bacteria 1977
639 Ga0439466_0008881 3300041411 Bacteria 3779
640 Ga0439466_0015610 3300041411 Bacteria 2758
641 Ga0439465_0000387 3300041413 Bacteria 12738
642 Ga0439465_0094931 3300041413 Bacteria 1024
643 Ga0451791_1261760 3300041451 Bacteria 724
644 Ga0451802_0405913 3300041460 Bacteria 537
645 Ga0451804_0865208 3300041463 Bacteria 624
646 Ga0451833_1215784 3300041491 Bacteria 1154
647 Ga0451833_1425945 3300041491 Bacteria 1012
648 Ga0451841_0537712 3300041498 Bacteria 756
649 Ga0451841_0963024 3300041498 Bacteria 575
650 Ga0451855_0271653 3300041511 Bacteria 769
651 Ga0451853_1667522 3300041512 Bacteria 595
652 Ga0439431_0001219 3300041997 Bacteria 5622
653 Ga0439433_0000473 3300041999 Bacteria 7421
654 Ga0439437_005415 3300042000 Bacteria 1404
655 Ga0439437_019870 3300042000 Bacteria 809
656 Ga0439442_004083 3300042002 Bacteria 2896
657 Ga0439443_032008 3300042003 Bacteria 870
658 Ga0439445_0000712 3300042004 Bacteria 6928
659 Ga0439445_0027176 3300042004 Bacteria 1469
660 Ga0439445_0047170 3300042004 Bacteria 1156
661 Ga0439432_002602 3300042006 Bacteria 6790
662 Ga0439432_019440 3300042006 Bacteria 2262
663 Ga0439449_0002379 3300042007 Bacteria 7363
664 Ga0439449_0003757 3300042007 Bacteria 5880
665 Ga0439449_0005865 3300042007 Bacteria 4695
666 Ga0439449_0006097 3300042007 Bacteria 4607
667 Ga0439449_0010161 3300042007 Bacteria 3559
668 Ga0439449_0049957 3300042007 Bacteria 1547
669 Ga0439452_000611 3300042010 Bacteria 18092
670 Ga0439452_062410 3300042010 Bacteria 832
671 Ga0439454_068024 3300042011 Bacteria 628
672 Ga0439457_002909 3300042014 Bacteria 4772
673 Ga0439457_013201 3300042014 Bacteria 1857
674 Ga0439462_0004945 3300042015 Bacteria 3270
675 Ga0439462_0123858 3300042015 Bacteria 720
676 Ga0450912_024875 3300042116 Bacteria 597
677 Ga0450913_001575 3300042117 Bacteria 1279
678 Ga0450919_000992 3300042121 Bacteria 3676
679 Ga0450920_009242 3300042122 Bacteria 1811
680 Ga0450920_025575 3300042122 Bacteria 1150
681 Ga0450921_000320 3300042123 Bacteria 2143
682 Ga0450923_001819 3300042125 Bacteria 2925
683 Ga0450888_000719 3300042126 Bacteria 3153
684 Ga0450890_006388 3300042127 Bacteria 1508
685 Ga0450890_019152 3300042127 Bacteria 920
686 Ga0450891_000123 3300042129 Bacteria 6931
687 Ga0450892_001446 3300042130 Bacteria 2312
688 Ga0450895_021983 3300042132 Bacteria 595
689 Ga0450896_008927 3300042133 Bacteria 1393
690 Ga0450896_012842 3300042133 Bacteria 1187
691 Ga0450898_004928 3300042134 Bacteria 1995
692 Ga0450902_008791 3300042137 Bacteria 1582
693 Ga0450889_000176 3300042144 Bacteria 6865
694 Ga0450906_007423 3300042145 Bacteria 2166
695 Ga0450906_009590 3300042145 Bacteria 1843
696 Ga0450907_014618 3300042146 Bacteria 1310
697 Ga0450910_005526 3300042147 Bacteria 1726
698 Ga0439446_0029700 3300042156 Bacteria 1577
699 Ga0450908_004328 3300042184 Bacteria 2737
700 Ga0450908_004926 3300042184 Bacteria 2564
701 Ga0450909_004479 3300042185 Bacteria 1994
702 Ga0439434_0003045 3300042435 Bacteria 4916
703 Ga0439434_0004381 3300042435 Bacteria 4128
704 Ga0439434_0038955 3300042435 Bacteria 1457
705 Ga0439435_0124557 3300042436 Bacteria 810
706 Ga0439464_0010780 3300042439 Bacteria 2416
707 Ga0450916_067619 3300042530 Bacteria 591
708 Ga0450918_000264 3300042531 Bacteria 11804
709 Ga0450918_001423 3300042531 Bacteria 4755
710 Ga0450893_0010771 3300042532 Bacteria 1506
711 Ga0450893_0020353 3300042532 Bacteria 1139
712 Ga0451577_0019186 3300042876 Bacteria 6289
713 Ga0451577_0144388 3300042876 Bacteria 2139
714 Ga0451577_0191062 3300042876 Bacteria 1847
715 Ga0466969_0000054 3300044656 Bacteria 59867
716 Ga0466969_0010663 3300044656 Bacteria 4869
717 Ga0453683_0002845 3300044673 Bacteria 13126
718 Ga0466965_0088633 3300044683 Bacteria 1571
719 Ga0466965_0094149 3300044683 Bacteria 1526
720 Ga0466965_0405699 3300044683 Bacteria 753
721 Ga0466966_0002469 3300044684 Bacteria 12104
722 Ga0466966_0011535 3300044684 Bacteria 5863
723 Ga0466961_0059317 3300044693 Bacteria 2433
724 Ga0466961_0226434 3300044693 Bacteria 1151
725 Ga0466964_0005457 3300044706 Bacteria 4721
726 Ga0453684_0361044 3300044712 Bacteria 1635
727 Ga0453684_0370975 3300044712 Bacteria 1609
728 Ga0453684_1601680 3300044712 Bacteria 668
729 Ga0466971_0007746 3300044719 Bacteria 4679
730 Ga0466971_0326792 3300044719 Bacteria 740
731 Ga0466970_0009993 3300044765 Bacteria 4806
732 Ga0466970_0047180 3300044765 Bacteria 2295
733 Ga0466957_0099067 3300044842 Bacteria 1835
734 Ga0466957_0184812 3300044842 Bacteria 1363
735 Ga0466957_0668137 3300044842 Bacteria 731
736 Ga0466960_0028787 3300044901 Bacteria 2544
737 Ga0466960_0239453 3300044901 Bacteria 1004
738 Ga0466959_0000528 3300045049 Bacteria 22186
739 Ga0466959_0104843 3300045049 Bacteria 2022
740 Ga0451576_0072525 3300045051 Bacteria 3583
741 Ga0451576_0099477 3300045051 Bacteria 3026
742 Ga0451576_0146107 3300045051 Bacteria 2465
743 Ga0451576_0269778 3300045051 Bacteria 1779
744 Ga0451576_1148854 3300045051 Bacteria 812
745 Ga0466967_0627724 3300045976 Bacteria 1061
746 Ga0466967_2472295 3300045976 Bacteria 514
747 Ga0495627_007791 3300046453 Bacteria 4077
748 Ga0495627_020910 3300046453 Bacteria 2174
749 Ga0495629_0104012 3300046459 Bacteria 1981
750 Ga0495629_0717846 3300046459 Bacteria 663
751 Ga0495638_0043532 3300046460 Bacteria 2832
752 Ga0495638_0063325 3300046460 Bacteria 2280
753 Ga0495651_0070658 3300046462 Bacteria 2656
754 Ga0495653_0133775 3300046463 Bacteria 1752
755 Ga0495639_0122426 3300046475 Bacteria 1241
756 Ga0495610_0010849 3300046512 Bacteria 5626
757 Ga0495610_0020359 3300046512 Bacteria 3685
758 Ga0495610_0085259 3300046512 Bacteria 1442
759 Ga0495610_0392893 3300046512 Bacteria 513
760 Ga0495616_0000722 3300046513 Bacteria 24406
761 Ga0495618_0138797 3300046514 Bacteria 1555
762 Ga0495618_0345519 3300046514 Bacteria 918
763 Ga0495620_0021122 3300046515 Bacteria 3166
764 Ga0495628_1035681 3300046516 Bacteria 563
765 Ga0495631_0000446 3300046518 Bacteria 28333
766 Ga0495632_0117942 3300046519 Bacteria 1242
767 Ga0495637_0028290 3300046520 Bacteria 2504
768 Ga0495643_0064789 3300046522 Bacteria 1930
769 Ga0495663_0095586 3300046525 Bacteria 973
770 Ga0495663_0099688 3300046525 Bacteria 955
771 Ga0495642_0038373 3300046528 Bacteria 1941
772 Ga0495654_0014862 3300046530 Bacteria 4136
773 Ga0495654_0016539 3300046530 Bacteria 3896
774 Ga0495609_0248669 3300046538 Bacteria 732
775 Ga0495621_0009160 3300046539 Bacteria 2996
776 Ga0495621_0100588 3300046539 Bacteria 1100
777 Ga0495621_0109254 3300046539 Bacteria 1059
778 Ga0495621_0346171 3300046539 Bacteria 623
779 Ga0495597_0001135 3300046542 Bacteria 20086
780 Ga0495622_0232948 3300046557 Bacteria 813
781 Ga0495633_0002529 3300046558 Bacteria 12851
782 Ga0495633_0157967 3300046558 Bacteria 1046
783 Ga0495656_0001008 3300046615 Bacteria 9110
784 Ga0495656_0021519 3300046615 Bacteria 2512
785 Ga0495634_0352510 3300046642 Bacteria 881
786 Ga0495625_0000396 3300046660 Bacteria 66627
787 Ga0495625_0020614 3300046660 Bacteria 5085
788 Ga0495635_0230945 3300046663 Bacteria 1250
789 Ga0495661_0101423 3300046665 Bacteria 1619
790 Ga0495588_0008771 3300046674 Bacteria 4646
791 Ga0495588_0017519 3300046674 Bacteria 3481
792 Ga0495588_0022794 3300046674 Bacteria 3096
793 Ga0495599_0210546 3300046678 Bacteria 1192
794 Ga0495658_0097627 3300046683 Bacteria 1749
795 Ga0495658_0263080 3300046683 Bacteria 1086
796 Ga0495670_0069830 3300046691 Bacteria 1777
797 Ga0495671_0006709 3300046692 Bacteria 6631
798 Ga0495600_0115925 3300046809 Bacteria 1744
799 Ga0495600_0207404 3300046809 Bacteria 1257
800 Ga0495600_0622530 3300046809 Bacteria 654
801 Ga0495660_0044178 3300046810 Bacteria 2453
802 Ga0495581_0296453 3300047315 Bacteria 945
803 Ga0495676_0050590 3300047321 Bacteria 3331
804 Ga0495687_203076 3300047443 Bacteria 628
805 Ga0495681_0113426 3300047470 Bacteria 1171
806 Ga0495686_0005856 3300047472 Bacteria 9583
807 Ga0495593_0005694 3300047673 Bacteria 7351
808 Ga0495593_0098558 3300047673 Bacteria 1501
809 Ga0495593_0631470 3300047673 Bacteria 538
810 Ga0495602_0459912 3300048088 Bacteria 897
811 Ga0495614_0008498 3300048089 Bacteria 4565
812 Ga0495615_0023364 3300048090 Bacteria 1416
813 Ga0495615_0172772 3300048090 Bacteria 655
814 Ga0496100_0078272 3300048903 Bacteria 2225
815 Ga0496100_1402725 3300048903 Bacteria 551
816 Ga0496101_0042961 3300048904 Bacteria 3228
817 Ga0496102_0032292 3300048905 Bacteria 4703
818 Ga0496102_0032877 3300048905 Bacteria 4662
819 Ga0496102_0036331 3300048905 Bacteria 4437
820 Ga0496103_0211580 3300048906 Bacteria 1247
821 Ga0496104_0464865 3300048907 Bacteria 1177
822 Ga0496105_0028533 3300048908 Bacteria 4563
823 Ga0496105_0197976 3300048908 Bacteria 1640
824 Ga0496106_0047925 3300048909 Bacteria 3217
825 Ga0496107_0248541 3300048910 Bacteria 1323
826 Ga0496112_0345553 3300048915 Bacteria 1431
827 Ga0496113_1385750 3300048916 Bacteria 545
828 Ga0496113_1591987 3300048916 Bacteria 503
829 Ga0496114_0056546 3300048917 Bacteria 3275
830 Ga0496114_0368850 3300048917 Bacteria 1270
831 Ga0496114_0472552 3300048917 Bacteria 1109
832 Ga0496116_0025554 3300048919 Bacteria 4340
833 Ga0496117_0044176 3300048920 Bacteria 3230
834 Ga0496117_0045056 3300048920 Bacteria 3190
835 Ga0496118_0050037 3300048921 Bacteria 3211
836 Ga0496118_0325976 3300048921 Bacteria 831
837 Ga0496121_0022936 3300048924 Bacteria 6032
838 Ga0496121_0244409 3300048924 Bacteria 1248
839 Ga0496122_0000688 3300048925 Bacteria 67392
840 Ga0496122_0069209 3300048925 Bacteria 2529
841 Ga0496122_0101496 3300048925 Bacteria 1922
842 Ga0496122_0110935 3300048925 Bacteria 1800
843 Ga0496122_0293218 3300048925 Bacteria 882
844 Ga0496122_0371799 3300048925 Bacteria 737
845 Ga0496123_0001158 3300048926 Bacteria 39125
846 Ga0496123_0038770 3300048926 Bacteria 3343
847 Ga0496123_0057248 3300048926 Bacteria 2539
848 Ga0496123_0131922 3300048926 Bacteria 1382
849 Ga0496123_0161827 3300048926 Bacteria 1192
850 Ga0496124_0052228 3300048927 Bacteria 3473
851 Ga0496124_0059351 3300048927 Bacteria 3214
852 Ga0496124_0077403 3300048927 Bacteria 2743
853 Ga0496124_0196762 3300048927 Bacteria 1537
854 Ga0496125_0006625 3300048928 Bacteria 12466
855 Ga0496125_0017065 3300048928 Bacteria 6937
856 Ga0496125_0290512 3300048928 Bacteria 1007
857 Ga0496125_0341143 3300048928 Bacteria 899
858 Ga0496125_0510420 3300048928 Bacteria 674
859 Ga0496126_0035110 3300048929 Bacteria 4702
860 Ga0496126_0234437 3300048929 Bacteria 1536
861 Ga0496126_0932713 3300048929 Bacteria 656
862 Ga0501301_010670 3300049524 Bacteria 756
863 Ga0501315_019643 3300049531 Bacteria 901
864 Ga0501034_0247677 3300049571 Bacteria 1727
865 Ga0501037_0244588 3300049573 Bacteria 1257
866 Ga0501038_0606296 3300049574 Bacteria 828
867 Ga0501043_0641387 3300049579 Bacteria 781
868 Ga0501198_000044 3300049649 Bacteria 43232
869 Ga0501222_000017 3300049662 Bacteria 75770
870 Ga0501253_003212 3300049683 Bacteria 1935
871 Ga0501035_0048271 3300049822 Bacteria 3818
872 Ga0501044_0278341 3300049823 Bacteria 1607
873 nmdc:mga03683_132966_c1 3300050489 Bacteria 1114
874 nmdc:mga03683_252889_c1 3300050489 Bacteria 819
875 nmdc:mga03683_32250_c1 3300050489 Bacteria 2107
876 nmdc:mga03683_60337_c1 3300050489 Bacteria 1602
877 nmdc:mga03n38_139021_c1 3300050490 Bacteria 1211
878 nmdc:mga03n38_850629_c1 3300050490 Bacteria 533
879 nmdc:mga03n38_90616_c1 3300050490 Bacteria 1455
880 nmdc:mga00v17_10018_c1 3300050491 Bacteria 5158
881 nmdc:mga00v17_665279_c1 3300050491 Bacteria 669
882 nmdc:mga00v17_99525_c1 3300050491 Bacteria 1834
883 nmdc:mga0yw44_14269_c1 3300050492 Bacteria 4214
884 nmdc:mga0yw44_309247_c1 3300050492 Bacteria 1060
885 nmdc:mga0k408_14275_c2 3300050493 Bacteria 1995
886 nmdc:mga0k408_157357_c1 3300050493 Bacteria 1353
887 nmdc:mga0k408_23067_c1 3300050493 Bacteria 3507
888 nmdc:mga0k408_28627_c1 3300050493 Bacteria 3168
889 nmdc:mga0k408_351820_c1 3300050493 Bacteria 878
890 nmdc:mga0k408_36399_c1 3300050493 Bacteria 2825
891 nmdc:mga0k408_38912_c1 3300050493 Bacteria 2731
892 nmdc:mga0k408_445271_c1 3300050493 Bacteria 769
893 nmdc:mga06z11_295078_c1 3300050494 Bacteria 963
894 nmdc:mga06z11_556810_c1 3300050494 Bacteria 696
895 nmdc:mga06z11_581398_c1 3300050494 Bacteria 681
896 nmdc:mga07m45_11241_c1 3300050496 Bacteria 4700
897 nmdc:mga07m45_13172_c1 3300050496 Bacteria 4381
898 nmdc:mga07m45_21825_c1 3300050496 Bacteria 3490
899 nmdc:mga07m45_249894_c1 3300050496 Bacteria 1032
900 nmdc:mga07m45_27154_c1 3300050496 Bacteria 3151
901 nmdc:mga07m45_312083_c1 3300050496 Bacteria 914
902 nmdc:mga07m45_533_c1 3300050496 Bacteria 16098
903 nmdc:mga07m45_58332_c1 3300050496 Bacteria 2184
904 nmdc:mga07m45_9770_c1 3300050496 Bacteria 4990
905 Ga0500610_0005849 3300053079 Bacteria 5088
906 Ga0500610_0007392 3300053079 Bacteria 4702
907 Ga0500578_0000926 3300053086 Bacteria 32927
908 Ga0500643_010390 3300053087 Bacteria 3468
909 Ga0500644_0004370 3300053088 Bacteria 3534
910 Ga0500644_0008346 3300053088 Bacteria 2732
911 Ga0500644_0215805 3300053088 Bacteria 798
912 Ga0500646_0022004 3300053090 Bacteria 1702
913 Ga0500647_0069700 3300053091 Bacteria 1691
914 Ga0500651_0000063 3300053093 Bacteria 70772
915 Ga0500651_0037817 3300053093 Bacteria 3042
916 Ga0500641_0082765 3300053096 Bacteria 1364
917 Ga0500641_0167280 3300053096 Bacteria 947
918 Ga0500650_0037746 3300053098 Bacteria 2221
919 Ga0500562_027216 3300053108 Bacteria 1500
920 Ga0500562_049118 3300053108 Bacteria 1127
921 Ga0500571_008126 3300053110 Bacteria 5741
922 Ga0500592_009925 3300053116 Bacteria 1515
923 Ga0500593_000487 3300053117 Bacteria 15665
924 Ga0500593_001737 3300053117 Bacteria 7855
925 Ga0500593_004766 3300053117 Bacteria 5281
926 Ga0500594_0000905 3300053118 Bacteria 6359
927 Ga0500597_113615 3300053120 Bacteria 1175
928 Ga0500607_001614 3300053121 Bacteria 19910
929 Ga0500607_095498 3300053121 Bacteria 1487
930 Ga0500608_008503 3300053122 Bacteria 4320
931 Ga0500608_083300 3300053122 Bacteria 1506
932 Ga0500618_035370 3300053125 Bacteria 1160
933 Ga0500618_045103 3300053125 Bacteria 1006
934 Ga0500626_105204 3300053128 Bacteria 1225
935 Ga0500642_0013135 3300053130 Bacteria 3032
936 Ga0500652_004429 3300053131 Bacteria 4350
937 Ga0500652_031259 3300053131 Bacteria 2087
938 Ga0500655_028009 3300053133 Bacteria 1077
939 Ga0500658_0002954 3300053134 Bacteria 6529
940 Ga0500658_0002955 3300053134 Bacteria 6529
941 Ga0500559_0000260 3300053136 Bacteria 41596
942 Ga0500559_0006663 3300053136 Bacteria 5193
943 Ga0500559_0008325 3300053136 Bacteria 4555
944 Ga0500559_0023456 3300053136 Bacteria 2619
945 Ga0500568_0003245 3300053139 Bacteria 9191
946 Ga0500568_0145526 3300053139 Bacteria 878
947 Ga0500574_031804 3300053141 Bacteria 1424
948 Ga0500577_0073196 3300053142 Bacteria 1348
949 Ga0500590_034903 3300053148 Bacteria 2603
950 Ga0500604_0021837 3300053151 Bacteria 1812
951 Ga0500604_0055885 3300053151 Bacteria 1228
952 Ga0500604_0248720 3300053151 Bacteria 615
953 Ga0500616_0025494 3300053153 Bacteria 3279
954 Ga0500619_000059 3300053154 Bacteria 33814
955 Ga0500619_113521 3300053154 Bacteria 923
956 Ga0500622_0001479 3300053156 Bacteria 18702
957 Ga0500622_0004445 3300053156 Bacteria 8803
958 Ga0500633_0032144 3300053160 Bacteria 1702
959 Ga0500634_0038376 3300053161 Bacteria 2604
960 Ga0500638_029064 3300053162 Bacteria 2658
961 Ga0500636_0165370 3300053177 Bacteria 1202
962 Ga0500570_083918 3300053724 Bacteria 1420
963 Ga0500645_000198 3300053730 Bacteria 46701
964 Ga0500645_004925 3300053730 Bacteria 5019
965 Ga0500645_015380 3300053730 Bacteria 2424
966 Ga0500587_000969 3300053739 Bacteria 3862
967 Ga0500587_006774 3300053739 Bacteria 1509
968 Ga0466962_0407838 3300061719 Bacteria 681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10097808 Ga0207658_100978084 138
2 3300006058 Ga0075432_10008843 Ga0075432_100088432 143
3 3300027907 Ga0207428_10102987 Ga0207428_101029872 143
4 3300005467 Ga0070706_100001719 Ga0070706_10000171918 144
5 3300025910 Ga0207684_10001654 Ga0207684_1000165423 144
6 3300025922 Ga0207646_10085820 Ga0207646_100858204 144
7 3300046516 Ga0495628_1035681 Ga0495628_1035681_13_447 144
8 3300046525 Ga0495663_0095586 Ga0495663_0095586_13_447 144
9 3300048916 Ga0496113_1591987 Ga0496113_1591987_10_444 144
10 3300050490 nmdc:mga03n38_139021_c1 nmdc:mga03n38_139021_c1_34_468 144
11 3300050490 nmdc:mga03n38_850629_c1 nmdc:mga03n38_850629_c1_77_511 144
12 iso_pu_bacteria 2547132374 2548497415 151
13 iso_pu_bacteria 2585428057 2587726267 151
14 iso_pu_bacteria 2585428058 2587734438 151
15 iso_pu_bacteria 2585428062 2587756326 151
16 iso_pu_bacteria 2588253510 2588293853 151
17 iso_pu_bacteria 2599185214 2599623674 151
18 iso_pu_bacteria 2599185226 2599671707 151
19 iso_pu_bacteria 2599185227 2599681280 151
20 iso_pu_bacteria 2599185229 2599693317 151
21 iso_pu_bacteria 2643221544 2643746347 151
22 iso_pu_bacteria 2643221570 2643866551 151
23 iso_pu_bacteria 2643221585 2643933180 151
24 iso_pu_bacteria 2643221592 2643970942 151
25 iso_pu_bacteria 2643221596 2643993303 151
26 iso_pu_bacteria 2643221625 2644138803 151
27 iso_pu_bacteria 2643221628 2644159608 151
28 iso_pu_bacteria 2643221644 2644243609 151
29 iso_pu_bacteria 2643221646 2644258899 151
30 iso_pu_bacteria 2643221648 2644273961 151
31 iso_pu_bacteria 2643221652 2644294092 151
32 iso_pu_bacteria 2643221656 2644314429 151
33 iso_pu_bacteria 2643221658 2644327631 151
34 iso_pu_bacteria 2643221683 2644468176 151
35 iso_pu_bacteria 2643221717 2644646095 151
36 iso_pu_bacteria 2721755523 2722883941 151
37 iso_pu_bacteria 2738541277 2738717743 151
38 iso_pu_bacteria 2738541307 2738879354 151
39 iso_pu_bacteria 2738541337 2739055646 151
40 iso_pu_bacteria 2738543012 2739242693 151
41 iso_pu_bacteria 2738543013 2739250710 151
42 iso_pu_bacteria 2738543019 2739278429 151
43 iso_pu_bacteria 2816332133 2816472990 151
44 iso_pu_bacteria 2818991446 2819597227 151
45 iso_pu_bacteria 2831265667 2831266352 151
46 iso_pu_bacteria 2838054893 2838057536 151
47 iso_pu_bacteria 2839138175 2839140286 151
48 iso_pu_bacteria 2842677519 2842679865 151
49 iso_pu_bacteria 2842718218 2842719553 151
50 iso_pu_bacteria 2842733646 2842736780 151
51 iso_pu_bacteria 2842747753 2842747851 151
52 iso_pu_bacteria 2881101125 2881101844 151
53 iso_pu_bacteria 2885192300 2885192687 151
54 iso_pu_bacteria 2885198086 2885204476 151
55 iso_pu_bacteria 2885211737 2885218129 151
56 iso_pu_bacteria 2899924645 2899924731 151
57 iso_pu_bacteria 2904449895 2904454420 151
58 iso_pu_bacteria 2904456579 2904461137 151
59 iso_pu_bacteria 2904541872 2904548182 151
60 iso_pu_bacteria 2916178963 2916180132 151
61 iso_pu_bacteria 2919462493 2919466014 151
62 iso_pu_bacteria 2919704043 2919704600 151
63 iso_pu_bacteria 2928037797 2928039142 151
64 iso_pu_bacteria 2928044640 2928045253 151
65 iso_pu_bacteria 2928051484 2928053058 151
66 iso_pu_bacteria 2928064002 2928064270 151
67 iso_pu_bacteria 2928070936 2928071707 151
68 iso_pu_bacteria 2928084124 2928084348 151
69 iso_pu_bacteria 2928115317 2928118544 151
70 iso_pu_bacteria 2929160207 2929163111 151
71 iso_pu_bacteria 2929520902 2929527019 151
72 iso_pu_bacteria 2932422444 2932425891 151
73 iso_pu_bacteria 2945909444 2945911615 151
74 iso_pu_bacteria 2945945610 2945948177 151
75 iso_pu_bacteria 2945972063 2945977178 151
76 iso_pu_bacteria 2945984333 2945986043 151
77 iso_pu_bacteria 2954767861 2954772295 151
78 iso_pu_bacteria 2974320154 2974323387 151
79 iso_pu_bacteria 2990710928 2990712263 151
80 iso_pu_bacteria 8054357960 8054359813 151
81 3300005543 Ga0070672_100639082 Ga0070672_1006390822 152
82 3300025926 Ga0207659_10258615 Ga0207659_102586152 152
83 3300025935 Ga0207709_10578054 Ga0207709_105780542 152
84 3300028794 Ga0307515_10127705 Ga0307515_101277054 154
85 3300031456 Ga0307513_10003449 Ga0307513_100034499 154
86 3300032133 Ga0316583_10017125 Ga0316583_100171252 154
87 3300039062 Ga0400483_098478 Ga0400483_098478_1876_2343 154
88 3300042876 Ga0451577_0019186 Ga0451577_0019186_3927_4394 154
89 3300001979 JGI24740J21852_10001987 JGI24740J21852_100019872 155
90 3300001979 JGI24740J21852_10022496 JGI24740J21852_100224964 155
91 3300001989 JGI24739J22299_10064426 JGI24739J22299_100644261 155
92 3300002773 JGI25152J39213_1003563 JGI25152J39213_10035633 155
93 3300002773 JGI25152J39213_1004322 JGI25152J39213_10043225 155
94 3300002774 JGI25150J39212_1000611 JGI25150J39212_100061112 155
95 3300002987 JGI25159J45721_1004613 JGI25159J45721_10046135 155
96 3300002987 JGI25159J45721_1005744 JGI25159J45721_10057443 155
97 3300003187 JGI25151J46595_10001037 JGI25151J46595_100010376 155
98 3300003187 JGI25151J46595_10002554 JGI25151J46595_100025547 155
99 3300003187 JGI25151J46595_10009062 JGI25151J46595_100090624 155
100 3300003187 JGI25151J46595_10042257 JGI25151J46595_100422571 155
101 3300003215 JGI25153J46596_10005629 JGI25153J46596_100056294 155
102 3300003215 JGI25153J46596_10008890 JGI25153J46596_100088904 155
103 3300003215 JGI25153J46596_10016584 JGI25153J46596_100165844 155
104 3300003215 JGI25153J46596_10034724 JGI25153J46596_100347241 155
105 3300003316 rootH1_10053737 rootH1_100537373 155
106 3300003320 rootH2_10216731 rootH2_102167312 155
107 3300003322 rootL2_10006742 rootL2_100067422 155
108 3300003322 rootL2_10326548 rootL2_103265482 155
109 3300003323 rootH1_10008734 rootH1_100087343 155
110 3300003354 JGI25160J50197_1008977 JGI25160J50197_10089774 155
111 3300003374 JGI25161J50226_1003069 JGI25161J50226_10030694 155
112 3300003578 Ga0006562J51391_1072998 Ga0006562J51391_10729984 155
113 3300003578 Ga0006562J51391_1072999 Ga0006562J51391_10729993 155
114 3300003578 Ga0006562J51391_1109357 Ga0006562J51391_11093574 155
115 3300003578 Ga0006562J51391_1109361 Ga0006562J51391_11093614 155
116 3300003760 Ga0055527_1008925 Ga0055527_10089252 155
117 3300003762 Ga0055542_1000039 Ga0055542_100003987 155
118 3300003771 Ga0055526_1005340 Ga0055526_10053402 155
119 3300003771 Ga0055526_1009890 Ga0055526_10098905 155
120 3300003771 Ga0055526_1009910 Ga0055526_10099105 155
121 3300003773 Ga0055537_1000296 Ga0055537_10002966 155
122 3300003773 Ga0055537_1003601 Ga0055537_10036014 155
123 3300003773 Ga0055537_1004830 Ga0055537_10048303 155
124 3300003775 Ga0055524_1000302 Ga0055524_100030239 155
125 3300003775 Ga0055524_1005397 Ga0055524_10053974 155
126 3300003775 Ga0055524_1007817 Ga0055524_10078174 155
127 3300003781 Ga0055536_1002464 Ga0055536_10024645 155
128 3300003781 Ga0055536_1025110 Ga0055536_10251102 155
129 3300003781 Ga0055536_1035294 Ga0055536_10352942 155
130 3300003784 Ga0055534_1000092 Ga0055534_100009238 155
131 3300003784 Ga0055534_1000506 Ga0055534_100050615 155
132 3300003784 Ga0055534_1003706 Ga0055534_10037064 155
133 3300003784 Ga0055534_1003774 Ga0055534_10037742 155
134 3300003790 Ga0055528_1000190 Ga0055528_100019026 155
135 3300003790 Ga0055528_1007713 Ga0055528_10077134 155
136 3300003790 Ga0055528_1011213 Ga0055528_10112134 155
137 3300003791 Ga0055530_10000214 Ga0055530_1000021422 155
138 3300003791 Ga0055530_10046040 Ga0055530_100460402 155
139 3300003792 Ga0055540_1000004 Ga0055540_100000473 155
140 3300003792 Ga0055540_1000035 Ga0055540_100003562 155
141 3300003792 Ga0055540_1006272 Ga0055540_10062724 155
142 3300003792 Ga0055540_1010662 Ga0055540_10106622 155
143 3300003794 Ga0055531_10000317 Ga0055531_100003173 155
144 3300003794 Ga0055531_10000612 Ga0055531_1000061222 155
145 3300003794 Ga0055531_10010027 Ga0055531_100100275 155
146 3300003794 Ga0055531_10010039 Ga0055531_100100394 155
147 3300003794 Ga0055531_10013011 Ga0055531_100130111 155
148 3300004625 Ga0055543_1003575 Ga0055543_10035754 155
149 3300004625 Ga0055543_1005529 Ga0055543_10055291 155
150 3300005262 Ga0065165_1001409 Ga0065165_100140914 155
151 3300005262 Ga0065165_1006920 Ga0065165_10069204 155
152 3300005262 Ga0065165_1019442 Ga0065165_10194422 155
153 3300005262 Ga0065165_1021156 Ga0065165_10211562 155
154 3300005288 Ga0065714_10071185 Ga0065714_100711854 155
155 3300005288 Ga0065714_10162009 Ga0065714_101620092 155
156 3300005327 Ga0070658_10153664 Ga0070658_101536642 155
157 3300005328 Ga0070676_10041207 Ga0070676_100412072 155
158 3300005328 Ga0070676_10245308 Ga0070676_102453082 155
159 3300005330 Ga0070690_100004296 Ga0070690_1000042962 155
160 3300005331 Ga0070670_100425081 Ga0070670_1004250812 155
161 3300005331 Ga0070670_100500835 Ga0070670_1005008352 155
162 3300005331 Ga0070670_100522989 Ga0070670_1005229892 155
163 3300005333 Ga0070677_10274327 Ga0070677_102743272 155
164 3300005334 Ga0068869_100028112 Ga0068869_1000281124 155
165 3300005334 Ga0068869_100324339 Ga0068869_1003243392 155
166 3300005335 Ga0070666_10002227 Ga0070666_100022271 155
167 3300005336 Ga0070680_100180066 Ga0070680_1001800663 155
168 3300005337 Ga0070682_100051931 Ga0070682_1000519312 155
169 3300005338 Ga0068868_100000526 Ga0068868_10000052623 155
170 3300005338 Ga0068868_100203916 Ga0068868_1002039163 155
171 3300005338 Ga0068868_100349216 Ga0068868_1003492162 155
172 3300005339 Ga0070660_100106598 Ga0070660_1001065984 155
173 3300005340 Ga0070689_100268559 Ga0070689_1002685593 155
174 3300005347 Ga0070668_100077914 Ga0070668_1000779144 155
175 3300005353 Ga0070669_100012794 Ga0070669_1000127942 155
176 3300005353 Ga0070669_100150344 Ga0070669_1001503442 155
177 3300005353 Ga0070669_100366576 Ga0070669_1003665762 155
178 3300005354 Ga0070675_100001257 Ga0070675_1000012574 155
179 3300005354 Ga0070675_100907041 Ga0070675_1009070412 155
180 3300005355 Ga0070671_100125518 Ga0070671_1001255182 155
181 3300005355 Ga0070671_100305998 Ga0070671_1003059982 155
182 3300005355 Ga0070671_100375628 Ga0070671_1003756282 155
183 3300005355 Ga0070671_100827308 Ga0070671_1008273081 155
184 3300005356 Ga0070674_100349044 Ga0070674_1003490442 155
185 3300005356 Ga0070674_100532809 Ga0070674_1005328091 155
186 3300005364 Ga0070673_100003204 Ga0070673_1000032049 155
187 3300005364 Ga0070673_100258085 Ga0070673_1002580851 155
188 3300005364 Ga0070673_100767072 Ga0070673_1007670722 155
189 3300005364 Ga0070673_100778093 Ga0070673_1007780932 155
190 3300005365 Ga0070688_100077097 Ga0070688_1000770972 155
191 3300005365 Ga0070688_100471911 Ga0070688_1004719112 155
192 3300005366 Ga0070659_100000481 Ga0070659_10000048110 155
193 3300005366 Ga0070659_101011499 Ga0070659_1010114991 155
194 3300005367 Ga0070667_100080720 Ga0070667_1000807203 155
195 3300005441 Ga0070700_100327988 Ga0070700_1003279882 155
196 3300005455 Ga0070663_100163635 Ga0070663_1001636352 155
197 3300005455 Ga0070663_100199411 Ga0070663_1001994112 155
198 3300005455 Ga0070663_100227984 Ga0070663_1002279843 155
199 3300005455 Ga0070663_100374548 Ga0070663_1003745481 155
200 3300005455 Ga0070663_101122346 Ga0070663_1011223461 155
201 3300005456 Ga0070678_100025493 Ga0070678_1000254933 155
202 3300005456 Ga0070678_100113725 Ga0070678_1001137252 155
203 3300005456 Ga0070678_100224620 Ga0070678_1002246202 155
204 3300005456 Ga0070678_101879349 Ga0070678_1018793491 155
205 3300005457 Ga0070662_100031047 Ga0070662_1000310473 155
206 3300005457 Ga0070662_100046139 Ga0070662_1000461393 155
207 3300005457 Ga0070662_100116974 Ga0070662_1001169743 155
208 3300005457 Ga0070662_100174632 Ga0070662_1001746322 155
209 3300005457 Ga0070662_100176844 Ga0070662_1001768442 155
210 3300005457 Ga0070662_100436768 Ga0070662_1004367682 155
211 3300005458 Ga0070681_10361019 Ga0070681_103610192 155
212 3300005459 Ga0068867_100000005 Ga0068867_10000000586 155
213 3300005459 Ga0068867_100062751 Ga0068867_1000627512 155
214 3300005459 Ga0068867_100097766 Ga0068867_1000977662 155
215 3300005459 Ga0068867_100112722 Ga0068867_1001127222 155
216 3300005459 Ga0068867_101148495 Ga0068867_1011484952 155
217 3300005466 Ga0070685_10250691 Ga0070685_102506911 155
218 3300005468 Ga0070707_101368383 Ga0070707_1013683831 155
219 3300005530 Ga0070679_100064787 Ga0070679_1000647872 155
220 3300005530 Ga0070679_100094911 Ga0070679_1000949113 155
221 3300005539 Ga0068853_100051725 Ga0068853_1000517255 155
222 3300005539 Ga0068853_100240813 Ga0068853_1002408132 155
223 3300005539 Ga0068853_100376107 Ga0068853_1003761072 155
224 3300005543 Ga0070672_100108731 Ga0070672_1001087312 155
225 3300005543 Ga0070672_100276294 Ga0070672_1002762942 155
226 3300005543 Ga0070672_101355628 Ga0070672_1013556281 155
227 3300005548 Ga0070665_100557805 Ga0070665_1005578052 155
228 3300005549 Ga0070704_100621411 Ga0070704_1006214112 155
229 3300005563 Ga0068855_100014182 Ga0068855_1000141822 155
230 3300005563 Ga0068855_100025134 Ga0068855_1000251342 155
231 3300005563 Ga0068855_100813039 Ga0068855_1008130392 155
232 3300005564 Ga0070664_100118860 Ga0070664_1001188602 155
233 3300005564 Ga0070664_100556684 Ga0070664_1005566842 155
234 3300005564 Ga0070664_100561635 Ga0070664_1005616352 155
235 3300005577 Ga0068857_100596251 Ga0068857_1005962512 155
236 3300005578 Ga0068854_100183933 Ga0068854_1001839333 155
237 3300005578 Ga0068854_100483848 Ga0068854_1004838482 155
238 3300005578 Ga0068854_100518381 Ga0068854_1005183812 155
239 3300005578 Ga0068854_100635519 Ga0068854_1006355192 155
240 3300005614 Ga0068856_100036361 Ga0068856_1000363613 155
241 3300005614 Ga0068856_100341872 Ga0068856_1003418722 155
242 3300005616 Ga0068852_100002367 Ga0068852_1000023674 155
243 3300005616 Ga0068852_100123976 Ga0068852_1001239763 155
244 3300005616 Ga0068852_100383670 Ga0068852_1003836702 155
245 3300005616 Ga0068852_101481327 Ga0068852_1014813272 155
246 3300005617 Ga0068859_100010093 Ga0068859_1000100938 155
247 3300005617 Ga0068859_100923527 Ga0068859_1009235271 155
248 3300005618 Ga0068864_100000511 Ga0068864_10000051131 155
249 3300005719 Ga0068861_100144813 Ga0068861_1001448132 155
250 3300005719 Ga0068861_101090679 Ga0068861_1010906792 155
251 3300005834 Ga0068851_10004317 Ga0068851_100043175 155
252 3300005834 Ga0068851_10037551 Ga0068851_100375514 155
253 3300005840 Ga0068870_10450785 Ga0068870_104507852 155
254 3300005841 Ga0068863_100007397 Ga0068863_1000073973 155
255 3300005842 Ga0068858_100000359 Ga0068858_10000035933 155
256 3300005843 Ga0068860_100072237 Ga0068860_1000722372 155
257 3300006038 Ga0075365_10013252 Ga0075365_100132524 155
258 3300006038 Ga0075365_10915880 Ga0075365_109158801 155
259 3300006048 Ga0075363_100070021 Ga0075363_1000700212 155
260 3300006048 Ga0075363_100084488 Ga0075363_1000844882 155
261 3300006048 Ga0075363_100171471 Ga0075363_1001714712 155
262 3300006051 Ga0075364_10054684 Ga0075364_100546843 155
263 3300006051 Ga0075364_10238777 Ga0075364_102387771 155
264 3300006051 Ga0075364_10271956 Ga0075364_102719561 155
265 3300006058 Ga0075432_10024139 Ga0075432_100241393 155
266 3300006177 Ga0075362_10003584 Ga0075362_100035842 155
267 3300006177 Ga0075362_10039489 Ga0075362_100394893 155
268 3300006177 Ga0075362_10131550 Ga0075362_101315502 155
269 3300006177 Ga0075362_10317351 Ga0075362_103173512 155
270 3300006178 Ga0075367_10147513 Ga0075367_101475132 155
271 3300006178 Ga0075367_10362599 Ga0075367_103625992 155
272 3300006186 Ga0075369_10032362 Ga0075369_100323624 155
273 3300006186 Ga0075369_10199483 Ga0075369_101994832 155
274 3300006195 Ga0075366_10002649 Ga0075366_100026493 155
275 3300006195 Ga0075366_10006970 Ga0075366_100069704 155
276 3300006195 Ga0075366_10009720 Ga0075366_100097203 155
277 3300006195 Ga0075366_10013620 Ga0075366_100136206 155
278 3300006195 Ga0075366_10033567 Ga0075366_100335672 155
279 3300006195 Ga0075366_10145745 Ga0075366_101457452 155
280 3300006195 Ga0075366_10172756 Ga0075366_101727562 155
281 3300006195 Ga0075366_10623891 Ga0075366_106238911 155
282 3300006237 Ga0097621_100057282 Ga0097621_1000572822 155
283 3300006237 Ga0097621_100831982 Ga0097621_1008319822 155
284 3300006353 Ga0075370_10000556 Ga0075370_100005562 155
285 3300006353 Ga0075370_10014562 Ga0075370_100145623 155
286 3300006353 Ga0075370_10016632 Ga0075370_100166325 155
287 3300006353 Ga0075370_10022291 Ga0075370_100222914 155
288 3300006353 Ga0075370_10023906 Ga0075370_100239063 155
289 3300006353 Ga0075370_10034046 Ga0075370_100340464 155
290 3300006353 Ga0075370_10048286 Ga0075370_100482862 155
291 3300006353 Ga0075370_10183655 Ga0075370_101836552 155
292 3300006353 Ga0075370_10351501 Ga0075370_103515012 155
293 3300006358 Ga0068871_100064447 Ga0068871_1000644473 155
294 3300006881 Ga0068865_100087270 Ga0068865_1000872702 155
295 3300006881 Ga0068865_100209277 Ga0068865_1002092772 155
296 3300006881 Ga0068865_100409664 Ga0068865_1004096642 155
297 3300006931 Ga0097620_100010093 Ga0097620_1000100938 155
298 3300006931 Ga0097620_100923533 Ga0097620_1009235331 155
299 3300006946 Ga0079104_1000024 Ga0079104_100002441 155
300 3300006948 Ga0099826_10000115 Ga0099826_1000011532 155
301 3300006948 Ga0099826_10159610 Ga0099826_101596102 155
302 3300009092 Ga0105250_10034781 Ga0105250_100347812 155
303 3300009093 Ga0105240_10003642 Ga0105240_1000364222 155
304 3300009093 Ga0105240_10625342 Ga0105240_106253422 155
305 3300009094 Ga0111539_12743599 Ga0111539_127435991 155
306 3300009098 Ga0105245_10008806 Ga0105245_100088065 155
307 3300009098 Ga0105245_10251226 Ga0105245_102512262 155
308 3300009098 Ga0105245_10668587 Ga0105245_106685872 155
309 3300009098 Ga0105245_11621319 Ga0105245_116213192 155
310 3300009148 Ga0105243_10000515 Ga0105243_1000051530 155
311 3300009148 Ga0105243_10001515 Ga0105243_1000151522 155
312 3300009148 Ga0105243_10003542 Ga0105243_100035427 155
313 3300009148 Ga0105243_10132451 Ga0105243_101324514 155
314 3300009148 Ga0105243_10134204 Ga0105243_101342042 155
315 3300009148 Ga0105243_10340324 Ga0105243_103403242 155
316 3300009148 Ga0105243_10427224 Ga0105243_104272241 155
317 3300009174 Ga0105241_10143886 Ga0105241_101438862 155
318 3300009176 Ga0105242_10004129 Ga0105242_100041293 155
319 3300009176 Ga0105242_10908655 Ga0105242_109086552 155
320 3300009177 Ga0105248_10161343 Ga0105248_101613434 155
321 3300009177 Ga0105248_10531646 Ga0105248_105316462 155
322 3300009545 Ga0105237_10034393 Ga0105237_100343933 155
323 3300009545 Ga0105237_10037398 Ga0105237_100373983 155
324 3300009551 Ga0105238_10006811 Ga0105238_100068118 155
325 3300009551 Ga0105238_10027040 Ga0105238_100270407 155
326 3300009551 Ga0105238_11315528 Ga0105238_113155281 155
327 3300009553 Ga0105249_10467555 Ga0105249_104675552 155
328 3300010375 Ga0105239_10216054 Ga0105239_102160543 155
329 3300010375 Ga0105239_11519189 Ga0105239_115191891 155
330 3300011119 Ga0105246_10131195 Ga0105246_101311953 155
331 3300013100 Ga0157373_10029757 Ga0157373_100297573 155
332 3300013102 Ga0157371_10133807 Ga0157371_101338072 155
333 3300013104 Ga0157370_10065472 Ga0157370_100654722 155
334 3300013105 Ga0157369_10043021 Ga0157369_100430215 155
335 3300013297 Ga0157378_10528330 Ga0157378_105283302 155
336 3300013297 Ga0157378_11042396 Ga0157378_110423962 155
337 3300013306 Ga0163162_10123599 Ga0163162_101235992 155
338 3300013306 Ga0163162_10239243 Ga0163162_102392433 155
339 3300013306 Ga0163162_10284627 Ga0163162_102846272 155
340 3300013306 Ga0163162_10973410 Ga0163162_109734101 155
341 3300013307 Ga0157372_10806654 Ga0157372_108066542 155
342 3300013308 Ga0157375_10169716 Ga0157375_101697162 155
343 3300013308 Ga0157375_11715030 Ga0157375_117150302 155
344 3300014325 Ga0163163_10010941 Ga0163163_100109413 155
345 3300014325 Ga0163163_12441689 Ga0163163_124416891 155
346 3300014326 Ga0157380_10119485 Ga0157380_101194853 155
347 3300014326 Ga0157380_10283257 Ga0157380_102832573 155
348 3300014326 Ga0157380_10948435 Ga0157380_109484351 155
349 3300014326 Ga0157380_10961539 Ga0157380_109615392 155
350 3300014497 Ga0182008_10009236 Ga0182008_100092363 155
351 3300014497 Ga0182008_10011067 Ga0182008_100110674 155
352 3300014497 Ga0182008_10057326 Ga0182008_100573262 155
353 3300014497 Ga0182008_10122108 Ga0182008_101221082 155
354 3300014745 Ga0157377_10000022 Ga0157377_1000002288 155
355 3300014745 Ga0157377_10138874 Ga0157377_101388742 155
356 3300014968 Ga0157379_10092454 Ga0157379_100924543 155
357 3300014968 Ga0157379_10523405 Ga0157379_105234052 155
358 3300014969 Ga0157376_10145094 Ga0157376_101450943 155
359 3300014969 Ga0157376_10796496 Ga0157376_107964962 155
360 3300015262 Ga0182007_10000472 Ga0182007_1000047218 155
361 3300015262 Ga0182007_10053924 Ga0182007_100539242 155
362 3300015265 Ga0182005_1042245 Ga0182005_10422452 155
363 3300015683 Ga0183362_10001 Ga0183362_100011323 155
364 3300017792 Ga0163161_10001036 Ga0163161_100010362 155
365 3300017792 Ga0163161_10031016 Ga0163161_100310163 155
366 3300017792 Ga0163161_10051910 Ga0163161_100519103 155
367 3300017792 Ga0163161_10503808 Ga0163161_105038082 155
368 3300025208 Ga0209436_108139 Ga0209436_1081393 155
369 3300025228 Ga0209672_101250 Ga0209672_1012508 155
370 3300025229 Ga0209147_102210 Ga0209147_1022102 155
371 3300025242 Ga0209258_100099 Ga0209258_100099126 155
372 3300025245 Ga0207425_1000239 Ga0207425_100023930 155
373 3300025245 Ga0207425_1001642 Ga0207425_10016425 155
374 3300025245 Ga0207425_1004428 Ga0207425_10044284 155
375 3300025254 Ga0209148_1000103 Ga0209148_1000103126 155
376 3300025258 Ga0209129_1000007 Ga0209129_1000007470 155
377 3300025258 Ga0209129_1000144 Ga0209129_100014462 155
378 3300025258 Ga0209129_1001130 Ga0209129_100113017 155
379 3300025258 Ga0209129_1004500 Ga0209129_10045004 155
380 3300025263 Ga0209565_1000073 Ga0209565_100007344 155
381 3300025263 Ga0209565_1000199 Ga0209565_10001994 155
382 3300025263 Ga0209565_1003122 Ga0209565_10031224 155
383 3300025273 Ga0209673_1000127 Ga0209673_1000127123 155
384 3300025273 Ga0209673_1000128 Ga0209673_100012888 155
385 3300025273 Ga0209673_1001078 Ga0209673_10010784 155
386 3300025273 Ga0209673_1001619 Ga0209673_10016192 155
387 3300025273 Ga0209673_1003135 Ga0209673_10031354 155
388 3300025273 Ga0209673_1013295 Ga0209673_10132953 155
389 3300025284 Ga0209130_1000471 Ga0209130_100047127 155
390 3300025284 Ga0209130_1000898 Ga0209130_100089815 155
391 3300025284 Ga0209130_1000914 Ga0209130_100091412 155
392 3300025284 Ga0209130_1002188 Ga0209130_10021888 155
393 3300025291 Ga0209675_1000029 Ga0209675_1000029123 155
394 3300025291 Ga0209675_1000114 Ga0209675_100011428 155
395 3300025291 Ga0209675_1000723 Ga0209675_10007236 155
396 3300025291 Ga0209675_1000976 Ga0209675_10009767 155
397 3300025291 Ga0209675_1002630 Ga0209675_10026308 155
398 3300025292 Ga0209676_1000122 Ga0209676_100012248 155
399 3300025292 Ga0209676_1000301 Ga0209676_100030122 155
400 3300025292 Ga0209676_1002710 Ga0209676_10027106 155
401 3300025292 Ga0209676_1003298 Ga0209676_100329812 155
402 3300025294 Ga0209025_1000073 Ga0209025_1000073108 155
403 3300025294 Ga0209025_1000248 Ga0209025_100024857 155
404 3300025294 Ga0209025_1000491 Ga0209025_100049144 155
405 3300025294 Ga0209025_1006463 Ga0209025_100646310 155
406 3300025294 Ga0209025_1026508 Ga0209025_10265084 155
407 3300025295 Ga0209564_1000029 Ga0209564_1000029106 155
408 3300025295 Ga0209564_1000360 Ga0209564_100036018 155
409 3300025295 Ga0209564_1001537 Ga0209564_100153710 155
410 3300025295 Ga0209564_1042300 Ga0209564_10423002 155
411 3300025297 Ga0209758_1000025 Ga0209758_100002556 155
412 3300025297 Ga0209758_1000043 Ga0209758_1000043334 155
413 3300025297 Ga0209758_1000434 Ga0209758_100043415 155
414 3300025298 Ga0209050_1000197 Ga0209050_100019796 155
415 3300025298 Ga0209050_1000433 Ga0209050_100043322 155
416 3300025298 Ga0209050_1000488 Ga0209050_100048843 155
417 3300025298 Ga0209050_1007621 Ga0209050_10076215 155
418 3300025298 Ga0209050_1007861 Ga0209050_10078612 155
419 3300025298 Ga0209050_1011027 Ga0209050_10110273 155
420 3300025298 Ga0209050_1042750 Ga0209050_10427502 155
421 3300025298 Ga0209050_1042975 Ga0209050_10429752 155
422 3300025299 Ga0209256_1000011 Ga0209256_1000011172 155
423 3300025299 Ga0209256_1000050 Ga0209256_1000050122 155
424 3300025299 Ga0209256_1000063 Ga0209256_1000063186 155
425 3300025302 Ga0207426_1000001 Ga0207426_1000001581 155
426 3300025302 Ga0207426_1000028 Ga0207426_1000028404 155
427 3300025302 Ga0207426_1001556 Ga0207426_100155611 155
428 3300025303 Ga0209051_1000002 Ga0209051_10000021491 155
429 3300025303 Ga0209051_1000016 Ga0209051_1000016165 155
430 3300025303 Ga0209051_1000542 Ga0209051_100054214 155
431 3300025303 Ga0209051_1001159 Ga0209051_10011596 155
432 3300025303 Ga0209051_1002010 Ga0209051_10020106 155
433 3300025303 Ga0209051_1004650 Ga0209051_10046503 155
434 3300025303 Ga0209051_1007504 Ga0209051_10075044 155
435 3300025303 Ga0209051_1023776 Ga0209051_10237762 155
436 3300025304 Ga0209257_1000002 Ga0209257_10000021632 155
437 3300025304 Ga0209257_1000012 Ga0209257_1000012594 155
438 3300025304 Ga0209257_1000021 Ga0209257_1000021584 155
439 3300025304 Ga0209257_1000102 Ga0209257_1000102128 155
440 3300025304 Ga0209257_1006647 Ga0209257_10066476 155
441 3300025304 Ga0209257_1007736 Ga0209257_10077366 155
442 3300025321 Ga0207656_10052949 Ga0207656_100529492 155
443 3300025321 Ga0207656_10060956 Ga0207656_100609562 155
444 3300025711 Ga0207696_1036136 Ga0207696_10361362 155
445 3300025893 Ga0207682_10075079 Ga0207682_100750793 155
446 3300025893 Ga0207682_10167125 Ga0207682_101671252 155
447 3300025903 Ga0207680_10005639 Ga0207680_100056393 155
448 3300025903 Ga0207680_10263764 Ga0207680_102637642 155
449 3300025907 Ga0207645_10018276 Ga0207645_100182763 155
450 3300025907 Ga0207645_10035636 Ga0207645_100356363 155
451 3300025907 Ga0207645_10100201 Ga0207645_101002013 155
452 3300025907 Ga0207645_10532092 Ga0207645_105320922 155
453 3300025909 Ga0207705_10141578 Ga0207705_101415782 155
454 3300025911 Ga0207654_10111296 Ga0207654_101112963 155
455 3300025912 Ga0207707_10310318 Ga0207707_103103183 155
456 3300025913 Ga0207695_10347517 Ga0207695_103475172 155
457 3300025913 Ga0207695_11112823 Ga0207695_111128232 155
458 3300025914 Ga0207671_10071283 Ga0207671_100712831 155
459 3300025914 Ga0207671_11036626 Ga0207671_110366262 155
460 3300025917 Ga0207660_10138485 Ga0207660_101384852 155
461 3300025919 Ga0207657_10016829 Ga0207657_100168296 155
462 3300025919 Ga0207657_10625583 Ga0207657_106255832 155
463 3300025919 Ga0207657_11079679 Ga0207657_110796791 155
464 3300025920 Ga0207649_10006892 Ga0207649_100068924 155
465 3300025920 Ga0207649_11137242 Ga0207649_111372421 155
466 3300025921 Ga0207652_10032924 Ga0207652_100329244 155
467 3300025923 Ga0207681_10343261 Ga0207681_103432612 155
468 3300025923 Ga0207681_10603020 Ga0207681_106030201 155
469 3300025924 Ga0207694_10043334 Ga0207694_100433344 155
470 3300025924 Ga0207694_10103673 Ga0207694_101036732 155
471 3300025924 Ga0207694_11257370 Ga0207694_112573702 155
472 3300025925 Ga0207650_10356242 Ga0207650_103562422 155
473 3300025925 Ga0207650_10565955 Ga0207650_105659552 155
474 3300025925 Ga0207650_10948396 Ga0207650_109483962 155
475 3300025926 Ga0207659_10003030 Ga0207659_100030309 155
476 3300025926 Ga0207659_10295076 Ga0207659_102950762 155
477 3300025926 Ga0207659_10479979 Ga0207659_104799792 155
478 3300025927 Ga0207687_10034029 Ga0207687_100340293 155
479 3300025927 Ga0207687_10481755 Ga0207687_104817552 155
480 3300025927 Ga0207687_10783030 Ga0207687_107830302 155
481 3300025931 Ga0207644_10105561 Ga0207644_101055612 155
482 3300025931 Ga0207644_10120978 Ga0207644_101209782 155
483 3300025931 Ga0207644_10154722 Ga0207644_101547222 155
484 3300025932 Ga0207690_10000428 Ga0207690_1000042818 155
485 3300025932 Ga0207690_10722352 Ga0207690_107223521 155
486 3300025933 Ga0207706_10039894 Ga0207706_100398945 155
487 3300025933 Ga0207706_10098221 Ga0207706_100982212 155
488 3300025933 Ga0207706_10192746 Ga0207706_101927462 155
489 3300025933 Ga0207706_10211544 Ga0207706_102115442 155
490 3300025933 Ga0207706_10452262 Ga0207706_104522622 155
491 3300025934 Ga0207686_10007355 Ga0207686_100073553 155
492 3300025935 Ga0207709_10000245 Ga0207709_1000024513 155
493 3300025935 Ga0207709_10000522 Ga0207709_1000052210 155
494 3300025935 Ga0207709_10001057 Ga0207709_100010572 155
495 3300025936 Ga0207670_10290321 Ga0207670_102903212 155
496 3300025937 Ga0207669_10767268 Ga0207669_107672681 155
497 3300025938 Ga0207704_10265032 Ga0207704_102650322 155
498 3300025940 Ga0207691_10193218 Ga0207691_101932182 155
499 3300025940 Ga0207691_10228240 Ga0207691_102282401 155
500 3300025940 Ga0207691_10355654 Ga0207691_103556542 155
501 3300025941 Ga0207711_10199470 Ga0207711_101994702 155
502 3300025941 Ga0207711_10509761 Ga0207711_105097612 155
503 3300025942 Ga0207689_10040791 Ga0207689_100407911 155
504 3300025942 Ga0207689_10079678 Ga0207689_100796783 155
505 3300025945 Ga0207679_10023501 Ga0207679_100235013 155
506 3300025945 Ga0207679_10026952 Ga0207679_100269524 155
507 3300025945 Ga0207679_10358199 Ga0207679_103581992 155
508 3300025949 Ga0207667_10089432 Ga0207667_100894322 155
509 3300025949 Ga0207667_11139411 Ga0207667_111394112 155
510 3300025960 Ga0207651_10001269 Ga0207651_100012696 155
511 3300025960 Ga0207651_10115784 Ga0207651_101157841 155
512 3300025960 Ga0207651_10182500 Ga0207651_101825003 155
513 3300025960 Ga0207651_10238065 Ga0207651_102380652 155
514 3300025960 Ga0207651_10396106 Ga0207651_103961062 155
515 3300025961 Ga0207712_10033531 Ga0207712_100335313 155
516 3300025972 Ga0207668_10151952 Ga0207668_101519523 155
517 3300025972 Ga0207668_11011088 Ga0207668_110110882 155
518 3300025981 Ga0207640_10121792 Ga0207640_101217922 155
519 3300025981 Ga0207640_10154690 Ga0207640_101546902 155
520 3300025981 Ga0207640_10384754 Ga0207640_103847542 155
521 3300025986 Ga0207658_10088021 Ga0207658_100880213 155
522 3300026023 Ga0207677_10008077 Ga0207677_100080772 155
523 3300026023 Ga0207677_10012869 Ga0207677_100128692 155
524 3300026023 Ga0207677_10420136 Ga0207677_104201362 155
525 3300026035 Ga0207703_10002190 Ga0207703_1000219019 155
526 3300026035 Ga0207703_10716627 Ga0207703_107166272 155
527 3300026041 Ga0207639_10070642 Ga0207639_100706423 155
528 3300026041 Ga0207639_10165441 Ga0207639_101654413 155
529 3300026041 Ga0207639_10339936 Ga0207639_103399362 155
530 3300026067 Ga0207678_10059926 Ga0207678_100599262 155
531 3300026067 Ga0207678_10086891 Ga0207678_100868912 155
532 3300026067 Ga0207678_10385440 Ga0207678_103854402 155
533 3300026067 Ga0207678_10386594 Ga0207678_103865942 155
534 3300026075 Ga0207708_10156192 Ga0207708_101561923 155
535 3300026078 Ga0207702_10046176 Ga0207702_100461763 155
536 3300026078 Ga0207702_11078602 Ga0207702_110786022 155
537 3300026078 Ga0207702_11107518 Ga0207702_111075182 155
538 3300026088 Ga0207641_10001726 Ga0207641_100017269 155
539 3300026089 Ga0207648_10000032 Ga0207648_1000003246 155
540 3300026089 Ga0207648_10017579 Ga0207648_100175796 155
541 3300026089 Ga0207648_10032114 Ga0207648_100321145 155
542 3300026089 Ga0207648_10205864 Ga0207648_102058642 155
543 3300026089 Ga0207648_10368277 Ga0207648_103682772 155
544 3300026089 Ga0207648_10583581 Ga0207648_105835811 155
545 3300026089 Ga0207648_10696885 Ga0207648_106968852 155
546 3300026095 Ga0207676_10003149 Ga0207676_100031492 155
547 3300026116 Ga0207674_10349962 Ga0207674_103499621 155
548 3300026116 Ga0207674_10540395 Ga0207674_105403952 155
549 3300026116 Ga0207674_11276771 Ga0207674_112767712 155
550 3300026118 Ga0207675_100109629 Ga0207675_1001096293 155
551 3300026121 Ga0207683_10010783 Ga0207683_100107833 155
552 3300026121 Ga0207683_10030115 Ga0207683_100301153 155
553 3300026121 Ga0207683_10032771 Ga0207683_100327713 155
554 3300026121 Ga0207683_10558013 Ga0207683_105580132 155
555 3300026142 Ga0207698_10004168 Ga0207698_100041684 155
556 3300026142 Ga0207698_10022533 Ga0207698_100225335 155
557 3300026142 Ga0207698_10024501 Ga0207698_100245013 155
558 3300026142 Ga0207698_10060126 Ga0207698_100601264 155
559 3300026142 Ga0207698_10329259 Ga0207698_103292592 155
560 3300027111 Ga0209281_1000005 Ga0209281_1000005884 155
561 3300027111 Ga0209281_1000104 Ga0209281_1000104161 155
562 3300027665 Ga0209983_1051536 Ga0209983_10515361 155
563 3300027666 Ga0209282_1000109 Ga0209282_100010922 155
564 3300027876 Ga0209974_10005579 Ga0209974_100055795 155
565 3300027876 Ga0209974_10091046 Ga0209974_100910462 155
566 3300027876 Ga0209974_10146591 Ga0209974_101465912 155
567 3300028379 Ga0268266_10107424 Ga0268266_101074242 155
568 3300028379 Ga0268266_11581600 Ga0268266_115816002 155
569 3300028380 Ga0268265_10029913 Ga0268265_100299135 155
570 3300028380 Ga0268265_10204653 Ga0268265_102046532 155
571 3300028380 Ga0268265_11174997 Ga0268265_111749972 155
572 3300028381 Ga0268264_10065396 Ga0268264_100653964 155
573 3300028381 Ga0268264_10195084 Ga0268264_101950842 155
574 3300028794 Ga0307515_10000842 Ga0307515_1000084250 155
575 3300028794 Ga0307515_10001088 Ga0307515_1000108838 155
576 3300028794 Ga0307515_10001640 Ga0307515_1000164028 155
577 3300028794 Ga0307515_10020481 Ga0307515_100204814 155
578 3300028794 Ga0307515_10064179 Ga0307515_100641795 155
579 3300028794 Ga0307515_10109248 Ga0307515_101092483 155
580 3300028794 Ga0307515_10166309 Ga0307515_101663092 155
581 3300028794 Ga0307515_10233339 Ga0307515_102333392 155
582 3300030522 Ga0307512_10045218 Ga0307512_100452184 155
583 3300030522 Ga0307512_10065075 Ga0307512_100650752 155
584 3300030731 Ga0316177_1071860 Ga0316177_10718603 155
585 3300030731 Ga0316177_1155855 Ga0316177_11558552 155
586 3300030732 Ga0316176_1148086 Ga0316176_11480863 155
587 3300030733 Ga0314311_1122598 Ga0314311_11225982 155
588 3300030735 Ga0316178_1138608 Ga0316178_11386084 155
589 3300030736 Ga0316180_1073464 Ga0316180_10734642 155
590 3300030742 Ga0316183_1020296 Ga0316183_10202963 155
591 3300030744 Ga0316181_1106329 Ga0316181_11063292 155
592 3300031238 Ga0265332_10008074 Ga0265332_100080744 155
593 3300031238 Ga0265332_10291341 Ga0265332_102913412 155
594 3300031242 Ga0265329_10036582 Ga0265329_100365822 155
595 3300031250 Ga0265331_10058291 Ga0265331_100582913 155
596 3300031251 Ga0265327_10000814 Ga0265327_1000081410 155
597 3300031251 Ga0265327_10006291 Ga0265327_100062917 155
598 3300031456 Ga0307513_10000019 Ga0307513_1000001916 155
599 3300031456 Ga0307513_10000051 Ga0307513_10000051112 155
600 3300031456 Ga0307513_10026043 Ga0307513_100260432 155
601 3300031456 Ga0307513_10217505 Ga0307513_102175052 155
602 3300031456 Ga0307513_10438385 Ga0307513_104383851 155
603 3300031456 Ga0307513_10467479 Ga0307513_104674792 155
604 3300031507 Ga0307509_10094623 Ga0307509_100946233 155
605 3300031548 Ga0307408_100000099 Ga0307408_10000009931 155
606 3300031548 Ga0307408_100000193 Ga0307408_10000019347 155
607 3300031548 Ga0307408_100019885 Ga0307408_1000198854 155
608 3300031548 Ga0307408_100028902 Ga0307408_1000289025 155
609 3300031548 Ga0307408_100040951 Ga0307408_1000409513 155
610 3300031548 Ga0307408_100318652 Ga0307408_1003186522 155
611 3300031548 Ga0307408_100430099 Ga0307408_1004300992 155
612 3300031548 Ga0307408_100544456 Ga0307408_1005444562 155
613 3300031616 Ga0307508_10002774 Ga0307508_1000277416 155
614 3300031649 Ga0307514_10002956 Ga0307514_100029563 155
615 3300031649 Ga0307514_10013325 Ga0307514_100133256 155
616 3300031711 Ga0265314_10013361 Ga0265314_100133614 155
617 3300031711 Ga0265314_10049626 Ga0265314_100496263 155
618 3300031730 Ga0307516_10004540 Ga0307516_100045403 155
619 3300031730 Ga0307516_10006152 Ga0307516_100061523 155
620 3300031730 Ga0307516_10222875 Ga0307516_102228751 155
621 3300031730 Ga0307516_10266001 Ga0307516_102660011 155
622 3300031730 Ga0307516_10271164 Ga0307516_102711641 155
623 3300031731 Ga0307405_10314292 Ga0307405_103142922 155
624 3300031731 Ga0307405_11084002 Ga0307405_110840021 155
625 3300031824 Ga0307413_11076597 Ga0307413_110765971 155
626 3300031852 Ga0307410_10741619 Ga0307410_107416192 155
627 3300031901 Ga0307406_10009579 Ga0307406_100095793 155
628 3300031901 Ga0307406_10016378 Ga0307406_100163782 155
629 3300031901 Ga0307406_10188553 Ga0307406_101885532 155
630 3300031901 Ga0307406_10514283 Ga0307406_105142832 155
631 3300031901 Ga0307406_10822053 Ga0307406_108220532 155
632 3300031903 Ga0307407_10047314 Ga0307407_100473143 155
633 3300031903 Ga0307407_10426950 Ga0307407_104269502 155
634 3300031911 Ga0307412_10037116 Ga0307412_100371164 155
635 3300031911 Ga0307412_10057816 Ga0307412_100578163 155
636 3300031911 Ga0307412_10065081 Ga0307412_100650813 155
637 3300031911 Ga0307412_10480906 Ga0307412_104809062 155
638 3300031911 Ga0307412_11115782 Ga0307412_111157821 155
639 3300031995 Ga0307409_100183715 Ga0307409_1001837153 155
640 3300031995 Ga0307409_101749225 Ga0307409_1017492251 155
641 3300032002 Ga0307416_100023015 Ga0307416_1000230154 155
642 3300032002 Ga0307416_100068689 Ga0307416_1000686892 155
643 3300032002 Ga0307416_100312658 Ga0307416_1003126582 155
644 3300032004 Ga0307414_10008085 Ga0307414_100080855 155
645 3300032004 Ga0307414_10321315 Ga0307414_103213152 155
646 3300032004 Ga0307414_10482254 Ga0307414_104822542 155
647 3300032004 Ga0307414_10968353 Ga0307414_109683532 155
648 3300032004 Ga0307414_11013262 Ga0307414_110132622 155
649 3300032005 Ga0307411_10000548 Ga0307411_100005487 155
650 3300032005 Ga0307411_10077498 Ga0307411_100774984 155
651 3300032005 Ga0307411_10232700 Ga0307411_102327002 155
652 3300032005 Ga0307411_10262288 Ga0307411_102622882 155
653 3300032005 Ga0307411_10421808 Ga0307411_104218082 155
654 3300032126 Ga0307415_101103417 Ga0307415_1011034172 155
655 3300032168 Ga0316593_10009836 Ga0316593_100098362 155
656 3300033180 Ga0307510_10000311 Ga0307510_100003119 155
657 3300034818 Ga0373950_0003412 Ga0373950_0003412_1434_1901 155
658 3300034820 Ga0373959_0058069 Ga0373959_0058069_182_649 155
659 3300035089 Ga0373944_0058770 Ga0373944_0058770_664_1131 155
660 3300035091 Ga0373951_0029584 Ga0373951_0029584_35_502 155
661 3300035114 Ga0373939_0000006 Ga0373939_0000006_49556_50023 155
662 3300035121 Ga0373960_0000041 Ga0373960_0000041_433_900 155
663 3300035171 Ga0373946_0107776 Ga0373946_0107776_564_1031 155
664 3300035691 Ga0373931_0000514 Ga0373931_0000514_11261_11728 155
665 3300036401 Ga0373937_0265951 Ga0373937_0265951_126_593 155
666 3300037312 Ga0395899_0003079 Ga0395899_0003079_12301_12768 155
667 3300037312 Ga0395899_0008624 Ga0395899_0008624_3414_3881 155
668 3300037312 Ga0395899_0111358 Ga0395899_0111358_735_1202 155
669 3300037312 Ga0395899_0260826 Ga0395899_0260826_662_1129 155
670 3300037418 Ga0395900_0000054 Ga0395900_0000054_48489_48956 155
671 3300037418 Ga0395900_0026485 Ga0395900_0026485_1839_2306 155
672 3300037418 Ga0395900_0064720 Ga0395900_0064720_1799_2266 155
673 3300037418 Ga0395900_0111316 Ga0395900_0111316_1870_2337 155
674 3300037418 Ga0395900_0411167 Ga0395900_0411167_223_690 155
675 3300037418 Ga0395900_0572708 Ga0395900_0572708_591_1058 155
676 3300037466 Ga0395898_0000798 Ga0395898_0000798_31806_32273 155
677 3300037466 Ga0395898_0425136 Ga0395898_0425136_291_758 155
678 3300037466 Ga0395898_0472253 Ga0395898_0472253_382_849 155
679 3300037471 Ga0395905_0000148 Ga0395905_0000148_17645_18112 155
680 3300037471 Ga0395905_0001062 Ga0395905_0001062_10121_10588 155
681 3300037471 Ga0395905_0002549 Ga0395905_0002549_7497_7967 155
682 3300037471 Ga0395905_0003187 Ga0395905_0003187_8005_8472 155
683 3300037471 Ga0395905_0016333 Ga0395905_0016333_709_1176 155
684 3300037471 Ga0395905_0030153 Ga0395905_0030153_1957_2424 155
685 3300037471 Ga0395905_0049497 Ga0395905_0049497_2041_2508 155
686 3300037471 Ga0395905_0049955 Ga0395905_0049955_1784_2251 155
687 3300037471 Ga0395905_0101793 Ga0395905_0101793_1144_1611 155
688 3300037471 Ga0395905_0323338 Ga0395905_0323338_202_669 155
689 3300037471 Ga0395905_0388293 Ga0395905_0388293_656_1126 155
690 3300037471 Ga0395905_0695531 Ga0395905_0695531_292_759 155
691 3300037471 Ga0395905_1294698 Ga0395905_1294698_65_532 155
692 3300038443 Ga0395901_0012708 Ga0395901_0012708_2709_3176 155
693 3300038443 Ga0395901_0085741 Ga0395901_0085741_1679_2146 155
694 3300038443 Ga0395901_0119190 Ga0395901_0119190_2274_2741 155
695 3300038443 Ga0395901_0121303 Ga0395901_0121303_169_636 155
696 3300038443 Ga0395901_0173517 Ga0395901_0173517_1445_1912 155
697 3300038443 Ga0395901_0176105 Ga0395901_0176105_667_1134 155
698 3300038443 Ga0395901_0187430 Ga0395901_0187430_1322_1789 155
699 3300038443 Ga0395901_0266367 Ga0395901_0266367_608_1075 155
700 3300038443 Ga0395901_0311735 Ga0395901_0311735_273_740 155
701 3300039437 Ga0436365_0161847 Ga0436365_0161847_14_481 155
702 3300039437 Ga0436365_0872657 Ga0436365_0872657_157_624 155
703 3300041404 Ga0439436_0000392 Ga0439436_0000392_1738_2205 155
704 3300041404 Ga0439436_0002953 Ga0439436_0002953_1879_2346 155
705 3300041404 Ga0439436_0013763 Ga0439436_0013763_1742_2209 155
706 3300041406 Ga0439439_0013953 Ga0439439_0013953_672_1139 155
707 3300041406 Ga0439439_0051148 Ga0439439_0051148_450_917 155
708 3300041406 Ga0439439_0114708 Ga0439439_0114708_203_670 155
709 3300041406 Ga0439439_0138768 Ga0439439_0138768_28_495 155
710 3300041407 Ga0439447_009228 Ga0439447_009228_1234_1701 155
711 3300041407 Ga0439447_032624 Ga0439447_032624_618_1085 155
712 3300041410 Ga0439461_0001378 Ga0439461_0001378_1555_2022 155
713 3300041410 Ga0439461_0007060 Ga0439461_0007060_47_514 155
714 3300041411 Ga0439466_0008881 Ga0439466_0008881_1978_2445 155
715 3300041411 Ga0439466_0015610 Ga0439466_0015610_361_828 155
716 3300041413 Ga0439465_0000387 Ga0439465_0000387_12083_12550 155
717 3300041413 Ga0439465_0094931 Ga0439465_0094931_280_747 155
718 3300041451 Ga0451791_1261760 Ga0451791_1261760_246_713 155
719 3300041460 Ga0451802_0405913 Ga0451802_0405913_19_486 155
720 3300041463 Ga0451804_0865208 Ga0451804_0865208_69_536 155
721 3300041491 Ga0451833_1215784 Ga0451833_1215784_247_714 155
722 3300041491 Ga0451833_1425945 Ga0451833_1425945_153_620 155
723 3300041498 Ga0451841_0537712 Ga0451841_0537712_148_615 155
724 3300041498 Ga0451841_0963024 Ga0451841_0963024_43_510 155
725 3300041511 Ga0451855_0271653 Ga0451855_0271653_174_641 155
726 3300041512 Ga0451853_1667522 Ga0451853_1667522_56_523 155
727 3300041997 Ga0439431_0001219 Ga0439431_0001219_3516_3983 155
728 3300041999 Ga0439433_0000473 Ga0439433_0000473_4077_4544 155
729 3300042000 Ga0439437_005415 Ga0439437_005415_37_504 155
730 3300042000 Ga0439437_019870 Ga0439437_019870_33_500 155
731 3300042002 Ga0439442_004083 Ga0439442_004083_1182_1649 155
732 3300042003 Ga0439443_032008 Ga0439443_032008_110_577 155
733 3300042004 Ga0439445_0000712 Ga0439445_0000712_2652_3119 155
734 3300042004 Ga0439445_0027176 Ga0439445_0027176_593_1060 155
735 3300042004 Ga0439445_0047170 Ga0439445_0047170_158_625 155
736 3300042006 Ga0439432_002602 Ga0439432_002602_1291_1758 155
737 3300042006 Ga0439432_019440 Ga0439432_019440_175_642 155
738 3300042007 Ga0439449_0002379 Ga0439449_0002379_5373_5840 155
739 3300042007 Ga0439449_0003757 Ga0439449_0003757_1714_2181 155
740 3300042007 Ga0439449_0005865 Ga0439449_0005865_1618_2085 155
741 3300042007 Ga0439449_0006097 Ga0439449_0006097_3760_4227 155
742 3300042007 Ga0439449_0010161 Ga0439449_0010161_285_752 155
743 3300042007 Ga0439449_0049957 Ga0439449_0049957_408_875 155
744 3300042010 Ga0439452_000611 Ga0439452_000611_11393_11860 155
745 3300042010 Ga0439452_062410 Ga0439452_062410_324_791 155
746 3300042011 Ga0439454_068024 Ga0439454_068024_26_493 155
747 3300042014 Ga0439457_002909 Ga0439457_002909_2876_3343 155
748 3300042014 Ga0439457_013201 Ga0439457_013201_1157_1624 155
749 3300042015 Ga0439462_0004945 Ga0439462_0004945_644_1111 155
750 3300042015 Ga0439462_0123858 Ga0439462_0123858_139_606 155
751 3300042116 Ga0450912_024875 Ga0450912_024875_17_484 155
752 3300042117 Ga0450913_001575 Ga0450913_001575_511_978 155
753 3300042121 Ga0450919_000992 Ga0450919_000992_347_814 155
754 3300042122 Ga0450920_009242 Ga0450920_009242_840_1307 155
755 3300042122 Ga0450920_025575 Ga0450920_025575_607_1074 155
756 3300042123 Ga0450921_000320 Ga0450921_000320_1611_2078 155
757 3300042125 Ga0450923_001819 Ga0450923_001819_607_1074 155
758 3300042126 Ga0450888_000719 Ga0450888_000719_1158_1625 155
759 3300042127 Ga0450890_006388 Ga0450890_006388_80_547 155
760 3300042127 Ga0450890_019152 Ga0450890_019152_346_813 155
761 3300042129 Ga0450891_000123 Ga0450891_000123_3321_3788 155
762 3300042130 Ga0450892_001446 Ga0450892_001446_1030_1497 155
763 3300042132 Ga0450895_021983 Ga0450895_021983_45_512 155
764 3300042133 Ga0450896_008927 Ga0450896_008927_302_769 155
765 3300042133 Ga0450896_012842 Ga0450896_012842_442_909 155
766 3300042134 Ga0450898_004928 Ga0450898_004928_399_866 155
767 3300042137 Ga0450902_008791 Ga0450902_008791_879_1346 155
768 3300042144 Ga0450889_000176 Ga0450889_000176_5073_5540 155
769 3300042145 Ga0450906_007423 Ga0450906_007423_1130_1597 155
770 3300042145 Ga0450906_009590 Ga0450906_009590_73_540 155
771 3300042146 Ga0450907_014618 Ga0450907_014618_514_981 155
772 3300042147 Ga0450910_005526 Ga0450910_005526_1060_1527 155
773 3300042156 Ga0439446_0029700 Ga0439446_0029700_190_657 155
774 3300042184 Ga0450908_004328 Ga0450908_004328_1139_1606 155
775 3300042184 Ga0450908_004926 Ga0450908_004926_1130_1597 155
776 3300042185 Ga0450909_004479 Ga0450909_004479_837_1304 155
777 3300042435 Ga0439434_0003045 Ga0439434_0003045_2842_3309 155
778 3300042435 Ga0439434_0004381 Ga0439434_0004381_1656_2123 155
779 3300042435 Ga0439434_0038955 Ga0439434_0038955_338_805 155
780 3300042436 Ga0439435_0124557 Ga0439435_0124557_232_699 155
781 3300042439 Ga0439464_0010780 Ga0439464_0010780_1342_1809 155
782 3300042530 Ga0450916_067619 Ga0450916_067619_79_546 155
783 3300042531 Ga0450918_000264 Ga0450918_000264_2049_2516 155
784 3300042531 Ga0450918_001423 Ga0450918_001423_4004_4471 155
785 3300042532 Ga0450893_0010771 Ga0450893_0010771_328_795 155
786 3300042532 Ga0450893_0020353 Ga0450893_0020353_39_506 155
787 3300042876 Ga0451577_0144388 Ga0451577_0144388_992_1459 155
788 3300042876 Ga0451577_0191062 Ga0451577_0191062_757_1224 155
789 3300044656 Ga0466969_0000054 Ga0466969_0000054_43474_43944 155
790 3300044656 Ga0466969_0010663 Ga0466969_0010663_3846_4313 155
791 3300044673 Ga0453683_0002845 Ga0453683_0002845_12618_13085 155
792 3300044683 Ga0466965_0088633 Ga0466965_0088633_221_688 155
793 3300044683 Ga0466965_0094149 Ga0466965_0094149_597_1067 155
794 3300044683 Ga0466965_0405699 Ga0466965_0405699_173_640 155
795 3300044684 Ga0466966_0002469 Ga0466966_0002469_928_1395 155
796 3300044684 Ga0466966_0011535 Ga0466966_0011535_1569_2036 155
797 3300044693 Ga0466961_0059317 Ga0466961_0059317_320_787 155
798 3300044693 Ga0466961_0226434 Ga0466961_0226434_268_735 155
799 3300044706 Ga0466964_0005457 Ga0466964_0005457_2815_3282 155
800 3300044712 Ga0453684_0361044 Ga0453684_0361044_899_1366 155
801 3300044712 Ga0453684_0370975 Ga0453684_0370975_723_1190 155
802 3300044712 Ga0453684_1601680 Ga0453684_1601680_179_646 155
803 3300044719 Ga0466971_0007746 Ga0466971_0007746_365_832 155
804 3300044719 Ga0466971_0326792 Ga0466971_0326792_47_514 155
805 3300044765 Ga0466970_0009993 Ga0466970_0009993_3605_4072 155
806 3300044765 Ga0466970_0047180 Ga0466970_0047180_156_626 155
807 3300044842 Ga0466957_0099067 Ga0466957_0099067_642_1109 155
808 3300044842 Ga0466957_0184812 Ga0466957_0184812_589_1056 155
809 3300044842 Ga0466957_0668137 Ga0466957_0668137_184_651 155
810 3300044901 Ga0466960_0028787 Ga0466960_0028787_525_992 155
811 3300044901 Ga0466960_0239453 Ga0466960_0239453_476_943 155
812 3300045049 Ga0466959_0000528 Ga0466959_0000528_2821_3288 155
813 3300045049 Ga0466959_0104843 Ga0466959_0104843_442_909 155
814 3300045051 Ga0451576_0072525 Ga0451576_0072525_2172_2639 155
815 3300045051 Ga0451576_0099477 Ga0451576_0099477_1143_1610 155
816 3300045051 Ga0451576_0146107 Ga0451576_0146107_1239_1706 155
817 3300045051 Ga0451576_0269778 Ga0451576_0269778_532_999 155
818 3300045051 Ga0451576_1148854 Ga0451576_1148854_83_550 155
819 3300045976 Ga0466967_0627724 Ga0466967_0627724_119_586 155
820 3300045976 Ga0466967_2472295 Ga0466967_2472295_27_494 155
821 3300046453 Ga0495627_007791 Ga0495627_007791_2274_2741 155
822 3300046453 Ga0495627_020910 Ga0495627_020910_968_1435 155
823 3300046459 Ga0495629_0104012 Ga0495629_0104012_995_1462 155
824 3300046459 Ga0495629_0717846 Ga0495629_0717846_95_562 155
825 3300046460 Ga0495638_0043532 Ga0495638_0043532_2301_2768 155
826 3300046460 Ga0495638_0063325 Ga0495638_0063325_1650_2117 155
827 3300046462 Ga0495651_0070658 Ga0495651_0070658_305_772 155
828 3300046463 Ga0495653_0133775 Ga0495653_0133775_1078_1545 155
829 3300046475 Ga0495639_0122426 Ga0495639_0122426_602_1069 155
830 3300046512 Ga0495610_0010849 Ga0495610_0010849_725_1192 155
831 3300046512 Ga0495610_0020359 Ga0495610_0020359_3036_3503 155
832 3300046512 Ga0495610_0085259 Ga0495610_0085259_387_854 155
833 3300046512 Ga0495610_0392893 Ga0495610_0392893_10_477 155
834 3300046513 Ga0495616_0000722 Ga0495616_0000722_21120_21587 155
835 3300046514 Ga0495618_0138797 Ga0495618_0138797_698_1165 155
836 3300046514 Ga0495618_0345519 Ga0495618_0345519_170_637 155
837 3300046515 Ga0495620_0021122 Ga0495620_0021122_740_1207 155
838 3300046518 Ga0495631_0000446 Ga0495631_0000446_24940_25407 155
839 3300046519 Ga0495632_0117942 Ga0495632_0117942_646_1113 155
840 3300046520 Ga0495637_0028290 Ga0495637_0028290_752_1219 155
841 3300046522 Ga0495643_0064789 Ga0495643_0064789_832_1299 155
842 3300046525 Ga0495663_0099688 Ga0495663_0099688_444_911 155
843 3300046528 Ga0495642_0038373 Ga0495642_0038373_827_1294 155
844 3300046530 Ga0495654_0014862 Ga0495654_0014862_927_1394 155
845 3300046530 Ga0495654_0016539 Ga0495654_0016539_375_842 155
846 3300046538 Ga0495609_0248669 Ga0495609_0248669_186_653 155
847 3300046539 Ga0495621_0009160 Ga0495621_0009160_221_688 155
848 3300046539 Ga0495621_0100588 Ga0495621_0100588_263_730 155
849 3300046539 Ga0495621_0109254 Ga0495621_0109254_35_502 155
850 3300046539 Ga0495621_0346171 Ga0495621_0346171_96_563 155
851 3300046542 Ga0495597_0001135 Ga0495597_0001135_17037_17504 155
852 3300046557 Ga0495622_0232948 Ga0495622_0232948_146_613 155
853 3300046558 Ga0495633_0002529 Ga0495633_0002529_5782_6249 155
854 3300046558 Ga0495633_0157967 Ga0495633_0157967_175_642 155
855 3300046615 Ga0495656_0001008 Ga0495656_0001008_7359_7826 155
856 3300046615 Ga0495656_0021519 Ga0495656_0021519_1327_1794 155
857 3300046642 Ga0495634_0352510 Ga0495634_0352510_395_862 155
858 3300046660 Ga0495625_0000396 Ga0495625_0000396_43799_44266 155
859 3300046660 Ga0495625_0020614 Ga0495625_0020614_605_1072 155
860 3300046663 Ga0495635_0230945 Ga0495635_0230945_660_1127 155
861 3300046665 Ga0495661_0101423 Ga0495661_0101423_1075_1542 155
862 3300046674 Ga0495588_0008771 Ga0495588_0008771_2857_3324 155
863 3300046674 Ga0495588_0017519 Ga0495588_0017519_1442_1909 155
864 3300046674 Ga0495588_0022794 Ga0495588_0022794_1765_2232 155
865 3300046678 Ga0495599_0210546 Ga0495599_0210546_24_491 155
866 3300046683 Ga0495658_0097627 Ga0495658_0097627_264_731 155
867 3300046683 Ga0495658_0263080 Ga0495658_0263080_95_562 155
868 3300046691 Ga0495670_0069830 Ga0495670_0069830_263_730 155
869 3300046692 Ga0495671_0006709 Ga0495671_0006709_3728_4195 155
870 3300046809 Ga0495600_0115925 Ga0495600_0115925_1256_1723 155
871 3300046809 Ga0495600_0207404 Ga0495600_0207404_611_1078 155
872 3300046809 Ga0495600_0622530 Ga0495600_0622530_150_617 155
873 3300046810 Ga0495660_0044178 Ga0495660_0044178_447_914 155
874 3300047315 Ga0495581_0296453 Ga0495581_0296453_337_804 155
875 3300047321 Ga0495676_0050590 Ga0495676_0050590_548_1015 155
876 3300047443 Ga0495687_203076 Ga0495687_203076_136_603 155
877 3300047470 Ga0495681_0113426 Ga0495681_0113426_400_867 155
878 3300047472 Ga0495686_0005856 Ga0495686_0005856_7253_7720 155
879 3300047673 Ga0495593_0005694 Ga0495593_0005694_4821_5288 155
880 3300047673 Ga0495593_0098558 Ga0495593_0098558_664_1131 155
881 3300047673 Ga0495593_0631470 Ga0495593_0631470_10_477 155
882 3300048088 Ga0495602_0459912 Ga0495602_0459912_280_747 155
883 3300048089 Ga0495614_0008498 Ga0495614_0008498_4019_4486 155
884 3300048090 Ga0495615_0023364 Ga0495615_0023364_511_978 155
885 3300048090 Ga0495615_0172772 Ga0495615_0172772_46_513 155
886 3300048903 Ga0496100_0078272 Ga0496100_0078272_652_1119 155
887 3300048903 Ga0496100_1402725 Ga0496100_1402725_29_496 155
888 3300048904 Ga0496101_0042961 Ga0496101_0042961_938_1405 155
889 3300048905 Ga0496102_0032292 Ga0496102_0032292_1643_2110 155
890 3300048905 Ga0496102_0032877 Ga0496102_0032877_1111_1578 155
891 3300048905 Ga0496102_0036331 Ga0496102_0036331_162_629 155
892 3300048906 Ga0496103_0211580 Ga0496103_0211580_583_1050 155
893 3300048907 Ga0496104_0464865 Ga0496104_0464865_249_716 155
894 3300048908 Ga0496105_0028533 Ga0496105_0028533_3117_3584 155
895 3300048908 Ga0496105_0197976 Ga0496105_0197976_152_619 155
896 3300048909 Ga0496106_0047925 Ga0496106_0047925_711_1178 155
897 3300048910 Ga0496107_0248541 Ga0496107_0248541_158_625 155
898 3300048915 Ga0496112_0345553 Ga0496112_0345553_93_560 155
899 3300048916 Ga0496113_1385750 Ga0496113_1385750_44_511 155
900 3300048917 Ga0496114_0056546 Ga0496114_0056546_393_860 155
901 3300048917 Ga0496114_0368850 Ga0496114_0368850_399_866 155
902 3300048917 Ga0496114_0472552 Ga0496114_0472552_310_777 155
903 3300048919 Ga0496116_0025554 Ga0496116_0025554_3701_4168 155
904 3300048920 Ga0496117_0044176 Ga0496117_0044176_286_753 155
905 3300048920 Ga0496117_0045056 Ga0496117_0045056_1533_2000 155
906 3300048921 Ga0496118_0050037 Ga0496118_0050037_431_898 155
907 3300048921 Ga0496118_0325976 Ga0496118_0325976_81_548 155
908 3300048924 Ga0496121_0022936 Ga0496121_0022936_1585_2052 155
909 3300048924 Ga0496121_0244409 Ga0496121_0244409_147_614 155
910 3300048925 Ga0496122_0000688 Ga0496122_0000688_63002_63469 155
911 3300048925 Ga0496122_0069209 Ga0496122_0069209_760_1227 155
912 3300048925 Ga0496122_0101496 Ga0496122_0101496_224_691 155
913 3300048925 Ga0496122_0110935 Ga0496122_0110935_401_868 155
914 3300048925 Ga0496122_0293218 Ga0496122_0293218_199_666 155
915 3300048925 Ga0496122_0371799 Ga0496122_0371799_116_583 155
916 3300048926 Ga0496123_0001158 Ga0496123_0001158_34531_34998 155
917 3300048926 Ga0496123_0038770 Ga0496123_0038770_569_1036 155
918 3300048926 Ga0496123_0057248 Ga0496123_0057248_58_525 155
919 3300048926 Ga0496123_0131922 Ga0496123_0131922_768_1235 155
920 3300048926 Ga0496123_0161827 Ga0496123_0161827_673_1140 155
921 3300048927 Ga0496124_0052228 Ga0496124_0052228_2620_3087 155
922 3300048927 Ga0496124_0059351 Ga0496124_0059351_1059_1526 155
923 3300048927 Ga0496124_0077403 Ga0496124_0077403_1793_2260 155
924 3300048927 Ga0496124_0196762 Ga0496124_0196762_629_1096 155
925 3300048928 Ga0496125_0006625 Ga0496125_0006625_3198_3665 155
926 3300048928 Ga0496125_0017065 Ga0496125_0017065_2406_2873 155
927 3300048928 Ga0496125_0290512 Ga0496125_0290512_128_595 155
928 3300048928 Ga0496125_0341143 Ga0496125_0341143_367_834 155
929 3300048928 Ga0496125_0510420 Ga0496125_0510420_11_478 155
930 3300048929 Ga0496126_0035110 Ga0496126_0035110_2153_2620 155
931 3300048929 Ga0496126_0234437 Ga0496126_0234437_962_1429 155
932 3300048929 Ga0496126_0932713 Ga0496126_0932713_149_616 155
933 3300049524 Ga0501301_010670 Ga0501301_010670_76_543 155
934 3300049531 Ga0501315_019643 Ga0501315_019643_313_780 155
935 3300049571 Ga0501034_0247677 Ga0501034_0247677_334_801 155
936 3300049573 Ga0501037_0244588 Ga0501037_0244588_150_617 155
937 3300049574 Ga0501038_0606296 Ga0501038_0606296_67_534 155
938 3300049579 Ga0501043_0641387 Ga0501043_0641387_239_706 155
939 3300049649 Ga0501198_000044 Ga0501198_000044_39170_39637 155
940 3300049662 Ga0501222_000017 Ga0501222_000017_36134_36601 155
941 3300049683 Ga0501253_003212 Ga0501253_003212_1351_1818 155
942 3300049822 Ga0501035_0048271 Ga0501035_0048271_2895_3362 155
943 3300049823 Ga0501044_0278341 Ga0501044_0278341_577_1044 155
944 3300050489 nmdc:mga03683_132966_c1 nmdc:mga03683_132966_c1_495_962 155
945 3300050489 nmdc:mga03683_252889_c1 nmdc:mga03683_252889_c1_98_565 155
946 3300050489 nmdc:mga03683_32250_c1 nmdc:mga03683_32250_c1_18_485 155
947 3300050489 nmdc:mga03683_60337_c1 nmdc:mga03683_60337_c1_113_580 155
948 3300050490 nmdc:mga03n38_90616_c1 nmdc:mga03n38_90616_c1_615_1082 155
949 3300050491 nmdc:mga00v17_10018_c1 nmdc:mga00v17_10018_c1_4120_4587 155
950 3300050491 nmdc:mga00v17_665279_c1 nmdc:mga00v17_665279_c1_183_650 155
951 3300050491 nmdc:mga00v17_99525_c1 nmdc:mga00v17_99525_c1_1315_1782 155
952 3300050492 nmdc:mga0yw44_14269_c1 nmdc:mga0yw44_14269_c1_1733_2200 155
953 3300050492 nmdc:mga0yw44_309247_c1 nmdc:mga0yw44_309247_c1_257_724 155
954 3300050493 nmdc:mga0k408_14275_c2 nmdc:mga0k408_14275_c2_1481_1948 155
955 3300050493 nmdc:mga0k408_157357_c1 nmdc:mga0k408_157357_c1_749_1216 155
956 3300050493 nmdc:mga0k408_23067_c1 nmdc:mga0k408_23067_c1_2819_3286 155
957 3300050493 nmdc:mga0k408_28627_c1 nmdc:mga0k408_28627_c1_1480_1947 155
958 3300050493 nmdc:mga0k408_351820_c1 nmdc:mga0k408_351820_c1_17_484 155
959 3300050493 nmdc:mga0k408_36399_c1 nmdc:mga0k408_36399_c1_129_596 155
960 3300050493 nmdc:mga0k408_38912_c1 nmdc:mga0k408_38912_c1_1283_1750 155
961 3300050493 nmdc:mga0k408_445271_c1 nmdc:mga0k408_445271_c1_285_752 155
962 3300050494 nmdc:mga06z11_295078_c1 nmdc:mga06z11_295078_c1_341_808 155
963 3300050494 nmdc:mga06z11_556810_c1 nmdc:mga06z11_556810_c1_170_637 155
964 3300050494 nmdc:mga06z11_581398_c1 nmdc:mga06z11_581398_c1_137_604 155
965 3300050496 nmdc:mga07m45_11241_c1 nmdc:mga07m45_11241_c1_4035_4502 155
966 3300050496 nmdc:mga07m45_13172_c1 nmdc:mga07m45_13172_c1_1698_2165 155
967 3300050496 nmdc:mga07m45_21825_c1 nmdc:mga07m45_21825_c1_2922_3389 155
968 3300050496 nmdc:mga07m45_249894_c1 nmdc:mga07m45_249894_c1_12_479 155
969 3300050496 nmdc:mga07m45_27154_c1 nmdc:mga07m45_27154_c1_2590_3057 155
970 3300050496 nmdc:mga07m45_312083_c1 nmdc:mga07m45_312083_c1_331_798 155
971 3300050496 nmdc:mga07m45_533_c1 nmdc:mga07m45_533_c1_3797_4264 155
972 3300050496 nmdc:mga07m45_58332_c1 nmdc:mga07m45_58332_c1_716_1183 155
973 3300050496 nmdc:mga07m45_9770_c1 nmdc:mga07m45_9770_c1_4235_4702 155
974 3300053079 Ga0500610_0005849 Ga0500610_0005849_4596_5063 155
975 3300053079 Ga0500610_0007392 Ga0500610_0007392_4210_4677 155
976 3300053086 Ga0500578_0000926 Ga0500578_0000926_4968_5435 155
977 3300053087 Ga0500643_010390 Ga0500643_010390_1160_1627 155
978 3300053088 Ga0500644_0004370 Ga0500644_0004370_1503_1970 155
979 3300053088 Ga0500644_0008346 Ga0500644_0008346_216_683 155
980 3300053088 Ga0500644_0215805 Ga0500644_0215805_113_580 155
981 3300053090 Ga0500646_0022004 Ga0500646_0022004_628_1095 155
982 3300053091 Ga0500647_0069700 Ga0500647_0069700_900_1367 155
983 3300053093 Ga0500651_0000063 Ga0500651_0000063_50035_50502 155
984 3300053093 Ga0500651_0037817 Ga0500651_0037817_146_613 155
985 3300053096 Ga0500641_0082765 Ga0500641_0082765_209_676 155
986 3300053096 Ga0500641_0167280 Ga0500641_0167280_199_666 155
987 3300053098 Ga0500650_0037746 Ga0500650_0037746_106_573 155
988 3300053108 Ga0500562_027216 Ga0500562_027216_379_846 155
989 3300053108 Ga0500562_049118 Ga0500562_049118_386_853 155
990 3300053110 Ga0500571_008126 Ga0500571_008126_2215_2682 155
991 3300053116 Ga0500592_009925 Ga0500592_009925_118_585 155
992 3300053117 Ga0500593_000487 Ga0500593_000487_2278_2745 155
993 3300053117 Ga0500593_001737 Ga0500593_001737_1720_2187 155
994 3300053117 Ga0500593_004766 Ga0500593_004766_3354_3821 155
995 3300053118 Ga0500594_0000905 Ga0500594_0000905_706_1173 155
996 3300053120 Ga0500597_113615 Ga0500597_113615_462_929 155
997 3300053121 Ga0500607_001614 Ga0500607_001614_6927_7394 155
998 3300053121 Ga0500607_095498 Ga0500607_095498_544_1011 155
999 3300053122 Ga0500608_008503 Ga0500608_008503_2596_3063 155
1000 3300053122 Ga0500608_083300 Ga0500608_083300_634_1101 155
1001 3300053125 Ga0500618_035370 Ga0500618_035370_531_998 155
1002 3300053125 Ga0500618_045103 Ga0500618_045103_408_875 155
1003 3300053128 Ga0500626_105204 Ga0500626_105204_174_641 155
1004 3300053130 Ga0500642_0013135 Ga0500642_0013135_1984_2451 155
1005 3300053131 Ga0500652_004429 Ga0500652_004429_2127_2594 155
1006 3300053131 Ga0500652_031259 Ga0500652_031259_152_619 155
1007 3300053133 Ga0500655_028009 Ga0500655_028009_422_1060 155
1008 3300053134 Ga0500658_0002954 Ga0500658_0002954_5365_5832 155
1009 3300053134 Ga0500658_0002955 Ga0500658_0002955_698_1165 155
1010 3300053136 Ga0500559_0000260 Ga0500559_0000260_30424_30891 155
1011 3300053136 Ga0500559_0006663 Ga0500559_0006663_1611_2078 155
1012 3300053136 Ga0500559_0008325 Ga0500559_0008325_1749_2216 155
1013 3300053136 Ga0500559_0023456 Ga0500559_0023456_1684_2151 155
1014 3300053139 Ga0500568_0003245 Ga0500568_0003245_6194_6661 155
1015 3300053139 Ga0500568_0145526 Ga0500568_0145526_31_498 155
1016 3300053141 Ga0500574_031804 Ga0500574_031804_845_1312 155
1017 3300053142 Ga0500577_0073196 Ga0500577_0073196_823_1290 155
1018 3300053148 Ga0500590_034903 Ga0500590_034903_1697_2164 155
1019 3300053151 Ga0500604_0021837 Ga0500604_0021837_653_1120 155
1020 3300053151 Ga0500604_0055885 Ga0500604_0055885_151_618 155
1021 3300053151 Ga0500604_0248720 Ga0500604_0248720_62_529 155
1022 3300053153 Ga0500616_0025494 Ga0500616_0025494_1473_1940 155
1023 3300053154 Ga0500619_000059 Ga0500619_000059_28613_29080 155
1024 3300053154 Ga0500619_113521 Ga0500619_113521_369_836 155
1025 3300053156 Ga0500622_0001479 Ga0500622_0001479_7587_8054 155
1026 3300053156 Ga0500622_0004445 Ga0500622_0004445_6509_6976 155
1027 3300053160 Ga0500633_0032144 Ga0500633_0032144_1203_1670 155
1028 3300053161 Ga0500634_0038376 Ga0500634_0038376_2040_2507 155
1029 3300053162 Ga0500638_029064 Ga0500638_029064_98_565 155
1030 3300053177 Ga0500636_0165370 Ga0500636_0165370_538_1005 155
1031 3300053724 Ga0500570_083918 Ga0500570_083918_362_829 155
1032 3300053730 Ga0500645_000198 Ga0500645_000198_8537_9004 155
1033 3300053730 Ga0500645_004925 Ga0500645_004925_651_1118 155
1034 3300053730 Ga0500645_015380 Ga0500645_015380_382_849 155
1035 3300053739 Ga0500587_000969 Ga0500587_000969_1867_2334 155
1036 3300053739 Ga0500587_006774 Ga0500587_006774_474_941 155
1037 3300061719 Ga0466962_0407838 Ga0466962_0407838_136_603 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

15

167

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9644 1 153
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9582 2 155
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9582 1 153
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9462 2 155
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9429 1 152
ID Description Score Start End Superfamily
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9567 3 153 3.40.1280.10
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9443 3 153 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9272 3 147 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9226 1 154 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9125 1 150 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2R7RW46-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9829 1 155 GO:0005737
GO:0070038
AF-A0A5C7JE22-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9821 1 155 GO:0005737
GO:0070038
AF-A0A7J6JSI1-F1-model_v4 deleted 0.9813 27 147
AF-A0A7W8HHK5-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9802 1 155 GO:0005737
GO:0070038
AF-A0A2E2R6H6-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9779 1 155 GO:0005737
GO:0070038

Feature Viewer

pLDDT pTM Quality
95.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map