F488690

General Info

Members Datasets Scaffolds Average Seq Length
1034 474 2068 472

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2687453743|2689991649
Length 533
Sequence GSVAAEDRPSSDKEQVQMDSRQAQDEAGQQPGATGATAAPGATGAAEPDRERDELDSGIGSAGADGAPPLRLWGGRFAGGPAEALARLSVSVXFDWRLAPYDLLASRSHARVLHRAGLLDAGELTAMLGALDDLSEAVTQGRFRPTIEDEDVHTALERGLLERLGALGGKLRAGRSRNDQVATDLRLYLRDHARQVAARLTELSTALVVLAEQHVDTPAPGMTHLQHAQPISFAHQLLAHVHAFARDTERLRDWDRRASVSALGAGALAGSSLPLDPAGVAAELGFDRAFANSLDAVSDRDFAAEFLFVAALAGVHLSRLGEEIVLWTTREFGWVELDDAFATGSSIMPQKKNPDIAELARGKSGRLIGALTGLLTTLKGLPLAYDRDLQEDKEPVFDAVDTLLVVLPAMTGMVATMRVRRDRLEAAAPDGFALATDVAEYLVRNGVAFREAHEAVGQLVAWCVAHEADLDEVSDDDLVVISPLXTPDVRTVLSVRGALEARSAPGGTAPERVREQIQALGPVLDRDRAWAGS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
169 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
374 2506783011 Frankia datiscae Dg1 Isolate Nodule
375 2508501039 Frankia saprophytica CN3 Isolate Nodule
376 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
377 2517572101 Frankia sp. DC12 Isolate Nodule
378 2527291627 Frankia casuarinae Thr Isolate Nodule
379 2527291629 Frankia sp. BMG5.23 Isolate Nodule
380 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
381 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
382 2576861822 Frankia sp. CeD Isolate Nodule
383 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
384 2582580736 Prauserella sp. Am3 Isolate Unclassified
385 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
386 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
387 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
388 2619618881 Frankia sp. ACN1ag Isolate Unclassified
389 2619619003 Frankia sp. CpI1-P Isolate Nodule
390 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
391 2626541554 Frankia sp. AvcI.1 Isolate Nodule
392 2643221578 Streptomyces sp. Root63 Isolate Unclassified
393 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
394 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
395 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
396 2643221711 Terrabacter sp. Root85 Isolate Unclassified
397 2671180195 Frankia sp. CcI49 Isolate Nodule
398 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
399 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
400 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
401 2684623036 Frankia sp. CgIM4 Isolate Nodule
402 2687453737 Frankia sp. BMG5.36 Isolate Nodule
403 2710264753 Frankia sp. KB5 Isolate Nodule
404 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
405 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
406 2773857922 Frankia sp. CcI49 Isolate Nodule
407 2773857924 Frankia sp. CgIS1 Isolate Nodule
408 2773857933 Frankia sp. BMG5.30 Isolate Nodule
409 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
410 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
411 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
412 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
413 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
414 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
415 2808606448 Streptomyces sp. 193411 Isolate Unclassified
416 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
417 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
418 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
419 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
420 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
421 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
422 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
423 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
424 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
425 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
426 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
427 2867428634 Streptomyces sp. RP5T Isolate Unclassified
428 2867475112 Streptomyces sp. TM32 Isolate Unclassified
429 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
430 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
431 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
432 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
433 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
434 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
435 2891562705 Microbispora tritici MT50 Isolate Unclassified
436 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
437 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
438 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
439 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
440 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
441 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
442 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
443 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
444 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
445 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
446 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
447 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
448 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
449 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
450 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
451 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
452 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
453 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
454 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
455 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
456 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
457 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
458 637000116 Frankia casuarinae CcI3 Isolate Nodule
459 8002775197 Frankia nepalensis CN7 Isolate Nodule
460 8002784119 Frankia sp. AgB1.9 Isolate Nodule
461 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
462 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
463 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
464 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
465 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
466 8054920844 Frankia tisae Agncl-8 Isolate Nodule
467 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
468 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
469 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
470 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
471 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
472 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
473 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
474 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 0.19
Isolates 9.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 2.32
Rhizoplane 4.26
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001239 3300003203 Bacteria 11995
2 JGI25407J50210_10005010 3300003373 Bacteria 3237
3 Ga0070658_10000155 3300005327 Bacteria 60553
4 Ga0070658_10002940 3300005327 Bacteria 14124
5 Ga0070658_10029662 3300005327 Bacteria 4395
6 Ga0070658_10157737 3300005327 Bacteria 1903
7 Ga0070690_100102271 3300005330 Bacteria 1901
8 Ga0068869_100023645 3300005334 Bacteria 4249
9 Ga0068869_100026269 3300005334 Bacteria 4052
10 Ga0070680_100001962 3300005336 Bacteria 15137
11 Ga0070680_100026940 3300005336 Bacteria 4600
12 Ga0070680_100028822 3300005336 Bacteria 4455
13 Ga0070680_100045036 3300005336 Bacteria 3586
14 Ga0070680_100090868 3300005336 Bacteria 2527
15 Ga0070682_100106717 3300005337 Bacteria 1859
16 Ga0068868_100013822 3300005338 Bacteria 5933
17 Ga0070660_100011330 3300005339 Bacteria 6329
18 Ga0070660_100029298 3300005339 Bacteria 4124
19 Ga0070660_100135097 3300005339 Bacteria 1976
20 Ga0070660_100139665 3300005339 Bacteria 1943
21 Ga0070689_100123691 3300005340 Bacteria 2068
22 Ga0070661_100150501 3300005344 Bacteria 1759
23 Ga0070675_100000432 3300005354 Bacteria 28465
24 Ga0070671_100009876 3300005355 Bacteria 7662
25 Ga0070659_100022854 3300005366 Bacteria 4778
26 Ga0070659_100043762 3300005366 Bacteria 3503
27 Ga0070659_100074131 3300005366 Bacteria 2711
28 Ga0070659_100074141 3300005366 Bacteria 2710
29 Ga0070667_100041762 3300005367 Bacteria 3847
30 Ga0070667_100083388 3300005367 Bacteria 2738
31 Ga0070709_10004934 3300005434 Bacteria 7207
32 Ga0070714_100001145 3300005435 Bacteria 19056
33 Ga0070714_100004012 3300005435 Bacteria 11070
34 Ga0070714_100008229 3300005435 Bacteria 8126
35 Ga0070714_100034331 3300005435 Bacteria 4248
36 Ga0070714_100070777 3300005435 Bacteria 3015
37 Ga0070713_100005230 3300005436 Bacteria 8844
38 Ga0070713_100014998 3300005436 Bacteria 5772
39 Ga0070713_100044036 3300005436 Bacteria 3652
40 Ga0070713_100074312 3300005436 Bacteria 2879
41 Ga0070713_100080927 3300005436 Bacteria 2770
42 Ga0070713_100203340 3300005436 Bacteria 1790
43 Ga0070710_10001141 3300005437 Bacteria 12594
44 Ga0070710_10001374 3300005437 Bacteria 11475
45 Ga0070710_10021293 3300005437 Bacteria 3377
46 Ga0070710_10076569 3300005437 Bacteria 1942
47 Ga0070711_100004625 3300005439 Bacteria 8147
48 Ga0070700_100025985 3300005441 Bacteria 3453
49 Ga0070708_100022408 3300005445 Bacteria 5358
50 Ga0070663_100035622 3300005455 Bacteria 3453
51 Ga0070663_100054412 3300005455 Bacteria 2860
52 Ga0070678_100041789 3300005456 Bacteria 3253
53 Ga0070662_100019366 3300005457 Bacteria 4619
54 Ga0070681_10000504 3300005458 Bacteria 31959
55 Ga0070681_10082341 3300005458 Bacteria 3173
56 Ga0070681_10288912 3300005458 Bacteria 1550
57 Ga0070706_100004502 3300005467 Bacteria 13430
58 Ga0070706_100022790 3300005467 Bacteria 5767
59 Ga0070706_100027267 3300005467 Bacteria 5256
60 Ga0070706_100032645 3300005467 Bacteria 4803
61 Ga0070706_100032981 3300005467 Bacteria 4778
62 Ga0070706_100061620 3300005467 Bacteria 3464
63 Ga0070706_100151403 3300005467 Bacteria 2165
64 Ga0070707_100002548 3300005468 Bacteria 17322
65 Ga0070707_100003790 3300005468 Bacteria 14265
66 Ga0070707_100058478 3300005468 Bacteria 3697
67 Ga0070707_100065381 3300005468 Bacteria 3493
68 Ga0070707_100117717 3300005468 Bacteria 2579
69 Ga0070707_100158936 3300005468 Bacteria 2201
70 Ga0070698_100002410 3300005471 Bacteria 20596
71 Ga0070698_100006733 3300005471 Bacteria 12461
72 Ga0070698_100019009 3300005471 Bacteria 7226
73 Ga0070698_100121782 3300005471 Bacteria 2568
74 Ga0070699_100144275 3300005518 Bacteria 2103
75 Ga0070679_100005358 3300005530 Bacteria 11869
76 Ga0070679_100036362 3300005530 Bacteria 4885
77 Ga0070679_100134258 3300005530 Bacteria 2456
78 Ga0070679_100140725 3300005530 Bacteria 2392
79 Ga0070684_100043382 3300005535 Bacteria 3883
80 Ga0070684_100211996 3300005535 Bacteria 1765
81 Ga0070697_100152242 3300005536 Bacteria 1950
82 Ga0070672_100108227 3300005543 Bacteria 2263
83 Ga0070696_100101654 3300005546 Bacteria 2061
84 Ga0070665_100054549 3300005548 Bacteria 4009
85 Ga0070665_100063573 3300005548 Bacteria 3701
86 Ga0070665_100067805 3300005548 Bacteria 3577
87 Ga0070665_100154454 3300005548 Bacteria 2297
88 Ga0070704_100055382 3300005549 Bacteria 2811
89 Ga0068855_100012387 3300005563 Bacteria 10301
90 Ga0068855_100019603 3300005563 Bacteria 8124
91 Ga0068855_100034580 3300005563 Bacteria 6024
92 Ga0068855_100296892 3300005563 Bacteria 1790
93 Ga0070664_100001189 3300005564 Bacteria 20725
94 Ga0068857_100071939 3300005577 Bacteria 3082
95 Ga0068854_100045745 3300005578 Bacteria 3113
96 Ga0068856_100050508 3300005614 Bacteria 4100
97 Ga0068856_100156691 3300005614 Bacteria 2287
98 Ga0070702_100013168 3300005615 Bacteria 4169
99 Ga0068852_100009673 3300005616 Bacteria 7164
100 Ga0068852_100018879 3300005616 Bacteria 5444
101 Ga0068852_100191252 3300005616 Bacteria 1931
102 Ga0068859_100002262 3300005617 Bacteria 19531
103 Ga0068859_100066859 3300005617 Bacteria 3629
104 Ga0068859_100282615 3300005617 Bacteria 1752
105 Ga0068861_100025747 3300005719 Bacteria 4270
106 Ga0068863_100007064 3300005841 Bacteria 11003
107 Ga0068863_100008788 3300005841 Bacteria 9864
108 Ga0068863_100013852 3300005841 Bacteria 7772
109 Ga0068863_100089770 3300005841 Bacteria 2914
110 Ga0068858_100000032 3300005842 Bacteria 142794
111 Ga0068858_100014430 3300005842 Bacteria 7448
112 Ga0068858_100116303 3300005842 Bacteria 2499
113 Ga0068860_100001541 3300005843 Bacteria 24832
114 Ga0068860_100279263 3300005843 Bacteria 1632
115 Ga0068862_100000021 3300005844 Bacteria 218035
116 Ga0068862_100132511 3300005844 Bacteria 2206
117 Ga0081455_10000117 3300005937 Bacteria 91308
118 Ga0081455_10000943 3300005937 Bacteria 37170
119 Ga0081455_10036026 3300005937 Bacteria 4412
120 Ga0081455_10062835 3300005937 Bacteria 3119
121 Ga0081538_10000008 3300005981 Bacteria 173780
122 Ga0081538_10004860 3300005981 Bacteria 12237
123 Ga0081540_1001691 3300005983 Bacteria 18722
124 Ga0081539_10001536 3300005985 Bacteria 38601
125 Ga0081539_10002043 3300005985 Bacteria 30343
126 Ga0070717_10009527 3300006028 Bacteria 7302
127 Ga0070717_10084774 3300006028 Bacteria 2666
128 Ga0070717_10097747 3300006028 Bacteria 2488
129 Ga0075363_100011120 3300006048 Bacteria 4301
130 Ga0075364_10054662 3300006051 Bacteria 2611
131 Ga0075432_10000747 3300006058 Bacteria 10087
132 Ga0075432_10002780 3300006058 Bacteria 5870
133 Ga0070715_10001858 3300006163 Bacteria 6315
134 Ga0070715_10077563 3300006163 Bacteria 1500
135 Ga0070716_100000107 3300006173 Bacteria 33042
136 Ga0070716_100001032 3300006173 Bacteria 12191
137 Ga0070716_100026556 3300006173 Bacteria 3102
138 Ga0070716_100036091 3300006173 Bacteria 2723
139 Ga0070712_100013526 3300006175 Bacteria 5216
140 Ga0070712_100021377 3300006175 Bacteria 4250
141 Ga0070712_100075464 3300006175 Bacteria 2424
142 Ga0075370_10004205 3300006353 Bacteria 6952
143 Ga0068871_100015523 3300006358 Bacteria 5704
144 Ga0068871_100066435 3300006358 Bacteria 2956
145 Ga0075428_100094224 3300006844 Bacteria 3265
146 Ga0075431_100009739 3300006847 Bacteria 9650
147 Ga0075433_10003991 3300006852 Bacteria 11422
148 Ga0075433_10004634 3300006852 Bacteria 10729
149 Ga0075433_10040914 3300006852 Bacteria 4014
150 Ga0075433_10046700 3300006852 Bacteria 3767
151 Ga0075433_10101347 3300006852 Bacteria 2550
152 Ga0075434_100005761 3300006871 Bacteria 11315
153 Ga0075434_100024785 3300006871 Bacteria 5865
154 Ga0075434_100036281 3300006871 Bacteria 4877
155 Ga0068865_100023825 3300006881 Bacteria 4012
156 Ga0068865_100026060 3300006881 Bacteria 3851
157 Ga0068865_100074547 3300006881 Bacteria 2417
158 Ga0075436_100010015 3300006914 Bacteria 6484
159 Ga0097620_100002262 3300006931 Bacteria 19531
160 Ga0097620_100066854 3300006931 Bacteria 3629
161 Ga0097620_100282612 3300006931 Bacteria 1752
162 Ga0075435_100003227 3300007076 Bacteria 11037
163 Ga0075435_100031679 3300007076 Bacteria 4168
164 Ga0075435_100058846 3300007076 Bacteria 3113
165 Ga0105251_10015488 3300009011 Bacteria 4165
166 Ga0105240_10023577 3300009093 Bacteria 8133
167 Ga0105240_10033631 3300009093 Bacteria 6620
168 Ga0105240_10062564 3300009093 Bacteria 4633
169 Ga0111539_10000158 3300009094 Bacteria 76916
170 Ga0111539_10012622 3300009094 Bacteria 10585
171 Ga0111539_10053176 3300009094 Bacteria 4820
172 Ga0105245_10006017 3300009098 Bacteria 10664
173 Ga0105245_10030109 3300009098 Bacteria 4799
174 Ga0105247_10000164 3300009101 Bacteria 64953
175 Ga0105247_10013514 3300009101 Bacteria 4896
176 Ga0114129_10003880 3300009147 Bacteria 21096
177 Ga0114129_10006158 3300009147 Bacteria 17018
178 Ga0114129_10381012 3300009147 Bacteria 1863
179 Ga0105243_10004679 3300009148 Bacteria 10775
180 Ga0105243_10015344 3300009148 Bacteria 5795
181 Ga0105243_10018374 3300009148 Bacteria 5295
182 Ga0105241_10000211 3300009174 Bacteria 43844
183 Ga0105241_10112876 3300009174 Bacteria 2178
184 Ga0105242_10041434 3300009176 Bacteria 3714
185 Ga0105242_10090994 3300009176 Bacteria 2568
186 Ga0105248_10008126 3300009177 Bacteria 11521
187 Ga0105248_10025426 3300009177 Bacteria 6583
188 Ga0105248_10084778 3300009177 Bacteria 3565
189 Ga0105248_10092052 3300009177 Bacteria 3415
190 Ga0105248_10092277 3300009177 Bacteria 3410
191 Ga0105237_10175971 3300009545 Bacteria 2140
192 Ga0105238_10135556 3300009551 Bacteria 2439
193 Ga0105249_10007978 3300009553 Bacteria 9229
194 Ga0105249_10018935 3300009553 Bacteria 6136
195 Ga0105249_10037975 3300009553 Bacteria 4370
196 Ga0105239_10221677 3300010375 Bacteria 2121
197 Ga0157371_10124312 3300013102 Bacteria 1835
198 Ga0157369_10003546 3300013105 Bacteria 18533
199 Ga0157369_10013234 3300013105 Bacteria 9333
200 Ga0157369_10015580 3300013105 Bacteria 8566
201 Ga0157369_10018498 3300013105 Bacteria 7811
202 Ga0157369_10101407 3300013105 Bacteria 3067
203 Ga0157369_10124574 3300013105 Bacteria 2733
204 Ga0157369_10160221 3300013105 Bacteria 2375
205 Ga0163162_10033407 3300013306 Bacteria 5112
206 Ga0157372_10051339 3300013307 Bacteria 4589
207 Ga0157372_10122109 3300013307 Bacteria 2993
208 Ga0157372_10362136 3300013307 Bacteria 1690
209 Ga0157375_10354597 3300013308 Bacteria 1633
210 Ga0163163_10003743 3300014325 Bacteria 12948
211 Ga0163163_10025818 3300014325 Bacteria 5604
212 Ga0163163_10061133 3300014325 Bacteria 3732
213 Ga0163163_10100616 3300014325 Bacteria 2913
214 Ga0163163_10125584 3300014325 Bacteria 2603
215 Ga0157380_10025917 3300014326 Bacteria 4449
216 Ga0157377_10052592 3300014745 Bacteria 2300
217 Ga0157379_10000802 3300014968 Bacteria 25461
218 Ga0163161_10021783 3300017792 Bacteria 4507
219 Ga0206353_11278065 3300020082 Bacteria 2427
220 Ga0213876_10008265 3300021384 Bacteria 5631
221 Ga0213876_10020805 3300021384 Bacteria 3469
222 Ga0213875_10000176 3300021388 Bacteria 67409
223 Ga0213875_10012930 3300021388 Bacteria 4111
224 Ga0213875_10022537 3300021388 Bacteria 3011
225 Ga0224712_10012656 3300022467 Bacteria 2661
226 Ga0224572_1002810 3300024225 Bacteria 2869
227 Ga0209148_1004143 3300025254 Bacteria 3651
228 Ga0209758_1018764 3300025297 Bacteria 3372
229 Ga0207653_10001877 3300025885 Bacteria 6729
230 Ga0207692_10002817 3300025898 Bacteria 6716
231 Ga0207692_10003209 3300025898 Bacteria 6361
232 Ga0207692_10007932 3300025898 Bacteria 4375
233 Ga0207692_10019912 3300025898 Bacteria 3042
234 Ga0207692_10030651 3300025898 Bacteria 2567
235 Ga0207710_10000082 3300025900 Bacteria 138091
236 Ga0207710_10000178 3300025900 Bacteria 64962
237 Ga0207688_10045759 3300025901 Bacteria 2441
238 Ga0207685_10016682 3300025905 Bacteria 2356
239 Ga0207699_10000162 3300025906 Bacteria 41608
240 Ga0207699_10003242 3300025906 Bacteria 7750
241 Ga0207699_10008552 3300025906 Bacteria 5059
242 Ga0207699_10009681 3300025906 Bacteria 4809
243 Ga0207699_10018654 3300025906 Bacteria 3681
244 Ga0207699_10019900 3300025906 Bacteria 3589
245 Ga0207705_10000595 3300025909 Bacteria 30272
246 Ga0207705_10036392 3300025909 Bacteria 3523
247 Ga0207684_10005597 3300025910 Bacteria 11563
248 Ga0207684_10008418 3300025910 Bacteria 9173
249 Ga0207684_10011027 3300025910 Bacteria 7921
250 Ga0207684_10028160 3300025910 Bacteria 4786
251 Ga0207684_10041912 3300025910 Bacteria 3880
252 Ga0207684_10059418 3300025910 Bacteria 3246
253 Ga0207684_10159732 3300025910 Bacteria 1940
254 Ga0207654_10000003 3300025911 Bacteria 1030378
255 Ga0207707_10021899 3300025912 Bacteria 5586
256 Ga0207707_10031920 3300025912 Bacteria 4610
257 Ga0207707_10201279 3300025912 Bacteria 1736
258 Ga0207695_10009600 3300025913 Bacteria 11949
259 Ga0207695_10035988 3300025913 Bacteria 5358
260 Ga0207671_10047284 3300025914 Bacteria 3184
261 Ga0207693_10005465 3300025915 Bacteria 10594
262 Ga0207693_10011553 3300025915 Bacteria 7141
263 Ga0207693_10044954 3300025915 Bacteria 3470
264 Ga0207693_10049152 3300025915 Bacteria 3312
265 Ga0207663_10010235 3300025916 Bacteria 4983
266 Ga0207663_10013983 3300025916 Bacteria 4380
267 Ga0207660_10014279 3300025917 Bacteria 5219
268 Ga0207660_10020234 3300025917 Bacteria 4463
269 Ga0207660_10115961 3300025917 Bacteria 2023
270 Ga0207662_10111824 3300025918 Bacteria 1704
271 Ga0207657_10027505 3300025919 Bacteria 5207
272 Ga0207657_10120345 3300025919 Bacteria 2160
273 Ga0207657_10152508 3300025919 Bacteria 1881
274 Ga0207652_10001493 3300025921 Bacteria 20662
275 Ga0207652_10011363 3300025921 Bacteria 7175
276 Ga0207652_10130610 3300025921 Bacteria 2240
277 Ga0207652_10210737 3300025921 Bacteria 1749
278 Ga0207646_10004909 3300025922 Bacteria 14315
279 Ga0207646_10006662 3300025922 Bacteria 11906
280 Ga0207646_10026254 3300025922 Bacteria 5317
281 Ga0207646_10049392 3300025922 Bacteria 3768
282 Ga0207646_10173500 3300025922 Bacteria 1947
283 Ga0207646_10254369 3300025922 Bacteria 1587
284 Ga0207694_10193655 3300025924 Bacteria 1652
285 Ga0207687_10015347 3300025927 Bacteria 5021
286 Ga0207700_10000208 3300025928 Bacteria 35189
287 Ga0207700_10005586 3300025928 Bacteria 7547
288 Ga0207700_10011622 3300025928 Bacteria 5625
289 Ga0207700_10023204 3300025928 Bacteria 4273
290 Ga0207700_10026506 3300025928 Bacteria 4042
291 Ga0207700_10030133 3300025928 Bacteria 3838
292 Ga0207700_10033068 3300025928 Bacteria 3697
293 Ga0207700_10034483 3300025928 Bacteria 3633
294 Ga0207700_10055575 3300025928 Bacteria 2976
295 Ga0207664_10000108 3300025929 Bacteria 72754
296 Ga0207664_10000652 3300025929 Bacteria 23974
297 Ga0207664_10006346 3300025929 Bacteria 8125
298 Ga0207664_10025397 3300025929 Bacteria 4462
299 Ga0207664_10050410 3300025929 Bacteria 3283
300 Ga0207664_10084753 3300025929 Bacteria 2585
301 Ga0207664_10150877 3300025929 Bacteria 1974
302 Ga0207644_10019377 3300025931 Bacteria 4616
303 Ga0207690_10015030 3300025932 Bacteria 4685
304 Ga0207690_10030577 3300025932 Bacteria 3437
305 Ga0207690_10045554 3300025932 Bacteria 2898
306 Ga0207706_10008994 3300025933 Bacteria 9193
307 Ga0207706_10012429 3300025933 Bacteria 7758
308 Ga0207709_10095220 3300025935 Bacteria 1956
309 Ga0207669_10050448 3300025937 Bacteria 2488
310 Ga0207665_10001654 3300025939 Bacteria 14998
311 Ga0207665_10009362 3300025939 Bacteria 6430
312 Ga0207665_10071751 3300025939 Bacteria 2364
313 Ga0207691_10056671 3300025940 Bacteria 3569
314 Ga0207711_10004436 3300025941 Bacteria 11961
315 Ga0207711_10005962 3300025941 Bacteria 10300
316 Ga0207711_10029591 3300025941 Bacteria 4622
317 Ga0207689_10002944 3300025942 Bacteria 15736
318 Ga0207689_10014973 3300025942 Bacteria 6579
319 Ga0207661_10070349 3300025944 Bacteria 2857
320 Ga0207679_10007877 3300025945 Bacteria 6767
321 Ga0207679_10043802 3300025945 Bacteria 3225
322 Ga0207667_10012713 3300025949 Bacteria 9671
323 Ga0207667_10027190 3300025949 Bacteria 6234
324 Ga0207667_10162034 3300025949 Bacteria 2300
325 Ga0207712_10016843 3300025961 Bacteria 4739
326 Ga0207640_10021338 3300025981 Bacteria 3860
327 Ga0207658_10033483 3300025986 Bacteria 3666
328 Ga0207677_10117420 3300026023 Bacteria 1994
329 Ga0207703_10000015 3300026035 Bacteria 287079
330 Ga0207703_10033969 3300026035 Bacteria 4046
331 Ga0207703_10085225 3300026035 Bacteria 2643
332 Ga0207678_10019054 3300026067 Bacteria 6027
333 Ga0207678_10022911 3300026067 Bacteria 5465
334 Ga0207708_10158656 3300026075 Bacteria 1785
335 Ga0207702_10019652 3300026078 Bacteria 5592
336 Ga0207702_10094998 3300026078 Bacteria 2618
337 Ga0207641_10005192 3300026088 Bacteria 11135
338 Ga0207641_10037816 3300026088 Bacteria 4033
339 Ga0207648_10150702 3300026089 Bacteria 2052
340 Ga0207676_10083282 3300026095 Bacteria 2604
341 Ga0207676_10103429 3300026095 Bacteria 2367
342 Ga0207674_10014112 3300026116 Bacteria 8826
343 Ga0207674_10014116 3300026116 Bacteria 8824
344 Ga0207674_10022371 3300026116 Bacteria 6788
345 Ga0207675_100034755 3300026118 Bacteria 4701
346 Ga0207675_100043753 3300026118 Bacteria 4183
347 Ga0207683_10002402 3300026121 Bacteria 16354
348 Ga0207698_10004922 3300026142 Bacteria 8188
349 Ga0207428_10005818 3300027907 Bacteria 11432
350 Ga0207428_10006063 3300027907 Bacteria 11175
351 Ga0268266_10108451 3300028379 Bacteria 2457
352 Ga0268265_10000034 3300028380 Bacteria 218695
353 Ga0268265_10093000 3300028380 Bacteria 2415
354 Ga0268264_10015171 3300028381 Bacteria 6320
355 Ga0268264_10016963 3300028381 Bacteria 5961
356 Ga0268264_10086378 3300028381 Bacteria 2695
357 Ga0265337_1000717 3300028556 Bacteria 17435
358 Ga0265319_1002807 3300028563 Bacteria 9330
359 Ga0265334_10003266 3300028573 Bacteria 7401
360 Ga0265318_10005188 3300028577 Bacteria 6149
361 Ga0265323_10018282 3300028653 Bacteria 2714
362 Ga0265322_10011862 3300028654 Bacteria 2520
363 Ga0265336_10008231 3300028666 Bacteria 3668
364 Ga0307517_10010693 3300028786 Bacteria 12808
365 Ga0307515_10000598 3300028794 Bacteria 84186
366 Ga0307515_10022335 3300028794 Bacteria 11156
367 Ga0307515_10041986 3300028794 Bacteria 7173
368 Ga0265338_10009703 3300028800 Bacteria 11417
369 Ga0265338_10010976 3300028800 Bacteria 10527
370 Ga0265338_10011718 3300028800 Bacteria 10092
371 Ga0265338_10013470 3300028800 Bacteria 9225
372 Ga0265324_10000014 3300029957 Bacteria 189109
373 Ga0265324_10017802 3300029957 Bacteria 2580
374 Ga0316177_1138842 3300030731 Bacteria 3758
375 Ga0316180_1183041 3300030736 Bacteria 1946
376 Ga0265332_10003020 3300031238 Bacteria 8253
377 Ga0265320_10038988 3300031240 Bacteria 2378
378 Ga0265325_10020950 3300031241 Bacteria 3598
379 Ga0265325_10074437 3300031241 Bacteria 1698
380 Ga0265340_10008841 3300031247 Bacteria 5425
381 Ga0265327_10008570 3300031251 Bacteria 7589
382 Ga0265316_10068732 3300031344 Bacteria 2735
383 Ga0307408_100008126 3300031548 Bacteria 6934
384 Ga0307408_100079754 3300031548 Bacteria 2444
385 Ga0307508_10007864 3300031616 Bacteria 9897
386 Ga0307514_10040454 3300031649 Bacteria 3675
387 Ga0265314_10003856 3300031711 Bacteria 14303
388 Ga0265314_10013885 3300031711 Bacteria 6480
389 Ga0265342_10013847 3300031712 Bacteria 5383
390 Ga0316576_10040482 3300031727 Bacteria 3350
391 Ga0316576_10043670 3300031727 Bacteria 3235
392 Ga0316576_10056242 3300031727 Bacteria 2873
393 Ga0316576_10069897 3300031727 Bacteria 2589
394 Ga0307516_10000753 3300031730 Bacteria 44155
395 Ga0307516_10076497 3300031730 Bacteria 3199
396 Ga0307516_10101985 3300031730 Bacteria 2685
397 Ga0307405_10012156 3300031731 Bacteria 4544
398 Ga0307405_10022858 3300031731 Bacteria 3543
399 Ga0307413_10015166 3300031824 Bacteria 3941
400 Ga0307413_10020869 3300031824 Bacteria 3495
401 Ga0307410_10000140 3300031852 Bacteria 25566
402 Ga0307410_10000908 3300031852 Bacteria 12622
403 Ga0307406_10000083 3300031901 Bacteria 52941
404 Ga0307406_10004620 3300031901 Bacteria 7495
405 Ga0307406_10015517 3300031901 Bacteria 4410
406 Ga0307406_10110650 3300031901 Bacteria 1890
407 Ga0307407_10006883 3300031903 Bacteria 5103
408 Ga0307407_10046652 3300031903 Bacteria 2454
409 Ga0307412_10153795 3300031911 Bacteria 1700
410 Ga0307409_100018937 3300031995 Bacteria 4646
411 Ga0307409_100021231 3300031995 Bacteria 4448
412 Ga0307409_100058000 3300031995 Bacteria 3004
413 Ga0307409_100063219 3300031995 Bacteria 2902
414 Ga0307409_100097021 3300031995 Bacteria 2433
415 Ga0307409_100195829 3300031995 Bacteria 1803
416 Ga0307416_100000105 3300032002 Bacteria 51970
417 Ga0307416_100015187 3300032002 Bacteria 5307
418 Ga0307416_100023950 3300032002 Bacteria 4443
419 Ga0307416_100030001 3300032002 Bacteria 4074
420 Ga0307416_100046883 3300032002 Bacteria 3415
421 Ga0307416_100091909 3300032002 Bacteria 2608
422 Ga0307414_10016780 3300032004 Bacteria 4463
423 Ga0307414_10067493 3300032004 Bacteria 2562
424 Ga0307415_100000023 3300032126 Bacteria 64440
425 Ga0307415_100003368 3300032126 Bacteria 8125
426 Ga0307415_100005815 3300032126 Bacteria 6592
427 Ga0307415_100009190 3300032126 Bacteria 5523
428 Ga0307415_100022541 3300032126 Bacteria 3888
429 Ga0307415_100129715 3300032126 Bacteria 1906
430 Ga0307510_10019969 3300033180 Bacteria 7846
431 Ga0316214_1001083 3300033545 Bacteria 3051
432 Ga0373948_0001069 3300034817 Bacteria 3702
433 Ga0373959_0003579 3300034820 Bacteria 2484
434 Ga0373926_0002255 3300035083 Bacteria 6092
435 Ga0373926_0012223 3300035083 Bacteria 2901
436 Ga0373928_0004612 3300035084 Bacteria 2626
437 Ga0373929_0010019 3300035085 Bacteria 1765
438 Ga0373934_0000014 3300035086 Bacteria 59312
439 Ga0373934_0009476 3300035086 Bacteria 3647
440 Ga0373934_0025439 3300035086 Bacteria 2292
441 Ga0373940_0010822 3300035088 Bacteria 2154
442 Ga0373944_0025121 3300035089 Bacteria 1751
443 Ga0373951_0004369 3300035091 Bacteria 3362
444 Ga0373923_0001958 3300035111 Bacteria 6175
445 Ga0373923_0014154 3300035111 Bacteria 2991
446 Ga0373936_0001017 3300035113 Bacteria 10032
447 Ga0373936_0002279 3300035113 Bacteria 7180
448 Ga0373936_0008667 3300035113 Bacteria 3829
449 Ga0373936_0046490 3300035113 Bacteria 1750
450 Ga0373936_0055803 3300035113 Bacteria 1604
451 Ga0373941_0018192 3300035115 Bacteria 1938
452 Ga0373945_0002858 3300035116 Bacteria 5427
453 Ga0373953_0027623 3300035117 Bacteria 2182
454 Ga0373954_0001669 3300035118 Bacteria 9091
455 Ga0373954_0009727 3300035118 Bacteria 4234
456 Ga0373954_0019931 3300035118 Bacteria 3028
457 Ga0373954_0025588 3300035118 Bacteria 2699
458 Ga0373956_0001414 3300035119 Bacteria 9923
459 Ga0373956_0011823 3300035119 Bacteria 3604
460 Ga0373956_0017976 3300035119 Bacteria 2989
461 Ga0373957_0000846 3300035120 Bacteria 8012
462 Ga0373957_0011733 3300035120 Bacteria 2932
463 Ga0373960_0014572 3300035121 Bacteria 1994
464 Ga0373943_0004220 3300035170 Bacteria 6518
465 Ga0373946_0001758 3300035171 Bacteria 7554
466 Ga0373946_0019534 3300035171 Bacteria 2611
467 Ga0373955_0000040 3300035172 Bacteria 51762
468 Ga0373955_0003711 3300035172 Bacteria 6721
469 Ga0373955_0027763 3300035172 Bacteria 2929
470 Ga0373962_0003761 3300035242 Bacteria 3650
471 Ga0316574_0007389 3300035398 Bacteria 6024
472 Ga0316574_0023970 3300035398 Bacteria 3648
473 Ga0316574_0040647 3300035398 Bacteria 2864
474 Ga0316574_0109968 3300035398 Bacteria 1766
475 Ga0373924_0001593 3300035410 Bacteria 7428
476 Ga0373924_0006313 3300035410 Bacteria 4240
477 Ga0373924_0036883 3300035410 Bacteria 1988
478 Ga0373935_0001435 3300035692 Bacteria 13201
479 Ga0373935_0016107 3300035692 Bacteria 4523
480 Ga0373935_0046237 3300035692 Bacteria 2748
481 Ga0373935_0056355 3300035692 Bacteria 2505
482 Ga0373935_0113598 3300035692 Bacteria 1800
483 Ga0373927_0009751 3300035695 Bacteria 6438
484 Ga0373933_0000085 3300035724 Bacteria 59115
485 Ga0373933_0010236 3300035724 Bacteria 5137
486 Ga0373933_0013165 3300035724 Bacteria 4581
487 Ga0373933_0017976 3300035724 Bacteria 3971
488 Ga0373933_0056954 3300035724 Bacteria 2347
489 Ga0373947_0000195 3300035725 Bacteria 33609
490 Ga0373947_0001660 3300035725 Bacteria 13615
491 Ga0373937_0000197 3300036401 Bacteria 59124
492 Ga0373937_0021787 3300036401 Bacteria 5752
493 Ga0373937_0034956 3300036401 Bacteria 4571
494 Ga0373937_0036313 3300036401 Bacteria 4490
495 Ga0373937_0040007 3300036401 Bacteria 4273
496 Ga0373937_0064398 3300036401 Bacteria 3371
497 Ga0373937_0164179 3300036401 Bacteria 2082
498 Ga0373937_0226602 3300036401 Bacteria 1759
499 Ga0373937_0272978 3300036401 Bacteria 1596
500 Ga0316582_0065993 3300036647 Bacteria 2332
501 Ga0316584_0011739 3300036712 Bacteria 6165
502 Ga0373925_0000030 3300037068 Bacteria 146196
503 Ga0373925_0007451 3300037068 Bacteria 7984
504 Ga0373925_0018348 3300037068 Bacteria 5085
505 Ga0373925_0052094 3300037068 Bacteria 3057
506 Ga0373925_0057493 3300037068 Bacteria 2914
507 Ga0373925_0084538 3300037068 Bacteria 2418
508 Ga0373925_0165333 3300037068 Bacteria 1744
509 Ga0395899_0002958 3300037312 Bacteria 13596
510 Ga0395900_0044150 3300037418 Bacteria 4594
511 Ga0395900_0099741 3300037418 Bacteria 2983
512 Ga0395898_0029283 3300037466 Bacteria 5517
513 Ga0395898_0123567 3300037466 Bacteria 2480
514 Ga0436364_0303129 3300037853 Bacteria 102080
515 Ga0436364_0875353 3300037853 Bacteria 55373
516 Ga0436364_1024480 3300037853 Bacteria 3104
517 Ga0436364_1109480 3300037853 Bacteria 2292
518 Ga0436364_1394034 3300037853 Bacteria 5606
519 Ga0395901_0085159 3300038443 Bacteria 3304
520 Ga0400483_062358 3300039062 Bacteria 16680
521 Ga0400483_276618 3300039062 Bacteria 37892
522 Ga0436365_0313897 3300039437 Bacteria 1673
523 Ga0436365_0557859 3300039437 Bacteria 4607
524 Ga0436365_0613236 3300039437 Bacteria 5826
525 Ga0436365_1288165 3300039437 Bacteria 2284
526 Ga0436363_1583056 3300039450 Bacteria 2977
527 Ga0436362_1219176 3300039453 Bacteria 1793
528 Ga0451791_0846982 3300041451 Bacteria 11622
529 Ga0439463_001655 3300042016 Bacteria 5875
530 Ga0439463_016883 3300042016 Bacteria 1806
531 Ga0451577_0000624 3300042876 Bacteria 56728
532 Ga0451577_0001084 3300042876 Bacteria 38968
533 Ga0439440_0012997 3300042993 Bacteria 1779
534 Ga0466969_0023091 3300044656 Bacteria 3207
535 Ga0466972_0045465 3300044658 Bacteria 2128
536 Ga0466966_0036482 3300044684 Bacteria 3174
537 Ga0466966_0052233 3300044684 Bacteria 2597
538 Ga0466966_0122180 3300044684 Bacteria 1599
539 Ga0466961_0005237 3300044693 Bacteria 8166
540 Ga0466961_0011992 3300044693 Bacteria 5540
541 Ga0466961_0035801 3300044693 Bacteria 3187
542 Ga0466961_0038381 3300044693 Bacteria 3072
543 Ga0466961_0053307 3300044693 Bacteria 2581
544 Ga0466961_0053848 3300044693 Bacteria 2567
545 Ga0466961_0075470 3300044693 Bacteria 2137
546 Ga0466961_0096522 3300044693 Bacteria 1864
547 Ga0466963_0000272 3300044694 Bacteria 22996
548 Ga0466963_0003348 3300044694 Bacteria 9150
549 Ga0466963_0008490 3300044694 Bacteria 6158
550 Ga0466963_0022711 3300044694 Bacteria 3976
551 Ga0466963_0031049 3300044694 Bacteria 3451
552 Ga0466963_0062369 3300044694 Bacteria 2493
553 Ga0466963_0076038 3300044694 Bacteria 2267
554 Ga0466963_0117065 3300044694 Bacteria 1832
555 Ga0466963_0126740 3300044694 Bacteria 1760
556 Ga0466963_0135177 3300044694 Bacteria 1706
557 Ga0466963_0149382 3300044694 Bacteria 1622
558 Ga0453684_0001802 3300044712 Bacteria 56876
559 Ga0466971_0002592 3300044719 Bacteria 7645
560 Ga0466971_0009865 3300044719 Bacteria 4170
561 Ga0466970_0000947 3300044765 Bacteria 14017
562 Ga0466959_0032930 3300045049 Bacteria 3836
563 Ga0466959_0062991 3300045049 Bacteria 2694
564 Ga0466958_0002261 3300045836 Bacteria 9596
565 Ga0466958_0003632 3300045836 Bacteria 8045
566 Ga0466958_0037231 3300045836 Bacteria 2915
567 Ga0466958_0065329 3300045836 Bacteria 2220
568 Ga0466958_0107708 3300045836 Bacteria 1738
569 Ga0466967_0022738 3300045976 Bacteria 5124
570 Ga0466967_0029542 3300045976 Bacteria 4589
571 Ga0466967_0031995 3300045976 Bacteria 4437
572 Ga0466967_0036785 3300045976 Bacteria 4183
573 Ga0466967_0045535 3300045976 Bacteria 3812
574 Ga0466967_0062388 3300045976 Bacteria 3308
575 Ga0466967_0101325 3300045976 Bacteria 2632
576 Ga0466967_0197789 3300045976 Bacteria 1902
577 Ga0495592_0000157 3300046454 Bacteria 59697
578 Ga0495592_0007215 3300046454 Bacteria 8325
579 Ga0495592_0033680 3300046454 Bacteria 3863
580 Ga0495592_0042356 3300046454 Bacteria 3409
581 Ga0495603_0013090 3300046455 Bacteria 5014
582 Ga0495603_0020408 3300046455 Bacteria 4015
583 Ga0495590_0000484 3300046457 Bacteria 19640
584 Ga0495629_0001111 3300046459 Bacteria 21303
585 Ga0495629_0004740 3300046459 Bacteria 10187
586 Ga0495629_0014332 3300046459 Bacteria 5704
587 Ga0495629_0022043 3300046459 Bacteria 4542
588 Ga0495629_0067606 3300046459 Bacteria 2493
589 Ga0495629_0109388 3300046459 Bacteria 1927
590 Ga0495641_0008500 3300046461 Bacteria 6245
591 Ga0495641_0035794 3300046461 Bacteria 2336
592 Ga0495641_0053637 3300046461 Bacteria 1833
593 Ga0495651_0000115 3300046462 Bacteria 59129
594 Ga0495651_0005863 3300046462 Bacteria 9370
595 Ga0495651_0006516 3300046462 Bacteria 8919
596 Ga0495651_0029499 3300046462 Bacteria 4278
597 Ga0495651_0053844 3300046462 Bacteria 3096
598 Ga0495651_0087535 3300046462 Bacteria 2342
599 Ga0495653_0009912 3300046463 Bacteria 7792
600 Ga0495653_0017549 3300046463 Bacteria 5819
601 Ga0495653_0024574 3300046463 Bacteria 4853
602 Ga0495653_0033132 3300046463 Bacteria 4095
603 Ga0495653_0052520 3300046463 Bacteria 3123
604 Ga0495653_0055578 3300046463 Bacteria 3020
605 Ga0495653_0056416 3300046463 Bacteria 2994
606 Ga0495653_0101832 3300046463 Bacteria 2079
607 Ga0495650_0005298 3300046471 Bacteria 8439
608 Ga0495580_0009545 3300046472 Bacteria 7625
609 Ga0495580_0055321 3300046472 Bacteria 2797
610 Ga0495582_0003495 3300046473 Bacteria 8852
611 Ga0495582_0004371 3300046473 Bacteria 7949
612 Ga0495639_0013157 3300046475 Bacteria 3570
613 Ga0495639_0037627 3300046475 Bacteria 2169
614 Ga0495662_0033900 3300046476 Bacteria 2466
615 Ga0495662_0043070 3300046476 Bacteria 2179
616 Ga0495664_0006176 3300046477 Bacteria 6615
617 Ga0495664_0030935 3300046477 Bacteria 3136
618 Ga0495664_0034817 3300046477 Bacteria 2963
619 Ga0495664_0109951 3300046477 Bacteria 1663
620 Ga0495585_0024459 3300046492 Bacteria 3463
621 Ga0495594_0000581 3300046499 Bacteria 18807
622 Ga0495608_0003716 3300046511 Bacteria 10963
623 Ga0495608_0007490 3300046511 Bacteria 7706
624 Ga0495608_0011618 3300046511 Bacteria 6127
625 Ga0495608_0033917 3300046511 Bacteria 3446
626 Ga0495618_0045353 3300046514 Bacteria 2773
627 Ga0495628_0000492 3300046516 Bacteria 36145
628 Ga0495628_0005799 3300046516 Bacteria 10819
629 Ga0495628_0020582 3300046516 Bacteria 5439
630 Ga0495630_0040719 3300046517 Bacteria 3472
631 Ga0495630_0176475 3300046517 Bacteria 1628
632 Ga0495648_0018440 3300046524 Bacteria 4939
633 Ga0495666_0009549 3300046526 Bacteria 4847
634 Ga0495652_0007274 3300046529 Bacteria 10216
635 Ga0495652_0014633 3300046529 Bacteria 7034
636 Ga0495652_0041679 3300046529 Bacteria 3961
637 Ga0495652_0043329 3300046529 Bacteria 3877
638 Ga0495640_0013371 3300046533 Bacteria 6236
639 Ga0495640_0021822 3300046533 Bacteria 4690
640 Ga0495640_0038134 3300046533 Bacteria 3381
641 Ga0495640_0076101 3300046533 Bacteria 2240
642 Ga0495640_0088756 3300046533 Bacteria 2043
643 Ga0495640_0095927 3300046533 Bacteria 1951
644 Ga0495586_0057385 3300046535 Bacteria 2112
645 Ga0495587_0000123 3300046536 Bacteria 59101
646 Ga0495587_0016217 3300046536 Bacteria 4637
647 Ga0495587_0032473 3300046536 Bacteria 3156
648 Ga0495645_0014230 3300046543 Bacteria 5643
649 Ga0495645_0039166 3300046543 Bacteria 3457
650 Ga0495645_0043089 3300046543 Bacteria 3292
651 Ga0495622_0019863 3300046557 Bacteria 3127
652 Ga0495667_0000107 3300046559 Bacteria 60366
653 Ga0495667_0007253 3300046559 Bacteria 7522
654 Ga0495667_0018130 3300046559 Bacteria 4755
655 Ga0495667_0019013 3300046559 Bacteria 4636
656 Ga0495667_0019310 3300046559 Bacteria 4599
657 Ga0495667_0020842 3300046559 Bacteria 4424
658 Ga0495667_0037158 3300046559 Bacteria 3246
659 Ga0495634_0020569 3300046642 Bacteria 4678
660 Ga0495634_0034159 3300046642 Bacteria 3490
661 Ga0495634_0049820 3300046642 Bacteria 2814
662 Ga0495634_0085558 3300046642 Bacteria 2054
663 Ga0495611_0016203 3300046648 Bacteria 3186
664 Ga0495635_0012621 3300046663 Bacteria 5924
665 Ga0495635_0014442 3300046663 Bacteria 5524
666 Ga0495635_0039605 3300046663 Bacteria 3259
667 Ga0495635_0068273 3300046663 Bacteria 2439
668 Ga0495635_0070122 3300046663 Bacteria 2402
669 Ga0495657_0000169 3300046675 Bacteria 59112
670 Ga0495657_0012881 3300046675 Bacteria 6194
671 Ga0495657_0017135 3300046675 Bacteria 5265
672 Ga0495657_0030266 3300046675 Bacteria 3793
673 Ga0495657_0060865 3300046675 Bacteria 2499
674 Ga0495657_0063226 3300046675 Bacteria 2442
675 Ga0495657_0077837 3300046675 Bacteria 2150
676 Ga0495599_0002521 3300046678 Bacteria 10653
677 Ga0495599_0008323 3300046678 Bacteria 6307
678 Ga0495599_0035014 3300046678 Bacteria 3152
679 Ga0495599_0050775 3300046678 Bacteria 2598
680 Ga0495623_0009785 3300046679 Bacteria 6215
681 Ga0495623_0033496 3300046679 Bacteria 3296
682 Ga0495623_0050466 3300046679 Bacteria 2634
683 Ga0495623_0054254 3300046679 Bacteria 2529
684 Ga0495646_0042668 3300046680 Bacteria 2782
685 Ga0495646_0054052 3300046680 Bacteria 2417
686 Ga0495646_0062104 3300046680 Bacteria 2222
687 Ga0495658_0007742 3300046683 Bacteria 5323
688 Ga0495658_0051082 3300046683 Bacteria 2341
689 Ga0495613_0015671 3300046689 Bacteria 5641
690 Ga0495613_0032000 3300046689 Bacteria 3907
691 Ga0495613_0040997 3300046689 Bacteria 3429
692 Ga0495613_0088773 3300046689 Bacteria 2240
693 Ga0495624_0030943 3300046690 Bacteria 3484
694 Ga0495624_0034495 3300046690 Bacteria 3272
695 Ga0495624_0034767 3300046690 Bacteria 3257
696 Ga0495624_0091681 3300046690 Bacteria 1874
697 Ga0495600_0009464 3300046809 Bacteria 6020
698 Ga0495600_0011208 3300046809 Bacteria 5585
699 Ga0495600_0014018 3300046809 Bacteria 5049
700 Ga0495600_0020085 3300046809 Bacteria 4272
701 Ga0495600_0028753 3300046809 Bacteria 3597
702 Ga0495600_0029305 3300046809 Bacteria 3563
703 Ga0495581_0006780 3300047315 Bacteria 6638
704 Ga0495581_0055827 3300047315 Bacteria 2279
705 Ga0495604_0000161 3300047317 Bacteria 59093
706 Ga0495604_0002557 3300047317 Bacteria 14546
707 Ga0495604_0009103 3300047317 Bacteria 7857
708 Ga0495604_0011992 3300047317 Bacteria 6890
709 Ga0495604_0012311 3300047317 Bacteria 6800
710 Ga0495604_0043812 3300047317 Bacteria 3500
711 Ga0495604_0106234 3300047317 Bacteria 2054
712 Ga0495674_0012623 3300047319 Bacteria 7960
713 Ga0495674_0053199 3300047319 Bacteria 3560
714 Ga0495674_0135608 3300047319 Bacteria 2071
715 Ga0495676_0005210 3300047321 Bacteria 11893
716 Ga0495676_0020253 3300047321 Bacteria 5841
717 Ga0495676_0030823 3300047321 Bacteria 4544
718 Ga0495676_0046854 3300047321 Bacteria 3503
719 Ga0495676_0083475 3300047321 Bacteria 2414
720 Ga0495680_0004695 3300047322 Bacteria 13009
721 Ga0495680_0007013 3300047322 Bacteria 10389
722 Ga0495680_0023511 3300047322 Bacteria 5122
723 Ga0495680_0040898 3300047322 Bacteria 3689
724 Ga0495680_0046760 3300047322 Bacteria 3409
725 Ga0495687_003567 3300047443 Bacteria 11164
726 Ga0495675_0002978 3300047444 Bacteria 10167
727 Ga0495675_0007679 3300047444 Bacteria 6652
728 Ga0495675_0007682 3300047444 Bacteria 6651
729 Ga0495675_0010155 3300047444 Bacteria 5871
730 Ga0495675_0011761 3300047444 Bacteria 5499
731 Ga0495685_017124 3300047447 Bacteria 2480
732 Ga0495684_0002750 3300047471 Bacteria 13905
733 Ga0495684_0002944 3300047471 Bacteria 13416
734 Ga0495684_0006983 3300047471 Bacteria 8768
735 Ga0495684_0052798 3300047471 Bacteria 3101
736 Ga0495684_0055420 3300047471 Bacteria 3023
737 Ga0495684_0062697 3300047471 Bacteria 2827
738 Ga0495593_0015283 3300047673 Bacteria 4351
739 Ga0495593_0023848 3300047673 Bacteria 3395
740 Ga0495593_0049092 3300047673 Bacteria 2240
741 Ga0495602_0000182 3300048088 Bacteria 59124
742 Ga0495602_0038715 3300048088 Bacteria 4403
743 Ga0495602_0041925 3300048088 Bacteria 4175
744 Ga0495602_0043021 3300048088 Bacteria 4110
745 Ga0495602_0049803 3300048088 Bacteria 3748
746 Ga0495602_0076720 3300048088 Bacteria 2830
747 Ga0495614_0037738 3300048089 Bacteria 2073
748 Ga0496101_0047351 3300048904 Bacteria 3086
749 Ga0496101_0061554 3300048904 Bacteria 2726
750 Ga0496102_0013379 3300048905 Bacteria 7107
751 Ga0496102_0065703 3300048905 Bacteria 3325
752 Ga0496102_0124101 3300048905 Bacteria 2413
753 Ga0496102_0199975 3300048905 Bacteria 1883
754 Ga0496103_0002735 3300048906 Bacteria 11006
755 Ga0496103_0013447 3300048906 Bacteria 4854
756 Ga0496104_0012811 3300048907 Bacteria 7552
757 Ga0496104_0016531 3300048907 Bacteria 6704
758 Ga0496104_0104429 3300048907 Bacteria 2715
759 Ga0496104_0133039 3300048907 Bacteria 2389
760 Ga0496104_0135243 3300048907 Bacteria 2368
761 Ga0496105_0001730 3300048908 Bacteria 15611
762 Ga0496105_0002855 3300048908 Bacteria 12645
763 Ga0496105_0023038 3300048908 Bacteria 5049
764 Ga0496106_0014818 3300048909 Bacteria 5764
765 Ga0496107_0032783 3300048910 Bacteria 3714
766 Ga0496108_0002365 3300048911 Bacteria 15107
767 Ga0496108_0008143 3300048911 Bacteria 8501
768 Ga0496108_0089477 3300048911 Bacteria 2616
769 Ga0496108_0114941 3300048911 Bacteria 2304
770 Ga0496108_0117891 3300048911 Bacteria 2275
771 Ga0496109_0012022 3300048912 Bacteria 7455
772 Ga0496109_0035580 3300048912 Bacteria 4493
773 Ga0496109_0062801 3300048912 Bacteria 3397
774 Ga0496110_0003627 3300048913 Bacteria 11876
775 Ga0496110_0018756 3300048913 Bacteria 5805
776 Ga0496110_0090641 3300048913 Bacteria 2733
777 Ga0496111_0039696 3300048914 Bacteria 3377
778 Ga0496112_0019138 3300048915 Bacteria 6456
779 Ga0496112_0044614 3300048915 Bacteria 4345
780 Ga0496112_0048961 3300048915 Bacteria 4141
781 Ga0496113_0007107 3300048916 Bacteria 7166
782 Ga0496113_0056171 3300048916 Bacteria 2954
783 Ga0496114_0008348 3300048917 Bacteria 8205
784 Ga0496114_0012039 3300048917 Bacteria 6920
785 Ga0496114_0055285 3300048917 Bacteria 3311
786 Ga0496114_0070842 3300048917 Bacteria 2929
787 Ga0496114_0113931 3300048917 Bacteria 2318
788 Ga0496115_0014904 3300048918 Bacteria 5894
789 Ga0496115_0029372 3300048918 Bacteria 4318
790 Ga0496116_0000165 3300048919 Bacteria 133688
791 Ga0496117_0002355 3300048920 Bacteria 24155
792 Ga0496117_0007254 3300048920 Bacteria 10896
793 Ga0496118_0004719 3300048921 Bacteria 15955
794 Ga0496118_0009080 3300048921 Bacteria 10128
795 Ga0496119_0000375 3300048922 Bacteria 61774
796 Ga0496119_0003013 3300048922 Bacteria 17835
797 Ga0496119_0010507 3300048922 Bacteria 7781
798 Ga0496119_0010538 3300048922 Bacteria 7761
799 Ga0496120_0000453 3300048923 Bacteria 64868
800 Ga0496120_0004273 3300048923 Bacteria 12140
801 Ga0496120_0011458 3300048923 Bacteria 6095
802 Ga0496121_0043764 3300048924 Bacteria 3872
803 Ga0496121_0047048 3300048924 Bacteria 3684
804 Ga0496126_0000676 3300048929 Bacteria 62750
805 Ga0496126_0027059 3300048929 Bacteria 5487
806 Ga0496126_0072013 3300048929 Bacteria 3075
807 Ga0496126_0107474 3300048929 Bacteria 2433
808 Ga0496126_0110630 3300048929 Bacteria 2393
809 Ga0496126_0113416 3300048929 Bacteria 2359
810 Ga0501031_0000714 3300049568 Bacteria 19874
811 Ga0501031_0006968 3300049568 Bacteria 7382
812 Ga0501031_0050578 3300049568 Bacteria 2707
813 Ga0501031_0103648 3300049568 Bacteria 1856
814 Ga0501032_0003502 3300049569 Bacteria 11993
815 Ga0501032_0005443 3300049569 Bacteria 9450
816 Ga0501032_0013867 3300049569 Bacteria 5717
817 Ga0501032_0061848 3300049569 Bacteria 2510
818 Ga0501032_0078279 3300049569 Bacteria 2201
819 Ga0501033_0006257 3300049570 Bacteria 9329
820 Ga0501033_0009672 3300049570 Bacteria 7414
821 Ga0501033_0055904 3300049570 Bacteria 2917
822 Ga0501033_0067622 3300049570 Bacteria 2627
823 Ga0501033_0072890 3300049570 Bacteria 2521
824 Ga0501033_0142363 3300049570 Bacteria 1733
825 Ga0501034_0004843 3300049571 Bacteria 14867
826 Ga0501034_0005064 3300049571 Bacteria 14478
827 Ga0501034_0011314 3300049571 Bacteria 9256
828 Ga0501034_0097032 3300049571 Bacteria 2943
829 Ga0501036_0010884 3300049572 Bacteria 7517
830 Ga0501036_0019934 3300049572 Bacteria 5630
831 Ga0501036_0237999 3300049572 Bacteria 1527
832 Ga0501037_0008312 3300049573 Bacteria 7606
833 Ga0501037_0016986 3300049573 Bacteria 5355
834 Ga0501037_0023492 3300049573 Bacteria 4559
835 Ga0501037_0063487 3300049573 Bacteria 2692
836 Ga0501038_0013926 3300049574 Bacteria 7330
837 Ga0501038_0123120 3300049574 Bacteria 2136
838 Ga0501038_0209504 3300049574 Bacteria 1560
839 Ga0501039_0002152 3300049575 Bacteria 14572
840 Ga0501039_0072978 3300049575 Bacteria 2667
841 Ga0501039_0109760 3300049575 Bacteria 2156
842 Ga0501040_0143173 3300049576 Bacteria 1684
843 Ga0501041_0121650 3300049577 Bacteria 1622
844 Ga0501042_0023401 3300049578 Bacteria 4323
845 Ga0501042_0045990 3300049578 Bacteria 3111
846 Ga0501043_0002910 3300049579 Bacteria 14293
847 Ga0501043_0034256 3300049579 Bacteria 3994
848 Ga0501043_0047789 3300049579 Bacteria 3364
849 Ga0501046_0000046 3300049580 Bacteria 144066
850 Ga0501046_0001735 3300049580 Bacteria 20794
851 Ga0501046_0005551 3300049580 Bacteria 11269
852 Ga0501046_0038992 3300049580 Bacteria 3808
853 Ga0501046_0050421 3300049580 Bacteria 3288
854 Ga0501046_0082200 3300049580 Bacteria 2488
855 Ga0501047_0000268 3300049581 Bacteria 60315
856 Ga0501047_0002183 3300049581 Bacteria 18725
857 Ga0501047_0008059 3300049581 Bacteria 9941
858 Ga0501047_0025578 3300049581 Bacteria 5675
859 Ga0501047_0033406 3300049581 Bacteria 4965
860 Ga0501047_0163413 3300049581 Bacteria 2098
861 Ga0501048_0002880 3300049582 Bacteria 13123
862 Ga0501048_0026207 3300049582 Bacteria 4244
863 Ga0501048_0068208 3300049582 Bacteria 2513
864 Ga0501068_0049315 3300049584 Bacteria 2542
865 Ga0501068_0075529 3300049584 Bacteria 2062
866 Ga0501069_0006022 3300049585 Bacteria 6328
867 Ga0501070_0022144 3300049586 Bacteria 5323
868 Ga0501070_0029658 3300049586 Bacteria 4584
869 Ga0501070_0064642 3300049586 Bacteria 3029
870 Ga0501073_0015061 3300049589 Bacteria 5609
871 Ga0501073_0024223 3300049589 Bacteria 4358
872 Ga0501074_0001157 3300049590 Bacteria 17270
873 Ga0501074_0073476 3300049590 Bacteria 2456
874 Ga0501074_0152253 3300049590 Bacteria 1653
875 Ga0501076_0112428 3300049592 Bacteria 2202
876 Ga0501079_0003055 3300049741 Bacteria 12245
877 Ga0501079_0111706 3300049741 Bacteria 2124
878 Ga0501080_0001035 3300049742 Bacteria 22914
879 Ga0501080_0016596 3300049742 Bacteria 6802
880 Ga0501083_0152203 3300049744 Bacteria 1515
881 Ga0501035_0014942 3300049822 Bacteria 7164
882 Ga0501035_0020279 3300049822 Bacteria 6103
883 Ga0501035_0024157 3300049822 Bacteria 5576
884 Ga0501035_0234920 3300049822 Bacteria 1561
885 Ga0501044_0001019 3300049823 Bacteria 33719
886 Ga0501044_0005882 3300049823 Bacteria 13589
887 Ga0501044_0011020 3300049823 Bacteria 9811
888 Ga0501044_0017181 3300049823 Bacteria 7761
889 Ga0501044_0021124 3300049823 Bacteria 6950
890 Ga0501044_0043045 3300049823 Bacteria 4692
891 Ga0501044_0045566 3300049823 Bacteria 4543
892 Ga0501044_0066591 3300049823 Bacteria 3672
893 Ga0501044_0068391 3300049823 Bacteria 3618
894 Ga0501044_0091273 3300049823 Bacteria 3072
895 Ga0501044_0102696 3300049823 Bacteria 2874
896 Ga0501044_0173627 3300049823 Bacteria 2125
897 Ga0501045_0141461 3300049824 Bacteria 1789
898 nmdc:mga00v17_39789_c1 3300050491 Bacteria 2817
899 nmdc:mga00v17_8489_c1 3300050491 Bacteria 5528
900 nmdc:mga07m45_29369_c1 3300050496 Bacteria 3040
901 nmdc:mga05p37_11899_c1 3300050507 Bacteria 10376
902 nmdc:mga05p37_9076_c1 3300050507 Bacteria 11754
903 nmdc:mga0qj67_695_c1 3300050509 Bacteria 22912
904 nmdc:mga06r32_294003_c1 3300050510 Bacteria 1611
905 nmdc:mga08y16_155725_c1 3300050511 Bacteria 2375
906 nmdc:mga08y16_5523_c1 3300050511 Bacteria 13234
907 nmdc:mga0n895_207316_c1 3300050512 Bacteria 1991
908 nmdc:mga0n895_4481_c1 3300050512 Bacteria 11480
909 nmdc:mga0rr50_10842_c1 3300050513 Bacteria 5810
910 nmdc:mga0rr50_16896_c1 3300050513 Bacteria 4859
911 nmdc:mga08x19_6337_c1 3300050514 Bacteria 7007
912 nmdc:mga0a205_1359_c1 3300050515 Bacteria 20623
913 Ga0495601_0027111 3300053077 Bacteria 3541
914 Ga0495612_0033808 3300053078 Bacteria 2069
915 Ga0495595_0006267 3300053084 Bacteria 4845
916 Ga0495595_0032638 3300053084 Bacteria 2345
917 Ga0495619_0009436 3300053085 Bacteria 6155
918 Ga0495619_0047753 3300053085 Bacteria 2820
919 Ga0495619_0057561 3300053085 Bacteria 2579
920 Ga0495619_0160847 3300053085 Bacteria 1551
921 Ga0500614_017827 3300053123 Bacteria 1609
922 Ga0500568_0002651 3300053139 Bacteria 10388
923 Ga0500568_0003582 3300053139 Bacteria 8575
924 Ga0500573_0004254 3300053140 Bacteria 7502
925 Ga0500573_0079129 3300053140 Bacteria 1870
926 Ga0500616_0000071 3300053153 Bacteria 232527
927 Ga0500616_0000643 3300053153 Bacteria 42016
928 Ga0500620_000387 3300053155 Bacteria 8152
929 Ga0501082_0092669 3300060353 Bacteria 2610
930 Ga0466962_0024949 3300061719 Bacteria 2871
931 Ga0530510_0018512 3300061734 Bacteria 4938
932 2689991649 2687453743 Bacteria 8361025
933 2506867831 2506783011 Bacteria 5323186
934 2508678196 2508501039 Bacteria 9978592
935 2515718917 2515154129 Bacteria 5584369
936 2517759690 2517572101 Bacteria 6884336
937 2528205552 2527291627 Bacteria 5309833
938 2528214971 2527291629 Bacteria 5267418
939 2546950329 2546825537 Bacteria 5389291
940 2554259473 2554235005 Bacteria 6457341
941 2579750245 2576861822 Bacteria 5004595
942 2579856476 2579778521 Bacteria 7624758
943 2583153418 2582580736 Bacteria 5325865
944 2585302007 2582581312 Bacteria 7308206
945 2585303625 2582581313 Bacteria 10042643
946 2616900753 2616644941 Bacteria 8510691
947 2619858078 2619618881 Bacteria 7521104
948 2620352617 2619619003 Bacteria 7619552
949 2623501120 2622736605 Bacteria 4992138
950 2626639666 2626541554 Bacteria 7741902
951 2643904554 2643221578 Bacteria 9213798
952 2644183855 2643221632 Bacteria 3406696
953 2644198588 2643221635 Bacteria 2632343
954 2644406180 2643221673 Bacteria 9196637
955 2644611656 2643221711 Bacteria 4865335
956 2671839071 2671180195 Bacteria 9757215
957 2676201709 2675902999 Bacteria 9438463
958 2676476048 2675903058 Bacteria 6822861
959 2686537796 2684623035 Bacteria 8032739
960 2686543135 2684623036 Bacteria 5199090
961 2689956222 2687453737 Bacteria 11203906
962 2710603811 2710264753 Bacteria 5455564
963 2731907034 2731639228 Bacteria 4187555
964 2774846285 2773857921 Bacteria 9435764
965 2774857227 2773857922 Bacteria 9757215
966 2774866102 2773857924 Bacteria 5256821
967 2774904259 2773857933 Bacteria 5818019
968 2784586819 2784132148 Bacteria 8627943
969 2786668276 2786546132 Bacteria 10419719
970 2793983468 2791355406 Bacteria 11364898
971 2795797751 2795385472 Bacteria 6627535
972 2799183911 2799112218 Bacteria 4315149
973 2809227057 2808606447 Bacteria 3572005
974 2809230385 2808606448 Bacteria 8656184
975 2811847039 2808606982 Bacteria 7791042
976 2819427960 2818991318 Bacteria 5266538
977 2827630610 2827628540 Bacteria 6858585
978 2852633557 2852632344 Bacteria 3463163
979 2856742490 2856741275 Bacteria 8096094
980 2857733593 2857729791 Bacteria 4040535
981 2861527630 2861520306 Bacteria 8348283
982 2862186184 2862178590 Bacteria 8583590
983 2862295316 2862290372 Bacteria 7471434
984 2862295562 2862290372 Bacteria 7471434
985 2866557123 2866552031 Bacteria 5824618
986 2866618212 2866612099 Bacteria 7543886
987 2867429806 2867428634 Bacteria 9590268
988 2867480855 2867475112 Bacteria 6909112
989 2873157616 2873151551 Bacteria 8625867
990 2873319326 2873314349 Bacteria 8512634
991 2875392760 2875391855 Bacteria 7600475
992 2877683318 2877676314 Bacteria 9512378
993 2891403605 2891395885 Bacteria 9251614
994 2891556140 2891554331 Bacteria 8812224
995 2891563883 2891562705 Bacteria 8039471
996 2895662796 2895660088 Bacteria 3782833
997 2895888740 2895880812 Bacteria 11255272
998 2897564754 2897561785 Bacteria 3256946
999 2912758958 2912757875 Bacteria 7940295
1000 2918502588 2918501144 Bacteria 8668083
1001 2919057288 2919055335 Bacteria 3875751
1002 2919472120 2919468124 Bacteria 9133025
1003 2928124606 2928121344 Bacteria 3972376
1004 2939663718 2939660829 Bacteria 3784848
1005 2946051955 2946045630 Bacteria 8527308
1006 2954011002 2954002825 Bacteria 9173742
1007 2954699354 2954691527 Bacteria 10720516
1008 2954702865 2954701450 Bacteria 10834262
1009 2954718296 2954711539 Bacteria 10867210
1010 2954728266 2954721474 Bacteria 10456478
1011 2954733544 2954731030 Bacteria 10243860
1012 2954747160 2954740390 Bacteria 10229294
1013 2954752427 2954749733 Bacteria 10366972
1014 2954766273 2954759201 Bacteria 9358192
1015 2966604316 2966598605 Bacteria 7676064
1016 2997605606 2997600082 Bacteria 9896405
1017 3006327931 3006321560 Bacteria 8247479
1018 637880492 637000116 Bacteria 5433628
1019 8002782778 8002775197 Bacteria 10728764
1020 8002788593 8002784119 Bacteria 9788632
1021 8023628519 8023623736 Bacteria 8593882
1022 8025481224 8025478263 Bacteria 8209203
1023 8025531021 8025530807 Bacteria 8495698
1024 8048364119 8048356638 Bacteria 11044339
1025 8054914100 8054913762 Bacteria 7713009
1026 8054922894 8054920844 Bacteria 7068637
1027 8055068479 8055066027 Bacteria 9479577
1028 8055162373 8055157932 Bacteria 6429399
1029 8055181035 8055172936 Bacteria 9305943
1030 8056210695 8056207758 Bacteria 8639239
1031 8056449304 8056447290 Bacteria 7680491
1032 8056670176 8056667051 Bacteria 6953971
1033 8057349524 8057345674 Bacteria 4160394
1034 8057568516 8057568493 Bacteria 7221719
1035 JGI25406J46586_10001239
1036 JGI25407J50210_10005010
1037 Ga0070658_10000155
1038 Ga0070658_10002940
1039 Ga0070658_10029662
1040 Ga0070658_10157737
1041 Ga0070690_100102271
1042 Ga0068869_100023645
1043 Ga0068869_100026269
1044 Ga0070680_100001962
1045 Ga0070680_100026940
1046 Ga0070680_100028822
1047 Ga0070680_100045036
1048 Ga0070680_100090868
1049 Ga0070682_100106717
1050 Ga0068868_100013822
1051 Ga0070660_100011330
1052 Ga0070660_100029298
1053 Ga0070660_100135097
1054 Ga0070660_100139665
1055 Ga0070689_100123691
1056 Ga0070661_100150501
1057 Ga0070675_100000432
1058 Ga0070671_100009876
1059 Ga0070659_100022854
1060 Ga0070659_100043762
1061 Ga0070659_100074131
1062 Ga0070659_100074141
1063 Ga0070667_100041762
1064 Ga0070667_100083388
1065 Ga0070709_10004934
1066 Ga0070714_100001145
1067 Ga0070714_100004012
1068 Ga0070714_100008229
1069 Ga0070714_100034331
1070 Ga0070714_100070777
1071 Ga0070713_100005230
1072 Ga0070713_100014998
1073 Ga0070713_100044036
1074 Ga0070713_100074312
1075 Ga0070713_100080927
1076 Ga0070713_100203340
1077 Ga0070710_10001141
1078 Ga0070710_10001374
1079 Ga0070710_10021293
1080 Ga0070710_10076569
1081 Ga0070711_100004625
1082 Ga0070700_100025985
1083 Ga0070708_100022408
1084 Ga0070663_100035622
1085 Ga0070663_100054412
1086 Ga0070678_100041789
1087 Ga0070662_100019366
1088 Ga0070681_10000504
1089 Ga0070681_10082341
1090 Ga0070681_10288912
1091 Ga0070706_100004502
1092 Ga0070706_100022790
1093 Ga0070706_100027267
1094 Ga0070706_100032645
1095 Ga0070706_100032981
1096 Ga0070706_100061620
1097 Ga0070706_100151403
1098 Ga0070707_100002548
1099 Ga0070707_100003790
1100 Ga0070707_100058478
1101 Ga0070707_100065381
1102 Ga0070707_100117717
1103 Ga0070707_100158936
1104 Ga0070698_100002410
1105 Ga0070698_100006733
1106 Ga0070698_100019009
1107 Ga0070698_100121782
1108 Ga0070699_100144275
1109 Ga0070679_100005358
1110 Ga0070679_100036362
1111 Ga0070679_100134258
1112 Ga0070679_100140725
1113 Ga0070684_100043382
1114 Ga0070684_100211996
1115 Ga0070697_100152242
1116 Ga0070672_100108227
1117 Ga0070696_100101654
1118 Ga0070665_100054549
1119 Ga0070665_100063573
1120 Ga0070665_100067805
1121 Ga0070665_100154454
1122 Ga0070704_100055382
1123 Ga0068855_100012387
1124 Ga0068855_100019603
1125 Ga0068855_100034580
1126 Ga0068855_100296892
1127 Ga0070664_100001189
1128 Ga0068857_100071939
1129 Ga0068854_100045745
1130 Ga0068856_100050508
1131 Ga0068856_100156691
1132 Ga0070702_100013168
1133 Ga0068852_100009673
1134 Ga0068852_100018879
1135 Ga0068852_100191252
1136 Ga0068859_100002262
1137 Ga0068859_100066859
1138 Ga0068859_100282615
1139 Ga0068861_100025747
1140 Ga0068863_100007064
1141 Ga0068863_100008788
1142 Ga0068863_100013852
1143 Ga0068863_100089770
1144 Ga0068858_100000032
1145 Ga0068858_100014430
1146 Ga0068858_100116303
1147 Ga0068860_100001541
1148 Ga0068860_100279263
1149 Ga0068862_100000021
1150 Ga0068862_100132511
1151 Ga0081455_10000117
1152 Ga0081455_10000943
1153 Ga0081455_10036026
1154 Ga0081455_10062835
1155 Ga0081538_10000008
1156 Ga0081538_10004860
1157 Ga0081540_1001691
1158 Ga0081539_10001536
1159 Ga0081539_10002043
1160 Ga0070717_10009527
1161 Ga0070717_10084774
1162 Ga0070717_10097747
1163 Ga0075363_100011120
1164 Ga0075364_10054662
1165 Ga0075432_10000747
1166 Ga0075432_10002780
1167 Ga0070715_10001858
1168 Ga0070715_10077563
1169 Ga0070716_100000107
1170 Ga0070716_100001032
1171 Ga0070716_100026556
1172 Ga0070716_100036091
1173 Ga0070712_100013526
1174 Ga0070712_100021377
1175 Ga0070712_100075464
1176 Ga0075370_10004205
1177 Ga0068871_100015523
1178 Ga0068871_100066435
1179 Ga0075428_100094224
1180 Ga0075431_100009739
1181 Ga0075433_10003991
1182 Ga0075433_10004634
1183 Ga0075433_10040914
1184 Ga0075433_10046700
1185 Ga0075433_10101347
1186 Ga0075434_100005761
1187 Ga0075434_100024785
1188 Ga0075434_100036281
1189 Ga0068865_100023825
1190 Ga0068865_100026060
1191 Ga0068865_100074547
1192 Ga0075436_100010015
1193 Ga0097620_100002262
1194 Ga0097620_100066854
1195 Ga0097620_100282612
1196 Ga0075435_100003227
1197 Ga0075435_100031679
1198 Ga0075435_100058846
1199 Ga0105251_10015488
1200 Ga0105240_10023577
1201 Ga0105240_10033631
1202 Ga0105240_10062564
1203 Ga0111539_10000158
1204 Ga0111539_10012622
1205 Ga0111539_10053176
1206 Ga0105245_10006017
1207 Ga0105245_10030109
1208 Ga0105247_10000164
1209 Ga0105247_10013514
1210 Ga0114129_10003880
1211 Ga0114129_10006158
1212 Ga0114129_10381012
1213 Ga0105243_10004679
1214 Ga0105243_10015344
1215 Ga0105243_10018374
1216 Ga0105241_10000211
1217 Ga0105241_10112876
1218 Ga0105242_10041434
1219 Ga0105242_10090994
1220 Ga0105248_10008126
1221 Ga0105248_10025426
1222 Ga0105248_10084778
1223 Ga0105248_10092052
1224 Ga0105248_10092277
1225 Ga0105237_10175971
1226 Ga0105238_10135556
1227 Ga0105249_10007978
1228 Ga0105249_10018935
1229 Ga0105249_10037975
1230 Ga0105239_10221677
1231 Ga0157371_10124312
1232 Ga0157369_10003546
1233 Ga0157369_10013234
1234 Ga0157369_10015580
1235 Ga0157369_10018498
1236 Ga0157369_10101407
1237 Ga0157369_10124574
1238 Ga0157369_10160221
1239 Ga0163162_10033407
1240 Ga0157372_10051339
1241 Ga0157372_10122109
1242 Ga0157372_10362136
1243 Ga0157375_10354597
1244 Ga0163163_10003743
1245 Ga0163163_10025818
1246 Ga0163163_10061133
1247 Ga0163163_10100616
1248 Ga0163163_10125584
1249 Ga0157380_10025917
1250 Ga0157377_10052592
1251 Ga0157379_10000802
1252 Ga0163161_10021783
1253 Ga0206353_11278065
1254 Ga0213876_10008265
1255 Ga0213876_10020805
1256 Ga0213875_10000176
1257 Ga0213875_10012930
1258 Ga0213875_10022537
1259 Ga0224712_10012656
1260 Ga0224572_1002810
1261 Ga0209148_1004143
1262 Ga0209758_1018764
1263 Ga0207653_10001877
1264 Ga0207692_10002817
1265 Ga0207692_10003209
1266 Ga0207692_10007932
1267 Ga0207692_10019912
1268 Ga0207692_10030651
1269 Ga0207710_10000082
1270 Ga0207710_10000178
1271 Ga0207688_10045759
1272 Ga0207685_10016682
1273 Ga0207699_10000162
1274 Ga0207699_10003242
1275 Ga0207699_10008552
1276 Ga0207699_10009681
1277 Ga0207699_10018654
1278 Ga0207699_10019900
1279 Ga0207705_10000595
1280 Ga0207705_10036392
1281 Ga0207684_10005597
1282 Ga0207684_10008418
1283 Ga0207684_10011027
1284 Ga0207684_10028160
1285 Ga0207684_10041912
1286 Ga0207684_10059418
1287 Ga0207684_10159732
1288 Ga0207654_10000003
1289 Ga0207707_10021899
1290 Ga0207707_10031920
1291 Ga0207707_10201279
1292 Ga0207695_10009600
1293 Ga0207695_10035988
1294 Ga0207671_10047284
1295 Ga0207693_10005465
1296 Ga0207693_10011553
1297 Ga0207693_10044954
1298 Ga0207693_10049152
1299 Ga0207663_10010235
1300 Ga0207663_10013983
1301 Ga0207660_10014279
1302 Ga0207660_10020234
1303 Ga0207660_10115961
1304 Ga0207662_10111824
1305 Ga0207657_10027505
1306 Ga0207657_10120345
1307 Ga0207657_10152508
1308 Ga0207652_10001493
1309 Ga0207652_10011363
1310 Ga0207652_10130610
1311 Ga0207652_10210737
1312 Ga0207646_10004909
1313 Ga0207646_10006662
1314 Ga0207646_10026254
1315 Ga0207646_10049392
1316 Ga0207646_10173500
1317 Ga0207646_10254369
1318 Ga0207694_10193655
1319 Ga0207687_10015347
1320 Ga0207700_10000208
1321 Ga0207700_10005586
1322 Ga0207700_10011622
1323 Ga0207700_10023204
1324 Ga0207700_10026506
1325 Ga0207700_10030133
1326 Ga0207700_10033068
1327 Ga0207700_10034483
1328 Ga0207700_10055575
1329 Ga0207664_10000108
1330 Ga0207664_10000652
1331 Ga0207664_10006346
1332 Ga0207664_10025397
1333 Ga0207664_10050410
1334 Ga0207664_10084753
1335 Ga0207664_10150877
1336 Ga0207644_10019377
1337 Ga0207690_10015030
1338 Ga0207690_10030577
1339 Ga0207690_10045554
1340 Ga0207706_10008994
1341 Ga0207706_10012429
1342 Ga0207709_10095220
1343 Ga0207669_10050448
1344 Ga0207665_10001654
1345 Ga0207665_10009362
1346 Ga0207665_10071751
1347 Ga0207691_10056671
1348 Ga0207711_10004436
1349 Ga0207711_10005962
1350 Ga0207711_10029591
1351 Ga0207689_10002944
1352 Ga0207689_10014973
1353 Ga0207661_10070349
1354 Ga0207679_10007877
1355 Ga0207679_10043802
1356 Ga0207667_10012713
1357 Ga0207667_10027190
1358 Ga0207667_10162034
1359 Ga0207712_10016843
1360 Ga0207640_10021338
1361 Ga0207658_10033483
1362 Ga0207677_10117420
1363 Ga0207703_10000015
1364 Ga0207703_10033969
1365 Ga0207703_10085225
1366 Ga0207678_10019054
1367 Ga0207678_10022911
1368 Ga0207708_10158656
1369 Ga0207702_10019652
1370 Ga0207702_10094998
1371 Ga0207641_10005192
1372 Ga0207641_10037816
1373 Ga0207648_10150702
1374 Ga0207676_10083282
1375 Ga0207676_10103429
1376 Ga0207674_10014112
1377 Ga0207674_10014116
1378 Ga0207674_10022371
1379 Ga0207675_100034755
1380 Ga0207675_100043753
1381 Ga0207683_10002402
1382 Ga0207698_10004922
1383 Ga0207428_10005818
1384 Ga0207428_10006063
1385 Ga0268266_10108451
1386 Ga0268265_10000034
1387 Ga0268265_10093000
1388 Ga0268264_10015171
1389 Ga0268264_10016963
1390 Ga0268264_10086378
1391 Ga0265337_1000717
1392 Ga0265319_1002807
1393 Ga0265334_10003266
1394 Ga0265318_10005188
1395 Ga0265323_10018282
1396 Ga0265322_10011862
1397 Ga0265336_10008231
1398 Ga0307517_10010693
1399 Ga0307515_10000598
1400 Ga0307515_10022335
1401 Ga0307515_10041986
1402 Ga0265338_10009703
1403 Ga0265338_10010976
1404 Ga0265338_10011718
1405 Ga0265338_10013470
1406 Ga0265324_10000014
1407 Ga0265324_10017802
1408 Ga0316177_1138842
1409 Ga0316180_1183041
1410 Ga0265332_10003020
1411 Ga0265320_10038988
1412 Ga0265325_10020950
1413 Ga0265325_10074437
1414 Ga0265340_10008841
1415 Ga0265327_10008570
1416 Ga0265316_10068732
1417 Ga0307408_100008126
1418 Ga0307408_100079754
1419 Ga0307508_10007864
1420 Ga0307514_10040454
1421 Ga0265314_10003856
1422 Ga0265314_10013885
1423 Ga0265342_10013847
1424 Ga0316576_10040482
1425 Ga0316576_10043670
1426 Ga0316576_10056242
1427 Ga0316576_10069897
1428 Ga0307516_10000753
1429 Ga0307516_10076497
1430 Ga0307516_10101985
1431 Ga0307405_10012156
1432 Ga0307405_10022858
1433 Ga0307413_10015166
1434 Ga0307413_10020869
1435 Ga0307410_10000140
1436 Ga0307410_10000908
1437 Ga0307406_10000083
1438 Ga0307406_10004620
1439 Ga0307406_10015517
1440 Ga0307406_10110650
1441 Ga0307407_10006883
1442 Ga0307407_10046652
1443 Ga0307412_10153795
1444 Ga0307409_100018937
1445 Ga0307409_100021231
1446 Ga0307409_100058000
1447 Ga0307409_100063219
1448 Ga0307409_100097021
1449 Ga0307409_100195829
1450 Ga0307416_100000105
1451 Ga0307416_100015187
1452 Ga0307416_100023950
1453 Ga0307416_100030001
1454 Ga0307416_100046883
1455 Ga0307416_100091909
1456 Ga0307414_10016780
1457 Ga0307414_10067493
1458 Ga0307415_100000023
1459 Ga0307415_100003368
1460 Ga0307415_100005815
1461 Ga0307415_100009190
1462 Ga0307415_100022541
1463 Ga0307415_100129715
1464 Ga0307510_10019969
1465 Ga0316214_1001083
1466 Ga0373948_0001069
1467 Ga0373959_0003579
1468 Ga0373926_0002255
1469 Ga0373926_0012223
1470 Ga0373928_0004612
1471 Ga0373929_0010019
1472 Ga0373934_0000014
1473 Ga0373934_0009476
1474 Ga0373934_0025439
1475 Ga0373940_0010822
1476 Ga0373944_0025121
1477 Ga0373951_0004369
1478 Ga0373923_0001958
1479 Ga0373923_0014154
1480 Ga0373936_0001017
1481 Ga0373936_0002279
1482 Ga0373936_0008667
1483 Ga0373936_0046490
1484 Ga0373936_0055803
1485 Ga0373941_0018192
1486 Ga0373945_0002858
1487 Ga0373953_0027623
1488 Ga0373954_0001669
1489 Ga0373954_0009727
1490 Ga0373954_0019931
1491 Ga0373954_0025588
1492 Ga0373956_0001414
1493 Ga0373956_0011823
1494 Ga0373956_0017976
1495 Ga0373957_0000846
1496 Ga0373957_0011733
1497 Ga0373960_0014572
1498 Ga0373943_0004220
1499 Ga0373946_0001758
1500 Ga0373946_0019534
1501 Ga0373955_0000040
1502 Ga0373955_0003711
1503 Ga0373955_0027763
1504 Ga0373962_0003761
1505 Ga0316574_0007389
1506 Ga0316574_0023970
1507 Ga0316574_0040647
1508 Ga0316574_0109968
1509 Ga0373924_0001593
1510 Ga0373924_0006313
1511 Ga0373924_0036883
1512 Ga0373935_0001435
1513 Ga0373935_0016107
1514 Ga0373935_0046237
1515 Ga0373935_0056355
1516 Ga0373935_0113598
1517 Ga0373927_0009751
1518 Ga0373933_0000085
1519 Ga0373933_0010236
1520 Ga0373933_0013165
1521 Ga0373933_0017976
1522 Ga0373933_0056954
1523 Ga0373947_0000195
1524 Ga0373947_0001660
1525 Ga0373937_0000197
1526 Ga0373937_0021787
1527 Ga0373937_0034956
1528 Ga0373937_0036313
1529 Ga0373937_0040007
1530 Ga0373937_0064398
1531 Ga0373937_0164179
1532 Ga0373937_0226602
1533 Ga0373937_0272978
1534 Ga0316582_0065993
1535 Ga0316584_0011739
1536 Ga0373925_0000030
1537 Ga0373925_0007451
1538 Ga0373925_0018348
1539 Ga0373925_0052094
1540 Ga0373925_0057493
1541 Ga0373925_0084538
1542 Ga0373925_0165333
1543 Ga0395899_0002958
1544 Ga0395900_0044150
1545 Ga0395900_0099741
1546 Ga0395898_0029283
1547 Ga0395898_0123567
1548 Ga0436364_0303129
1549 Ga0436364_0875353
1550 Ga0436364_1024480
1551 Ga0436364_1109480
1552 Ga0436364_1394034
1553 Ga0395901_0085159
1554 Ga0400483_062358
1555 Ga0400483_276618
1556 Ga0436365_0313897
1557 Ga0436365_0557859
1558 Ga0436365_0613236
1559 Ga0436365_1288165
1560 Ga0436363_1583056
1561 Ga0436362_1219176
1562 Ga0451791_0846982
1563 Ga0439463_001655
1564 Ga0439463_016883
1565 Ga0451577_0000624
1566 Ga0451577_0001084
1567 Ga0439440_0012997
1568 Ga0466969_0023091
1569 Ga0466972_0045465
1570 Ga0466966_0036482
1571 Ga0466966_0052233
1572 Ga0466966_0122180
1573 Ga0466961_0005237
1574 Ga0466961_0011992
1575 Ga0466961_0035801
1576 Ga0466961_0038381
1577 Ga0466961_0053307
1578 Ga0466961_0053848
1579 Ga0466961_0075470
1580 Ga0466961_0096522
1581 Ga0466963_0000272
1582 Ga0466963_0003348
1583 Ga0466963_0008490
1584 Ga0466963_0022711
1585 Ga0466963_0031049
1586 Ga0466963_0062369
1587 Ga0466963_0076038
1588 Ga0466963_0117065
1589 Ga0466963_0126740
1590 Ga0466963_0135177
1591 Ga0466963_0149382
1592 Ga0453684_0001802
1593 Ga0466971_0002592
1594 Ga0466971_0009865
1595 Ga0466970_0000947
1596 Ga0466959_0032930
1597 Ga0466959_0062991
1598 Ga0466958_0002261
1599 Ga0466958_0003632
1600 Ga0466958_0037231
1601 Ga0466958_0065329
1602 Ga0466958_0107708
1603 Ga0466967_0022738
1604 Ga0466967_0029542
1605 Ga0466967_0031995
1606 Ga0466967_0036785
1607 Ga0466967_0045535
1608 Ga0466967_0062388
1609 Ga0466967_0101325
1610 Ga0466967_0197789
1611 Ga0495592_0000157
1612 Ga0495592_0007215
1613 Ga0495592_0033680
1614 Ga0495592_0042356
1615 Ga0495603_0013090
1616 Ga0495603_0020408
1617 Ga0495590_0000484
1618 Ga0495629_0001111
1619 Ga0495629_0004740
1620 Ga0495629_0014332
1621 Ga0495629_0022043
1622 Ga0495629_0067606
1623 Ga0495629_0109388
1624 Ga0495641_0008500
1625 Ga0495641_0035794
1626 Ga0495641_0053637
1627 Ga0495651_0000115
1628 Ga0495651_0005863
1629 Ga0495651_0006516
1630 Ga0495651_0029499
1631 Ga0495651_0053844
1632 Ga0495651_0087535
1633 Ga0495653_0009912
1634 Ga0495653_0017549
1635 Ga0495653_0024574
1636 Ga0495653_0033132
1637 Ga0495653_0052520
1638 Ga0495653_0055578
1639 Ga0495653_0056416
1640 Ga0495653_0101832
1641 Ga0495650_0005298
1642 Ga0495580_0009545
1643 Ga0495580_0055321
1644 Ga0495582_0003495
1645 Ga0495582_0004371
1646 Ga0495639_0013157
1647 Ga0495639_0037627
1648 Ga0495662_0033900
1649 Ga0495662_0043070
1650 Ga0495664_0006176
1651 Ga0495664_0030935
1652 Ga0495664_0034817
1653 Ga0495664_0109951
1654 Ga0495585_0024459
1655 Ga0495594_0000581
1656 Ga0495608_0003716
1657 Ga0495608_0007490
1658 Ga0495608_0011618
1659 Ga0495608_0033917
1660 Ga0495618_0045353
1661 Ga0495628_0000492
1662 Ga0495628_0005799
1663 Ga0495628_0020582
1664 Ga0495630_0040719
1665 Ga0495630_0176475
1666 Ga0495648_0018440
1667 Ga0495666_0009549
1668 Ga0495652_0007274
1669 Ga0495652_0014633
1670 Ga0495652_0041679
1671 Ga0495652_0043329
1672 Ga0495640_0013371
1673 Ga0495640_0021822
1674 Ga0495640_0038134
1675 Ga0495640_0076101
1676 Ga0495640_0088756
1677 Ga0495640_0095927
1678 Ga0495586_0057385
1679 Ga0495587_0000123
1680 Ga0495587_0016217
1681 Ga0495587_0032473
1682 Ga0495645_0014230
1683 Ga0495645_0039166
1684 Ga0495645_0043089
1685 Ga0495622_0019863
1686 Ga0495667_0000107
1687 Ga0495667_0007253
1688 Ga0495667_0018130
1689 Ga0495667_0019013
1690 Ga0495667_0019310
1691 Ga0495667_0020842
1692 Ga0495667_0037158
1693 Ga0495634_0020569
1694 Ga0495634_0034159
1695 Ga0495634_0049820
1696 Ga0495634_0085558
1697 Ga0495611_0016203
1698 Ga0495635_0012621
1699 Ga0495635_0014442
1700 Ga0495635_0039605
1701 Ga0495635_0068273
1702 Ga0495635_0070122
1703 Ga0495657_0000169
1704 Ga0495657_0012881
1705 Ga0495657_0017135
1706 Ga0495657_0030266
1707 Ga0495657_0060865
1708 Ga0495657_0063226
1709 Ga0495657_0077837
1710 Ga0495599_0002521
1711 Ga0495599_0008323
1712 Ga0495599_0035014
1713 Ga0495599_0050775
1714 Ga0495623_0009785
1715 Ga0495623_0033496
1716 Ga0495623_0050466
1717 Ga0495623_0054254
1718 Ga0495646_0042668
1719 Ga0495646_0054052
1720 Ga0495646_0062104
1721 Ga0495658_0007742
1722 Ga0495658_0051082
1723 Ga0495613_0015671
1724 Ga0495613_0032000
1725 Ga0495613_0040997
1726 Ga0495613_0088773
1727 Ga0495624_0030943
1728 Ga0495624_0034495
1729 Ga0495624_0034767
1730 Ga0495624_0091681
1731 Ga0495600_0009464
1732 Ga0495600_0011208
1733 Ga0495600_0014018
1734 Ga0495600_0020085
1735 Ga0495600_0028753
1736 Ga0495600_0029305
1737 Ga0495581_0006780
1738 Ga0495581_0055827
1739 Ga0495604_0000161
1740 Ga0495604_0002557
1741 Ga0495604_0009103
1742 Ga0495604_0011992
1743 Ga0495604_0012311
1744 Ga0495604_0043812
1745 Ga0495604_0106234
1746 Ga0495674_0012623
1747 Ga0495674_0053199
1748 Ga0495674_0135608
1749 Ga0495676_0005210
1750 Ga0495676_0020253
1751 Ga0495676_0030823
1752 Ga0495676_0046854
1753 Ga0495676_0083475
1754 Ga0495680_0004695
1755 Ga0495680_0007013
1756 Ga0495680_0023511
1757 Ga0495680_0040898
1758 Ga0495680_0046760
1759 Ga0495687_003567
1760 Ga0495675_0002978
1761 Ga0495675_0007679
1762 Ga0495675_0007682
1763 Ga0495675_0010155
1764 Ga0495675_0011761
1765 Ga0495685_017124
1766 Ga0495684_0002750
1767 Ga0495684_0002944
1768 Ga0495684_0006983
1769 Ga0495684_0052798
1770 Ga0495684_0055420
1771 Ga0495684_0062697
1772 Ga0495593_0015283
1773 Ga0495593_0023848
1774 Ga0495593_0049092
1775 Ga0495602_0000182
1776 Ga0495602_0038715
1777 Ga0495602_0041925
1778 Ga0495602_0043021
1779 Ga0495602_0049803
1780 Ga0495602_0076720
1781 Ga0495614_0037738
1782 Ga0496101_0047351
1783 Ga0496101_0061554
1784 Ga0496102_0013379
1785 Ga0496102_0065703
1786 Ga0496102_0124101
1787 Ga0496102_0199975
1788 Ga0496103_0002735
1789 Ga0496103_0013447
1790 Ga0496104_0012811
1791 Ga0496104_0016531
1792 Ga0496104_0104429
1793 Ga0496104_0133039
1794 Ga0496104_0135243
1795 Ga0496105_0001730
1796 Ga0496105_0002855
1797 Ga0496105_0023038
1798 Ga0496106_0014818
1799 Ga0496107_0032783
1800 Ga0496108_0002365
1801 Ga0496108_0008143
1802 Ga0496108_0089477
1803 Ga0496108_0114941
1804 Ga0496108_0117891
1805 Ga0496109_0012022
1806 Ga0496109_0035580
1807 Ga0496109_0062801
1808 Ga0496110_0003627
1809 Ga0496110_0018756
1810 Ga0496110_0090641
1811 Ga0496111_0039696
1812 Ga0496112_0019138
1813 Ga0496112_0044614
1814 Ga0496112_0048961
1815 Ga0496113_0007107
1816 Ga0496113_0056171
1817 Ga0496114_0008348
1818 Ga0496114_0012039
1819 Ga0496114_0055285
1820 Ga0496114_0070842
1821 Ga0496114_0113931
1822 Ga0496115_0014904
1823 Ga0496115_0029372
1824 Ga0496116_0000165
1825 Ga0496117_0002355
1826 Ga0496117_0007254
1827 Ga0496118_0004719
1828 Ga0496118_0009080
1829 Ga0496119_0000375
1830 Ga0496119_0003013
1831 Ga0496119_0010507
1832 Ga0496119_0010538
1833 Ga0496120_0000453
1834 Ga0496120_0004273
1835 Ga0496120_0011458
1836 Ga0496121_0043764
1837 Ga0496121_0047048
1838 Ga0496126_0000676
1839 Ga0496126_0027059
1840 Ga0496126_0072013
1841 Ga0496126_0107474
1842 Ga0496126_0110630
1843 Ga0496126_0113416
1844 Ga0501031_0000714
1845 Ga0501031_0006968
1846 Ga0501031_0050578
1847 Ga0501031_0103648
1848 Ga0501032_0003502
1849 Ga0501032_0005443
1850 Ga0501032_0013867
1851 Ga0501032_0061848
1852 Ga0501032_0078279
1853 Ga0501033_0006257
1854 Ga0501033_0009672
1855 Ga0501033_0055904
1856 Ga0501033_0067622
1857 Ga0501033_0072890
1858 Ga0501033_0142363
1859 Ga0501034_0004843
1860 Ga0501034_0005064
1861 Ga0501034_0011314
1862 Ga0501034_0097032
1863 Ga0501036_0010884
1864 Ga0501036_0019934
1865 Ga0501036_0237999
1866 Ga0501037_0008312
1867 Ga0501037_0016986
1868 Ga0501037_0023492
1869 Ga0501037_0063487
1870 Ga0501038_0013926
1871 Ga0501038_0123120
1872 Ga0501038_0209504
1873 Ga0501039_0002152
1874 Ga0501039_0072978
1875 Ga0501039_0109760
1876 Ga0501040_0143173
1877 Ga0501041_0121650
1878 Ga0501042_0023401
1879 Ga0501042_0045990
1880 Ga0501043_0002910
1881 Ga0501043_0034256
1882 Ga0501043_0047789
1883 Ga0501046_0000046
1884 Ga0501046_0001735
1885 Ga0501046_0005551
1886 Ga0501046_0038992
1887 Ga0501046_0050421
1888 Ga0501046_0082200
1889 Ga0501047_0000268
1890 Ga0501047_0002183
1891 Ga0501047_0008059
1892 Ga0501047_0025578
1893 Ga0501047_0033406
1894 Ga0501047_0163413
1895 Ga0501048_0002880
1896 Ga0501048_0026207
1897 Ga0501048_0068208
1898 Ga0501068_0049315
1899 Ga0501068_0075529
1900 Ga0501069_0006022
1901 Ga0501070_0022144
1902 Ga0501070_0029658
1903 Ga0501070_0064642
1904 Ga0501073_0015061
1905 Ga0501073_0024223
1906 Ga0501074_0001157
1907 Ga0501074_0073476
1908 Ga0501074_0152253
1909 Ga0501076_0112428
1910 Ga0501079_0003055
1911 Ga0501079_0111706
1912 Ga0501080_0001035
1913 Ga0501080_0016596
1914 Ga0501083_0152203
1915 Ga0501035_0014942
1916 Ga0501035_0020279
1917 Ga0501035_0024157
1918 Ga0501035_0234920
1919 Ga0501044_0001019
1920 Ga0501044_0005882
1921 Ga0501044_0011020
1922 Ga0501044_0017181
1923 Ga0501044_0021124
1924 Ga0501044_0043045
1925 Ga0501044_0045566
1926 Ga0501044_0066591
1927 Ga0501044_0068391
1928 Ga0501044_0091273
1929 Ga0501044_0102696
1930 Ga0501044_0173627
1931 Ga0501045_0141461
1932 nmdc:mga00v17_39789_c1
1933 nmdc:mga00v17_8489_c1
1934 nmdc:mga07m45_29369_c1
1935 nmdc:mga05p37_11899_c1
1936 nmdc:mga05p37_9076_c1
1937 nmdc:mga0qj67_695_c1
1938 nmdc:mga06r32_294003_c1
1939 nmdc:mga08y16_155725_c1
1940 nmdc:mga08y16_5523_c1
1941 nmdc:mga0n895_207316_c1
1942 nmdc:mga0n895_4481_c1
1943 nmdc:mga0rr50_10842_c1
1944 nmdc:mga0rr50_16896_c1
1945 nmdc:mga08x19_6337_c1
1946 nmdc:mga0a205_1359_c1
1947 Ga0495601_0027111
1948 Ga0495612_0033808
1949 Ga0495595_0006267
1950 Ga0495595_0032638
1951 Ga0495619_0009436
1952 Ga0495619_0047753
1953 Ga0495619_0057561
1954 Ga0495619_0160847
1955 Ga0500614_017827
1956 Ga0500568_0002651
1957 Ga0500568_0003582
1958 Ga0500573_0004254
1959 Ga0500573_0079129
1960 Ga0500616_0000071
1961 Ga0500616_0000643
1962 Ga0500620_000387
1963 Ga0501082_0092669
1964 Ga0466962_0024949
1965 Ga0530510_0018512
1966 2689991649
1967 2506867831
1968 2508678196
1969 2515718917
1970 2517759690
1971 2528205552
1972 2528214971
1973 2546950329
1974 2554259473
1975 2579750245
1976 2579856476
1977 2583153418
1978 2585302007
1979 2585303625
1980 2616900753
1981 2619858078
1982 2620352617
1983 2623501120
1984 2626639666
1985 2643904554
1986 2644183855
1987 2644198588
1988 2644406180
1989 2644611656
1990 2671839071
1991 2676201709
1992 2676476048
1993 2686537796
1994 2686543135
1995 2689956222
1996 2710603811
1997 2731907034
1998 2774846285
1999 2774857227
2000 2774866102
2001 2774904259
2002 2784586819
2003 2786668276
2004 2793983468
2005 2795797751
2006 2799183911
2007 2809227057
2008 2809230385
2009 2811847039
2010 2819427960
2011 2827630610
2012 2852633557
2013 2856742490
2014 2857733593
2015 2861527630
2016 2862186184
2017 2862295316
2018 2862295562
2019 2866557123
2020 2866618212
2021 2867429806
2022 2867480855
2023 2873157616
2024 2873319326
2025 2875392760
2026 2877683318
2027 2891403605
2028 2891556140
2029 2891563883
2030 2895662796
2031 2895888740
2032 2897564754
2033 2912758958
2034 2918502588
2035 2919057288
2036 2919472120
2037 2928124606
2038 2939663718
2039 2946051955
2040 2954011002
2041 2954699354
2042 2954702865
2043 2954718296
2044 2954728266
2045 2954733544
2046 2954747160
2047 2954752427
2048 2954766273
2049 2966604316
2050 2997605606
2051 3006327931
2052 637880492
2053 8002782778
2054 8002788593
2055 8023628519
2056 8025481224
2057 8025531021
2058 8048364119
2059 8054914100
2060 8054922894
2061 8055068479
2062 8055162373
2063 8055181035
2064 8056210695
2065 8056449304
2066 8056670176
2067 8057349524
2068 8057568516

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14698

ASL_C2

Argininosuccinate lyase C-terminal

432

500

0.97

PF00206

Lyase_1

Lyase

75

369

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ien-assembly1.cif.gz_C substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.9821 14 467
6ien-assembly1.cif.gz_A substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.982 14 467
6ien-assembly1.cif.gz_D substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.9808 14 467
6ien-assembly1.cif.gz_A substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.9799 14 467
6ien-assembly1.cif.gz_C substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.9798 14 467
ID Description Score Start End Superfamily
af_I1JV68_416_478_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9887 365 425 1.10.40.30
6iemA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9853 364 434 1.10.40.30
af_Q59R31_374_436_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9845 368 425 1.10.40.30
af_F1RA91_366_428_1.10.40.30 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9839 366 426 1.10.40.30
6iemG03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.9829 364 434 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A077HK97-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9867 5 467 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-W1VGY7-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9857 61 465 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A4V3EBN3-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9852 5 467 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A4R5X310-F1-model_v4 Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) 0.9846 5 467 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A7C6GH40-F1-model_v4 Argininosuccinate lyase 0.9846 357 463 GO:0004056
GO:0005829
GO:0042450

Map