F488690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 474 | 2068 | 472 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2687453743|2689991649 |
| Length | 533 |
| Sequence | GSVAAEDRPSSDKEQVQMDSRQAQDEAGQQPGATGATAAPGATGAAEPDRERDELDSGIGSAGADGAPPLRLWGGRFAGGPAEALARLSVSVXFDWRLAPYDLLASRSHARVLHRAGLLDAGELTAMLGALDDLSEAVTQGRFRPTIEDEDVHTALERGLLERLGALGGKLRAGRSRNDQVATDLRLYLRDHARQVAARLTELSTALVVLAEQHVDTPAPGMTHLQHAQPISFAHQLLAHVHAFARDTERLRDWDRRASVSALGAGALAGSSLPLDPAGVAAELGFDRAFANSLDAVSDRDFAAEFLFVAALAGVHLSRLGEEIVLWTTREFGWVELDDAFATGSSIMPQKKNPDIAELARGKSGRLIGALTGLLTTLKGLPLAYDRDLQEDKEPVFDAVDTLLVVLPAMTGMVATMRVRRDRLEAAAPDGFALATDVAEYLVRNGVAFREAHEAVGQLVAWCVAHEADLDEVSDDDLVVISPLXTPDVRTVLSVRGALEARSAPGGTAPERVREQIQALGPVLDRDRAWAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 169 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 225 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 374 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 375 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 376 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 377 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 378 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 379 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 380 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 381 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 382 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 383 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 384 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 385 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 386 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 387 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 388 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 389 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 390 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 391 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 392 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 393 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 394 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 395 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 396 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 397 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 398 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 399 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 400 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 401 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 402 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 403 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 404 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 405 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 406 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 407 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 408 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 409 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 410 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 411 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 412 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 413 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 414 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 415 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 416 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 417 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 418 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 419 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 420 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 421 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 422 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 423 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 424 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 425 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 426 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 427 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 428 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 429 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 430 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 431 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 432 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 433 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 434 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 435 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 436 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 437 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 438 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 439 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 440 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 441 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 442 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 443 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 444 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 445 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 446 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 447 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 448 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 449 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 450 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 451 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 452 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 453 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 454 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 455 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 456 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 457 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 458 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 459 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 460 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 461 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 462 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 463 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 464 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 465 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 466 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 467 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 468 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 469 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 470 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 471 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 472 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 473 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
| 474 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.85 |
| Metatranscriptomes | 0.19 |
| Isolates | 9.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 2.32 |
| Rhizoplane | 4.26 |
| Rhizosphere | 83.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001239 | 3300003203 | Bacteria | 11995 |
| 2 | JGI25407J50210_10005010 | 3300003373 | Bacteria | 3237 |
| 3 | Ga0070658_10000155 | 3300005327 | Bacteria | 60553 |
| 4 | Ga0070658_10002940 | 3300005327 | Bacteria | 14124 |
| 5 | Ga0070658_10029662 | 3300005327 | Bacteria | 4395 |
| 6 | Ga0070658_10157737 | 3300005327 | Bacteria | 1903 |
| 7 | Ga0070690_100102271 | 3300005330 | Bacteria | 1901 |
| 8 | Ga0068869_100023645 | 3300005334 | Bacteria | 4249 |
| 9 | Ga0068869_100026269 | 3300005334 | Bacteria | 4052 |
| 10 | Ga0070680_100001962 | 3300005336 | Bacteria | 15137 |
| 11 | Ga0070680_100026940 | 3300005336 | Bacteria | 4600 |
| 12 | Ga0070680_100028822 | 3300005336 | Bacteria | 4455 |
| 13 | Ga0070680_100045036 | 3300005336 | Bacteria | 3586 |
| 14 | Ga0070680_100090868 | 3300005336 | Bacteria | 2527 |
| 15 | Ga0070682_100106717 | 3300005337 | Bacteria | 1859 |
| 16 | Ga0068868_100013822 | 3300005338 | Bacteria | 5933 |
| 17 | Ga0070660_100011330 | 3300005339 | Bacteria | 6329 |
| 18 | Ga0070660_100029298 | 3300005339 | Bacteria | 4124 |
| 19 | Ga0070660_100135097 | 3300005339 | Bacteria | 1976 |
| 20 | Ga0070660_100139665 | 3300005339 | Bacteria | 1943 |
| 21 | Ga0070689_100123691 | 3300005340 | Bacteria | 2068 |
| 22 | Ga0070661_100150501 | 3300005344 | Bacteria | 1759 |
| 23 | Ga0070675_100000432 | 3300005354 | Bacteria | 28465 |
| 24 | Ga0070671_100009876 | 3300005355 | Bacteria | 7662 |
| 25 | Ga0070659_100022854 | 3300005366 | Bacteria | 4778 |
| 26 | Ga0070659_100043762 | 3300005366 | Bacteria | 3503 |
| 27 | Ga0070659_100074131 | 3300005366 | Bacteria | 2711 |
| 28 | Ga0070659_100074141 | 3300005366 | Bacteria | 2710 |
| 29 | Ga0070667_100041762 | 3300005367 | Bacteria | 3847 |
| 30 | Ga0070667_100083388 | 3300005367 | Bacteria | 2738 |
| 31 | Ga0070709_10004934 | 3300005434 | Bacteria | 7207 |
| 32 | Ga0070714_100001145 | 3300005435 | Bacteria | 19056 |
| 33 | Ga0070714_100004012 | 3300005435 | Bacteria | 11070 |
| 34 | Ga0070714_100008229 | 3300005435 | Bacteria | 8126 |
| 35 | Ga0070714_100034331 | 3300005435 | Bacteria | 4248 |
| 36 | Ga0070714_100070777 | 3300005435 | Bacteria | 3015 |
| 37 | Ga0070713_100005230 | 3300005436 | Bacteria | 8844 |
| 38 | Ga0070713_100014998 | 3300005436 | Bacteria | 5772 |
| 39 | Ga0070713_100044036 | 3300005436 | Bacteria | 3652 |
| 40 | Ga0070713_100074312 | 3300005436 | Bacteria | 2879 |
| 41 | Ga0070713_100080927 | 3300005436 | Bacteria | 2770 |
| 42 | Ga0070713_100203340 | 3300005436 | Bacteria | 1790 |
| 43 | Ga0070710_10001141 | 3300005437 | Bacteria | 12594 |
| 44 | Ga0070710_10001374 | 3300005437 | Bacteria | 11475 |
| 45 | Ga0070710_10021293 | 3300005437 | Bacteria | 3377 |
| 46 | Ga0070710_10076569 | 3300005437 | Bacteria | 1942 |
| 47 | Ga0070711_100004625 | 3300005439 | Bacteria | 8147 |
| 48 | Ga0070700_100025985 | 3300005441 | Bacteria | 3453 |
| 49 | Ga0070708_100022408 | 3300005445 | Bacteria | 5358 |
| 50 | Ga0070663_100035622 | 3300005455 | Bacteria | 3453 |
| 51 | Ga0070663_100054412 | 3300005455 | Bacteria | 2860 |
| 52 | Ga0070678_100041789 | 3300005456 | Bacteria | 3253 |
| 53 | Ga0070662_100019366 | 3300005457 | Bacteria | 4619 |
| 54 | Ga0070681_10000504 | 3300005458 | Bacteria | 31959 |
| 55 | Ga0070681_10082341 | 3300005458 | Bacteria | 3173 |
| 56 | Ga0070681_10288912 | 3300005458 | Bacteria | 1550 |
| 57 | Ga0070706_100004502 | 3300005467 | Bacteria | 13430 |
| 58 | Ga0070706_100022790 | 3300005467 | Bacteria | 5767 |
| 59 | Ga0070706_100027267 | 3300005467 | Bacteria | 5256 |
| 60 | Ga0070706_100032645 | 3300005467 | Bacteria | 4803 |
| 61 | Ga0070706_100032981 | 3300005467 | Bacteria | 4778 |
| 62 | Ga0070706_100061620 | 3300005467 | Bacteria | 3464 |
| 63 | Ga0070706_100151403 | 3300005467 | Bacteria | 2165 |
| 64 | Ga0070707_100002548 | 3300005468 | Bacteria | 17322 |
| 65 | Ga0070707_100003790 | 3300005468 | Bacteria | 14265 |
| 66 | Ga0070707_100058478 | 3300005468 | Bacteria | 3697 |
| 67 | Ga0070707_100065381 | 3300005468 | Bacteria | 3493 |
| 68 | Ga0070707_100117717 | 3300005468 | Bacteria | 2579 |
| 69 | Ga0070707_100158936 | 3300005468 | Bacteria | 2201 |
| 70 | Ga0070698_100002410 | 3300005471 | Bacteria | 20596 |
| 71 | Ga0070698_100006733 | 3300005471 | Bacteria | 12461 |
| 72 | Ga0070698_100019009 | 3300005471 | Bacteria | 7226 |
| 73 | Ga0070698_100121782 | 3300005471 | Bacteria | 2568 |
| 74 | Ga0070699_100144275 | 3300005518 | Bacteria | 2103 |
| 75 | Ga0070679_100005358 | 3300005530 | Bacteria | 11869 |
| 76 | Ga0070679_100036362 | 3300005530 | Bacteria | 4885 |
| 77 | Ga0070679_100134258 | 3300005530 | Bacteria | 2456 |
| 78 | Ga0070679_100140725 | 3300005530 | Bacteria | 2392 |
| 79 | Ga0070684_100043382 | 3300005535 | Bacteria | 3883 |
| 80 | Ga0070684_100211996 | 3300005535 | Bacteria | 1765 |
| 81 | Ga0070697_100152242 | 3300005536 | Bacteria | 1950 |
| 82 | Ga0070672_100108227 | 3300005543 | Bacteria | 2263 |
| 83 | Ga0070696_100101654 | 3300005546 | Bacteria | 2061 |
| 84 | Ga0070665_100054549 | 3300005548 | Bacteria | 4009 |
| 85 | Ga0070665_100063573 | 3300005548 | Bacteria | 3701 |
| 86 | Ga0070665_100067805 | 3300005548 | Bacteria | 3577 |
| 87 | Ga0070665_100154454 | 3300005548 | Bacteria | 2297 |
| 88 | Ga0070704_100055382 | 3300005549 | Bacteria | 2811 |
| 89 | Ga0068855_100012387 | 3300005563 | Bacteria | 10301 |
| 90 | Ga0068855_100019603 | 3300005563 | Bacteria | 8124 |
| 91 | Ga0068855_100034580 | 3300005563 | Bacteria | 6024 |
| 92 | Ga0068855_100296892 | 3300005563 | Bacteria | 1790 |
| 93 | Ga0070664_100001189 | 3300005564 | Bacteria | 20725 |
| 94 | Ga0068857_100071939 | 3300005577 | Bacteria | 3082 |
| 95 | Ga0068854_100045745 | 3300005578 | Bacteria | 3113 |
| 96 | Ga0068856_100050508 | 3300005614 | Bacteria | 4100 |
| 97 | Ga0068856_100156691 | 3300005614 | Bacteria | 2287 |
| 98 | Ga0070702_100013168 | 3300005615 | Bacteria | 4169 |
| 99 | Ga0068852_100009673 | 3300005616 | Bacteria | 7164 |
| 100 | Ga0068852_100018879 | 3300005616 | Bacteria | 5444 |
| 101 | Ga0068852_100191252 | 3300005616 | Bacteria | 1931 |
| 102 | Ga0068859_100002262 | 3300005617 | Bacteria | 19531 |
| 103 | Ga0068859_100066859 | 3300005617 | Bacteria | 3629 |
| 104 | Ga0068859_100282615 | 3300005617 | Bacteria | 1752 |
| 105 | Ga0068861_100025747 | 3300005719 | Bacteria | 4270 |
| 106 | Ga0068863_100007064 | 3300005841 | Bacteria | 11003 |
| 107 | Ga0068863_100008788 | 3300005841 | Bacteria | 9864 |
| 108 | Ga0068863_100013852 | 3300005841 | Bacteria | 7772 |
| 109 | Ga0068863_100089770 | 3300005841 | Bacteria | 2914 |
| 110 | Ga0068858_100000032 | 3300005842 | Bacteria | 142794 |
| 111 | Ga0068858_100014430 | 3300005842 | Bacteria | 7448 |
| 112 | Ga0068858_100116303 | 3300005842 | Bacteria | 2499 |
| 113 | Ga0068860_100001541 | 3300005843 | Bacteria | 24832 |
| 114 | Ga0068860_100279263 | 3300005843 | Bacteria | 1632 |
| 115 | Ga0068862_100000021 | 3300005844 | Bacteria | 218035 |
| 116 | Ga0068862_100132511 | 3300005844 | Bacteria | 2206 |
| 117 | Ga0081455_10000117 | 3300005937 | Bacteria | 91308 |
| 118 | Ga0081455_10000943 | 3300005937 | Bacteria | 37170 |
| 119 | Ga0081455_10036026 | 3300005937 | Bacteria | 4412 |
| 120 | Ga0081455_10062835 | 3300005937 | Bacteria | 3119 |
| 121 | Ga0081538_10000008 | 3300005981 | Bacteria | 173780 |
| 122 | Ga0081538_10004860 | 3300005981 | Bacteria | 12237 |
| 123 | Ga0081540_1001691 | 3300005983 | Bacteria | 18722 |
| 124 | Ga0081539_10001536 | 3300005985 | Bacteria | 38601 |
| 125 | Ga0081539_10002043 | 3300005985 | Bacteria | 30343 |
| 126 | Ga0070717_10009527 | 3300006028 | Bacteria | 7302 |
| 127 | Ga0070717_10084774 | 3300006028 | Bacteria | 2666 |
| 128 | Ga0070717_10097747 | 3300006028 | Bacteria | 2488 |
| 129 | Ga0075363_100011120 | 3300006048 | Bacteria | 4301 |
| 130 | Ga0075364_10054662 | 3300006051 | Bacteria | 2611 |
| 131 | Ga0075432_10000747 | 3300006058 | Bacteria | 10087 |
| 132 | Ga0075432_10002780 | 3300006058 | Bacteria | 5870 |
| 133 | Ga0070715_10001858 | 3300006163 | Bacteria | 6315 |
| 134 | Ga0070715_10077563 | 3300006163 | Bacteria | 1500 |
| 135 | Ga0070716_100000107 | 3300006173 | Bacteria | 33042 |
| 136 | Ga0070716_100001032 | 3300006173 | Bacteria | 12191 |
| 137 | Ga0070716_100026556 | 3300006173 | Bacteria | 3102 |
| 138 | Ga0070716_100036091 | 3300006173 | Bacteria | 2723 |
| 139 | Ga0070712_100013526 | 3300006175 | Bacteria | 5216 |
| 140 | Ga0070712_100021377 | 3300006175 | Bacteria | 4250 |
| 141 | Ga0070712_100075464 | 3300006175 | Bacteria | 2424 |
| 142 | Ga0075370_10004205 | 3300006353 | Bacteria | 6952 |
| 143 | Ga0068871_100015523 | 3300006358 | Bacteria | 5704 |
| 144 | Ga0068871_100066435 | 3300006358 | Bacteria | 2956 |
| 145 | Ga0075428_100094224 | 3300006844 | Bacteria | 3265 |
| 146 | Ga0075431_100009739 | 3300006847 | Bacteria | 9650 |
| 147 | Ga0075433_10003991 | 3300006852 | Bacteria | 11422 |
| 148 | Ga0075433_10004634 | 3300006852 | Bacteria | 10729 |
| 149 | Ga0075433_10040914 | 3300006852 | Bacteria | 4014 |
| 150 | Ga0075433_10046700 | 3300006852 | Bacteria | 3767 |
| 151 | Ga0075433_10101347 | 3300006852 | Bacteria | 2550 |
| 152 | Ga0075434_100005761 | 3300006871 | Bacteria | 11315 |
| 153 | Ga0075434_100024785 | 3300006871 | Bacteria | 5865 |
| 154 | Ga0075434_100036281 | 3300006871 | Bacteria | 4877 |
| 155 | Ga0068865_100023825 | 3300006881 | Bacteria | 4012 |
| 156 | Ga0068865_100026060 | 3300006881 | Bacteria | 3851 |
| 157 | Ga0068865_100074547 | 3300006881 | Bacteria | 2417 |
| 158 | Ga0075436_100010015 | 3300006914 | Bacteria | 6484 |
| 159 | Ga0097620_100002262 | 3300006931 | Bacteria | 19531 |
| 160 | Ga0097620_100066854 | 3300006931 | Bacteria | 3629 |
| 161 | Ga0097620_100282612 | 3300006931 | Bacteria | 1752 |
| 162 | Ga0075435_100003227 | 3300007076 | Bacteria | 11037 |
| 163 | Ga0075435_100031679 | 3300007076 | Bacteria | 4168 |
| 164 | Ga0075435_100058846 | 3300007076 | Bacteria | 3113 |
| 165 | Ga0105251_10015488 | 3300009011 | Bacteria | 4165 |
| 166 | Ga0105240_10023577 | 3300009093 | Bacteria | 8133 |
| 167 | Ga0105240_10033631 | 3300009093 | Bacteria | 6620 |
| 168 | Ga0105240_10062564 | 3300009093 | Bacteria | 4633 |
| 169 | Ga0111539_10000158 | 3300009094 | Bacteria | 76916 |
| 170 | Ga0111539_10012622 | 3300009094 | Bacteria | 10585 |
| 171 | Ga0111539_10053176 | 3300009094 | Bacteria | 4820 |
| 172 | Ga0105245_10006017 | 3300009098 | Bacteria | 10664 |
| 173 | Ga0105245_10030109 | 3300009098 | Bacteria | 4799 |
| 174 | Ga0105247_10000164 | 3300009101 | Bacteria | 64953 |
| 175 | Ga0105247_10013514 | 3300009101 | Bacteria | 4896 |
| 176 | Ga0114129_10003880 | 3300009147 | Bacteria | 21096 |
| 177 | Ga0114129_10006158 | 3300009147 | Bacteria | 17018 |
| 178 | Ga0114129_10381012 | 3300009147 | Bacteria | 1863 |
| 179 | Ga0105243_10004679 | 3300009148 | Bacteria | 10775 |
| 180 | Ga0105243_10015344 | 3300009148 | Bacteria | 5795 |
| 181 | Ga0105243_10018374 | 3300009148 | Bacteria | 5295 |
| 182 | Ga0105241_10000211 | 3300009174 | Bacteria | 43844 |
| 183 | Ga0105241_10112876 | 3300009174 | Bacteria | 2178 |
| 184 | Ga0105242_10041434 | 3300009176 | Bacteria | 3714 |
| 185 | Ga0105242_10090994 | 3300009176 | Bacteria | 2568 |
| 186 | Ga0105248_10008126 | 3300009177 | Bacteria | 11521 |
| 187 | Ga0105248_10025426 | 3300009177 | Bacteria | 6583 |
| 188 | Ga0105248_10084778 | 3300009177 | Bacteria | 3565 |
| 189 | Ga0105248_10092052 | 3300009177 | Bacteria | 3415 |
| 190 | Ga0105248_10092277 | 3300009177 | Bacteria | 3410 |
| 191 | Ga0105237_10175971 | 3300009545 | Bacteria | 2140 |
| 192 | Ga0105238_10135556 | 3300009551 | Bacteria | 2439 |
| 193 | Ga0105249_10007978 | 3300009553 | Bacteria | 9229 |
| 194 | Ga0105249_10018935 | 3300009553 | Bacteria | 6136 |
| 195 | Ga0105249_10037975 | 3300009553 | Bacteria | 4370 |
| 196 | Ga0105239_10221677 | 3300010375 | Bacteria | 2121 |
| 197 | Ga0157371_10124312 | 3300013102 | Bacteria | 1835 |
| 198 | Ga0157369_10003546 | 3300013105 | Bacteria | 18533 |
| 199 | Ga0157369_10013234 | 3300013105 | Bacteria | 9333 |
| 200 | Ga0157369_10015580 | 3300013105 | Bacteria | 8566 |
| 201 | Ga0157369_10018498 | 3300013105 | Bacteria | 7811 |
| 202 | Ga0157369_10101407 | 3300013105 | Bacteria | 3067 |
| 203 | Ga0157369_10124574 | 3300013105 | Bacteria | 2733 |
| 204 | Ga0157369_10160221 | 3300013105 | Bacteria | 2375 |
| 205 | Ga0163162_10033407 | 3300013306 | Bacteria | 5112 |
| 206 | Ga0157372_10051339 | 3300013307 | Bacteria | 4589 |
| 207 | Ga0157372_10122109 | 3300013307 | Bacteria | 2993 |
| 208 | Ga0157372_10362136 | 3300013307 | Bacteria | 1690 |
| 209 | Ga0157375_10354597 | 3300013308 | Bacteria | 1633 |
| 210 | Ga0163163_10003743 | 3300014325 | Bacteria | 12948 |
| 211 | Ga0163163_10025818 | 3300014325 | Bacteria | 5604 |
| 212 | Ga0163163_10061133 | 3300014325 | Bacteria | 3732 |
| 213 | Ga0163163_10100616 | 3300014325 | Bacteria | 2913 |
| 214 | Ga0163163_10125584 | 3300014325 | Bacteria | 2603 |
| 215 | Ga0157380_10025917 | 3300014326 | Bacteria | 4449 |
| 216 | Ga0157377_10052592 | 3300014745 | Bacteria | 2300 |
| 217 | Ga0157379_10000802 | 3300014968 | Bacteria | 25461 |
| 218 | Ga0163161_10021783 | 3300017792 | Bacteria | 4507 |
| 219 | Ga0206353_11278065 | 3300020082 | Bacteria | 2427 |
| 220 | Ga0213876_10008265 | 3300021384 | Bacteria | 5631 |
| 221 | Ga0213876_10020805 | 3300021384 | Bacteria | 3469 |
| 222 | Ga0213875_10000176 | 3300021388 | Bacteria | 67409 |
| 223 | Ga0213875_10012930 | 3300021388 | Bacteria | 4111 |
| 224 | Ga0213875_10022537 | 3300021388 | Bacteria | 3011 |
| 225 | Ga0224712_10012656 | 3300022467 | Bacteria | 2661 |
| 226 | Ga0224572_1002810 | 3300024225 | Bacteria | 2869 |
| 227 | Ga0209148_1004143 | 3300025254 | Bacteria | 3651 |
| 228 | Ga0209758_1018764 | 3300025297 | Bacteria | 3372 |
| 229 | Ga0207653_10001877 | 3300025885 | Bacteria | 6729 |
| 230 | Ga0207692_10002817 | 3300025898 | Bacteria | 6716 |
| 231 | Ga0207692_10003209 | 3300025898 | Bacteria | 6361 |
| 232 | Ga0207692_10007932 | 3300025898 | Bacteria | 4375 |
| 233 | Ga0207692_10019912 | 3300025898 | Bacteria | 3042 |
| 234 | Ga0207692_10030651 | 3300025898 | Bacteria | 2567 |
| 235 | Ga0207710_10000082 | 3300025900 | Bacteria | 138091 |
| 236 | Ga0207710_10000178 | 3300025900 | Bacteria | 64962 |
| 237 | Ga0207688_10045759 | 3300025901 | Bacteria | 2441 |
| 238 | Ga0207685_10016682 | 3300025905 | Bacteria | 2356 |
| 239 | Ga0207699_10000162 | 3300025906 | Bacteria | 41608 |
| 240 | Ga0207699_10003242 | 3300025906 | Bacteria | 7750 |
| 241 | Ga0207699_10008552 | 3300025906 | Bacteria | 5059 |
| 242 | Ga0207699_10009681 | 3300025906 | Bacteria | 4809 |
| 243 | Ga0207699_10018654 | 3300025906 | Bacteria | 3681 |
| 244 | Ga0207699_10019900 | 3300025906 | Bacteria | 3589 |
| 245 | Ga0207705_10000595 | 3300025909 | Bacteria | 30272 |
| 246 | Ga0207705_10036392 | 3300025909 | Bacteria | 3523 |
| 247 | Ga0207684_10005597 | 3300025910 | Bacteria | 11563 |
| 248 | Ga0207684_10008418 | 3300025910 | Bacteria | 9173 |
| 249 | Ga0207684_10011027 | 3300025910 | Bacteria | 7921 |
| 250 | Ga0207684_10028160 | 3300025910 | Bacteria | 4786 |
| 251 | Ga0207684_10041912 | 3300025910 | Bacteria | 3880 |
| 252 | Ga0207684_10059418 | 3300025910 | Bacteria | 3246 |
| 253 | Ga0207684_10159732 | 3300025910 | Bacteria | 1940 |
| 254 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 255 | Ga0207707_10021899 | 3300025912 | Bacteria | 5586 |
| 256 | Ga0207707_10031920 | 3300025912 | Bacteria | 4610 |
| 257 | Ga0207707_10201279 | 3300025912 | Bacteria | 1736 |
| 258 | Ga0207695_10009600 | 3300025913 | Bacteria | 11949 |
| 259 | Ga0207695_10035988 | 3300025913 | Bacteria | 5358 |
| 260 | Ga0207671_10047284 | 3300025914 | Bacteria | 3184 |
| 261 | Ga0207693_10005465 | 3300025915 | Bacteria | 10594 |
| 262 | Ga0207693_10011553 | 3300025915 | Bacteria | 7141 |
| 263 | Ga0207693_10044954 | 3300025915 | Bacteria | 3470 |
| 264 | Ga0207693_10049152 | 3300025915 | Bacteria | 3312 |
| 265 | Ga0207663_10010235 | 3300025916 | Bacteria | 4983 |
| 266 | Ga0207663_10013983 | 3300025916 | Bacteria | 4380 |
| 267 | Ga0207660_10014279 | 3300025917 | Bacteria | 5219 |
| 268 | Ga0207660_10020234 | 3300025917 | Bacteria | 4463 |
| 269 | Ga0207660_10115961 | 3300025917 | Bacteria | 2023 |
| 270 | Ga0207662_10111824 | 3300025918 | Bacteria | 1704 |
| 271 | Ga0207657_10027505 | 3300025919 | Bacteria | 5207 |
| 272 | Ga0207657_10120345 | 3300025919 | Bacteria | 2160 |
| 273 | Ga0207657_10152508 | 3300025919 | Bacteria | 1881 |
| 274 | Ga0207652_10001493 | 3300025921 | Bacteria | 20662 |
| 275 | Ga0207652_10011363 | 3300025921 | Bacteria | 7175 |
| 276 | Ga0207652_10130610 | 3300025921 | Bacteria | 2240 |
| 277 | Ga0207652_10210737 | 3300025921 | Bacteria | 1749 |
| 278 | Ga0207646_10004909 | 3300025922 | Bacteria | 14315 |
| 279 | Ga0207646_10006662 | 3300025922 | Bacteria | 11906 |
| 280 | Ga0207646_10026254 | 3300025922 | Bacteria | 5317 |
| 281 | Ga0207646_10049392 | 3300025922 | Bacteria | 3768 |
| 282 | Ga0207646_10173500 | 3300025922 | Bacteria | 1947 |
| 283 | Ga0207646_10254369 | 3300025922 | Bacteria | 1587 |
| 284 | Ga0207694_10193655 | 3300025924 | Bacteria | 1652 |
| 285 | Ga0207687_10015347 | 3300025927 | Bacteria | 5021 |
| 286 | Ga0207700_10000208 | 3300025928 | Bacteria | 35189 |
| 287 | Ga0207700_10005586 | 3300025928 | Bacteria | 7547 |
| 288 | Ga0207700_10011622 | 3300025928 | Bacteria | 5625 |
| 289 | Ga0207700_10023204 | 3300025928 | Bacteria | 4273 |
| 290 | Ga0207700_10026506 | 3300025928 | Bacteria | 4042 |
| 291 | Ga0207700_10030133 | 3300025928 | Bacteria | 3838 |
| 292 | Ga0207700_10033068 | 3300025928 | Bacteria | 3697 |
| 293 | Ga0207700_10034483 | 3300025928 | Bacteria | 3633 |
| 294 | Ga0207700_10055575 | 3300025928 | Bacteria | 2976 |
| 295 | Ga0207664_10000108 | 3300025929 | Bacteria | 72754 |
| 296 | Ga0207664_10000652 | 3300025929 | Bacteria | 23974 |
| 297 | Ga0207664_10006346 | 3300025929 | Bacteria | 8125 |
| 298 | Ga0207664_10025397 | 3300025929 | Bacteria | 4462 |
| 299 | Ga0207664_10050410 | 3300025929 | Bacteria | 3283 |
| 300 | Ga0207664_10084753 | 3300025929 | Bacteria | 2585 |
| 301 | Ga0207664_10150877 | 3300025929 | Bacteria | 1974 |
| 302 | Ga0207644_10019377 | 3300025931 | Bacteria | 4616 |
| 303 | Ga0207690_10015030 | 3300025932 | Bacteria | 4685 |
| 304 | Ga0207690_10030577 | 3300025932 | Bacteria | 3437 |
| 305 | Ga0207690_10045554 | 3300025932 | Bacteria | 2898 |
| 306 | Ga0207706_10008994 | 3300025933 | Bacteria | 9193 |
| 307 | Ga0207706_10012429 | 3300025933 | Bacteria | 7758 |
| 308 | Ga0207709_10095220 | 3300025935 | Bacteria | 1956 |
| 309 | Ga0207669_10050448 | 3300025937 | Bacteria | 2488 |
| 310 | Ga0207665_10001654 | 3300025939 | Bacteria | 14998 |
| 311 | Ga0207665_10009362 | 3300025939 | Bacteria | 6430 |
| 312 | Ga0207665_10071751 | 3300025939 | Bacteria | 2364 |
| 313 | Ga0207691_10056671 | 3300025940 | Bacteria | 3569 |
| 314 | Ga0207711_10004436 | 3300025941 | Bacteria | 11961 |
| 315 | Ga0207711_10005962 | 3300025941 | Bacteria | 10300 |
| 316 | Ga0207711_10029591 | 3300025941 | Bacteria | 4622 |
| 317 | Ga0207689_10002944 | 3300025942 | Bacteria | 15736 |
| 318 | Ga0207689_10014973 | 3300025942 | Bacteria | 6579 |
| 319 | Ga0207661_10070349 | 3300025944 | Bacteria | 2857 |
| 320 | Ga0207679_10007877 | 3300025945 | Bacteria | 6767 |
| 321 | Ga0207679_10043802 | 3300025945 | Bacteria | 3225 |
| 322 | Ga0207667_10012713 | 3300025949 | Bacteria | 9671 |
| 323 | Ga0207667_10027190 | 3300025949 | Bacteria | 6234 |
| 324 | Ga0207667_10162034 | 3300025949 | Bacteria | 2300 |
| 325 | Ga0207712_10016843 | 3300025961 | Bacteria | 4739 |
| 326 | Ga0207640_10021338 | 3300025981 | Bacteria | 3860 |
| 327 | Ga0207658_10033483 | 3300025986 | Bacteria | 3666 |
| 328 | Ga0207677_10117420 | 3300026023 | Bacteria | 1994 |
| 329 | Ga0207703_10000015 | 3300026035 | Bacteria | 287079 |
| 330 | Ga0207703_10033969 | 3300026035 | Bacteria | 4046 |
| 331 | Ga0207703_10085225 | 3300026035 | Bacteria | 2643 |
| 332 | Ga0207678_10019054 | 3300026067 | Bacteria | 6027 |
| 333 | Ga0207678_10022911 | 3300026067 | Bacteria | 5465 |
| 334 | Ga0207708_10158656 | 3300026075 | Bacteria | 1785 |
| 335 | Ga0207702_10019652 | 3300026078 | Bacteria | 5592 |
| 336 | Ga0207702_10094998 | 3300026078 | Bacteria | 2618 |
| 337 | Ga0207641_10005192 | 3300026088 | Bacteria | 11135 |
| 338 | Ga0207641_10037816 | 3300026088 | Bacteria | 4033 |
| 339 | Ga0207648_10150702 | 3300026089 | Bacteria | 2052 |
| 340 | Ga0207676_10083282 | 3300026095 | Bacteria | 2604 |
| 341 | Ga0207676_10103429 | 3300026095 | Bacteria | 2367 |
| 342 | Ga0207674_10014112 | 3300026116 | Bacteria | 8826 |
| 343 | Ga0207674_10014116 | 3300026116 | Bacteria | 8824 |
| 344 | Ga0207674_10022371 | 3300026116 | Bacteria | 6788 |
| 345 | Ga0207675_100034755 | 3300026118 | Bacteria | 4701 |
| 346 | Ga0207675_100043753 | 3300026118 | Bacteria | 4183 |
| 347 | Ga0207683_10002402 | 3300026121 | Bacteria | 16354 |
| 348 | Ga0207698_10004922 | 3300026142 | Bacteria | 8188 |
| 349 | Ga0207428_10005818 | 3300027907 | Bacteria | 11432 |
| 350 | Ga0207428_10006063 | 3300027907 | Bacteria | 11175 |
| 351 | Ga0268266_10108451 | 3300028379 | Bacteria | 2457 |
| 352 | Ga0268265_10000034 | 3300028380 | Bacteria | 218695 |
| 353 | Ga0268265_10093000 | 3300028380 | Bacteria | 2415 |
| 354 | Ga0268264_10015171 | 3300028381 | Bacteria | 6320 |
| 355 | Ga0268264_10016963 | 3300028381 | Bacteria | 5961 |
| 356 | Ga0268264_10086378 | 3300028381 | Bacteria | 2695 |
| 357 | Ga0265337_1000717 | 3300028556 | Bacteria | 17435 |
| 358 | Ga0265319_1002807 | 3300028563 | Bacteria | 9330 |
| 359 | Ga0265334_10003266 | 3300028573 | Bacteria | 7401 |
| 360 | Ga0265318_10005188 | 3300028577 | Bacteria | 6149 |
| 361 | Ga0265323_10018282 | 3300028653 | Bacteria | 2714 |
| 362 | Ga0265322_10011862 | 3300028654 | Bacteria | 2520 |
| 363 | Ga0265336_10008231 | 3300028666 | Bacteria | 3668 |
| 364 | Ga0307517_10010693 | 3300028786 | Bacteria | 12808 |
| 365 | Ga0307515_10000598 | 3300028794 | Bacteria | 84186 |
| 366 | Ga0307515_10022335 | 3300028794 | Bacteria | 11156 |
| 367 | Ga0307515_10041986 | 3300028794 | Bacteria | 7173 |
| 368 | Ga0265338_10009703 | 3300028800 | Bacteria | 11417 |
| 369 | Ga0265338_10010976 | 3300028800 | Bacteria | 10527 |
| 370 | Ga0265338_10011718 | 3300028800 | Bacteria | 10092 |
| 371 | Ga0265338_10013470 | 3300028800 | Bacteria | 9225 |
| 372 | Ga0265324_10000014 | 3300029957 | Bacteria | 189109 |
| 373 | Ga0265324_10017802 | 3300029957 | Bacteria | 2580 |
| 374 | Ga0316177_1138842 | 3300030731 | Bacteria | 3758 |
| 375 | Ga0316180_1183041 | 3300030736 | Bacteria | 1946 |
| 376 | Ga0265332_10003020 | 3300031238 | Bacteria | 8253 |
| 377 | Ga0265320_10038988 | 3300031240 | Bacteria | 2378 |
| 378 | Ga0265325_10020950 | 3300031241 | Bacteria | 3598 |
| 379 | Ga0265325_10074437 | 3300031241 | Bacteria | 1698 |
| 380 | Ga0265340_10008841 | 3300031247 | Bacteria | 5425 |
| 381 | Ga0265327_10008570 | 3300031251 | Bacteria | 7589 |
| 382 | Ga0265316_10068732 | 3300031344 | Bacteria | 2735 |
| 383 | Ga0307408_100008126 | 3300031548 | Bacteria | 6934 |
| 384 | Ga0307408_100079754 | 3300031548 | Bacteria | 2444 |
| 385 | Ga0307508_10007864 | 3300031616 | Bacteria | 9897 |
| 386 | Ga0307514_10040454 | 3300031649 | Bacteria | 3675 |
| 387 | Ga0265314_10003856 | 3300031711 | Bacteria | 14303 |
| 388 | Ga0265314_10013885 | 3300031711 | Bacteria | 6480 |
| 389 | Ga0265342_10013847 | 3300031712 | Bacteria | 5383 |
| 390 | Ga0316576_10040482 | 3300031727 | Bacteria | 3350 |
| 391 | Ga0316576_10043670 | 3300031727 | Bacteria | 3235 |
| 392 | Ga0316576_10056242 | 3300031727 | Bacteria | 2873 |
| 393 | Ga0316576_10069897 | 3300031727 | Bacteria | 2589 |
| 394 | Ga0307516_10000753 | 3300031730 | Bacteria | 44155 |
| 395 | Ga0307516_10076497 | 3300031730 | Bacteria | 3199 |
| 396 | Ga0307516_10101985 | 3300031730 | Bacteria | 2685 |
| 397 | Ga0307405_10012156 | 3300031731 | Bacteria | 4544 |
| 398 | Ga0307405_10022858 | 3300031731 | Bacteria | 3543 |
| 399 | Ga0307413_10015166 | 3300031824 | Bacteria | 3941 |
| 400 | Ga0307413_10020869 | 3300031824 | Bacteria | 3495 |
| 401 | Ga0307410_10000140 | 3300031852 | Bacteria | 25566 |
| 402 | Ga0307410_10000908 | 3300031852 | Bacteria | 12622 |
| 403 | Ga0307406_10000083 | 3300031901 | Bacteria | 52941 |
| 404 | Ga0307406_10004620 | 3300031901 | Bacteria | 7495 |
| 405 | Ga0307406_10015517 | 3300031901 | Bacteria | 4410 |
| 406 | Ga0307406_10110650 | 3300031901 | Bacteria | 1890 |
| 407 | Ga0307407_10006883 | 3300031903 | Bacteria | 5103 |
| 408 | Ga0307407_10046652 | 3300031903 | Bacteria | 2454 |
| 409 | Ga0307412_10153795 | 3300031911 | Bacteria | 1700 |
| 410 | Ga0307409_100018937 | 3300031995 | Bacteria | 4646 |
| 411 | Ga0307409_100021231 | 3300031995 | Bacteria | 4448 |
| 412 | Ga0307409_100058000 | 3300031995 | Bacteria | 3004 |
| 413 | Ga0307409_100063219 | 3300031995 | Bacteria | 2902 |
| 414 | Ga0307409_100097021 | 3300031995 | Bacteria | 2433 |
| 415 | Ga0307409_100195829 | 3300031995 | Bacteria | 1803 |
| 416 | Ga0307416_100000105 | 3300032002 | Bacteria | 51970 |
| 417 | Ga0307416_100015187 | 3300032002 | Bacteria | 5307 |
| 418 | Ga0307416_100023950 | 3300032002 | Bacteria | 4443 |
| 419 | Ga0307416_100030001 | 3300032002 | Bacteria | 4074 |
| 420 | Ga0307416_100046883 | 3300032002 | Bacteria | 3415 |
| 421 | Ga0307416_100091909 | 3300032002 | Bacteria | 2608 |
| 422 | Ga0307414_10016780 | 3300032004 | Bacteria | 4463 |
| 423 | Ga0307414_10067493 | 3300032004 | Bacteria | 2562 |
| 424 | Ga0307415_100000023 | 3300032126 | Bacteria | 64440 |
| 425 | Ga0307415_100003368 | 3300032126 | Bacteria | 8125 |
| 426 | Ga0307415_100005815 | 3300032126 | Bacteria | 6592 |
| 427 | Ga0307415_100009190 | 3300032126 | Bacteria | 5523 |
| 428 | Ga0307415_100022541 | 3300032126 | Bacteria | 3888 |
| 429 | Ga0307415_100129715 | 3300032126 | Bacteria | 1906 |
| 430 | Ga0307510_10019969 | 3300033180 | Bacteria | 7846 |
| 431 | Ga0316214_1001083 | 3300033545 | Bacteria | 3051 |
| 432 | Ga0373948_0001069 | 3300034817 | Bacteria | 3702 |
| 433 | Ga0373959_0003579 | 3300034820 | Bacteria | 2484 |
| 434 | Ga0373926_0002255 | 3300035083 | Bacteria | 6092 |
| 435 | Ga0373926_0012223 | 3300035083 | Bacteria | 2901 |
| 436 | Ga0373928_0004612 | 3300035084 | Bacteria | 2626 |
| 437 | Ga0373929_0010019 | 3300035085 | Bacteria | 1765 |
| 438 | Ga0373934_0000014 | 3300035086 | Bacteria | 59312 |
| 439 | Ga0373934_0009476 | 3300035086 | Bacteria | 3647 |
| 440 | Ga0373934_0025439 | 3300035086 | Bacteria | 2292 |
| 441 | Ga0373940_0010822 | 3300035088 | Bacteria | 2154 |
| 442 | Ga0373944_0025121 | 3300035089 | Bacteria | 1751 |
| 443 | Ga0373951_0004369 | 3300035091 | Bacteria | 3362 |
| 444 | Ga0373923_0001958 | 3300035111 | Bacteria | 6175 |
| 445 | Ga0373923_0014154 | 3300035111 | Bacteria | 2991 |
| 446 | Ga0373936_0001017 | 3300035113 | Bacteria | 10032 |
| 447 | Ga0373936_0002279 | 3300035113 | Bacteria | 7180 |
| 448 | Ga0373936_0008667 | 3300035113 | Bacteria | 3829 |
| 449 | Ga0373936_0046490 | 3300035113 | Bacteria | 1750 |
| 450 | Ga0373936_0055803 | 3300035113 | Bacteria | 1604 |
| 451 | Ga0373941_0018192 | 3300035115 | Bacteria | 1938 |
| 452 | Ga0373945_0002858 | 3300035116 | Bacteria | 5427 |
| 453 | Ga0373953_0027623 | 3300035117 | Bacteria | 2182 |
| 454 | Ga0373954_0001669 | 3300035118 | Bacteria | 9091 |
| 455 | Ga0373954_0009727 | 3300035118 | Bacteria | 4234 |
| 456 | Ga0373954_0019931 | 3300035118 | Bacteria | 3028 |
| 457 | Ga0373954_0025588 | 3300035118 | Bacteria | 2699 |
| 458 | Ga0373956_0001414 | 3300035119 | Bacteria | 9923 |
| 459 | Ga0373956_0011823 | 3300035119 | Bacteria | 3604 |
| 460 | Ga0373956_0017976 | 3300035119 | Bacteria | 2989 |
| 461 | Ga0373957_0000846 | 3300035120 | Bacteria | 8012 |
| 462 | Ga0373957_0011733 | 3300035120 | Bacteria | 2932 |
| 463 | Ga0373960_0014572 | 3300035121 | Bacteria | 1994 |
| 464 | Ga0373943_0004220 | 3300035170 | Bacteria | 6518 |
| 465 | Ga0373946_0001758 | 3300035171 | Bacteria | 7554 |
| 466 | Ga0373946_0019534 | 3300035171 | Bacteria | 2611 |
| 467 | Ga0373955_0000040 | 3300035172 | Bacteria | 51762 |
| 468 | Ga0373955_0003711 | 3300035172 | Bacteria | 6721 |
| 469 | Ga0373955_0027763 | 3300035172 | Bacteria | 2929 |
| 470 | Ga0373962_0003761 | 3300035242 | Bacteria | 3650 |
| 471 | Ga0316574_0007389 | 3300035398 | Bacteria | 6024 |
| 472 | Ga0316574_0023970 | 3300035398 | Bacteria | 3648 |
| 473 | Ga0316574_0040647 | 3300035398 | Bacteria | 2864 |
| 474 | Ga0316574_0109968 | 3300035398 | Bacteria | 1766 |
| 475 | Ga0373924_0001593 | 3300035410 | Bacteria | 7428 |
| 476 | Ga0373924_0006313 | 3300035410 | Bacteria | 4240 |
| 477 | Ga0373924_0036883 | 3300035410 | Bacteria | 1988 |
| 478 | Ga0373935_0001435 | 3300035692 | Bacteria | 13201 |
| 479 | Ga0373935_0016107 | 3300035692 | Bacteria | 4523 |
| 480 | Ga0373935_0046237 | 3300035692 | Bacteria | 2748 |
| 481 | Ga0373935_0056355 | 3300035692 | Bacteria | 2505 |
| 482 | Ga0373935_0113598 | 3300035692 | Bacteria | 1800 |
| 483 | Ga0373927_0009751 | 3300035695 | Bacteria | 6438 |
| 484 | Ga0373933_0000085 | 3300035724 | Bacteria | 59115 |
| 485 | Ga0373933_0010236 | 3300035724 | Bacteria | 5137 |
| 486 | Ga0373933_0013165 | 3300035724 | Bacteria | 4581 |
| 487 | Ga0373933_0017976 | 3300035724 | Bacteria | 3971 |
| 488 | Ga0373933_0056954 | 3300035724 | Bacteria | 2347 |
| 489 | Ga0373947_0000195 | 3300035725 | Bacteria | 33609 |
| 490 | Ga0373947_0001660 | 3300035725 | Bacteria | 13615 |
| 491 | Ga0373937_0000197 | 3300036401 | Bacteria | 59124 |
| 492 | Ga0373937_0021787 | 3300036401 | Bacteria | 5752 |
| 493 | Ga0373937_0034956 | 3300036401 | Bacteria | 4571 |
| 494 | Ga0373937_0036313 | 3300036401 | Bacteria | 4490 |
| 495 | Ga0373937_0040007 | 3300036401 | Bacteria | 4273 |
| 496 | Ga0373937_0064398 | 3300036401 | Bacteria | 3371 |
| 497 | Ga0373937_0164179 | 3300036401 | Bacteria | 2082 |
| 498 | Ga0373937_0226602 | 3300036401 | Bacteria | 1759 |
| 499 | Ga0373937_0272978 | 3300036401 | Bacteria | 1596 |
| 500 | Ga0316582_0065993 | 3300036647 | Bacteria | 2332 |
| 501 | Ga0316584_0011739 | 3300036712 | Bacteria | 6165 |
| 502 | Ga0373925_0000030 | 3300037068 | Bacteria | 146196 |
| 503 | Ga0373925_0007451 | 3300037068 | Bacteria | 7984 |
| 504 | Ga0373925_0018348 | 3300037068 | Bacteria | 5085 |
| 505 | Ga0373925_0052094 | 3300037068 | Bacteria | 3057 |
| 506 | Ga0373925_0057493 | 3300037068 | Bacteria | 2914 |
| 507 | Ga0373925_0084538 | 3300037068 | Bacteria | 2418 |
| 508 | Ga0373925_0165333 | 3300037068 | Bacteria | 1744 |
| 509 | Ga0395899_0002958 | 3300037312 | Bacteria | 13596 |
| 510 | Ga0395900_0044150 | 3300037418 | Bacteria | 4594 |
| 511 | Ga0395900_0099741 | 3300037418 | Bacteria | 2983 |
| 512 | Ga0395898_0029283 | 3300037466 | Bacteria | 5517 |
| 513 | Ga0395898_0123567 | 3300037466 | Bacteria | 2480 |
| 514 | Ga0436364_0303129 | 3300037853 | Bacteria | 102080 |
| 515 | Ga0436364_0875353 | 3300037853 | Bacteria | 55373 |
| 516 | Ga0436364_1024480 | 3300037853 | Bacteria | 3104 |
| 517 | Ga0436364_1109480 | 3300037853 | Bacteria | 2292 |
| 518 | Ga0436364_1394034 | 3300037853 | Bacteria | 5606 |
| 519 | Ga0395901_0085159 | 3300038443 | Bacteria | 3304 |
| 520 | Ga0400483_062358 | 3300039062 | Bacteria | 16680 |
| 521 | Ga0400483_276618 | 3300039062 | Bacteria | 37892 |
| 522 | Ga0436365_0313897 | 3300039437 | Bacteria | 1673 |
| 523 | Ga0436365_0557859 | 3300039437 | Bacteria | 4607 |
| 524 | Ga0436365_0613236 | 3300039437 | Bacteria | 5826 |
| 525 | Ga0436365_1288165 | 3300039437 | Bacteria | 2284 |
| 526 | Ga0436363_1583056 | 3300039450 | Bacteria | 2977 |
| 527 | Ga0436362_1219176 | 3300039453 | Bacteria | 1793 |
| 528 | Ga0451791_0846982 | 3300041451 | Bacteria | 11622 |
| 529 | Ga0439463_001655 | 3300042016 | Bacteria | 5875 |
| 530 | Ga0439463_016883 | 3300042016 | Bacteria | 1806 |
| 531 | Ga0451577_0000624 | 3300042876 | Bacteria | 56728 |
| 532 | Ga0451577_0001084 | 3300042876 | Bacteria | 38968 |
| 533 | Ga0439440_0012997 | 3300042993 | Bacteria | 1779 |
| 534 | Ga0466969_0023091 | 3300044656 | Bacteria | 3207 |
| 535 | Ga0466972_0045465 | 3300044658 | Bacteria | 2128 |
| 536 | Ga0466966_0036482 | 3300044684 | Bacteria | 3174 |
| 537 | Ga0466966_0052233 | 3300044684 | Bacteria | 2597 |
| 538 | Ga0466966_0122180 | 3300044684 | Bacteria | 1599 |
| 539 | Ga0466961_0005237 | 3300044693 | Bacteria | 8166 |
| 540 | Ga0466961_0011992 | 3300044693 | Bacteria | 5540 |
| 541 | Ga0466961_0035801 | 3300044693 | Bacteria | 3187 |
| 542 | Ga0466961_0038381 | 3300044693 | Bacteria | 3072 |
| 543 | Ga0466961_0053307 | 3300044693 | Bacteria | 2581 |
| 544 | Ga0466961_0053848 | 3300044693 | Bacteria | 2567 |
| 545 | Ga0466961_0075470 | 3300044693 | Bacteria | 2137 |
| 546 | Ga0466961_0096522 | 3300044693 | Bacteria | 1864 |
| 547 | Ga0466963_0000272 | 3300044694 | Bacteria | 22996 |
| 548 | Ga0466963_0003348 | 3300044694 | Bacteria | 9150 |
| 549 | Ga0466963_0008490 | 3300044694 | Bacteria | 6158 |
| 550 | Ga0466963_0022711 | 3300044694 | Bacteria | 3976 |
| 551 | Ga0466963_0031049 | 3300044694 | Bacteria | 3451 |
| 552 | Ga0466963_0062369 | 3300044694 | Bacteria | 2493 |
| 553 | Ga0466963_0076038 | 3300044694 | Bacteria | 2267 |
| 554 | Ga0466963_0117065 | 3300044694 | Bacteria | 1832 |
| 555 | Ga0466963_0126740 | 3300044694 | Bacteria | 1760 |
| 556 | Ga0466963_0135177 | 3300044694 | Bacteria | 1706 |
| 557 | Ga0466963_0149382 | 3300044694 | Bacteria | 1622 |
| 558 | Ga0453684_0001802 | 3300044712 | Bacteria | 56876 |
| 559 | Ga0466971_0002592 | 3300044719 | Bacteria | 7645 |
| 560 | Ga0466971_0009865 | 3300044719 | Bacteria | 4170 |
| 561 | Ga0466970_0000947 | 3300044765 | Bacteria | 14017 |
| 562 | Ga0466959_0032930 | 3300045049 | Bacteria | 3836 |
| 563 | Ga0466959_0062991 | 3300045049 | Bacteria | 2694 |
| 564 | Ga0466958_0002261 | 3300045836 | Bacteria | 9596 |
| 565 | Ga0466958_0003632 | 3300045836 | Bacteria | 8045 |
| 566 | Ga0466958_0037231 | 3300045836 | Bacteria | 2915 |
| 567 | Ga0466958_0065329 | 3300045836 | Bacteria | 2220 |
| 568 | Ga0466958_0107708 | 3300045836 | Bacteria | 1738 |
| 569 | Ga0466967_0022738 | 3300045976 | Bacteria | 5124 |
| 570 | Ga0466967_0029542 | 3300045976 | Bacteria | 4589 |
| 571 | Ga0466967_0031995 | 3300045976 | Bacteria | 4437 |
| 572 | Ga0466967_0036785 | 3300045976 | Bacteria | 4183 |
| 573 | Ga0466967_0045535 | 3300045976 | Bacteria | 3812 |
| 574 | Ga0466967_0062388 | 3300045976 | Bacteria | 3308 |
| 575 | Ga0466967_0101325 | 3300045976 | Bacteria | 2632 |
| 576 | Ga0466967_0197789 | 3300045976 | Bacteria | 1902 |
| 577 | Ga0495592_0000157 | 3300046454 | Bacteria | 59697 |
| 578 | Ga0495592_0007215 | 3300046454 | Bacteria | 8325 |
| 579 | Ga0495592_0033680 | 3300046454 | Bacteria | 3863 |
| 580 | Ga0495592_0042356 | 3300046454 | Bacteria | 3409 |
| 581 | Ga0495603_0013090 | 3300046455 | Bacteria | 5014 |
| 582 | Ga0495603_0020408 | 3300046455 | Bacteria | 4015 |
| 583 | Ga0495590_0000484 | 3300046457 | Bacteria | 19640 |
| 584 | Ga0495629_0001111 | 3300046459 | Bacteria | 21303 |
| 585 | Ga0495629_0004740 | 3300046459 | Bacteria | 10187 |
| 586 | Ga0495629_0014332 | 3300046459 | Bacteria | 5704 |
| 587 | Ga0495629_0022043 | 3300046459 | Bacteria | 4542 |
| 588 | Ga0495629_0067606 | 3300046459 | Bacteria | 2493 |
| 589 | Ga0495629_0109388 | 3300046459 | Bacteria | 1927 |
| 590 | Ga0495641_0008500 | 3300046461 | Bacteria | 6245 |
| 591 | Ga0495641_0035794 | 3300046461 | Bacteria | 2336 |
| 592 | Ga0495641_0053637 | 3300046461 | Bacteria | 1833 |
| 593 | Ga0495651_0000115 | 3300046462 | Bacteria | 59129 |
| 594 | Ga0495651_0005863 | 3300046462 | Bacteria | 9370 |
| 595 | Ga0495651_0006516 | 3300046462 | Bacteria | 8919 |
| 596 | Ga0495651_0029499 | 3300046462 | Bacteria | 4278 |
| 597 | Ga0495651_0053844 | 3300046462 | Bacteria | 3096 |
| 598 | Ga0495651_0087535 | 3300046462 | Bacteria | 2342 |
| 599 | Ga0495653_0009912 | 3300046463 | Bacteria | 7792 |
| 600 | Ga0495653_0017549 | 3300046463 | Bacteria | 5819 |
| 601 | Ga0495653_0024574 | 3300046463 | Bacteria | 4853 |
| 602 | Ga0495653_0033132 | 3300046463 | Bacteria | 4095 |
| 603 | Ga0495653_0052520 | 3300046463 | Bacteria | 3123 |
| 604 | Ga0495653_0055578 | 3300046463 | Bacteria | 3020 |
| 605 | Ga0495653_0056416 | 3300046463 | Bacteria | 2994 |
| 606 | Ga0495653_0101832 | 3300046463 | Bacteria | 2079 |
| 607 | Ga0495650_0005298 | 3300046471 | Bacteria | 8439 |
| 608 | Ga0495580_0009545 | 3300046472 | Bacteria | 7625 |
| 609 | Ga0495580_0055321 | 3300046472 | Bacteria | 2797 |
| 610 | Ga0495582_0003495 | 3300046473 | Bacteria | 8852 |
| 611 | Ga0495582_0004371 | 3300046473 | Bacteria | 7949 |
| 612 | Ga0495639_0013157 | 3300046475 | Bacteria | 3570 |
| 613 | Ga0495639_0037627 | 3300046475 | Bacteria | 2169 |
| 614 | Ga0495662_0033900 | 3300046476 | Bacteria | 2466 |
| 615 | Ga0495662_0043070 | 3300046476 | Bacteria | 2179 |
| 616 | Ga0495664_0006176 | 3300046477 | Bacteria | 6615 |
| 617 | Ga0495664_0030935 | 3300046477 | Bacteria | 3136 |
| 618 | Ga0495664_0034817 | 3300046477 | Bacteria | 2963 |
| 619 | Ga0495664_0109951 | 3300046477 | Bacteria | 1663 |
| 620 | Ga0495585_0024459 | 3300046492 | Bacteria | 3463 |
| 621 | Ga0495594_0000581 | 3300046499 | Bacteria | 18807 |
| 622 | Ga0495608_0003716 | 3300046511 | Bacteria | 10963 |
| 623 | Ga0495608_0007490 | 3300046511 | Bacteria | 7706 |
| 624 | Ga0495608_0011618 | 3300046511 | Bacteria | 6127 |
| 625 | Ga0495608_0033917 | 3300046511 | Bacteria | 3446 |
| 626 | Ga0495618_0045353 | 3300046514 | Bacteria | 2773 |
| 627 | Ga0495628_0000492 | 3300046516 | Bacteria | 36145 |
| 628 | Ga0495628_0005799 | 3300046516 | Bacteria | 10819 |
| 629 | Ga0495628_0020582 | 3300046516 | Bacteria | 5439 |
| 630 | Ga0495630_0040719 | 3300046517 | Bacteria | 3472 |
| 631 | Ga0495630_0176475 | 3300046517 | Bacteria | 1628 |
| 632 | Ga0495648_0018440 | 3300046524 | Bacteria | 4939 |
| 633 | Ga0495666_0009549 | 3300046526 | Bacteria | 4847 |
| 634 | Ga0495652_0007274 | 3300046529 | Bacteria | 10216 |
| 635 | Ga0495652_0014633 | 3300046529 | Bacteria | 7034 |
| 636 | Ga0495652_0041679 | 3300046529 | Bacteria | 3961 |
| 637 | Ga0495652_0043329 | 3300046529 | Bacteria | 3877 |
| 638 | Ga0495640_0013371 | 3300046533 | Bacteria | 6236 |
| 639 | Ga0495640_0021822 | 3300046533 | Bacteria | 4690 |
| 640 | Ga0495640_0038134 | 3300046533 | Bacteria | 3381 |
| 641 | Ga0495640_0076101 | 3300046533 | Bacteria | 2240 |
| 642 | Ga0495640_0088756 | 3300046533 | Bacteria | 2043 |
| 643 | Ga0495640_0095927 | 3300046533 | Bacteria | 1951 |
| 644 | Ga0495586_0057385 | 3300046535 | Bacteria | 2112 |
| 645 | Ga0495587_0000123 | 3300046536 | Bacteria | 59101 |
| 646 | Ga0495587_0016217 | 3300046536 | Bacteria | 4637 |
| 647 | Ga0495587_0032473 | 3300046536 | Bacteria | 3156 |
| 648 | Ga0495645_0014230 | 3300046543 | Bacteria | 5643 |
| 649 | Ga0495645_0039166 | 3300046543 | Bacteria | 3457 |
| 650 | Ga0495645_0043089 | 3300046543 | Bacteria | 3292 |
| 651 | Ga0495622_0019863 | 3300046557 | Bacteria | 3127 |
| 652 | Ga0495667_0000107 | 3300046559 | Bacteria | 60366 |
| 653 | Ga0495667_0007253 | 3300046559 | Bacteria | 7522 |
| 654 | Ga0495667_0018130 | 3300046559 | Bacteria | 4755 |
| 655 | Ga0495667_0019013 | 3300046559 | Bacteria | 4636 |
| 656 | Ga0495667_0019310 | 3300046559 | Bacteria | 4599 |
| 657 | Ga0495667_0020842 | 3300046559 | Bacteria | 4424 |
| 658 | Ga0495667_0037158 | 3300046559 | Bacteria | 3246 |
| 659 | Ga0495634_0020569 | 3300046642 | Bacteria | 4678 |
| 660 | Ga0495634_0034159 | 3300046642 | Bacteria | 3490 |
| 661 | Ga0495634_0049820 | 3300046642 | Bacteria | 2814 |
| 662 | Ga0495634_0085558 | 3300046642 | Bacteria | 2054 |
| 663 | Ga0495611_0016203 | 3300046648 | Bacteria | 3186 |
| 664 | Ga0495635_0012621 | 3300046663 | Bacteria | 5924 |
| 665 | Ga0495635_0014442 | 3300046663 | Bacteria | 5524 |
| 666 | Ga0495635_0039605 | 3300046663 | Bacteria | 3259 |
| 667 | Ga0495635_0068273 | 3300046663 | Bacteria | 2439 |
| 668 | Ga0495635_0070122 | 3300046663 | Bacteria | 2402 |
| 669 | Ga0495657_0000169 | 3300046675 | Bacteria | 59112 |
| 670 | Ga0495657_0012881 | 3300046675 | Bacteria | 6194 |
| 671 | Ga0495657_0017135 | 3300046675 | Bacteria | 5265 |
| 672 | Ga0495657_0030266 | 3300046675 | Bacteria | 3793 |
| 673 | Ga0495657_0060865 | 3300046675 | Bacteria | 2499 |
| 674 | Ga0495657_0063226 | 3300046675 | Bacteria | 2442 |
| 675 | Ga0495657_0077837 | 3300046675 | Bacteria | 2150 |
| 676 | Ga0495599_0002521 | 3300046678 | Bacteria | 10653 |
| 677 | Ga0495599_0008323 | 3300046678 | Bacteria | 6307 |
| 678 | Ga0495599_0035014 | 3300046678 | Bacteria | 3152 |
| 679 | Ga0495599_0050775 | 3300046678 | Bacteria | 2598 |
| 680 | Ga0495623_0009785 | 3300046679 | Bacteria | 6215 |
| 681 | Ga0495623_0033496 | 3300046679 | Bacteria | 3296 |
| 682 | Ga0495623_0050466 | 3300046679 | Bacteria | 2634 |
| 683 | Ga0495623_0054254 | 3300046679 | Bacteria | 2529 |
| 684 | Ga0495646_0042668 | 3300046680 | Bacteria | 2782 |
| 685 | Ga0495646_0054052 | 3300046680 | Bacteria | 2417 |
| 686 | Ga0495646_0062104 | 3300046680 | Bacteria | 2222 |
| 687 | Ga0495658_0007742 | 3300046683 | Bacteria | 5323 |
| 688 | Ga0495658_0051082 | 3300046683 | Bacteria | 2341 |
| 689 | Ga0495613_0015671 | 3300046689 | Bacteria | 5641 |
| 690 | Ga0495613_0032000 | 3300046689 | Bacteria | 3907 |
| 691 | Ga0495613_0040997 | 3300046689 | Bacteria | 3429 |
| 692 | Ga0495613_0088773 | 3300046689 | Bacteria | 2240 |
| 693 | Ga0495624_0030943 | 3300046690 | Bacteria | 3484 |
| 694 | Ga0495624_0034495 | 3300046690 | Bacteria | 3272 |
| 695 | Ga0495624_0034767 | 3300046690 | Bacteria | 3257 |
| 696 | Ga0495624_0091681 | 3300046690 | Bacteria | 1874 |
| 697 | Ga0495600_0009464 | 3300046809 | Bacteria | 6020 |
| 698 | Ga0495600_0011208 | 3300046809 | Bacteria | 5585 |
| 699 | Ga0495600_0014018 | 3300046809 | Bacteria | 5049 |
| 700 | Ga0495600_0020085 | 3300046809 | Bacteria | 4272 |
| 701 | Ga0495600_0028753 | 3300046809 | Bacteria | 3597 |
| 702 | Ga0495600_0029305 | 3300046809 | Bacteria | 3563 |
| 703 | Ga0495581_0006780 | 3300047315 | Bacteria | 6638 |
| 704 | Ga0495581_0055827 | 3300047315 | Bacteria | 2279 |
| 705 | Ga0495604_0000161 | 3300047317 | Bacteria | 59093 |
| 706 | Ga0495604_0002557 | 3300047317 | Bacteria | 14546 |
| 707 | Ga0495604_0009103 | 3300047317 | Bacteria | 7857 |
| 708 | Ga0495604_0011992 | 3300047317 | Bacteria | 6890 |
| 709 | Ga0495604_0012311 | 3300047317 | Bacteria | 6800 |
| 710 | Ga0495604_0043812 | 3300047317 | Bacteria | 3500 |
| 711 | Ga0495604_0106234 | 3300047317 | Bacteria | 2054 |
| 712 | Ga0495674_0012623 | 3300047319 | Bacteria | 7960 |
| 713 | Ga0495674_0053199 | 3300047319 | Bacteria | 3560 |
| 714 | Ga0495674_0135608 | 3300047319 | Bacteria | 2071 |
| 715 | Ga0495676_0005210 | 3300047321 | Bacteria | 11893 |
| 716 | Ga0495676_0020253 | 3300047321 | Bacteria | 5841 |
| 717 | Ga0495676_0030823 | 3300047321 | Bacteria | 4544 |
| 718 | Ga0495676_0046854 | 3300047321 | Bacteria | 3503 |
| 719 | Ga0495676_0083475 | 3300047321 | Bacteria | 2414 |
| 720 | Ga0495680_0004695 | 3300047322 | Bacteria | 13009 |
| 721 | Ga0495680_0007013 | 3300047322 | Bacteria | 10389 |
| 722 | Ga0495680_0023511 | 3300047322 | Bacteria | 5122 |
| 723 | Ga0495680_0040898 | 3300047322 | Bacteria | 3689 |
| 724 | Ga0495680_0046760 | 3300047322 | Bacteria | 3409 |
| 725 | Ga0495687_003567 | 3300047443 | Bacteria | 11164 |
| 726 | Ga0495675_0002978 | 3300047444 | Bacteria | 10167 |
| 727 | Ga0495675_0007679 | 3300047444 | Bacteria | 6652 |
| 728 | Ga0495675_0007682 | 3300047444 | Bacteria | 6651 |
| 729 | Ga0495675_0010155 | 3300047444 | Bacteria | 5871 |
| 730 | Ga0495675_0011761 | 3300047444 | Bacteria | 5499 |
| 731 | Ga0495685_017124 | 3300047447 | Bacteria | 2480 |
| 732 | Ga0495684_0002750 | 3300047471 | Bacteria | 13905 |
| 733 | Ga0495684_0002944 | 3300047471 | Bacteria | 13416 |
| 734 | Ga0495684_0006983 | 3300047471 | Bacteria | 8768 |
| 735 | Ga0495684_0052798 | 3300047471 | Bacteria | 3101 |
| 736 | Ga0495684_0055420 | 3300047471 | Bacteria | 3023 |
| 737 | Ga0495684_0062697 | 3300047471 | Bacteria | 2827 |
| 738 | Ga0495593_0015283 | 3300047673 | Bacteria | 4351 |
| 739 | Ga0495593_0023848 | 3300047673 | Bacteria | 3395 |
| 740 | Ga0495593_0049092 | 3300047673 | Bacteria | 2240 |
| 741 | Ga0495602_0000182 | 3300048088 | Bacteria | 59124 |
| 742 | Ga0495602_0038715 | 3300048088 | Bacteria | 4403 |
| 743 | Ga0495602_0041925 | 3300048088 | Bacteria | 4175 |
| 744 | Ga0495602_0043021 | 3300048088 | Bacteria | 4110 |
| 745 | Ga0495602_0049803 | 3300048088 | Bacteria | 3748 |
| 746 | Ga0495602_0076720 | 3300048088 | Bacteria | 2830 |
| 747 | Ga0495614_0037738 | 3300048089 | Bacteria | 2073 |
| 748 | Ga0496101_0047351 | 3300048904 | Bacteria | 3086 |
| 749 | Ga0496101_0061554 | 3300048904 | Bacteria | 2726 |
| 750 | Ga0496102_0013379 | 3300048905 | Bacteria | 7107 |
| 751 | Ga0496102_0065703 | 3300048905 | Bacteria | 3325 |
| 752 | Ga0496102_0124101 | 3300048905 | Bacteria | 2413 |
| 753 | Ga0496102_0199975 | 3300048905 | Bacteria | 1883 |
| 754 | Ga0496103_0002735 | 3300048906 | Bacteria | 11006 |
| 755 | Ga0496103_0013447 | 3300048906 | Bacteria | 4854 |
| 756 | Ga0496104_0012811 | 3300048907 | Bacteria | 7552 |
| 757 | Ga0496104_0016531 | 3300048907 | Bacteria | 6704 |
| 758 | Ga0496104_0104429 | 3300048907 | Bacteria | 2715 |
| 759 | Ga0496104_0133039 | 3300048907 | Bacteria | 2389 |
| 760 | Ga0496104_0135243 | 3300048907 | Bacteria | 2368 |
| 761 | Ga0496105_0001730 | 3300048908 | Bacteria | 15611 |
| 762 | Ga0496105_0002855 | 3300048908 | Bacteria | 12645 |
| 763 | Ga0496105_0023038 | 3300048908 | Bacteria | 5049 |
| 764 | Ga0496106_0014818 | 3300048909 | Bacteria | 5764 |
| 765 | Ga0496107_0032783 | 3300048910 | Bacteria | 3714 |
| 766 | Ga0496108_0002365 | 3300048911 | Bacteria | 15107 |
| 767 | Ga0496108_0008143 | 3300048911 | Bacteria | 8501 |
| 768 | Ga0496108_0089477 | 3300048911 | Bacteria | 2616 |
| 769 | Ga0496108_0114941 | 3300048911 | Bacteria | 2304 |
| 770 | Ga0496108_0117891 | 3300048911 | Bacteria | 2275 |
| 771 | Ga0496109_0012022 | 3300048912 | Bacteria | 7455 |
| 772 | Ga0496109_0035580 | 3300048912 | Bacteria | 4493 |
| 773 | Ga0496109_0062801 | 3300048912 | Bacteria | 3397 |
| 774 | Ga0496110_0003627 | 3300048913 | Bacteria | 11876 |
| 775 | Ga0496110_0018756 | 3300048913 | Bacteria | 5805 |
| 776 | Ga0496110_0090641 | 3300048913 | Bacteria | 2733 |
| 777 | Ga0496111_0039696 | 3300048914 | Bacteria | 3377 |
| 778 | Ga0496112_0019138 | 3300048915 | Bacteria | 6456 |
| 779 | Ga0496112_0044614 | 3300048915 | Bacteria | 4345 |
| 780 | Ga0496112_0048961 | 3300048915 | Bacteria | 4141 |
| 781 | Ga0496113_0007107 | 3300048916 | Bacteria | 7166 |
| 782 | Ga0496113_0056171 | 3300048916 | Bacteria | 2954 |
| 783 | Ga0496114_0008348 | 3300048917 | Bacteria | 8205 |
| 784 | Ga0496114_0012039 | 3300048917 | Bacteria | 6920 |
| 785 | Ga0496114_0055285 | 3300048917 | Bacteria | 3311 |
| 786 | Ga0496114_0070842 | 3300048917 | Bacteria | 2929 |
| 787 | Ga0496114_0113931 | 3300048917 | Bacteria | 2318 |
| 788 | Ga0496115_0014904 | 3300048918 | Bacteria | 5894 |
| 789 | Ga0496115_0029372 | 3300048918 | Bacteria | 4318 |
| 790 | Ga0496116_0000165 | 3300048919 | Bacteria | 133688 |
| 791 | Ga0496117_0002355 | 3300048920 | Bacteria | 24155 |
| 792 | Ga0496117_0007254 | 3300048920 | Bacteria | 10896 |
| 793 | Ga0496118_0004719 | 3300048921 | Bacteria | 15955 |
| 794 | Ga0496118_0009080 | 3300048921 | Bacteria | 10128 |
| 795 | Ga0496119_0000375 | 3300048922 | Bacteria | 61774 |
| 796 | Ga0496119_0003013 | 3300048922 | Bacteria | 17835 |
| 797 | Ga0496119_0010507 | 3300048922 | Bacteria | 7781 |
| 798 | Ga0496119_0010538 | 3300048922 | Bacteria | 7761 |
| 799 | Ga0496120_0000453 | 3300048923 | Bacteria | 64868 |
| 800 | Ga0496120_0004273 | 3300048923 | Bacteria | 12140 |
| 801 | Ga0496120_0011458 | 3300048923 | Bacteria | 6095 |
| 802 | Ga0496121_0043764 | 3300048924 | Bacteria | 3872 |
| 803 | Ga0496121_0047048 | 3300048924 | Bacteria | 3684 |
| 804 | Ga0496126_0000676 | 3300048929 | Bacteria | 62750 |
| 805 | Ga0496126_0027059 | 3300048929 | Bacteria | 5487 |
| 806 | Ga0496126_0072013 | 3300048929 | Bacteria | 3075 |
| 807 | Ga0496126_0107474 | 3300048929 | Bacteria | 2433 |
| 808 | Ga0496126_0110630 | 3300048929 | Bacteria | 2393 |
| 809 | Ga0496126_0113416 | 3300048929 | Bacteria | 2359 |
| 810 | Ga0501031_0000714 | 3300049568 | Bacteria | 19874 |
| 811 | Ga0501031_0006968 | 3300049568 | Bacteria | 7382 |
| 812 | Ga0501031_0050578 | 3300049568 | Bacteria | 2707 |
| 813 | Ga0501031_0103648 | 3300049568 | Bacteria | 1856 |
| 814 | Ga0501032_0003502 | 3300049569 | Bacteria | 11993 |
| 815 | Ga0501032_0005443 | 3300049569 | Bacteria | 9450 |
| 816 | Ga0501032_0013867 | 3300049569 | Bacteria | 5717 |
| 817 | Ga0501032_0061848 | 3300049569 | Bacteria | 2510 |
| 818 | Ga0501032_0078279 | 3300049569 | Bacteria | 2201 |
| 819 | Ga0501033_0006257 | 3300049570 | Bacteria | 9329 |
| 820 | Ga0501033_0009672 | 3300049570 | Bacteria | 7414 |
| 821 | Ga0501033_0055904 | 3300049570 | Bacteria | 2917 |
| 822 | Ga0501033_0067622 | 3300049570 | Bacteria | 2627 |
| 823 | Ga0501033_0072890 | 3300049570 | Bacteria | 2521 |
| 824 | Ga0501033_0142363 | 3300049570 | Bacteria | 1733 |
| 825 | Ga0501034_0004843 | 3300049571 | Bacteria | 14867 |
| 826 | Ga0501034_0005064 | 3300049571 | Bacteria | 14478 |
| 827 | Ga0501034_0011314 | 3300049571 | Bacteria | 9256 |
| 828 | Ga0501034_0097032 | 3300049571 | Bacteria | 2943 |
| 829 | Ga0501036_0010884 | 3300049572 | Bacteria | 7517 |
| 830 | Ga0501036_0019934 | 3300049572 | Bacteria | 5630 |
| 831 | Ga0501036_0237999 | 3300049572 | Bacteria | 1527 |
| 832 | Ga0501037_0008312 | 3300049573 | Bacteria | 7606 |
| 833 | Ga0501037_0016986 | 3300049573 | Bacteria | 5355 |
| 834 | Ga0501037_0023492 | 3300049573 | Bacteria | 4559 |
| 835 | Ga0501037_0063487 | 3300049573 | Bacteria | 2692 |
| 836 | Ga0501038_0013926 | 3300049574 | Bacteria | 7330 |
| 837 | Ga0501038_0123120 | 3300049574 | Bacteria | 2136 |
| 838 | Ga0501038_0209504 | 3300049574 | Bacteria | 1560 |
| 839 | Ga0501039_0002152 | 3300049575 | Bacteria | 14572 |
| 840 | Ga0501039_0072978 | 3300049575 | Bacteria | 2667 |
| 841 | Ga0501039_0109760 | 3300049575 | Bacteria | 2156 |
| 842 | Ga0501040_0143173 | 3300049576 | Bacteria | 1684 |
| 843 | Ga0501041_0121650 | 3300049577 | Bacteria | 1622 |
| 844 | Ga0501042_0023401 | 3300049578 | Bacteria | 4323 |
| 845 | Ga0501042_0045990 | 3300049578 | Bacteria | 3111 |
| 846 | Ga0501043_0002910 | 3300049579 | Bacteria | 14293 |
| 847 | Ga0501043_0034256 | 3300049579 | Bacteria | 3994 |
| 848 | Ga0501043_0047789 | 3300049579 | Bacteria | 3364 |
| 849 | Ga0501046_0000046 | 3300049580 | Bacteria | 144066 |
| 850 | Ga0501046_0001735 | 3300049580 | Bacteria | 20794 |
| 851 | Ga0501046_0005551 | 3300049580 | Bacteria | 11269 |
| 852 | Ga0501046_0038992 | 3300049580 | Bacteria | 3808 |
| 853 | Ga0501046_0050421 | 3300049580 | Bacteria | 3288 |
| 854 | Ga0501046_0082200 | 3300049580 | Bacteria | 2488 |
| 855 | Ga0501047_0000268 | 3300049581 | Bacteria | 60315 |
| 856 | Ga0501047_0002183 | 3300049581 | Bacteria | 18725 |
| 857 | Ga0501047_0008059 | 3300049581 | Bacteria | 9941 |
| 858 | Ga0501047_0025578 | 3300049581 | Bacteria | 5675 |
| 859 | Ga0501047_0033406 | 3300049581 | Bacteria | 4965 |
| 860 | Ga0501047_0163413 | 3300049581 | Bacteria | 2098 |
| 861 | Ga0501048_0002880 | 3300049582 | Bacteria | 13123 |
| 862 | Ga0501048_0026207 | 3300049582 | Bacteria | 4244 |
| 863 | Ga0501048_0068208 | 3300049582 | Bacteria | 2513 |
| 864 | Ga0501068_0049315 | 3300049584 | Bacteria | 2542 |
| 865 | Ga0501068_0075529 | 3300049584 | Bacteria | 2062 |
| 866 | Ga0501069_0006022 | 3300049585 | Bacteria | 6328 |
| 867 | Ga0501070_0022144 | 3300049586 | Bacteria | 5323 |
| 868 | Ga0501070_0029658 | 3300049586 | Bacteria | 4584 |
| 869 | Ga0501070_0064642 | 3300049586 | Bacteria | 3029 |
| 870 | Ga0501073_0015061 | 3300049589 | Bacteria | 5609 |
| 871 | Ga0501073_0024223 | 3300049589 | Bacteria | 4358 |
| 872 | Ga0501074_0001157 | 3300049590 | Bacteria | 17270 |
| 873 | Ga0501074_0073476 | 3300049590 | Bacteria | 2456 |
| 874 | Ga0501074_0152253 | 3300049590 | Bacteria | 1653 |
| 875 | Ga0501076_0112428 | 3300049592 | Bacteria | 2202 |
| 876 | Ga0501079_0003055 | 3300049741 | Bacteria | 12245 |
| 877 | Ga0501079_0111706 | 3300049741 | Bacteria | 2124 |
| 878 | Ga0501080_0001035 | 3300049742 | Bacteria | 22914 |
| 879 | Ga0501080_0016596 | 3300049742 | Bacteria | 6802 |
| 880 | Ga0501083_0152203 | 3300049744 | Bacteria | 1515 |
| 881 | Ga0501035_0014942 | 3300049822 | Bacteria | 7164 |
| 882 | Ga0501035_0020279 | 3300049822 | Bacteria | 6103 |
| 883 | Ga0501035_0024157 | 3300049822 | Bacteria | 5576 |
| 884 | Ga0501035_0234920 | 3300049822 | Bacteria | 1561 |
| 885 | Ga0501044_0001019 | 3300049823 | Bacteria | 33719 |
| 886 | Ga0501044_0005882 | 3300049823 | Bacteria | 13589 |
| 887 | Ga0501044_0011020 | 3300049823 | Bacteria | 9811 |
| 888 | Ga0501044_0017181 | 3300049823 | Bacteria | 7761 |
| 889 | Ga0501044_0021124 | 3300049823 | Bacteria | 6950 |
| 890 | Ga0501044_0043045 | 3300049823 | Bacteria | 4692 |
| 891 | Ga0501044_0045566 | 3300049823 | Bacteria | 4543 |
| 892 | Ga0501044_0066591 | 3300049823 | Bacteria | 3672 |
| 893 | Ga0501044_0068391 | 3300049823 | Bacteria | 3618 |
| 894 | Ga0501044_0091273 | 3300049823 | Bacteria | 3072 |
| 895 | Ga0501044_0102696 | 3300049823 | Bacteria | 2874 |
| 896 | Ga0501044_0173627 | 3300049823 | Bacteria | 2125 |
| 897 | Ga0501045_0141461 | 3300049824 | Bacteria | 1789 |
| 898 | nmdc:mga00v17_39789_c1 | 3300050491 | Bacteria | 2817 |
| 899 | nmdc:mga00v17_8489_c1 | 3300050491 | Bacteria | 5528 |
| 900 | nmdc:mga07m45_29369_c1 | 3300050496 | Bacteria | 3040 |
| 901 | nmdc:mga05p37_11899_c1 | 3300050507 | Bacteria | 10376 |
| 902 | nmdc:mga05p37_9076_c1 | 3300050507 | Bacteria | 11754 |
| 903 | nmdc:mga0qj67_695_c1 | 3300050509 | Bacteria | 22912 |
| 904 | nmdc:mga06r32_294003_c1 | 3300050510 | Bacteria | 1611 |
| 905 | nmdc:mga08y16_155725_c1 | 3300050511 | Bacteria | 2375 |
| 906 | nmdc:mga08y16_5523_c1 | 3300050511 | Bacteria | 13234 |
| 907 | nmdc:mga0n895_207316_c1 | 3300050512 | Bacteria | 1991 |
| 908 | nmdc:mga0n895_4481_c1 | 3300050512 | Bacteria | 11480 |
| 909 | nmdc:mga0rr50_10842_c1 | 3300050513 | Bacteria | 5810 |
| 910 | nmdc:mga0rr50_16896_c1 | 3300050513 | Bacteria | 4859 |
| 911 | nmdc:mga08x19_6337_c1 | 3300050514 | Bacteria | 7007 |
| 912 | nmdc:mga0a205_1359_c1 | 3300050515 | Bacteria | 20623 |
| 913 | Ga0495601_0027111 | 3300053077 | Bacteria | 3541 |
| 914 | Ga0495612_0033808 | 3300053078 | Bacteria | 2069 |
| 915 | Ga0495595_0006267 | 3300053084 | Bacteria | 4845 |
| 916 | Ga0495595_0032638 | 3300053084 | Bacteria | 2345 |
| 917 | Ga0495619_0009436 | 3300053085 | Bacteria | 6155 |
| 918 | Ga0495619_0047753 | 3300053085 | Bacteria | 2820 |
| 919 | Ga0495619_0057561 | 3300053085 | Bacteria | 2579 |
| 920 | Ga0495619_0160847 | 3300053085 | Bacteria | 1551 |
| 921 | Ga0500614_017827 | 3300053123 | Bacteria | 1609 |
| 922 | Ga0500568_0002651 | 3300053139 | Bacteria | 10388 |
| 923 | Ga0500568_0003582 | 3300053139 | Bacteria | 8575 |
| 924 | Ga0500573_0004254 | 3300053140 | Bacteria | 7502 |
| 925 | Ga0500573_0079129 | 3300053140 | Bacteria | 1870 |
| 926 | Ga0500616_0000071 | 3300053153 | Bacteria | 232527 |
| 927 | Ga0500616_0000643 | 3300053153 | Bacteria | 42016 |
| 928 | Ga0500620_000387 | 3300053155 | Bacteria | 8152 |
| 929 | Ga0501082_0092669 | 3300060353 | Bacteria | 2610 |
| 930 | Ga0466962_0024949 | 3300061719 | Bacteria | 2871 |
| 931 | Ga0530510_0018512 | 3300061734 | Bacteria | 4938 |
| 932 | 2689991649 | 2687453743 | Bacteria | 8361025 |
| 933 | 2506867831 | 2506783011 | Bacteria | 5323186 |
| 934 | 2508678196 | 2508501039 | Bacteria | 9978592 |
| 935 | 2515718917 | 2515154129 | Bacteria | 5584369 |
| 936 | 2517759690 | 2517572101 | Bacteria | 6884336 |
| 937 | 2528205552 | 2527291627 | Bacteria | 5309833 |
| 938 | 2528214971 | 2527291629 | Bacteria | 5267418 |
| 939 | 2546950329 | 2546825537 | Bacteria | 5389291 |
| 940 | 2554259473 | 2554235005 | Bacteria | 6457341 |
| 941 | 2579750245 | 2576861822 | Bacteria | 5004595 |
| 942 | 2579856476 | 2579778521 | Bacteria | 7624758 |
| 943 | 2583153418 | 2582580736 | Bacteria | 5325865 |
| 944 | 2585302007 | 2582581312 | Bacteria | 7308206 |
| 945 | 2585303625 | 2582581313 | Bacteria | 10042643 |
| 946 | 2616900753 | 2616644941 | Bacteria | 8510691 |
| 947 | 2619858078 | 2619618881 | Bacteria | 7521104 |
| 948 | 2620352617 | 2619619003 | Bacteria | 7619552 |
| 949 | 2623501120 | 2622736605 | Bacteria | 4992138 |
| 950 | 2626639666 | 2626541554 | Bacteria | 7741902 |
| 951 | 2643904554 | 2643221578 | Bacteria | 9213798 |
| 952 | 2644183855 | 2643221632 | Bacteria | 3406696 |
| 953 | 2644198588 | 2643221635 | Bacteria | 2632343 |
| 954 | 2644406180 | 2643221673 | Bacteria | 9196637 |
| 955 | 2644611656 | 2643221711 | Bacteria | 4865335 |
| 956 | 2671839071 | 2671180195 | Bacteria | 9757215 |
| 957 | 2676201709 | 2675902999 | Bacteria | 9438463 |
| 958 | 2676476048 | 2675903058 | Bacteria | 6822861 |
| 959 | 2686537796 | 2684623035 | Bacteria | 8032739 |
| 960 | 2686543135 | 2684623036 | Bacteria | 5199090 |
| 961 | 2689956222 | 2687453737 | Bacteria | 11203906 |
| 962 | 2710603811 | 2710264753 | Bacteria | 5455564 |
| 963 | 2731907034 | 2731639228 | Bacteria | 4187555 |
| 964 | 2774846285 | 2773857921 | Bacteria | 9435764 |
| 965 | 2774857227 | 2773857922 | Bacteria | 9757215 |
| 966 | 2774866102 | 2773857924 | Bacteria | 5256821 |
| 967 | 2774904259 | 2773857933 | Bacteria | 5818019 |
| 968 | 2784586819 | 2784132148 | Bacteria | 8627943 |
| 969 | 2786668276 | 2786546132 | Bacteria | 10419719 |
| 970 | 2793983468 | 2791355406 | Bacteria | 11364898 |
| 971 | 2795797751 | 2795385472 | Bacteria | 6627535 |
| 972 | 2799183911 | 2799112218 | Bacteria | 4315149 |
| 973 | 2809227057 | 2808606447 | Bacteria | 3572005 |
| 974 | 2809230385 | 2808606448 | Bacteria | 8656184 |
| 975 | 2811847039 | 2808606982 | Bacteria | 7791042 |
| 976 | 2819427960 | 2818991318 | Bacteria | 5266538 |
| 977 | 2827630610 | 2827628540 | Bacteria | 6858585 |
| 978 | 2852633557 | 2852632344 | Bacteria | 3463163 |
| 979 | 2856742490 | 2856741275 | Bacteria | 8096094 |
| 980 | 2857733593 | 2857729791 | Bacteria | 4040535 |
| 981 | 2861527630 | 2861520306 | Bacteria | 8348283 |
| 982 | 2862186184 | 2862178590 | Bacteria | 8583590 |
| 983 | 2862295316 | 2862290372 | Bacteria | 7471434 |
| 984 | 2862295562 | 2862290372 | Bacteria | 7471434 |
| 985 | 2866557123 | 2866552031 | Bacteria | 5824618 |
| 986 | 2866618212 | 2866612099 | Bacteria | 7543886 |
| 987 | 2867429806 | 2867428634 | Bacteria | 9590268 |
| 988 | 2867480855 | 2867475112 | Bacteria | 6909112 |
| 989 | 2873157616 | 2873151551 | Bacteria | 8625867 |
| 990 | 2873319326 | 2873314349 | Bacteria | 8512634 |
| 991 | 2875392760 | 2875391855 | Bacteria | 7600475 |
| 992 | 2877683318 | 2877676314 | Bacteria | 9512378 |
| 993 | 2891403605 | 2891395885 | Bacteria | 9251614 |
| 994 | 2891556140 | 2891554331 | Bacteria | 8812224 |
| 995 | 2891563883 | 2891562705 | Bacteria | 8039471 |
| 996 | 2895662796 | 2895660088 | Bacteria | 3782833 |
| 997 | 2895888740 | 2895880812 | Bacteria | 11255272 |
| 998 | 2897564754 | 2897561785 | Bacteria | 3256946 |
| 999 | 2912758958 | 2912757875 | Bacteria | 7940295 |
| 1000 | 2918502588 | 2918501144 | Bacteria | 8668083 |
| 1001 | 2919057288 | 2919055335 | Bacteria | 3875751 |
| 1002 | 2919472120 | 2919468124 | Bacteria | 9133025 |
| 1003 | 2928124606 | 2928121344 | Bacteria | 3972376 |
| 1004 | 2939663718 | 2939660829 | Bacteria | 3784848 |
| 1005 | 2946051955 | 2946045630 | Bacteria | 8527308 |
| 1006 | 2954011002 | 2954002825 | Bacteria | 9173742 |
| 1007 | 2954699354 | 2954691527 | Bacteria | 10720516 |
| 1008 | 2954702865 | 2954701450 | Bacteria | 10834262 |
| 1009 | 2954718296 | 2954711539 | Bacteria | 10867210 |
| 1010 | 2954728266 | 2954721474 | Bacteria | 10456478 |
| 1011 | 2954733544 | 2954731030 | Bacteria | 10243860 |
| 1012 | 2954747160 | 2954740390 | Bacteria | 10229294 |
| 1013 | 2954752427 | 2954749733 | Bacteria | 10366972 |
| 1014 | 2954766273 | 2954759201 | Bacteria | 9358192 |
| 1015 | 2966604316 | 2966598605 | Bacteria | 7676064 |
| 1016 | 2997605606 | 2997600082 | Bacteria | 9896405 |
| 1017 | 3006327931 | 3006321560 | Bacteria | 8247479 |
| 1018 | 637880492 | 637000116 | Bacteria | 5433628 |
| 1019 | 8002782778 | 8002775197 | Bacteria | 10728764 |
| 1020 | 8002788593 | 8002784119 | Bacteria | 9788632 |
| 1021 | 8023628519 | 8023623736 | Bacteria | 8593882 |
| 1022 | 8025481224 | 8025478263 | Bacteria | 8209203 |
| 1023 | 8025531021 | 8025530807 | Bacteria | 8495698 |
| 1024 | 8048364119 | 8048356638 | Bacteria | 11044339 |
| 1025 | 8054914100 | 8054913762 | Bacteria | 7713009 |
| 1026 | 8054922894 | 8054920844 | Bacteria | 7068637 |
| 1027 | 8055068479 | 8055066027 | Bacteria | 9479577 |
| 1028 | 8055162373 | 8055157932 | Bacteria | 6429399 |
| 1029 | 8055181035 | 8055172936 | Bacteria | 9305943 |
| 1030 | 8056210695 | 8056207758 | Bacteria | 8639239 |
| 1031 | 8056449304 | 8056447290 | Bacteria | 7680491 |
| 1032 | 8056670176 | 8056667051 | Bacteria | 6953971 |
| 1033 | 8057349524 | 8057345674 | Bacteria | 4160394 |
| 1034 | 8057568516 | 8057568493 | Bacteria | 7221719 |
| 1035 | JGI25406J46586_10001239 | |||
| 1036 | JGI25407J50210_10005010 | |||
| 1037 | Ga0070658_10000155 | |||
| 1038 | Ga0070658_10002940 | |||
| 1039 | Ga0070658_10029662 | |||
| 1040 | Ga0070658_10157737 | |||
| 1041 | Ga0070690_100102271 | |||
| 1042 | Ga0068869_100023645 | |||
| 1043 | Ga0068869_100026269 | |||
| 1044 | Ga0070680_100001962 | |||
| 1045 | Ga0070680_100026940 | |||
| 1046 | Ga0070680_100028822 | |||
| 1047 | Ga0070680_100045036 | |||
| 1048 | Ga0070680_100090868 | |||
| 1049 | Ga0070682_100106717 | |||
| 1050 | Ga0068868_100013822 | |||
| 1051 | Ga0070660_100011330 | |||
| 1052 | Ga0070660_100029298 | |||
| 1053 | Ga0070660_100135097 | |||
| 1054 | Ga0070660_100139665 | |||
| 1055 | Ga0070689_100123691 | |||
| 1056 | Ga0070661_100150501 | |||
| 1057 | Ga0070675_100000432 | |||
| 1058 | Ga0070671_100009876 | |||
| 1059 | Ga0070659_100022854 | |||
| 1060 | Ga0070659_100043762 | |||
| 1061 | Ga0070659_100074131 | |||
| 1062 | Ga0070659_100074141 | |||
| 1063 | Ga0070667_100041762 | |||
| 1064 | Ga0070667_100083388 | |||
| 1065 | Ga0070709_10004934 | |||
| 1066 | Ga0070714_100001145 | |||
| 1067 | Ga0070714_100004012 | |||
| 1068 | Ga0070714_100008229 | |||
| 1069 | Ga0070714_100034331 | |||
| 1070 | Ga0070714_100070777 | |||
| 1071 | Ga0070713_100005230 | |||
| 1072 | Ga0070713_100014998 | |||
| 1073 | Ga0070713_100044036 | |||
| 1074 | Ga0070713_100074312 | |||
| 1075 | Ga0070713_100080927 | |||
| 1076 | Ga0070713_100203340 | |||
| 1077 | Ga0070710_10001141 | |||
| 1078 | Ga0070710_10001374 | |||
| 1079 | Ga0070710_10021293 | |||
| 1080 | Ga0070710_10076569 | |||
| 1081 | Ga0070711_100004625 | |||
| 1082 | Ga0070700_100025985 | |||
| 1083 | Ga0070708_100022408 | |||
| 1084 | Ga0070663_100035622 | |||
| 1085 | Ga0070663_100054412 | |||
| 1086 | Ga0070678_100041789 | |||
| 1087 | Ga0070662_100019366 | |||
| 1088 | Ga0070681_10000504 | |||
| 1089 | Ga0070681_10082341 | |||
| 1090 | Ga0070681_10288912 | |||
| 1091 | Ga0070706_100004502 | |||
| 1092 | Ga0070706_100022790 | |||
| 1093 | Ga0070706_100027267 | |||
| 1094 | Ga0070706_100032645 | |||
| 1095 | Ga0070706_100032981 | |||
| 1096 | Ga0070706_100061620 | |||
| 1097 | Ga0070706_100151403 | |||
| 1098 | Ga0070707_100002548 | |||
| 1099 | Ga0070707_100003790 | |||
| 1100 | Ga0070707_100058478 | |||
| 1101 | Ga0070707_100065381 | |||
| 1102 | Ga0070707_100117717 | |||
| 1103 | Ga0070707_100158936 | |||
| 1104 | Ga0070698_100002410 | |||
| 1105 | Ga0070698_100006733 | |||
| 1106 | Ga0070698_100019009 | |||
| 1107 | Ga0070698_100121782 | |||
| 1108 | Ga0070699_100144275 | |||
| 1109 | Ga0070679_100005358 | |||
| 1110 | Ga0070679_100036362 | |||
| 1111 | Ga0070679_100134258 | |||
| 1112 | Ga0070679_100140725 | |||
| 1113 | Ga0070684_100043382 | |||
| 1114 | Ga0070684_100211996 | |||
| 1115 | Ga0070697_100152242 | |||
| 1116 | Ga0070672_100108227 | |||
| 1117 | Ga0070696_100101654 | |||
| 1118 | Ga0070665_100054549 | |||
| 1119 | Ga0070665_100063573 | |||
| 1120 | Ga0070665_100067805 | |||
| 1121 | Ga0070665_100154454 | |||
| 1122 | Ga0070704_100055382 | |||
| 1123 | Ga0068855_100012387 | |||
| 1124 | Ga0068855_100019603 | |||
| 1125 | Ga0068855_100034580 | |||
| 1126 | Ga0068855_100296892 | |||
| 1127 | Ga0070664_100001189 | |||
| 1128 | Ga0068857_100071939 | |||
| 1129 | Ga0068854_100045745 | |||
| 1130 | Ga0068856_100050508 | |||
| 1131 | Ga0068856_100156691 | |||
| 1132 | Ga0070702_100013168 | |||
| 1133 | Ga0068852_100009673 | |||
| 1134 | Ga0068852_100018879 | |||
| 1135 | Ga0068852_100191252 | |||
| 1136 | Ga0068859_100002262 | |||
| 1137 | Ga0068859_100066859 | |||
| 1138 | Ga0068859_100282615 | |||
| 1139 | Ga0068861_100025747 | |||
| 1140 | Ga0068863_100007064 | |||
| 1141 | Ga0068863_100008788 | |||
| 1142 | Ga0068863_100013852 | |||
| 1143 | Ga0068863_100089770 | |||
| 1144 | Ga0068858_100000032 | |||
| 1145 | Ga0068858_100014430 | |||
| 1146 | Ga0068858_100116303 | |||
| 1147 | Ga0068860_100001541 | |||
| 1148 | Ga0068860_100279263 | |||
| 1149 | Ga0068862_100000021 | |||
| 1150 | Ga0068862_100132511 | |||
| 1151 | Ga0081455_10000117 | |||
| 1152 | Ga0081455_10000943 | |||
| 1153 | Ga0081455_10036026 | |||
| 1154 | Ga0081455_10062835 | |||
| 1155 | Ga0081538_10000008 | |||
| 1156 | Ga0081538_10004860 | |||
| 1157 | Ga0081540_1001691 | |||
| 1158 | Ga0081539_10001536 | |||
| 1159 | Ga0081539_10002043 | |||
| 1160 | Ga0070717_10009527 | |||
| 1161 | Ga0070717_10084774 | |||
| 1162 | Ga0070717_10097747 | |||
| 1163 | Ga0075363_100011120 | |||
| 1164 | Ga0075364_10054662 | |||
| 1165 | Ga0075432_10000747 | |||
| 1166 | Ga0075432_10002780 | |||
| 1167 | Ga0070715_10001858 | |||
| 1168 | Ga0070715_10077563 | |||
| 1169 | Ga0070716_100000107 | |||
| 1170 | Ga0070716_100001032 | |||
| 1171 | Ga0070716_100026556 | |||
| 1172 | Ga0070716_100036091 | |||
| 1173 | Ga0070712_100013526 | |||
| 1174 | Ga0070712_100021377 | |||
| 1175 | Ga0070712_100075464 | |||
| 1176 | Ga0075370_10004205 | |||
| 1177 | Ga0068871_100015523 | |||
| 1178 | Ga0068871_100066435 | |||
| 1179 | Ga0075428_100094224 | |||
| 1180 | Ga0075431_100009739 | |||
| 1181 | Ga0075433_10003991 | |||
| 1182 | Ga0075433_10004634 | |||
| 1183 | Ga0075433_10040914 | |||
| 1184 | Ga0075433_10046700 | |||
| 1185 | Ga0075433_10101347 | |||
| 1186 | Ga0075434_100005761 | |||
| 1187 | Ga0075434_100024785 | |||
| 1188 | Ga0075434_100036281 | |||
| 1189 | Ga0068865_100023825 | |||
| 1190 | Ga0068865_100026060 | |||
| 1191 | Ga0068865_100074547 | |||
| 1192 | Ga0075436_100010015 | |||
| 1193 | Ga0097620_100002262 | |||
| 1194 | Ga0097620_100066854 | |||
| 1195 | Ga0097620_100282612 | |||
| 1196 | Ga0075435_100003227 | |||
| 1197 | Ga0075435_100031679 | |||
| 1198 | Ga0075435_100058846 | |||
| 1199 | Ga0105251_10015488 | |||
| 1200 | Ga0105240_10023577 | |||
| 1201 | Ga0105240_10033631 | |||
| 1202 | Ga0105240_10062564 | |||
| 1203 | Ga0111539_10000158 | |||
| 1204 | Ga0111539_10012622 | |||
| 1205 | Ga0111539_10053176 | |||
| 1206 | Ga0105245_10006017 | |||
| 1207 | Ga0105245_10030109 | |||
| 1208 | Ga0105247_10000164 | |||
| 1209 | Ga0105247_10013514 | |||
| 1210 | Ga0114129_10003880 | |||
| 1211 | Ga0114129_10006158 | |||
| 1212 | Ga0114129_10381012 | |||
| 1213 | Ga0105243_10004679 | |||
| 1214 | Ga0105243_10015344 | |||
| 1215 | Ga0105243_10018374 | |||
| 1216 | Ga0105241_10000211 | |||
| 1217 | Ga0105241_10112876 | |||
| 1218 | Ga0105242_10041434 | |||
| 1219 | Ga0105242_10090994 | |||
| 1220 | Ga0105248_10008126 | |||
| 1221 | Ga0105248_10025426 | |||
| 1222 | Ga0105248_10084778 | |||
| 1223 | Ga0105248_10092052 | |||
| 1224 | Ga0105248_10092277 | |||
| 1225 | Ga0105237_10175971 | |||
| 1226 | Ga0105238_10135556 | |||
| 1227 | Ga0105249_10007978 | |||
| 1228 | Ga0105249_10018935 | |||
| 1229 | Ga0105249_10037975 | |||
| 1230 | Ga0105239_10221677 | |||
| 1231 | Ga0157371_10124312 | |||
| 1232 | Ga0157369_10003546 | |||
| 1233 | Ga0157369_10013234 | |||
| 1234 | Ga0157369_10015580 | |||
| 1235 | Ga0157369_10018498 | |||
| 1236 | Ga0157369_10101407 | |||
| 1237 | Ga0157369_10124574 | |||
| 1238 | Ga0157369_10160221 | |||
| 1239 | Ga0163162_10033407 | |||
| 1240 | Ga0157372_10051339 | |||
| 1241 | Ga0157372_10122109 | |||
| 1242 | Ga0157372_10362136 | |||
| 1243 | Ga0157375_10354597 | |||
| 1244 | Ga0163163_10003743 | |||
| 1245 | Ga0163163_10025818 | |||
| 1246 | Ga0163163_10061133 | |||
| 1247 | Ga0163163_10100616 | |||
| 1248 | Ga0163163_10125584 | |||
| 1249 | Ga0157380_10025917 | |||
| 1250 | Ga0157377_10052592 | |||
| 1251 | Ga0157379_10000802 | |||
| 1252 | Ga0163161_10021783 | |||
| 1253 | Ga0206353_11278065 | |||
| 1254 | Ga0213876_10008265 | |||
| 1255 | Ga0213876_10020805 | |||
| 1256 | Ga0213875_10000176 | |||
| 1257 | Ga0213875_10012930 | |||
| 1258 | Ga0213875_10022537 | |||
| 1259 | Ga0224712_10012656 | |||
| 1260 | Ga0224572_1002810 | |||
| 1261 | Ga0209148_1004143 | |||
| 1262 | Ga0209758_1018764 | |||
| 1263 | Ga0207653_10001877 | |||
| 1264 | Ga0207692_10002817 | |||
| 1265 | Ga0207692_10003209 | |||
| 1266 | Ga0207692_10007932 | |||
| 1267 | Ga0207692_10019912 | |||
| 1268 | Ga0207692_10030651 | |||
| 1269 | Ga0207710_10000082 | |||
| 1270 | Ga0207710_10000178 | |||
| 1271 | Ga0207688_10045759 | |||
| 1272 | Ga0207685_10016682 | |||
| 1273 | Ga0207699_10000162 | |||
| 1274 | Ga0207699_10003242 | |||
| 1275 | Ga0207699_10008552 | |||
| 1276 | Ga0207699_10009681 | |||
| 1277 | Ga0207699_10018654 | |||
| 1278 | Ga0207699_10019900 | |||
| 1279 | Ga0207705_10000595 | |||
| 1280 | Ga0207705_10036392 | |||
| 1281 | Ga0207684_10005597 | |||
| 1282 | Ga0207684_10008418 | |||
| 1283 | Ga0207684_10011027 | |||
| 1284 | Ga0207684_10028160 | |||
| 1285 | Ga0207684_10041912 | |||
| 1286 | Ga0207684_10059418 | |||
| 1287 | Ga0207684_10159732 | |||
| 1288 | Ga0207654_10000003 | |||
| 1289 | Ga0207707_10021899 | |||
| 1290 | Ga0207707_10031920 | |||
| 1291 | Ga0207707_10201279 | |||
| 1292 | Ga0207695_10009600 | |||
| 1293 | Ga0207695_10035988 | |||
| 1294 | Ga0207671_10047284 | |||
| 1295 | Ga0207693_10005465 | |||
| 1296 | Ga0207693_10011553 | |||
| 1297 | Ga0207693_10044954 | |||
| 1298 | Ga0207693_10049152 | |||
| 1299 | Ga0207663_10010235 | |||
| 1300 | Ga0207663_10013983 | |||
| 1301 | Ga0207660_10014279 | |||
| 1302 | Ga0207660_10020234 | |||
| 1303 | Ga0207660_10115961 | |||
| 1304 | Ga0207662_10111824 | |||
| 1305 | Ga0207657_10027505 | |||
| 1306 | Ga0207657_10120345 | |||
| 1307 | Ga0207657_10152508 | |||
| 1308 | Ga0207652_10001493 | |||
| 1309 | Ga0207652_10011363 | |||
| 1310 | Ga0207652_10130610 | |||
| 1311 | Ga0207652_10210737 | |||
| 1312 | Ga0207646_10004909 | |||
| 1313 | Ga0207646_10006662 | |||
| 1314 | Ga0207646_10026254 | |||
| 1315 | Ga0207646_10049392 | |||
| 1316 | Ga0207646_10173500 | |||
| 1317 | Ga0207646_10254369 | |||
| 1318 | Ga0207694_10193655 | |||
| 1319 | Ga0207687_10015347 | |||
| 1320 | Ga0207700_10000208 | |||
| 1321 | Ga0207700_10005586 | |||
| 1322 | Ga0207700_10011622 | |||
| 1323 | Ga0207700_10023204 | |||
| 1324 | Ga0207700_10026506 | |||
| 1325 | Ga0207700_10030133 | |||
| 1326 | Ga0207700_10033068 | |||
| 1327 | Ga0207700_10034483 | |||
| 1328 | Ga0207700_10055575 | |||
| 1329 | Ga0207664_10000108 | |||
| 1330 | Ga0207664_10000652 | |||
| 1331 | Ga0207664_10006346 | |||
| 1332 | Ga0207664_10025397 | |||
| 1333 | Ga0207664_10050410 | |||
| 1334 | Ga0207664_10084753 | |||
| 1335 | Ga0207664_10150877 | |||
| 1336 | Ga0207644_10019377 | |||
| 1337 | Ga0207690_10015030 | |||
| 1338 | Ga0207690_10030577 | |||
| 1339 | Ga0207690_10045554 | |||
| 1340 | Ga0207706_10008994 | |||
| 1341 | Ga0207706_10012429 | |||
| 1342 | Ga0207709_10095220 | |||
| 1343 | Ga0207669_10050448 | |||
| 1344 | Ga0207665_10001654 | |||
| 1345 | Ga0207665_10009362 | |||
| 1346 | Ga0207665_10071751 | |||
| 1347 | Ga0207691_10056671 | |||
| 1348 | Ga0207711_10004436 | |||
| 1349 | Ga0207711_10005962 | |||
| 1350 | Ga0207711_10029591 | |||
| 1351 | Ga0207689_10002944 | |||
| 1352 | Ga0207689_10014973 | |||
| 1353 | Ga0207661_10070349 | |||
| 1354 | Ga0207679_10007877 | |||
| 1355 | Ga0207679_10043802 | |||
| 1356 | Ga0207667_10012713 | |||
| 1357 | Ga0207667_10027190 | |||
| 1358 | Ga0207667_10162034 | |||
| 1359 | Ga0207712_10016843 | |||
| 1360 | Ga0207640_10021338 | |||
| 1361 | Ga0207658_10033483 | |||
| 1362 | Ga0207677_10117420 | |||
| 1363 | Ga0207703_10000015 | |||
| 1364 | Ga0207703_10033969 | |||
| 1365 | Ga0207703_10085225 | |||
| 1366 | Ga0207678_10019054 | |||
| 1367 | Ga0207678_10022911 | |||
| 1368 | Ga0207708_10158656 | |||
| 1369 | Ga0207702_10019652 | |||
| 1370 | Ga0207702_10094998 | |||
| 1371 | Ga0207641_10005192 | |||
| 1372 | Ga0207641_10037816 | |||
| 1373 | Ga0207648_10150702 | |||
| 1374 | Ga0207676_10083282 | |||
| 1375 | Ga0207676_10103429 | |||
| 1376 | Ga0207674_10014112 | |||
| 1377 | Ga0207674_10014116 | |||
| 1378 | Ga0207674_10022371 | |||
| 1379 | Ga0207675_100034755 | |||
| 1380 | Ga0207675_100043753 | |||
| 1381 | Ga0207683_10002402 | |||
| 1382 | Ga0207698_10004922 | |||
| 1383 | Ga0207428_10005818 | |||
| 1384 | Ga0207428_10006063 | |||
| 1385 | Ga0268266_10108451 | |||
| 1386 | Ga0268265_10000034 | |||
| 1387 | Ga0268265_10093000 | |||
| 1388 | Ga0268264_10015171 | |||
| 1389 | Ga0268264_10016963 | |||
| 1390 | Ga0268264_10086378 | |||
| 1391 | Ga0265337_1000717 | |||
| 1392 | Ga0265319_1002807 | |||
| 1393 | Ga0265334_10003266 | |||
| 1394 | Ga0265318_10005188 | |||
| 1395 | Ga0265323_10018282 | |||
| 1396 | Ga0265322_10011862 | |||
| 1397 | Ga0265336_10008231 | |||
| 1398 | Ga0307517_10010693 | |||
| 1399 | Ga0307515_10000598 | |||
| 1400 | Ga0307515_10022335 | |||
| 1401 | Ga0307515_10041986 | |||
| 1402 | Ga0265338_10009703 | |||
| 1403 | Ga0265338_10010976 | |||
| 1404 | Ga0265338_10011718 | |||
| 1405 | Ga0265338_10013470 | |||
| 1406 | Ga0265324_10000014 | |||
| 1407 | Ga0265324_10017802 | |||
| 1408 | Ga0316177_1138842 | |||
| 1409 | Ga0316180_1183041 | |||
| 1410 | Ga0265332_10003020 | |||
| 1411 | Ga0265320_10038988 | |||
| 1412 | Ga0265325_10020950 | |||
| 1413 | Ga0265325_10074437 | |||
| 1414 | Ga0265340_10008841 | |||
| 1415 | Ga0265327_10008570 | |||
| 1416 | Ga0265316_10068732 | |||
| 1417 | Ga0307408_100008126 | |||
| 1418 | Ga0307408_100079754 | |||
| 1419 | Ga0307508_10007864 | |||
| 1420 | Ga0307514_10040454 | |||
| 1421 | Ga0265314_10003856 | |||
| 1422 | Ga0265314_10013885 | |||
| 1423 | Ga0265342_10013847 | |||
| 1424 | Ga0316576_10040482 | |||
| 1425 | Ga0316576_10043670 | |||
| 1426 | Ga0316576_10056242 | |||
| 1427 | Ga0316576_10069897 | |||
| 1428 | Ga0307516_10000753 | |||
| 1429 | Ga0307516_10076497 | |||
| 1430 | Ga0307516_10101985 | |||
| 1431 | Ga0307405_10012156 | |||
| 1432 | Ga0307405_10022858 | |||
| 1433 | Ga0307413_10015166 | |||
| 1434 | Ga0307413_10020869 | |||
| 1435 | Ga0307410_10000140 | |||
| 1436 | Ga0307410_10000908 | |||
| 1437 | Ga0307406_10000083 | |||
| 1438 | Ga0307406_10004620 | |||
| 1439 | Ga0307406_10015517 | |||
| 1440 | Ga0307406_10110650 | |||
| 1441 | Ga0307407_10006883 | |||
| 1442 | Ga0307407_10046652 | |||
| 1443 | Ga0307412_10153795 | |||
| 1444 | Ga0307409_100018937 | |||
| 1445 | Ga0307409_100021231 | |||
| 1446 | Ga0307409_100058000 | |||
| 1447 | Ga0307409_100063219 | |||
| 1448 | Ga0307409_100097021 | |||
| 1449 | Ga0307409_100195829 | |||
| 1450 | Ga0307416_100000105 | |||
| 1451 | Ga0307416_100015187 | |||
| 1452 | Ga0307416_100023950 | |||
| 1453 | Ga0307416_100030001 | |||
| 1454 | Ga0307416_100046883 | |||
| 1455 | Ga0307416_100091909 | |||
| 1456 | Ga0307414_10016780 | |||
| 1457 | Ga0307414_10067493 | |||
| 1458 | Ga0307415_100000023 | |||
| 1459 | Ga0307415_100003368 | |||
| 1460 | Ga0307415_100005815 | |||
| 1461 | Ga0307415_100009190 | |||
| 1462 | Ga0307415_100022541 | |||
| 1463 | Ga0307415_100129715 | |||
| 1464 | Ga0307510_10019969 | |||
| 1465 | Ga0316214_1001083 | |||
| 1466 | Ga0373948_0001069 | |||
| 1467 | Ga0373959_0003579 | |||
| 1468 | Ga0373926_0002255 | |||
| 1469 | Ga0373926_0012223 | |||
| 1470 | Ga0373928_0004612 | |||
| 1471 | Ga0373929_0010019 | |||
| 1472 | Ga0373934_0000014 | |||
| 1473 | Ga0373934_0009476 | |||
| 1474 | Ga0373934_0025439 | |||
| 1475 | Ga0373940_0010822 | |||
| 1476 | Ga0373944_0025121 | |||
| 1477 | Ga0373951_0004369 | |||
| 1478 | Ga0373923_0001958 | |||
| 1479 | Ga0373923_0014154 | |||
| 1480 | Ga0373936_0001017 | |||
| 1481 | Ga0373936_0002279 | |||
| 1482 | Ga0373936_0008667 | |||
| 1483 | Ga0373936_0046490 | |||
| 1484 | Ga0373936_0055803 | |||
| 1485 | Ga0373941_0018192 | |||
| 1486 | Ga0373945_0002858 | |||
| 1487 | Ga0373953_0027623 | |||
| 1488 | Ga0373954_0001669 | |||
| 1489 | Ga0373954_0009727 | |||
| 1490 | Ga0373954_0019931 | |||
| 1491 | Ga0373954_0025588 | |||
| 1492 | Ga0373956_0001414 | |||
| 1493 | Ga0373956_0011823 | |||
| 1494 | Ga0373956_0017976 | |||
| 1495 | Ga0373957_0000846 | |||
| 1496 | Ga0373957_0011733 | |||
| 1497 | Ga0373960_0014572 | |||
| 1498 | Ga0373943_0004220 | |||
| 1499 | Ga0373946_0001758 | |||
| 1500 | Ga0373946_0019534 | |||
| 1501 | Ga0373955_0000040 | |||
| 1502 | Ga0373955_0003711 | |||
| 1503 | Ga0373955_0027763 | |||
| 1504 | Ga0373962_0003761 | |||
| 1505 | Ga0316574_0007389 | |||
| 1506 | Ga0316574_0023970 | |||
| 1507 | Ga0316574_0040647 | |||
| 1508 | Ga0316574_0109968 | |||
| 1509 | Ga0373924_0001593 | |||
| 1510 | Ga0373924_0006313 | |||
| 1511 | Ga0373924_0036883 | |||
| 1512 | Ga0373935_0001435 | |||
| 1513 | Ga0373935_0016107 | |||
| 1514 | Ga0373935_0046237 | |||
| 1515 | Ga0373935_0056355 | |||
| 1516 | Ga0373935_0113598 | |||
| 1517 | Ga0373927_0009751 | |||
| 1518 | Ga0373933_0000085 | |||
| 1519 | Ga0373933_0010236 | |||
| 1520 | Ga0373933_0013165 | |||
| 1521 | Ga0373933_0017976 | |||
| 1522 | Ga0373933_0056954 | |||
| 1523 | Ga0373947_0000195 | |||
| 1524 | Ga0373947_0001660 | |||
| 1525 | Ga0373937_0000197 | |||
| 1526 | Ga0373937_0021787 | |||
| 1527 | Ga0373937_0034956 | |||
| 1528 | Ga0373937_0036313 | |||
| 1529 | Ga0373937_0040007 | |||
| 1530 | Ga0373937_0064398 | |||
| 1531 | Ga0373937_0164179 | |||
| 1532 | Ga0373937_0226602 | |||
| 1533 | Ga0373937_0272978 | |||
| 1534 | Ga0316582_0065993 | |||
| 1535 | Ga0316584_0011739 | |||
| 1536 | Ga0373925_0000030 | |||
| 1537 | Ga0373925_0007451 | |||
| 1538 | Ga0373925_0018348 | |||
| 1539 | Ga0373925_0052094 | |||
| 1540 | Ga0373925_0057493 | |||
| 1541 | Ga0373925_0084538 | |||
| 1542 | Ga0373925_0165333 | |||
| 1543 | Ga0395899_0002958 | |||
| 1544 | Ga0395900_0044150 | |||
| 1545 | Ga0395900_0099741 | |||
| 1546 | Ga0395898_0029283 | |||
| 1547 | Ga0395898_0123567 | |||
| 1548 | Ga0436364_0303129 | |||
| 1549 | Ga0436364_0875353 | |||
| 1550 | Ga0436364_1024480 | |||
| 1551 | Ga0436364_1109480 | |||
| 1552 | Ga0436364_1394034 | |||
| 1553 | Ga0395901_0085159 | |||
| 1554 | Ga0400483_062358 | |||
| 1555 | Ga0400483_276618 | |||
| 1556 | Ga0436365_0313897 | |||
| 1557 | Ga0436365_0557859 | |||
| 1558 | Ga0436365_0613236 | |||
| 1559 | Ga0436365_1288165 | |||
| 1560 | Ga0436363_1583056 | |||
| 1561 | Ga0436362_1219176 | |||
| 1562 | Ga0451791_0846982 | |||
| 1563 | Ga0439463_001655 | |||
| 1564 | Ga0439463_016883 | |||
| 1565 | Ga0451577_0000624 | |||
| 1566 | Ga0451577_0001084 | |||
| 1567 | Ga0439440_0012997 | |||
| 1568 | Ga0466969_0023091 | |||
| 1569 | Ga0466972_0045465 | |||
| 1570 | Ga0466966_0036482 | |||
| 1571 | Ga0466966_0052233 | |||
| 1572 | Ga0466966_0122180 | |||
| 1573 | Ga0466961_0005237 | |||
| 1574 | Ga0466961_0011992 | |||
| 1575 | Ga0466961_0035801 | |||
| 1576 | Ga0466961_0038381 | |||
| 1577 | Ga0466961_0053307 | |||
| 1578 | Ga0466961_0053848 | |||
| 1579 | Ga0466961_0075470 | |||
| 1580 | Ga0466961_0096522 | |||
| 1581 | Ga0466963_0000272 | |||
| 1582 | Ga0466963_0003348 | |||
| 1583 | Ga0466963_0008490 | |||
| 1584 | Ga0466963_0022711 | |||
| 1585 | Ga0466963_0031049 | |||
| 1586 | Ga0466963_0062369 | |||
| 1587 | Ga0466963_0076038 | |||
| 1588 | Ga0466963_0117065 | |||
| 1589 | Ga0466963_0126740 | |||
| 1590 | Ga0466963_0135177 | |||
| 1591 | Ga0466963_0149382 | |||
| 1592 | Ga0453684_0001802 | |||
| 1593 | Ga0466971_0002592 | |||
| 1594 | Ga0466971_0009865 | |||
| 1595 | Ga0466970_0000947 | |||
| 1596 | Ga0466959_0032930 | |||
| 1597 | Ga0466959_0062991 | |||
| 1598 | Ga0466958_0002261 | |||
| 1599 | Ga0466958_0003632 | |||
| 1600 | Ga0466958_0037231 | |||
| 1601 | Ga0466958_0065329 | |||
| 1602 | Ga0466958_0107708 | |||
| 1603 | Ga0466967_0022738 | |||
| 1604 | Ga0466967_0029542 | |||
| 1605 | Ga0466967_0031995 | |||
| 1606 | Ga0466967_0036785 | |||
| 1607 | Ga0466967_0045535 | |||
| 1608 | Ga0466967_0062388 | |||
| 1609 | Ga0466967_0101325 | |||
| 1610 | Ga0466967_0197789 | |||
| 1611 | Ga0495592_0000157 | |||
| 1612 | Ga0495592_0007215 | |||
| 1613 | Ga0495592_0033680 | |||
| 1614 | Ga0495592_0042356 | |||
| 1615 | Ga0495603_0013090 | |||
| 1616 | Ga0495603_0020408 | |||
| 1617 | Ga0495590_0000484 | |||
| 1618 | Ga0495629_0001111 | |||
| 1619 | Ga0495629_0004740 | |||
| 1620 | Ga0495629_0014332 | |||
| 1621 | Ga0495629_0022043 | |||
| 1622 | Ga0495629_0067606 | |||
| 1623 | Ga0495629_0109388 | |||
| 1624 | Ga0495641_0008500 | |||
| 1625 | Ga0495641_0035794 | |||
| 1626 | Ga0495641_0053637 | |||
| 1627 | Ga0495651_0000115 | |||
| 1628 | Ga0495651_0005863 | |||
| 1629 | Ga0495651_0006516 | |||
| 1630 | Ga0495651_0029499 | |||
| 1631 | Ga0495651_0053844 | |||
| 1632 | Ga0495651_0087535 | |||
| 1633 | Ga0495653_0009912 | |||
| 1634 | Ga0495653_0017549 | |||
| 1635 | Ga0495653_0024574 | |||
| 1636 | Ga0495653_0033132 | |||
| 1637 | Ga0495653_0052520 | |||
| 1638 | Ga0495653_0055578 | |||
| 1639 | Ga0495653_0056416 | |||
| 1640 | Ga0495653_0101832 | |||
| 1641 | Ga0495650_0005298 | |||
| 1642 | Ga0495580_0009545 | |||
| 1643 | Ga0495580_0055321 | |||
| 1644 | Ga0495582_0003495 | |||
| 1645 | Ga0495582_0004371 | |||
| 1646 | Ga0495639_0013157 | |||
| 1647 | Ga0495639_0037627 | |||
| 1648 | Ga0495662_0033900 | |||
| 1649 | Ga0495662_0043070 | |||
| 1650 | Ga0495664_0006176 | |||
| 1651 | Ga0495664_0030935 | |||
| 1652 | Ga0495664_0034817 | |||
| 1653 | Ga0495664_0109951 | |||
| 1654 | Ga0495585_0024459 | |||
| 1655 | Ga0495594_0000581 | |||
| 1656 | Ga0495608_0003716 | |||
| 1657 | Ga0495608_0007490 | |||
| 1658 | Ga0495608_0011618 | |||
| 1659 | Ga0495608_0033917 | |||
| 1660 | Ga0495618_0045353 | |||
| 1661 | Ga0495628_0000492 | |||
| 1662 | Ga0495628_0005799 | |||
| 1663 | Ga0495628_0020582 | |||
| 1664 | Ga0495630_0040719 | |||
| 1665 | Ga0495630_0176475 | |||
| 1666 | Ga0495648_0018440 | |||
| 1667 | Ga0495666_0009549 | |||
| 1668 | Ga0495652_0007274 | |||
| 1669 | Ga0495652_0014633 | |||
| 1670 | Ga0495652_0041679 | |||
| 1671 | Ga0495652_0043329 | |||
| 1672 | Ga0495640_0013371 | |||
| 1673 | Ga0495640_0021822 | |||
| 1674 | Ga0495640_0038134 | |||
| 1675 | Ga0495640_0076101 | |||
| 1676 | Ga0495640_0088756 | |||
| 1677 | Ga0495640_0095927 | |||
| 1678 | Ga0495586_0057385 | |||
| 1679 | Ga0495587_0000123 | |||
| 1680 | Ga0495587_0016217 | |||
| 1681 | Ga0495587_0032473 | |||
| 1682 | Ga0495645_0014230 | |||
| 1683 | Ga0495645_0039166 | |||
| 1684 | Ga0495645_0043089 | |||
| 1685 | Ga0495622_0019863 | |||
| 1686 | Ga0495667_0000107 | |||
| 1687 | Ga0495667_0007253 | |||
| 1688 | Ga0495667_0018130 | |||
| 1689 | Ga0495667_0019013 | |||
| 1690 | Ga0495667_0019310 | |||
| 1691 | Ga0495667_0020842 | |||
| 1692 | Ga0495667_0037158 | |||
| 1693 | Ga0495634_0020569 | |||
| 1694 | Ga0495634_0034159 | |||
| 1695 | Ga0495634_0049820 | |||
| 1696 | Ga0495634_0085558 | |||
| 1697 | Ga0495611_0016203 | |||
| 1698 | Ga0495635_0012621 | |||
| 1699 | Ga0495635_0014442 | |||
| 1700 | Ga0495635_0039605 | |||
| 1701 | Ga0495635_0068273 | |||
| 1702 | Ga0495635_0070122 | |||
| 1703 | Ga0495657_0000169 | |||
| 1704 | Ga0495657_0012881 | |||
| 1705 | Ga0495657_0017135 | |||
| 1706 | Ga0495657_0030266 | |||
| 1707 | Ga0495657_0060865 | |||
| 1708 | Ga0495657_0063226 | |||
| 1709 | Ga0495657_0077837 | |||
| 1710 | Ga0495599_0002521 | |||
| 1711 | Ga0495599_0008323 | |||
| 1712 | Ga0495599_0035014 | |||
| 1713 | Ga0495599_0050775 | |||
| 1714 | Ga0495623_0009785 | |||
| 1715 | Ga0495623_0033496 | |||
| 1716 | Ga0495623_0050466 | |||
| 1717 | Ga0495623_0054254 | |||
| 1718 | Ga0495646_0042668 | |||
| 1719 | Ga0495646_0054052 | |||
| 1720 | Ga0495646_0062104 | |||
| 1721 | Ga0495658_0007742 | |||
| 1722 | Ga0495658_0051082 | |||
| 1723 | Ga0495613_0015671 | |||
| 1724 | Ga0495613_0032000 | |||
| 1725 | Ga0495613_0040997 | |||
| 1726 | Ga0495613_0088773 | |||
| 1727 | Ga0495624_0030943 | |||
| 1728 | Ga0495624_0034495 | |||
| 1729 | Ga0495624_0034767 | |||
| 1730 | Ga0495624_0091681 | |||
| 1731 | Ga0495600_0009464 | |||
| 1732 | Ga0495600_0011208 | |||
| 1733 | Ga0495600_0014018 | |||
| 1734 | Ga0495600_0020085 | |||
| 1735 | Ga0495600_0028753 | |||
| 1736 | Ga0495600_0029305 | |||
| 1737 | Ga0495581_0006780 | |||
| 1738 | Ga0495581_0055827 | |||
| 1739 | Ga0495604_0000161 | |||
| 1740 | Ga0495604_0002557 | |||
| 1741 | Ga0495604_0009103 | |||
| 1742 | Ga0495604_0011992 | |||
| 1743 | Ga0495604_0012311 | |||
| 1744 | Ga0495604_0043812 | |||
| 1745 | Ga0495604_0106234 | |||
| 1746 | Ga0495674_0012623 | |||
| 1747 | Ga0495674_0053199 | |||
| 1748 | Ga0495674_0135608 | |||
| 1749 | Ga0495676_0005210 | |||
| 1750 | Ga0495676_0020253 | |||
| 1751 | Ga0495676_0030823 | |||
| 1752 | Ga0495676_0046854 | |||
| 1753 | Ga0495676_0083475 | |||
| 1754 | Ga0495680_0004695 | |||
| 1755 | Ga0495680_0007013 | |||
| 1756 | Ga0495680_0023511 | |||
| 1757 | Ga0495680_0040898 | |||
| 1758 | Ga0495680_0046760 | |||
| 1759 | Ga0495687_003567 | |||
| 1760 | Ga0495675_0002978 | |||
| 1761 | Ga0495675_0007679 | |||
| 1762 | Ga0495675_0007682 | |||
| 1763 | Ga0495675_0010155 | |||
| 1764 | Ga0495675_0011761 | |||
| 1765 | Ga0495685_017124 | |||
| 1766 | Ga0495684_0002750 | |||
| 1767 | Ga0495684_0002944 | |||
| 1768 | Ga0495684_0006983 | |||
| 1769 | Ga0495684_0052798 | |||
| 1770 | Ga0495684_0055420 | |||
| 1771 | Ga0495684_0062697 | |||
| 1772 | Ga0495593_0015283 | |||
| 1773 | Ga0495593_0023848 | |||
| 1774 | Ga0495593_0049092 | |||
| 1775 | Ga0495602_0000182 | |||
| 1776 | Ga0495602_0038715 | |||
| 1777 | Ga0495602_0041925 | |||
| 1778 | Ga0495602_0043021 | |||
| 1779 | Ga0495602_0049803 | |||
| 1780 | Ga0495602_0076720 | |||
| 1781 | Ga0495614_0037738 | |||
| 1782 | Ga0496101_0047351 | |||
| 1783 | Ga0496101_0061554 | |||
| 1784 | Ga0496102_0013379 | |||
| 1785 | Ga0496102_0065703 | |||
| 1786 | Ga0496102_0124101 | |||
| 1787 | Ga0496102_0199975 | |||
| 1788 | Ga0496103_0002735 | |||
| 1789 | Ga0496103_0013447 | |||
| 1790 | Ga0496104_0012811 | |||
| 1791 | Ga0496104_0016531 | |||
| 1792 | Ga0496104_0104429 | |||
| 1793 | Ga0496104_0133039 | |||
| 1794 | Ga0496104_0135243 | |||
| 1795 | Ga0496105_0001730 | |||
| 1796 | Ga0496105_0002855 | |||
| 1797 | Ga0496105_0023038 | |||
| 1798 | Ga0496106_0014818 | |||
| 1799 | Ga0496107_0032783 | |||
| 1800 | Ga0496108_0002365 | |||
| 1801 | Ga0496108_0008143 | |||
| 1802 | Ga0496108_0089477 | |||
| 1803 | Ga0496108_0114941 | |||
| 1804 | Ga0496108_0117891 | |||
| 1805 | Ga0496109_0012022 | |||
| 1806 | Ga0496109_0035580 | |||
| 1807 | Ga0496109_0062801 | |||
| 1808 | Ga0496110_0003627 | |||
| 1809 | Ga0496110_0018756 | |||
| 1810 | Ga0496110_0090641 | |||
| 1811 | Ga0496111_0039696 | |||
| 1812 | Ga0496112_0019138 | |||
| 1813 | Ga0496112_0044614 | |||
| 1814 | Ga0496112_0048961 | |||
| 1815 | Ga0496113_0007107 | |||
| 1816 | Ga0496113_0056171 | |||
| 1817 | Ga0496114_0008348 | |||
| 1818 | Ga0496114_0012039 | |||
| 1819 | Ga0496114_0055285 | |||
| 1820 | Ga0496114_0070842 | |||
| 1821 | Ga0496114_0113931 | |||
| 1822 | Ga0496115_0014904 | |||
| 1823 | Ga0496115_0029372 | |||
| 1824 | Ga0496116_0000165 | |||
| 1825 | Ga0496117_0002355 | |||
| 1826 | Ga0496117_0007254 | |||
| 1827 | Ga0496118_0004719 | |||
| 1828 | Ga0496118_0009080 | |||
| 1829 | Ga0496119_0000375 | |||
| 1830 | Ga0496119_0003013 | |||
| 1831 | Ga0496119_0010507 | |||
| 1832 | Ga0496119_0010538 | |||
| 1833 | Ga0496120_0000453 | |||
| 1834 | Ga0496120_0004273 | |||
| 1835 | Ga0496120_0011458 | |||
| 1836 | Ga0496121_0043764 | |||
| 1837 | Ga0496121_0047048 | |||
| 1838 | Ga0496126_0000676 | |||
| 1839 | Ga0496126_0027059 | |||
| 1840 | Ga0496126_0072013 | |||
| 1841 | Ga0496126_0107474 | |||
| 1842 | Ga0496126_0110630 | |||
| 1843 | Ga0496126_0113416 | |||
| 1844 | Ga0501031_0000714 | |||
| 1845 | Ga0501031_0006968 | |||
| 1846 | Ga0501031_0050578 | |||
| 1847 | Ga0501031_0103648 | |||
| 1848 | Ga0501032_0003502 | |||
| 1849 | Ga0501032_0005443 | |||
| 1850 | Ga0501032_0013867 | |||
| 1851 | Ga0501032_0061848 | |||
| 1852 | Ga0501032_0078279 | |||
| 1853 | Ga0501033_0006257 | |||
| 1854 | Ga0501033_0009672 | |||
| 1855 | Ga0501033_0055904 | |||
| 1856 | Ga0501033_0067622 | |||
| 1857 | Ga0501033_0072890 | |||
| 1858 | Ga0501033_0142363 | |||
| 1859 | Ga0501034_0004843 | |||
| 1860 | Ga0501034_0005064 | |||
| 1861 | Ga0501034_0011314 | |||
| 1862 | Ga0501034_0097032 | |||
| 1863 | Ga0501036_0010884 | |||
| 1864 | Ga0501036_0019934 | |||
| 1865 | Ga0501036_0237999 | |||
| 1866 | Ga0501037_0008312 | |||
| 1867 | Ga0501037_0016986 | |||
| 1868 | Ga0501037_0023492 | |||
| 1869 | Ga0501037_0063487 | |||
| 1870 | Ga0501038_0013926 | |||
| 1871 | Ga0501038_0123120 | |||
| 1872 | Ga0501038_0209504 | |||
| 1873 | Ga0501039_0002152 | |||
| 1874 | Ga0501039_0072978 | |||
| 1875 | Ga0501039_0109760 | |||
| 1876 | Ga0501040_0143173 | |||
| 1877 | Ga0501041_0121650 | |||
| 1878 | Ga0501042_0023401 | |||
| 1879 | Ga0501042_0045990 | |||
| 1880 | Ga0501043_0002910 | |||
| 1881 | Ga0501043_0034256 | |||
| 1882 | Ga0501043_0047789 | |||
| 1883 | Ga0501046_0000046 | |||
| 1884 | Ga0501046_0001735 | |||
| 1885 | Ga0501046_0005551 | |||
| 1886 | Ga0501046_0038992 | |||
| 1887 | Ga0501046_0050421 | |||
| 1888 | Ga0501046_0082200 | |||
| 1889 | Ga0501047_0000268 | |||
| 1890 | Ga0501047_0002183 | |||
| 1891 | Ga0501047_0008059 | |||
| 1892 | Ga0501047_0025578 | |||
| 1893 | Ga0501047_0033406 | |||
| 1894 | Ga0501047_0163413 | |||
| 1895 | Ga0501048_0002880 | |||
| 1896 | Ga0501048_0026207 | |||
| 1897 | Ga0501048_0068208 | |||
| 1898 | Ga0501068_0049315 | |||
| 1899 | Ga0501068_0075529 | |||
| 1900 | Ga0501069_0006022 | |||
| 1901 | Ga0501070_0022144 | |||
| 1902 | Ga0501070_0029658 | |||
| 1903 | Ga0501070_0064642 | |||
| 1904 | Ga0501073_0015061 | |||
| 1905 | Ga0501073_0024223 | |||
| 1906 | Ga0501074_0001157 | |||
| 1907 | Ga0501074_0073476 | |||
| 1908 | Ga0501074_0152253 | |||
| 1909 | Ga0501076_0112428 | |||
| 1910 | Ga0501079_0003055 | |||
| 1911 | Ga0501079_0111706 | |||
| 1912 | Ga0501080_0001035 | |||
| 1913 | Ga0501080_0016596 | |||
| 1914 | Ga0501083_0152203 | |||
| 1915 | Ga0501035_0014942 | |||
| 1916 | Ga0501035_0020279 | |||
| 1917 | Ga0501035_0024157 | |||
| 1918 | Ga0501035_0234920 | |||
| 1919 | Ga0501044_0001019 | |||
| 1920 | Ga0501044_0005882 | |||
| 1921 | Ga0501044_0011020 | |||
| 1922 | Ga0501044_0017181 | |||
| 1923 | Ga0501044_0021124 | |||
| 1924 | Ga0501044_0043045 | |||
| 1925 | Ga0501044_0045566 | |||
| 1926 | Ga0501044_0066591 | |||
| 1927 | Ga0501044_0068391 | |||
| 1928 | Ga0501044_0091273 | |||
| 1929 | Ga0501044_0102696 | |||
| 1930 | Ga0501044_0173627 | |||
| 1931 | Ga0501045_0141461 | |||
| 1932 | nmdc:mga00v17_39789_c1 | |||
| 1933 | nmdc:mga00v17_8489_c1 | |||
| 1934 | nmdc:mga07m45_29369_c1 | |||
| 1935 | nmdc:mga05p37_11899_c1 | |||
| 1936 | nmdc:mga05p37_9076_c1 | |||
| 1937 | nmdc:mga0qj67_695_c1 | |||
| 1938 | nmdc:mga06r32_294003_c1 | |||
| 1939 | nmdc:mga08y16_155725_c1 | |||
| 1940 | nmdc:mga08y16_5523_c1 | |||
| 1941 | nmdc:mga0n895_207316_c1 | |||
| 1942 | nmdc:mga0n895_4481_c1 | |||
| 1943 | nmdc:mga0rr50_10842_c1 | |||
| 1944 | nmdc:mga0rr50_16896_c1 | |||
| 1945 | nmdc:mga08x19_6337_c1 | |||
| 1946 | nmdc:mga0a205_1359_c1 | |||
| 1947 | Ga0495601_0027111 | |||
| 1948 | Ga0495612_0033808 | |||
| 1949 | Ga0495595_0006267 | |||
| 1950 | Ga0495595_0032638 | |||
| 1951 | Ga0495619_0009436 | |||
| 1952 | Ga0495619_0047753 | |||
| 1953 | Ga0495619_0057561 | |||
| 1954 | Ga0495619_0160847 | |||
| 1955 | Ga0500614_017827 | |||
| 1956 | Ga0500568_0002651 | |||
| 1957 | Ga0500568_0003582 | |||
| 1958 | Ga0500573_0004254 | |||
| 1959 | Ga0500573_0079129 | |||
| 1960 | Ga0500616_0000071 | |||
| 1961 | Ga0500616_0000643 | |||
| 1962 | Ga0500620_000387 | |||
| 1963 | Ga0501082_0092669 | |||
| 1964 | Ga0466962_0024949 | |||
| 1965 | Ga0530510_0018512 | |||
| 1966 | 2689991649 | |||
| 1967 | 2506867831 | |||
| 1968 | 2508678196 | |||
| 1969 | 2515718917 | |||
| 1970 | 2517759690 | |||
| 1971 | 2528205552 | |||
| 1972 | 2528214971 | |||
| 1973 | 2546950329 | |||
| 1974 | 2554259473 | |||
| 1975 | 2579750245 | |||
| 1976 | 2579856476 | |||
| 1977 | 2583153418 | |||
| 1978 | 2585302007 | |||
| 1979 | 2585303625 | |||
| 1980 | 2616900753 | |||
| 1981 | 2619858078 | |||
| 1982 | 2620352617 | |||
| 1983 | 2623501120 | |||
| 1984 | 2626639666 | |||
| 1985 | 2643904554 | |||
| 1986 | 2644183855 | |||
| 1987 | 2644198588 | |||
| 1988 | 2644406180 | |||
| 1989 | 2644611656 | |||
| 1990 | 2671839071 | |||
| 1991 | 2676201709 | |||
| 1992 | 2676476048 | |||
| 1993 | 2686537796 | |||
| 1994 | 2686543135 | |||
| 1995 | 2689956222 | |||
| 1996 | 2710603811 | |||
| 1997 | 2731907034 | |||
| 1998 | 2774846285 | |||
| 1999 | 2774857227 | |||
| 2000 | 2774866102 | |||
| 2001 | 2774904259 | |||
| 2002 | 2784586819 | |||
| 2003 | 2786668276 | |||
| 2004 | 2793983468 | |||
| 2005 | 2795797751 | |||
| 2006 | 2799183911 | |||
| 2007 | 2809227057 | |||
| 2008 | 2809230385 | |||
| 2009 | 2811847039 | |||
| 2010 | 2819427960 | |||
| 2011 | 2827630610 | |||
| 2012 | 2852633557 | |||
| 2013 | 2856742490 | |||
| 2014 | 2857733593 | |||
| 2015 | 2861527630 | |||
| 2016 | 2862186184 | |||
| 2017 | 2862295316 | |||
| 2018 | 2862295562 | |||
| 2019 | 2866557123 | |||
| 2020 | 2866618212 | |||
| 2021 | 2867429806 | |||
| 2022 | 2867480855 | |||
| 2023 | 2873157616 | |||
| 2024 | 2873319326 | |||
| 2025 | 2875392760 | |||
| 2026 | 2877683318 | |||
| 2027 | 2891403605 | |||
| 2028 | 2891556140 | |||
| 2029 | 2891563883 | |||
| 2030 | 2895662796 | |||
| 2031 | 2895888740 | |||
| 2032 | 2897564754 | |||
| 2033 | 2912758958 | |||
| 2034 | 2918502588 | |||
| 2035 | 2919057288 | |||
| 2036 | 2919472120 | |||
| 2037 | 2928124606 | |||
| 2038 | 2939663718 | |||
| 2039 | 2946051955 | |||
| 2040 | 2954011002 | |||
| 2041 | 2954699354 | |||
| 2042 | 2954702865 | |||
| 2043 | 2954718296 | |||
| 2044 | 2954728266 | |||
| 2045 | 2954733544 | |||
| 2046 | 2954747160 | |||
| 2047 | 2954752427 | |||
| 2048 | 2954766273 | |||
| 2049 | 2966604316 | |||
| 2050 | 2997605606 | |||
| 2051 | 3006327931 | |||
| 2052 | 637880492 | |||
| 2053 | 8002782778 | |||
| 2054 | 8002788593 | |||
| 2055 | 8023628519 | |||
| 2056 | 8025481224 | |||
| 2057 | 8025531021 | |||
| 2058 | 8048364119 | |||
| 2059 | 8054914100 | |||
| 2060 | 8054922894 | |||
| 2061 | 8055068479 | |||
| 2062 | 8055162373 | |||
| 2063 | 8055181035 | |||
| 2064 | 8056210695 | |||
| 2065 | 8056449304 | |||
| 2066 | 8056670176 | |||
| 2067 | 8057349524 | |||
| 2068 | 8057568516 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ien-assembly1.cif.gz_C | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.9821 | 14 | 467 |
| 6ien-assembly1.cif.gz_A | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.982 | 14 | 467 |
| 6ien-assembly1.cif.gz_D | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.9808 | 14 | 467 |
| 6ien-assembly1.cif.gz_A | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.9799 | 14 | 467 |
| 6ien-assembly1.cif.gz_C | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.9798 | 14 | 467 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JV68_416_478_1.10.40.30 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 0.9887 | 365 | 425 | 1.10.40.30 |
| 6iemA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 0.9853 | 364 | 434 | 1.10.40.30 |
| af_Q59R31_374_436_1.10.40.30 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 0.9845 | 368 | 425 | 1.10.40.30 |
| af_F1RA91_366_428_1.10.40.30 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 0.9839 | 366 | 426 | 1.10.40.30 |
| 6iemG03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) | 0.9829 | 364 | 434 | 1.10.40.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A077HK97-F1-model_v4 | Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) | 0.9867 | 5 | 467 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-W1VGY7-F1-model_v4 | Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) | 0.9857 | 61 | 465 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-A0A4V3EBN3-F1-model_v4 | Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) | 0.9852 | 5 | 467 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-A0A4R5X310-F1-model_v4 | Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) | 0.9846 | 5 | 467 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-A0A7C6GH40-F1-model_v4 | Argininosuccinate lyase | 0.9846 | 357 | 463 |
GO:0004056
GO:0005829 GO:0042450 |