F488655

General Info

Members Datasets Scaffolds Average Seq Length
1033 241 2066 127

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100034188|Ga0070680_1000341885
Length 144
Sequence VDGSLAGRGAFRQCRNPMGFWSKTFTWWNGATFGTALFTRRFGNEVGRDSEGNVYYQDKKRPWRRWVIYNGSNDGSRVPPDWQLWLRGTIDDLPEKVLPPIRKFQKKPTPNLTGTMEAFRPDGALGSGRIRPASTGDYEPWIPE

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 3.1
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100034188 3300005336 Bacteria 4098
2 MBSR1b_contig_3052630 2162886012 Bacteria 1211
3 JGI24741J21665_1005973 3300001915 Bacteria 2489
4 JGI24740J21852_10000772 3300001979 Bacteria 14030
5 JGI24740J21852_10020575 3300001979 Bacteria 2299
6 JGI24740J21852_10035020 3300001979 Bacteria 1574
7 JGI24739J22299_10000789 3300001989 Bacteria 11558
8 JGI24739J22299_10055087 3300001989 Bacteria 1272
9 JGI24737J22298_10016936 3300001990 Bacteria 2351
10 JGI24737J22298_10031983 3300001990 Bacteria 1641
11 JGI24737J22298_10060966 3300001990 Bacteria 1135
12 JGI24735J21928_10001231 3300002067 Bacteria 9095
13 JGI24735J21928_10003507 3300002067 Bacteria 5344
14 JGI24735J21928_10038778 3300002067 Bacteria 1393
15 JGI24735J21928_10042734 3300002067 Bacteria 1319
16 JGI24738J21930_10007283 3300002075 Bacteria 2563
17 JGI24738J21930_10023460 3300002075 Bacteria 1271
18 rootH2_10085618 3300003320 Unclassified 1393
19 Ga0058862_12069213 3300004803 Bacteria 596
20 Ga0065715_10122844 3300005293 Unclassified 2194
21 Ga0070658_10000360 3300005327 Bacteria 39619
22 Ga0070658_10011538 3300005327 Bacteria 7087
23 Ga0070658_10030574 3300005327 Bacteria 4326
24 Ga0070658_10249928 3300005327 Bacteria 1504
25 Ga0070658_10253426 3300005327 Bacteria 1493
26 Ga0070658_10276807 3300005327 Bacteria 1428
27 Ga0070658_10306482 3300005327 Unclassified 1355
28 Ga0070658_10345731 3300005327 Bacteria 1273
29 Ga0070658_10508970 3300005327 Bacteria 1040
30 Ga0070658_10690639 3300005327 Bacteria 886
31 Ga0070658_10929004 3300005327 Bacteria 756
32 Ga0070658_11664722 3300005327 Bacteria 552
33 Ga0070676_10065667 3300005328 Bacteria 2167
34 Ga0070676_11095388 3300005328 Bacteria 602
35 Ga0070676_11553419 3300005328 Bacteria 511
36 Ga0070683_100007904 3300005329 Bacteria 9016
37 Ga0070683_100044160 3300005329 Bacteria 4109
38 Ga0070683_100068883 3300005329 Bacteria 3297
39 Ga0070683_100074337 3300005329 Bacteria 3174
40 Ga0070683_100105738 3300005329 Bacteria 2653
41 Ga0070683_100308337 3300005329 Bacteria 1506
42 Ga0070683_100617665 3300005329 Bacteria 1038
43 Ga0070690_100007961 3300005330 Bacteria 6083
44 Ga0070690_100125672 3300005330 Bacteria 1726
45 Ga0070670_100009424 3300005331 Bacteria 8336
46 Ga0070670_100017460 3300005331 Bacteria 6155
47 Ga0070670_100353210 3300005331 Bacteria 1292
48 Ga0070670_100465301 3300005331 Bacteria 1122
49 Ga0070670_100953980 3300005331 Bacteria 779
50 Ga0070677_10002668 3300005333 Bacteria 5709
51 Ga0070677_10110724 3300005333 Bacteria 1225
52 Ga0070666_10002126 3300005335 Bacteria 12043
53 Ga0070666_10052402 3300005335 Bacteria 2750
54 Ga0070666_10444234 3300005335 Bacteria 936
55 Ga0070666_10739961 3300005335 Unclassified 722
56 Ga0070680_100003113 3300005336 Bacteria 12313
57 Ga0070680_100007743 3300005336 Bacteria 8188
58 Ga0070680_100010921 3300005336 Bacteria 7017
59 Ga0070680_100023849 3300005336 Bacteria 4884
60 Ga0070680_100029754 3300005336 Bacteria 4384
61 Ga0070680_100047844 3300005336 Bacteria 3483
62 Ga0070680_100075189 3300005336 Bacteria 2781
63 Ga0070680_100112073 3300005336 Bacteria 2271
64 Ga0070680_100205102 3300005336 Bacteria 1663
65 Ga0070680_101137560 3300005336 Bacteria 675
66 Ga0070682_100002715 3300005337 Bacteria 9800
67 Ga0070682_100017508 3300005337 Bacteria 4180
68 Ga0070682_100083712 3300005337 Unclassified 2071
69 Ga0070682_100124111 3300005337 Bacteria 1738
70 Ga0070682_100496322 3300005337 Bacteria 945
71 Ga0068868_100002897 3300005338 Bacteria 11908
72 Ga0068868_100093716 3300005338 Bacteria 2422
73 Ga0068868_100223062 3300005338 Bacteria 1579
74 Ga0068868_101699419 3300005338 Bacteria 595
75 Ga0070660_100000075 3300005339 Bacteria 59407
76 Ga0070660_100008590 3300005339 Bacteria 7152
77 Ga0070660_100009957 3300005339 Bacteria 6704
78 Ga0070660_100077654 3300005339 Bacteria 2602
79 Ga0070660_100113791 3300005339 Bacteria 2155
80 Ga0070660_100150960 3300005339 Bacteria 1868
81 Ga0070660_100256780 3300005339 Bacteria 1426
82 Ga0070660_100276901 3300005339 Bacteria 1372
83 Ga0070660_100329631 3300005339 Bacteria 1255
84 Ga0070660_100901660 3300005339 Bacteria 745
85 Ga0070660_100917032 3300005339 Bacteria 739
86 Ga0070660_101128650 3300005339 Bacteria 664
87 Ga0070691_10001562 3300005341 Bacteria 9878
88 Ga0070687_100314469 3300005343 Bacteria 998
89 Ga0070661_100000273 3300005344 Bacteria 41798
90 Ga0070661_100007349 3300005344 Bacteria 7595
91 Ga0070661_100007692 3300005344 Bacteria 7443
92 Ga0070661_100023040 3300005344 Bacteria 4461
93 Ga0070661_100038051 3300005344 Bacteria 3501
94 Ga0070661_100042824 3300005344 Bacteria 3306
95 Ga0070661_100176933 3300005344 Bacteria 1622
96 Ga0070661_100339535 3300005344 Bacteria 1176
97 Ga0070661_100648253 3300005344 Bacteria 857
98 Ga0070661_100825848 3300005344 Bacteria 762
99 Ga0070661_101138098 3300005344 Unclassified 651
100 Ga0070661_101263471 3300005344 Bacteria 619
101 Ga0070661_101700551 3300005344 Unclassified 534
102 Ga0070692_10041262 3300005345 Bacteria 2363
103 Ga0070692_10043648 3300005345 Bacteria 2307
104 Ga0070692_10068482 3300005345 Bacteria 1886
105 Ga0070692_10171923 3300005345 Bacteria 1250
106 Ga0070692_10309575 3300005345 Bacteria 967
107 Ga0070668_100088496 3300005347 Bacteria 2438
108 Ga0070668_100114961 3300005347 Archaea 2145
109 Ga0070669_100034764 3300005353 Bacteria 3648
110 Ga0070669_100071343 3300005353 Bacteria 2570
111 Ga0070669_100096805 3300005353 Bacteria 2221
112 Ga0070669_100149358 3300005353 Bacteria 1808
113 Ga0070675_100002201 3300005354 Bacteria 14455
114 Ga0070675_100003070 3300005354 Bacteria 12613
115 Ga0070675_100068603 3300005354 Bacteria 2936
116 Ga0070675_101369748 3300005354 Unclassified 652
117 Ga0070671_100004385 3300005355 Bacteria 11154
118 Ga0070671_100010381 3300005355 Bacteria 7470
119 Ga0070671_100011228 3300005355 Bacteria 7193
120 Ga0070671_100053409 3300005355 Bacteria 3359
121 Ga0070671_100423798 3300005355 Bacteria 1140
122 Ga0070674_100051889 3300005356 Bacteria 2828
123 Ga0070674_100548774 3300005356 Unclassified 969
124 Ga0070674_100785922 3300005356 Bacteria 821
125 Ga0070674_102152170 3300005356 Bacteria 509
126 Ga0070673_100018940 3300005364 Bacteria 4934
127 Ga0070673_100041580 3300005364 Bacteria 3537
128 Ga0070673_100062104 3300005364 Bacteria 2967
129 Ga0070688_100973522 3300005365 Bacteria 673
130 Ga0070659_100000084 3300005366 Bacteria 71138
131 Ga0070659_100004523 3300005366 Bacteria 9934
132 Ga0070659_100034234 3300005366 Bacteria 3950
133 Ga0070659_100039124 3300005366 Bacteria 3701
134 Ga0070659_100078215 3300005366 Bacteria 2638
135 Ga0070659_100080633 3300005366 Bacteria 2598
136 Ga0070659_100109549 3300005366 Bacteria 2229
137 Ga0070659_100167024 3300005366 Bacteria 1801
138 Ga0070659_100212271 3300005366 Bacteria 1595
139 Ga0070659_100246960 3300005366 Bacteria 1478
140 Ga0070659_100266822 3300005366 Bacteria 1421
141 Ga0070659_100431124 3300005366 Bacteria 1116
142 Ga0070659_100472519 3300005366 Bacteria 1066
143 Ga0070659_100586961 3300005366 Bacteria 956
144 Ga0070667_100001607 3300005367 Bacteria 20221
145 Ga0070667_100007596 3300005367 Bacteria 8991
146 Ga0070667_100073833 3300005367 Bacteria 2909
147 Ga0070667_100215317 3300005367 Bacteria 1708
148 Ga0070667_100224914 3300005367 Bacteria 1671
149 Ga0070667_100439251 3300005367 Bacteria 1191
150 Ga0070667_101395215 3300005367 Unclassified 657
151 Ga0070714_100090368 3300005435 Bacteria 2682
152 Ga0070714_100120474 3300005435 Bacteria 2333
153 Ga0070714_101388188 3300005435 Unclassified 686
154 Ga0070713_100465628 3300005436 Bacteria 1189
155 Ga0070711_100175932 3300005439 Bacteria 1635
156 Ga0070663_100008206 3300005455 Bacteria 6411
157 Ga0070663_100014657 3300005455 Bacteria 5037
158 Ga0070663_100021492 3300005455 Bacteria 4293
159 Ga0070663_100056409 3300005455 Bacteria 2814
160 Ga0070663_100075901 3300005455 Bacteria 2457
161 Ga0070663_100136965 3300005455 Bacteria 1865
162 Ga0070663_100400782 3300005455 Bacteria 1121
163 Ga0070663_100405269 3300005455 Bacteria 1116
164 Ga0070663_101562059 3300005455 Bacteria 588
165 Ga0070678_100052145 3300005456 Bacteria 2969
166 Ga0070678_100214532 3300005456 Bacteria 1597
167 Ga0070662_100000058 3300005457 Bacteria 59818
168 Ga0070662_100002250 3300005457 Bacteria 11839
169 Ga0070662_100008506 3300005457 Bacteria 6695
170 Ga0070662_100032283 3300005457 Bacteria 3679
171 Ga0070662_100036428 3300005457 Bacteria 3480
172 Ga0070662_100057502 3300005457 Bacteria 2826
173 Ga0070662_100132123 3300005457 Bacteria 1926
174 Ga0070662_100210895 3300005457 Bacteria 1546
175 Ga0070662_100255115 3300005457 Unclassified 1411
176 Ga0070662_100484535 3300005457 Bacteria 1030
177 Ga0070681_10065617 3300005458 Bacteria 3598
178 Ga0070681_10091641 3300005458 Bacteria 2989
179 Ga0070681_10156729 3300005458 Bacteria 2201
180 Ga0070681_10158250 3300005458 Bacteria 2189
181 Ga0068867_100055985 3300005459 Bacteria 2917
182 Ga0068867_100130086 3300005459 Bacteria 1955
183 Ga0068867_101264861 3300005459 Bacteria 680
184 Ga0070679_100030970 3300005530 Bacteria 5285
185 Ga0070679_100071424 3300005530 Bacteria 3462
186 Ga0070679_100099671 3300005530 Bacteria 2892
187 Ga0070679_100113223 3300005530 Bacteria 2699
188 Ga0070679_100209484 3300005530 Bacteria 1913
189 Ga0070679_100256307 3300005530 Bacteria 1705
190 Ga0070684_100002051 3300005535 Bacteria 14834
191 Ga0070684_100025627 3300005535 Bacteria 4960
192 Ga0070684_100027846 3300005535 Bacteria 4774
193 Ga0070684_100082964 3300005535 Bacteria 2839
194 Ga0070684_100102478 3300005535 Bacteria 2559
195 Ga0070684_100299794 3300005535 Bacteria 1475
196 Ga0070684_100575460 3300005535 Unclassified 1046
197 Ga0068853_100000223 3300005539 Bacteria 40165
198 Ga0068853_100015827 3300005539 Bacteria 6194
199 Ga0068853_100020632 3300005539 Bacteria 5479
200 Ga0068853_100029925 3300005539 Bacteria 4595
201 Ga0068853_100313236 3300005539 Bacteria 1453
202 Ga0068853_100570159 3300005539 Unclassified 1073
203 Ga0068853_100631462 3300005539 Bacteria 1018
204 Ga0068853_100916836 3300005539 Bacteria 842
205 Ga0070672_100000951 3300005543 Bacteria 17441
206 Ga0070672_100034782 3300005543 Bacteria 3826
207 Ga0070672_100050000 3300005543 Bacteria 3255
208 Ga0070672_100475464 3300005543 Bacteria 1079
209 Ga0070672_100584649 3300005543 Bacteria 972
210 Ga0070696_100406720 3300005546 Bacteria 1066
211 Ga0070693_100002238 3300005547 Bacteria 8882
212 Ga0070693_100078520 3300005547 Bacteria 1962
213 Ga0070693_100083745 3300005547 Bacteria 1907
214 Ga0070693_100496475 3300005547 Bacteria 865
215 Ga0070665_100004855 3300005548 Bacteria 13970
216 Ga0070665_100018109 3300005548 Bacteria 7066
217 Ga0070665_100036337 3300005548 Bacteria 4955
218 Ga0070665_100712346 3300005548 Bacteria 1017
219 Ga0068855_100001315 3300005563 Bacteria 30794
220 Ga0068855_100008388 3300005563 Bacteria 12494
221 Ga0068855_100053659 3300005563 Bacteria 4741
222 Ga0068855_100087004 3300005563 Bacteria 3612
223 Ga0068855_100092758 3300005563 Bacteria 3482
224 Ga0068855_100132257 3300005563 Bacteria 2848
225 Ga0068855_100240503 3300005563 Bacteria 2023
226 Ga0068855_100264416 3300005563 Bacteria 1915
227 Ga0068855_100544733 3300005563 Bacteria 1257
228 Ga0068855_100549154 3300005563 Bacteria 1251
229 Ga0068855_100582841 3300005563 Bacteria 1208
230 Ga0068855_100658765 3300005563 Bacteria 1124
231 Ga0070664_100000032 3300005564 Bacteria 88298
232 Ga0070664_100001054 3300005564 Bacteria 21689
233 Ga0070664_100001145 3300005564 Bacteria 21000
234 Ga0070664_100018769 3300005564 Bacteria 5688
235 Ga0070664_100043491 3300005564 Bacteria 3790
236 Ga0070664_100249423 3300005564 Bacteria 1595
237 Ga0070664_100353327 3300005564 Bacteria 1337
238 Ga0070664_100379852 3300005564 Bacteria 1289
239 Ga0070664_100590575 3300005564 Unclassified 1029
240 Ga0070664_100752386 3300005564 Bacteria 910
241 Ga0068857_100025979 3300005577 Bacteria 5158
242 Ga0068857_100041788 3300005577 Bacteria 4065
243 Ga0068857_100054910 3300005577 Bacteria 3535
244 Ga0068857_100097548 3300005577 Bacteria 2635
245 Ga0068857_100137919 3300005577 Bacteria 2203
246 Ga0068857_100219595 3300005577 Bacteria 1736
247 Ga0068854_100002274 3300005578 Bacteria 11823
248 Ga0068854_100010860 3300005578 Bacteria 5909
249 Ga0068854_100018007 3300005578 Bacteria 4735
250 Ga0068854_100022118 3300005578 Bacteria 4325
251 Ga0068854_100022260 3300005578 Bacteria 4314
252 Ga0068854_100051246 3300005578 Bacteria 2956
253 Ga0068854_100225705 3300005578 Bacteria 1484
254 Ga0068854_100329714 3300005578 Bacteria 1243
255 Ga0068854_100395181 3300005578 Bacteria 1143
256 Ga0068854_100459051 3300005578 Bacteria 1065
257 Ga0068856_100000161 3300005614 Bacteria 69696
258 Ga0068856_100030079 3300005614 Bacteria 5308
259 Ga0068856_100067386 3300005614 Bacteria 3537
260 Ga0068856_100223155 3300005614 Bacteria 1900
261 Ga0068856_100233583 3300005614 Bacteria 1854
262 Ga0068856_100481679 3300005614 Bacteria 1262
263 Ga0068856_100484810 3300005614 Bacteria 1257
264 Ga0068856_101156444 3300005614 Bacteria 791
265 Ga0068856_101740764 3300005614 Bacteria 635
266 Ga0068852_100002629 3300005616 Bacteria 12411
267 Ga0068852_100002985 3300005616 Bacteria 11756
268 Ga0068852_100008322 3300005616 Bacteria 7635
269 Ga0068852_100011217 3300005616 Bacteria 6734
270 Ga0068852_100137448 3300005616 Bacteria 2257
271 Ga0068852_100192667 3300005616 Bacteria 1924
272 Ga0068852_100331711 3300005616 Bacteria 1480
273 Ga0068852_100497046 3300005616 Bacteria 1214
274 Ga0068852_100523823 3300005616 Bacteria 1183
275 Ga0068852_100591995 3300005616 Bacteria 1113
276 Ga0068852_100729991 3300005616 Bacteria 1002
277 Ga0068859_100072250 3300005617 Bacteria 3487
278 Ga0068859_100262365 3300005617 Bacteria 1819
279 Ga0068864_100014951 3300005618 Bacteria 6450
280 Ga0068864_100080670 3300005618 Bacteria 2851
281 Ga0068864_100118668 3300005618 Bacteria 2362
282 Ga0068864_100379163 3300005618 Bacteria 1340
283 Ga0068864_100488436 3300005618 Bacteria 1183
284 Ga0068864_100496176 3300005618 Bacteria 1174
285 Ga0068866_10035196 3300005718 Bacteria 2444
286 Ga0068851_10012636 3300005834 Bacteria 3984
287 Ga0068851_10059339 3300005834 Bacteria 1957
288 Ga0068851_10061356 3300005834 Bacteria 1927
289 Ga0068851_10164411 3300005834 Bacteria 1221
290 Ga0068851_10197268 3300005834 Bacteria 1122
291 Ga0068851_10545777 3300005834 Unclassified 700
292 Ga0068863_100021109 3300005841 Bacteria 6221
293 Ga0068863_100047141 3300005841 Bacteria 4089
294 Ga0068863_100052264 3300005841 Bacteria 3873
295 Ga0068863_100301111 3300005841 Bacteria 1555
296 Ga0068858_100001074 3300005842 Bacteria 28281
297 Ga0068858_100049615 3300005842 Bacteria 3887
298 Ga0068858_100137204 3300005842 Bacteria 2296
299 Ga0068860_100233157 3300005843 Bacteria 1789
300 Ga0068860_100787260 3300005843 Bacteria 964
301 Ga0068862_100061057 3300005844 Bacteria 3239
302 Ga0081539_10048957 3300005985 Bacteria 2401
303 Ga0068865_100230028 3300006881 Bacteria 1454
304 Ga0097620_100072252 3300006931 Bacteria 3487
305 Ga0097620_100262370 3300006931 Bacteria 1819
306 Ga0105240_10017996 3300009093 Bacteria 9505
307 Ga0105240_10036523 3300009093 Bacteria 6318
308 Ga0105240_10144103 3300009093 Bacteria 2844
309 Ga0105245_10199454 3300009098 Bacteria 1921
310 Ga0105245_10253403 3300009098 Bacteria 1711
311 Ga0105243_11430964 3300009148 Bacteria 713
312 Ga0105241_10066740 3300009174 Bacteria 2783
313 Ga0105241_10094108 3300009174 Bacteria 2369
314 Ga0105241_10109797 3300009174 Bacteria 2206
315 Ga0105242_11195269 3300009176 Bacteria 779
316 Ga0105248_10000223 3300009177 Bacteria 65010
317 Ga0105248_10004318 3300009177 Bacteria 15721
318 Ga0105248_10016377 3300009177 Bacteria 8158
319 Ga0105248_10036994 3300009177 Bacteria 5459
320 Ga0105248_10052433 3300009177 Bacteria 4577
321 Ga0105248_11690277 3300009177 Bacteria 717
322 Ga0105248_11771649 3300009177 Bacteria 700
323 Ga0105237_10027414 3300009545 Bacteria 5816
324 Ga0105237_10353454 3300009545 Bacteria 1474
325 Ga0105238_10078979 3300009551 Bacteria 3281
326 Ga0105238_10159429 3300009551 Bacteria 2231
327 Ga0105238_10558413 3300009551 Bacteria 1150
328 Ga0105238_10671747 3300009551 Bacteria 1047
329 Ga0105238_11502915 3300009551 Unclassified 702
330 Ga0105249_10242916 3300009553 Bacteria 1781
331 Ga0105239_10163966 3300010375 Bacteria 2484
332 Ga0105239_10385060 3300010375 Bacteria 1586
333 Ga0105239_11051293 3300010375 Bacteria 937
334 Ga0105246_10965703 3300011119 Bacteria 769
335 Ga0157373_10010802 3300013100 Bacteria 6721
336 Ga0157373_10020196 3300013100 Bacteria 4845
337 Ga0157373_10042206 3300013100 Bacteria 3261
338 Ga0157373_10056429 3300013100 Bacteria 2789
339 Ga0157373_10081819 3300013100 Bacteria 2276
340 Ga0157373_10140252 3300013100 Bacteria 1700
341 Ga0157373_10169059 3300013100 Bacteria 1538
342 Ga0157373_10460897 3300013100 Bacteria 915
343 Ga0157373_10651205 3300013100 Bacteria 769
344 Ga0157373_10762276 3300013100 Unclassified 712
345 Ga0157371_10001103 3300013102 Bacteria 29269
346 Ga0157371_10026893 3300013102 Bacteria 4176
347 Ga0157371_10069895 3300013102 Bacteria 2486
348 Ga0157371_10073988 3300013102 Bacteria 2413
349 Ga0157371_10088750 3300013102 Bacteria 2189
350 Ga0157371_10107371 3300013102 Bacteria 1981
351 Ga0157371_10133842 3300013102 Bacteria 1765
352 Ga0157371_10208824 3300013102 Bacteria 1401
353 Ga0157371_10250597 3300013102 Bacteria 1275
354 Ga0157371_10382991 3300013102 Unclassified 1027
355 Ga0157371_10492606 3300013102 Bacteria 904
356 Ga0157370_10001094 3300013104 Bacteria 33972
357 Ga0157370_10010418 3300013104 Bacteria 9797
358 Ga0157370_10046919 3300013104 Bacteria 4141
359 Ga0157370_10116759 3300013104 Bacteria 2493
360 Ga0157370_10202139 3300013104 Bacteria 1843
361 Ga0157370_10411494 3300013104 Bacteria 1244
362 Ga0157370_10443589 3300013104 Bacteria 1193
363 Ga0157370_10987163 3300013104 Bacteria 763
364 Ga0157370_11145444 3300013104 Bacteria 702
365 Ga0157369_10042136 3300013105 Bacteria 4981
366 Ga0157369_10068780 3300013105 Bacteria 3804
367 Ga0157369_10092706 3300013105 Bacteria 3224
368 Ga0157369_10244592 3300013105 Bacteria 1873
369 Ga0157369_10285145 3300013105 Unclassified 1720
370 Ga0157369_10396871 3300013105 Bacteria 1431
371 Ga0157369_10425072 3300013105 Bacteria 1377
372 Ga0157369_10458052 3300013105 Bacteria 1320
373 Ga0157369_10606893 3300013105 Bacteria 1129
374 Ga0157369_10639217 3300013105 Bacteria 1098
375 Ga0157369_10797730 3300013105 Bacteria 970
376 Ga0157369_11246461 3300013105 Unclassified 759
377 Ga0157369_12136441 3300013105 Unclassified 568
378 Ga0157374_10098709 3300013296 Bacteria 2797
379 Ga0157374_10164799 3300013296 Bacteria 2160
380 Ga0157378_10178787 3300013297 Bacteria 1995
381 Ga0157378_12014496 3300013297 Bacteria 627
382 Ga0163162_10616613 3300013306 Bacteria 1210
383 Ga0163162_10870203 3300013306 Bacteria 1016
384 Ga0163162_11970727 3300013306 Bacteria 669
385 Ga0157372_10016489 3300013307 Bacteria 7928
386 Ga0157372_10051938 3300013307 Bacteria 4563
387 Ga0157372_10070058 3300013307 Bacteria 3945
388 Ga0157372_10117481 3300013307 Bacteria 3051
389 Ga0157372_10223619 3300013307 Bacteria 2182
390 Ga0157372_10365497 3300013307 Bacteria 1681
391 Ga0157372_10763207 3300013307 Bacteria 1124
392 Ga0157372_11593991 3300013307 Unclassified 752
393 Ga0157375_10116832 3300013308 Bacteria 2772
394 Ga0157375_10123262 3300013308 Bacteria 2704
395 Ga0157375_11071480 3300013308 Bacteria 943
396 Ga0163163_10000567 3300014325 Bacteria 32441
397 Ga0163163_10722135 3300014325 Unclassified 1060
398 Ga0157380_10316719 3300014326 Bacteria 1444
399 Ga0157380_12098750 3300014326 Bacteria 628
400 Ga0157379_10164669 3300014968 Bacteria 2001
401 Ga0163161_10067003 3300017792 Bacteria 2622
402 Ga0163161_10453100 3300017792 Bacteria 1037
403 Ga0197907_10443190 3300020069 Bacteria 1655
404 Ga0206354_10469396 3300020081 Bacteria 848
405 Ga0206354_10890655 3300020081 Bacteria 1820
406 Ga0206353_11539987 3300020082 Bacteria 2489
407 Ga0206353_11568958 3300020082 Bacteria 2164
408 Ga0213875_10005764 3300021388 Bacteria 6596
409 Ga0207697_10272096 3300025315 Bacteria 750
410 Ga0207656_10146010 3300025321 Bacteria 1118
411 Ga0207656_10162271 3300025321 Bacteria 1064
412 Ga0207656_10589893 3300025321 Unclassified 567
413 Ga0207682_10007482 3300025893 Bacteria 4348
414 Ga0207682_10117815 3300025893 Bacteria 1175
415 Ga0207682_10171817 3300025893 Bacteria 986
416 Ga0207682_10537291 3300025893 Unclassified 553
417 Ga0207642_10181193 3300025899 Bacteria 1148
418 Ga0207688_10138171 3300025901 Bacteria 1433
419 Ga0207688_10194616 3300025901 Bacteria 1214
420 Ga0207688_10305491 3300025901 Bacteria 973
421 Ga0207688_10412213 3300025901 Bacteria 839
422 Ga0207688_10527574 3300025901 Bacteria 741
423 Ga0207680_10000287 3300025903 Bacteria 24123
424 Ga0207680_10000518 3300025903 Bacteria 18426
425 Ga0207680_10071225 3300025903 Bacteria 2154
426 Ga0207680_10502905 3300025903 Unclassified 863
427 Ga0207647_10001865 3300025904 Bacteria 16141
428 Ga0207647_10011056 3300025904 Bacteria 6346
429 Ga0207647_10021020 3300025904 Bacteria 4364
430 Ga0207647_10026799 3300025904 Bacteria 3765
431 Ga0207647_10064719 3300025904 Bacteria 2221
432 Ga0207647_10186083 3300025904 Bacteria 1205
433 Ga0207647_10195364 3300025904 Bacteria 1171
434 Ga0207699_10048117 3300025906 Bacteria 2503
435 Ga0207645_10010343 3300025907 Bacteria 6404
436 Ga0207645_10097664 3300025907 Bacteria 1893
437 Ga0207705_10000918 3300025909 Bacteria 24102
438 Ga0207705_10002069 3300025909 Bacteria 15599
439 Ga0207705_10002487 3300025909 Bacteria 14197
440 Ga0207705_10004009 3300025909 Bacteria 11203
441 Ga0207705_10015789 3300025909 Bacteria 5422
442 Ga0207705_10060556 3300025909 Bacteria 2734
443 Ga0207705_10067722 3300025909 Bacteria 2584
444 Ga0207705_10079895 3300025909 Bacteria 2382
445 Ga0207705_10080309 3300025909 Bacteria 2376
446 Ga0207705_10148760 3300025909 Bacteria 1753
447 Ga0207705_10151776 3300025909 Bacteria 1736
448 Ga0207705_10194989 3300025909 Bacteria 1533
449 Ga0207705_10243479 3300025909 Unclassified 1370
450 Ga0207705_10516516 3300025909 Bacteria 928
451 Ga0207705_10986564 3300025909 Bacteria 651
452 Ga0207705_11005236 3300025909 Bacteria 644
453 Ga0207654_10038052 3300025911 Bacteria 2696
454 Ga0207654_10043247 3300025911 Bacteria 2553
455 Ga0207707_10006776 3300025912 Bacteria 9996
456 Ga0207707_10026039 3300025912 Bacteria 5115
457 Ga0207707_10034897 3300025912 Bacteria 4400
458 Ga0207707_10050032 3300025912 Bacteria 3641
459 Ga0207707_10163678 3300025912 Bacteria 1944
460 Ga0207707_10287234 3300025912 Bacteria 1423
461 Ga0207707_10365803 3300025912 Bacteria 1241
462 Ga0207695_10175044 3300025913 Bacteria 2069
463 Ga0207695_10229635 3300025913 Bacteria 1761
464 Ga0207671_10311292 3300025914 Bacteria 1245
465 Ga0207693_10229282 3300025915 Bacteria 1458
466 Ga0207660_10006350 3300025917 Bacteria 7663
467 Ga0207660_10006640 3300025917 Bacteria 7503
468 Ga0207660_10009865 3300025917 Bacteria 6184
469 Ga0207660_10085185 3300025917 Bacteria 2330
470 Ga0207660_10114183 3300025917 Bacteria 2037
471 Ga0207660_10270407 3300025917 Bacteria 1346
472 Ga0207660_10451058 3300025917 Bacteria 1040
473 Ga0207660_10818436 3300025917 Bacteria 760
474 Ga0207662_10657047 3300025918 Bacteria 733
475 Ga0207657_10000164 3300025919 Bacteria 67184
476 Ga0207657_10003166 3300025919 Bacteria 17609
477 Ga0207657_10004331 3300025919 Bacteria 15036
478 Ga0207657_10008912 3300025919 Bacteria 10142
479 Ga0207657_10010138 3300025919 Bacteria 9417
480 Ga0207657_10020990 3300025919 Bacteria 6159
481 Ga0207657_10030267 3300025919 Bacteria 4915
482 Ga0207657_10034718 3300025919 Bacteria 4531
483 Ga0207657_10061324 3300025919 Bacteria 3225
484 Ga0207657_10200735 3300025919 Bacteria 1604
485 Ga0207657_10238392 3300025919 Bacteria 1453
486 Ga0207657_10290503 3300025919 Bacteria 1296
487 Ga0207657_10291682 3300025919 Bacteria 1293
488 Ga0207657_10531256 3300025919 Bacteria 920
489 Ga0207657_10819506 3300025919 Bacteria 719
490 Ga0207657_11167676 3300025919 Bacteria 586
491 Ga0207649_10000580 3300025920 Bacteria 25006
492 Ga0207649_10002698 3300025920 Bacteria 9835
493 Ga0207649_10009014 3300025920 Bacteria 5450
494 Ga0207649_10010162 3300025920 Bacteria 5166
495 Ga0207649_10014720 3300025920 Bacteria 4385
496 Ga0207649_10080637 3300025920 Bacteria 2105
497 Ga0207649_10174955 3300025920 Bacteria 1498
498 Ga0207649_10289388 3300025920 Unclassified 1194
499 Ga0207649_10316759 3300025920 Bacteria 1145
500 Ga0207649_10355675 3300025920 Bacteria 1085
501 Ga0207649_10374754 3300025920 Bacteria 1059
502 Ga0207649_10451525 3300025920 Bacteria 970
503 Ga0207649_10745067 3300025920 Bacteria 762
504 Ga0207649_10812620 3300025920 Bacteria 730
505 Ga0207649_10929166 3300025920 Bacteria 683
506 Ga0207652_10002403 3300025921 Bacteria 15807
507 Ga0207652_10017090 3300025921 Bacteria 5934
508 Ga0207652_10072638 3300025921 Bacteria 2992
509 Ga0207652_10200967 3300025921 Bacteria 1793
510 Ga0207652_10417483 3300025921 Bacteria 1210
511 Ga0207652_10577084 3300025921 Bacteria 1009
512 Ga0207652_10755513 3300025921 Unclassified 865
513 Ga0207681_10029760 3300025923 Bacteria 3552
514 Ga0207681_10048755 3300025923 Bacteria 2860
515 Ga0207681_10464051 3300025923 Bacteria 1032
516 Ga0207681_10695854 3300025923 Bacteria 845
517 Ga0207681_10993234 3300025923 Bacteria 704
518 Ga0207694_10002652 3300025924 Bacteria 14514
519 Ga0207694_10144960 3300025924 Bacteria 1911
520 Ga0207694_11114031 3300025924 Bacteria 668
521 Ga0207650_10006901 3300025925 Bacteria 7744
522 Ga0207650_10022254 3300025925 Bacteria 4485
523 Ga0207650_10038195 3300025925 Bacteria 3504
524 Ga0207650_10114050 3300025925 Bacteria 2096
525 Ga0207650_10224113 3300025925 Bacteria 1514
526 Ga0207650_10234319 3300025925 Bacteria 1482
527 Ga0207650_10790173 3300025925 Bacteria 804
528 Ga0207650_11100495 3300025925 Bacteria 676
529 Ga0207659_10008159 3300025926 Bacteria 6483
530 Ga0207659_10043782 3300025926 Bacteria 3146
531 Ga0207659_10220496 3300025926 Bacteria 1525
532 Ga0207659_10988589 3300025926 Unclassified 724
533 Ga0207687_10315661 3300025927 Bacteria 1263
534 Ga0207687_10371650 3300025927 Bacteria 1169
535 Ga0207700_10639395 3300025928 Bacteria 948
536 Ga0207700_10745341 3300025928 Bacteria 875
537 Ga0207664_10035496 3300025929 Bacteria 3847
538 Ga0207664_10177454 3300025929 Bacteria 1827
539 Ga0207664_10242668 3300025929 Bacteria 1569
540 Ga0207664_10309989 3300025929 Bacteria 1390
541 Ga0207644_10003151 3300025931 Bacteria 10623
542 Ga0207644_10004195 3300025931 Bacteria 9353
543 Ga0207644_10006157 3300025931 Bacteria 7822
544 Ga0207644_10028272 3300025931 Bacteria 3880
545 Ga0207644_10280562 3300025931 Bacteria 1337
546 Ga0207644_10295757 3300025931 Bacteria 1303
547 Ga0207644_10876075 3300025931 Bacteria 752
548 Ga0207690_10000800 3300025932 Bacteria 20216
549 Ga0207690_10002026 3300025932 Bacteria 12421
550 Ga0207690_10003062 3300025932 Bacteria 10072
551 Ga0207690_10004345 3300025932 Bacteria 8374
552 Ga0207690_10006912 3300025932 Bacteria 6725
553 Ga0207690_10022117 3300025932 Bacteria 3951
554 Ga0207690_10031117 3300025932 Bacteria 3412
555 Ga0207690_10038541 3300025932 Bacteria 3111
556 Ga0207690_10177235 3300025932 Bacteria 1602
557 Ga0207690_10228802 3300025932 Bacteria 1426
558 Ga0207690_10418614 3300025932 Bacteria 1071
559 Ga0207690_11198187 3300025932 Bacteria 634
560 Ga0207690_11275163 3300025932 Bacteria 614
561 Ga0207690_11407150 3300025932 Bacteria 583
562 Ga0207706_10000196 3300025933 Bacteria 67184
563 Ga0207706_10003899 3300025933 Bacteria 14158
564 Ga0207706_10005418 3300025933 Bacteria 11894
565 Ga0207706_10008864 3300025933 Bacteria 9260
566 Ga0207706_10014479 3300025933 Bacteria 7150
567 Ga0207706_10031514 3300025933 Bacteria 4723
568 Ga0207706_10082986 3300025933 Bacteria 2817
569 Ga0207706_10125690 3300025933 Bacteria 2256
570 Ga0207706_10147296 3300025933 Bacteria 2071
571 Ga0207706_10237994 3300025933 Bacteria 1592
572 Ga0207706_10314016 3300025933 Unclassified 1364
573 Ga0207709_10621408 3300025935 Bacteria 857
574 Ga0207670_10748937 3300025936 Bacteria 811
575 Ga0207670_11656504 3300025936 Bacteria 544
576 Ga0207669_10053662 3300025937 Bacteria 2430
577 Ga0207669_10255221 3300025937 Bacteria 1308
578 Ga0207669_10342144 3300025937 Bacteria 1152
579 Ga0207669_10503471 3300025937 Bacteria 969
580 Ga0207669_11606146 3300025937 Bacteria 555
581 Ga0207704_10196901 3300025938 Bacteria 1471
582 Ga0207665_10009018 3300025939 Bacteria 6546
583 Ga0207691_10002269 3300025940 Bacteria 18838
584 Ga0207691_10018513 3300025940 Bacteria 6600
585 Ga0207691_10035264 3300025940 Bacteria 4645
586 Ga0207691_10202092 3300025940 Bacteria 1729
587 Ga0207691_10235235 3300025940 Bacteria 1585
588 Ga0207691_10490656 3300025940 Bacteria 1043
589 Ga0207711_10000698 3300025941 Bacteria 33120
590 Ga0207711_10000964 3300025941 Bacteria 27531
591 Ga0207711_10007246 3300025941 Bacteria 9294
592 Ga0207711_10007578 3300025941 Bacteria 9082
593 Ga0207711_10097827 3300025941 Bacteria 2592
594 Ga0207711_10117700 3300025941 Bacteria 2370
595 Ga0207689_10543128 3300025942 Bacteria 976
596 Ga0207661_10003155 3300025944 Bacteria 11437
597 Ga0207661_10020126 3300025944 Bacteria 4983
598 Ga0207661_10022858 3300025944 Bacteria 4715
599 Ga0207661_10032800 3300025944 Bacteria 4027
600 Ga0207661_10152760 3300025944 Bacteria 1997
601 Ga0207661_10388127 3300025944 Bacteria 1264
602 Ga0207661_10893338 3300025944 Bacteria 818
603 Ga0207679_10001145 3300025945 Bacteria 16891
604 Ga0207679_10004258 3300025945 Bacteria 8888
605 Ga0207679_10007849 3300025945 Bacteria 6782
606 Ga0207679_10058384 3300025945 Bacteria 2859
607 Ga0207679_10061848 3300025945 Bacteria 2788
608 Ga0207679_10111604 3300025945 Bacteria 2159
609 Ga0207679_10155623 3300025945 Bacteria 1866
610 Ga0207679_10215308 3300025945 Bacteria 1613
611 Ga0207679_10493550 3300025945 Unclassified 1092
612 Ga0207679_10575960 3300025945 Bacteria 1012
613 Ga0207679_10725032 3300025945 Bacteria 903
614 Ga0207679_10918971 3300025945 Bacteria 801
615 Ga0207667_10001975 3300025949 Bacteria 25689
616 Ga0207667_10012015 3300025949 Bacteria 10021
617 Ga0207667_10043334 3300025949 Bacteria 4776
618 Ga0207667_10074000 3300025949 Bacteria 3539
619 Ga0207667_10085320 3300025949 Bacteria 3269
620 Ga0207667_10138676 3300025949 Bacteria 2504
621 Ga0207667_10191969 3300025949 Bacteria 2096
622 Ga0207667_10209821 3300025949 Bacteria 1996
623 Ga0207667_10295669 3300025949 Bacteria 1654
624 Ga0207667_10495950 3300025949 Bacteria 1239
625 Ga0207667_10523963 3300025949 Bacteria 1200
626 Ga0207667_10723872 3300025949 Bacteria 996
627 Ga0207667_10786227 3300025949 Bacteria 949
628 Ga0207651_10088992 3300025960 Bacteria 2252
629 Ga0207651_10198343 3300025960 Bacteria 1606
630 Ga0207651_10324727 3300025960 Bacteria 1287
631 Ga0207651_10375329 3300025960 Bacteria 1204
632 Ga0207651_10893570 3300025960 Bacteria 791
633 Ga0207651_11296172 3300025960 Bacteria 655
634 Ga0207712_10300542 3300025961 Bacteria 1317
635 Ga0207668_10141726 3300025972 Bacteria 1850
636 Ga0207668_10165342 3300025972 Bacteria 1729
637 Ga0207668_10234097 3300025972 Bacteria 1482
638 Ga0207668_10566387 3300025972 Bacteria 986
639 Ga0207668_10722658 3300025972 Bacteria 877
640 Ga0207640_10005356 3300025981 Bacteria 6996
641 Ga0207640_10005994 3300025981 Bacteria 6642
642 Ga0207640_10031342 3300025981 Bacteria 3284
643 Ga0207640_10067965 3300025981 Bacteria 2386
644 Ga0207640_10075767 3300025981 Bacteria 2281
645 Ga0207640_10588568 3300025981 Bacteria 940
646 Ga0207640_10666362 3300025981 Bacteria 888
647 Ga0207640_10746517 3300025981 Bacteria 843
648 Ga0207640_11498196 3300025981 Bacteria 606
649 Ga0207658_10004902 3300025986 Bacteria 9232
650 Ga0207658_10010805 3300025986 Bacteria 6211
651 Ga0207658_10048431 3300025986 Bacteria 3116
652 Ga0207658_10062041 3300025986 Bacteria 2796
653 Ga0207658_10122275 3300025986 Bacteria 2077
654 Ga0207658_10229390 3300025986 Bacteria 1566
655 Ga0207658_11744808 3300025986 Bacteria 568
656 Ga0207677_10007770 3300026023 Bacteria 5953
657 Ga0207677_10033933 3300026023 Bacteria 3299
658 Ga0207677_10046166 3300026023 Bacteria 2915
659 Ga0207703_10010398 3300026035 Bacteria 7281
660 Ga0207703_10038175 3300026035 Bacteria 3831
661 Ga0207703_10488906 3300026035 Bacteria 1154
662 Ga0207639_10000124 3300026041 Bacteria 57560
663 Ga0207639_10001229 3300026041 Bacteria 17375
664 Ga0207639_10001939 3300026041 Bacteria 13893
665 Ga0207639_10005669 3300026041 Bacteria 8449
666 Ga0207639_10015790 3300026041 Bacteria 5330
667 Ga0207639_10098982 3300026041 Bacteria 2352
668 Ga0207639_10100404 3300026041 Bacteria 2337
669 Ga0207639_10106086 3300026041 Bacteria 2280
670 Ga0207639_10994886 3300026041 Bacteria 785
671 Ga0207678_10000864 3300026067 Bacteria 27765
672 Ga0207678_10009242 3300026067 Bacteria 8674
673 Ga0207678_10015113 3300026067 Bacteria 6791
674 Ga0207678_10030837 3300026067 Bacteria 4681
675 Ga0207678_10048878 3300026067 Bacteria 3655
676 Ga0207678_10068109 3300026067 Bacteria 3055
677 Ga0207678_10069929 3300026067 Bacteria 3010
678 Ga0207678_10292612 3300026067 Bacteria 1399
679 Ga0207678_10297066 3300026067 Bacteria 1388
680 Ga0207678_10998029 3300026067 Bacteria 741
681 Ga0207678_11331730 3300026067 Bacteria 635
682 Ga0207702_10000435 3300026078 Bacteria 47593
683 Ga0207702_10045189 3300026078 Bacteria 3705
684 Ga0207702_10067353 3300026078 Bacteria 3073
685 Ga0207702_10075513 3300026078 Bacteria 2912
686 Ga0207702_10201904 3300026078 Bacteria 1843
687 Ga0207702_10362185 3300026078 Bacteria 1390
688 Ga0207702_10406850 3300026078 Bacteria 1313
689 Ga0207702_10727823 3300026078 Bacteria 979
690 Ga0207702_11109158 3300026078 Bacteria 785
691 Ga0207702_11505090 3300026078 Unclassified 666
692 Ga0207702_11645840 3300026078 Bacteria 635
693 Ga0207641_10016966 3300026088 Bacteria 5962
694 Ga0207641_10318420 3300026088 Bacteria 1474
695 Ga0207641_10545451 3300026088 Bacteria 1130
696 Ga0207648_10020678 3300026089 Bacteria 5925
697 Ga0207648_11096574 3300026089 Bacteria 747
698 Ga0207676_10054304 3300026095 Bacteria 3139
699 Ga0207676_10397483 3300026095 Bacteria 1287
700 Ga0207676_10399602 3300026095 Bacteria 1284
701 Ga0207674_10001518 3300026116 Bacteria 29932
702 Ga0207674_10001923 3300026116 Bacteria 26367
703 Ga0207674_10003802 3300026116 Bacteria 18408
704 Ga0207674_10007288 3300026116 Bacteria 12892
705 Ga0207674_10102865 3300026116 Bacteria 2836
706 Ga0207674_10196050 3300026116 Bacteria 1969
707 Ga0207674_11034160 3300026116 Bacteria 791
708 Ga0207675_100358470 3300026118 Bacteria 1430
709 Ga0207683_10056679 3300026121 Bacteria 3438
710 Ga0207683_10352433 3300026121 Bacteria 1351
711 Ga0207683_11076203 3300026121 Bacteria 746
712 Ga0207698_10001464 3300026142 Bacteria 13732
713 Ga0207698_10003125 3300026142 Bacteria 9926
714 Ga0207698_10029445 3300026142 Bacteria 3933
715 Ga0207698_10039763 3300026142 Bacteria 3487
716 Ga0207698_10066598 3300026142 Bacteria 2836
717 Ga0207698_10376474 3300026142 Bacteria 1349
718 Ga0207698_10406565 3300026142 Bacteria 1302
719 Ga0207698_10429704 3300026142 Bacteria 1270
720 Ga0207698_10570784 3300026142 Bacteria 1112
721 Ga0207698_10588806 3300026142 Bacteria 1095
722 Ga0207698_11148265 3300026142 Bacteria 790
723 Ga0207698_11512262 3300026142 Bacteria 687
724 Ga0209974_10044680 3300027876 Bacteria 1478
725 Ga0268266_10008238 3300028379 Bacteria 9288
726 Ga0268266_10126567 3300028379 Unclassified 2281
727 Ga0268266_10181693 3300028379 Bacteria 1915
728 Ga0268266_11292954 3300028379 Bacteria 705
729 Ga0268265_10038850 3300028380 Bacteria 3504
730 Ga0268265_10043686 3300028380 Bacteria 3333
731 Ga0268265_10393532 3300028380 Bacteria 1279
732 Ga0268265_11120492 3300028380 Unclassified 782
733 Ga0268264_10061030 3300028381 Bacteria 3162
734 Ga0268264_10235341 3300028381 Bacteria 1694
735 Ga0268264_11494636 3300028381 Bacteria 686
736 Ga0316178_1024636 3300030735 Bacteria 696
737 Ga0316182_1015273 3300030745 Bacteria 823
738 Ga0316182_1436356 3300030745 Bacteria 1007
739 Ga0307408_100011358 3300031548 Bacteria 5883
740 Ga0307408_100028010 3300031548 Bacteria 3890
741 Ga0307408_100136498 3300031548 Bacteria 1920
742 Ga0307408_100150926 3300031548 Bacteria 1834
743 Ga0307408_100255218 3300031548 Bacteria 1448
744 Ga0307405_10160299 3300031731 Bacteria 1592
745 Ga0307405_10297668 3300031731 Bacteria 1222
746 Ga0307405_10349248 3300031731 Bacteria 1140
747 Ga0307405_10491829 3300031731 Bacteria 981
748 Ga0307405_10556346 3300031731 Bacteria 929
749 Ga0307413_10007305 3300031824 Bacteria 5120
750 Ga0307413_10014262 3300031824 Bacteria 4028
751 Ga0307413_10017979 3300031824 Bacteria 3696
752 Ga0307413_10026344 3300031824 Bacteria 3202
753 Ga0307413_10026426 3300031824 Bacteria 3198
754 Ga0307413_10108631 3300031824 Bacteria 1852
755 Ga0307413_10194211 3300031824 Bacteria 1460
756 Ga0307413_10194609 3300031824 Bacteria 1459
757 Ga0307413_10782247 3300031824 Bacteria 800
758 Ga0307410_10000725 3300031852 Bacteria 13778
759 Ga0307410_10000754 3300031852 Bacteria 13563
760 Ga0307410_10018851 3300031852 Bacteria 4180
761 Ga0307410_10193357 3300031852 Bacteria 1548
762 Ga0307410_10377060 3300031852 Bacteria 1140
763 Ga0307410_10412256 3300031852 Bacteria 1094
764 Ga0307410_10518119 3300031852 Bacteria 984
765 Ga0307410_10554838 3300031852 Bacteria 952
766 Ga0307410_10948922 3300031852 Bacteria 739
767 Ga0307406_10042056 3300031901 Bacteria 2851
768 Ga0307406_10069405 3300031901 Bacteria 2304
769 Ga0307406_10072498 3300031901 Bacteria 2261
770 Ga0307406_10098463 3300031901 Bacteria 1986
771 Ga0307406_10184450 3300031901 Bacteria 1522
772 Ga0307406_10481466 3300031901 Bacteria 1002
773 Ga0307406_10572852 3300031901 Bacteria 927
774 Ga0307406_10589215 3300031901 Bacteria 915
775 Ga0307407_10006626 3300031903 Bacteria 5172
776 Ga0307407_10025285 3300031903 Bacteria 3127
777 Ga0307407_10285185 3300031903 Bacteria 1145
778 Ga0307407_10403355 3300031903 Bacteria 981
779 Ga0307407_10410043 3300031903 Bacteria 974
780 Ga0307407_10591680 3300031903 Bacteria 825
781 Ga0307412_10040452 3300031911 Bacteria 3016
782 Ga0307412_10057621 3300031911 Bacteria 2595
783 Ga0307412_10225716 3300031911 Bacteria 1439
784 Ga0307412_10319303 3300031911 Bacteria 1235
785 Ga0307412_10395639 3300031911 Bacteria 1123
786 Ga0307412_11234460 3300031911 Bacteria 670
787 Ga0307409_100012140 3300031995 Bacteria 5473
788 Ga0307409_100029936 3300031995 Bacteria 3904
789 Ga0307409_100048167 3300031995 Bacteria 3240
790 Ga0307409_100048980 3300031995 Bacteria 3219
791 Ga0307409_100102425 3300031995 Bacteria 2378
792 Ga0307409_100209855 3300031995 Bacteria 1749
793 Ga0307409_100713703 3300031995 Bacteria 1003
794 Ga0307409_100844408 3300031995 Bacteria 926
795 Ga0307409_100915295 3300031995 Bacteria 891
796 Ga0307409_100922054 3300031995 Bacteria 888
797 Ga0307409_100983385 3300031995 Bacteria 861
798 Ga0307416_100146919 3300032002 Bacteria 2154
799 Ga0307416_100235245 3300032002 Bacteria 1770
800 Ga0307416_100327710 3300032002 Bacteria 1537
801 Ga0307416_100804439 3300032002 Bacteria 1036
802 Ga0307416_101452449 3300032002 Unclassified 792
803 Ga0307416_102043656 3300032002 Bacteria 675
804 Ga0307414_10003556 3300032004 Bacteria 8345
805 Ga0307414_10006688 3300032004 Bacteria 6449
806 Ga0307414_10013271 3300032004 Bacteria 4901
807 Ga0307414_10089168 3300032004 Bacteria 2285
808 Ga0307414_10113644 3300032004 Bacteria 2067
809 Ga0307414_10243795 3300032004 Bacteria 1489
810 Ga0307414_10300026 3300032004 Bacteria 1359
811 Ga0307411_10005504 3300032005 Bacteria 6231
812 Ga0307411_10008007 3300032005 Bacteria 5441
813 Ga0307411_10028965 3300032005 Bacteria 3375
814 Ga0307411_10029320 3300032005 Bacteria 3358
815 Ga0307411_10066692 3300032005 Bacteria 2419
816 Ga0307411_10076934 3300032005 Bacteria 2282
817 Ga0307411_10083779 3300032005 Bacteria 2203
818 Ga0307411_10139671 3300032005 Bacteria 1784
819 Ga0307411_10200211 3300032005 Bacteria 1533
820 Ga0307411_10585005 3300032005 Bacteria 957
821 Ga0307411_10892551 3300032005 Bacteria 789
822 Ga0307411_11513660 3300032005 Bacteria 617
823 Ga0307415_100030563 3300032126 Bacteria 3459
824 Ga0307415_100039832 3300032126 Bacteria 3109
825 Ga0307415_100047218 3300032126 Bacteria 2898
826 Ga0307415_100047423 3300032126 Bacteria 2892
827 Ga0307415_100250717 3300032126 Bacteria 1438
828 Ga0307415_100335116 3300032126 Bacteria 1267
829 Ga0307415_100495893 3300032126 Bacteria 1066
830 Ga0307415_100529643 3300032126 Bacteria 1036
831 Ga0307415_100584809 3300032126 Bacteria 991
832 Ga0373958_0006318 3300034819 Bacteria 1842
833 Ga0373938_0050246 3300034957 Bacteria 951
834 Ga0373929_0116519 3300035085 Bacteria 688
835 Ga0373923_0028635 3300035111 Bacteria 2229
836 Ga0373932_0011316 3300035112 Bacteria 2178
837 Ga0373960_0067428 3300035121 Bacteria 1099
838 Ga0373943_0167649 3300035170 Bacteria 1200
839 Ga0373955_0147201 3300035172 Bacteria 1384
840 Ga0373942_0231454 3300035207 Bacteria 622
841 Ga0373942_0324671 3300035207 Bacteria 539
842 Ga0373962_0191497 3300035242 Bacteria 688
843 Ga0373931_0075236 3300035691 Bacteria 1851
844 Ga0373933_0101602 3300035724 Bacteria 1784
845 Ga0373937_0047794 3300036401 Bacteria 3916
846 Ga0373937_0637782 3300036401 Bacteria 1011
847 Ga0373937_0816829 3300036401 Bacteria 880
848 Ga0395899_0004300 3300037312 Bacteria 11125
849 Ga0395899_0031601 3300037312 Bacteria 3978
850 Ga0395899_0055136 3300037312 Bacteria 2940
851 Ga0395899_0100447 3300037312 Bacteria 2089
852 Ga0395899_0217358 3300037312 Bacteria 1325
853 Ga0395899_0305051 3300037312 Bacteria 1076
854 Ga0395899_0438909 3300037312 Bacteria 857
855 Ga0395899_0489775 3300037312 Bacteria 799
856 Ga0395899_0712184 3300037312 Unclassified 628
857 Ga0395899_0837774 3300037312 Bacteria 565
858 Ga0395900_0015650 3300037418 Bacteria 7732
859 Ga0395900_0024529 3300037418 Bacteria 6175
860 Ga0395900_0031534 3300037418 Bacteria 5447
861 Ga0395900_0038904 3300037418 Bacteria 4903
862 Ga0395900_0049293 3300037418 Bacteria 4338
863 Ga0395900_0114202 3300037418 Bacteria 2771
864 Ga0395900_0128826 3300037418 Bacteria 2594
865 Ga0395900_0156576 3300037418 Bacteria 2327
866 Ga0395900_0263982 3300037418 Bacteria 1718
867 Ga0395900_0385097 3300037418 Bacteria 1369
868 Ga0395900_0552116 3300037418 Bacteria 1096
869 Ga0395900_0650765 3300037418 Bacteria 990
870 Ga0395900_0706256 3300037418 Bacteria 941
871 Ga0395900_1289228 3300037418 Unclassified 645
872 Ga0395900_1620914 3300037418 Bacteria 558
873 Ga0395898_0027870 3300037466 Bacteria 5664
874 Ga0395898_0102374 3300037466 Bacteria 2749
875 Ga0395898_0106171 3300037466 Bacteria 2693
876 Ga0395898_0124354 3300037466 Bacteria 2471
877 Ga0395898_0172998 3300037466 Bacteria 2064
878 Ga0395898_0433753 3300037466 Bacteria 1252
879 Ga0395898_0694601 3300037466 Bacteria 959
880 Ga0395898_0736222 3300037466 Bacteria 927
881 Ga0395898_0843954 3300037466 Bacteria 855
882 Ga0395898_1214171 3300037466 Unclassified 685
883 Ga0395905_0006451 3300037471 Bacteria 11809
884 Ga0395905_0014903 3300037471 Bacteria 7416
885 Ga0395905_0060340 3300037471 Bacteria 3546
886 Ga0395905_0073812 3300037471 Bacteria 3198
887 Ga0395905_0079552 3300037471 Bacteria 3073
888 Ga0395905_0116875 3300037471 Bacteria 2506
889 Ga0395905_0139276 3300037471 Bacteria 2283
890 Ga0395905_0145424 3300037471 Unclassified 2230
891 Ga0395905_0205441 3300037471 Bacteria 1846
892 Ga0395905_0318394 3300037471 Bacteria 1445
893 Ga0395905_0392555 3300037471 Bacteria 1282
894 Ga0395905_0403640 3300037471 Bacteria 1262
895 Ga0395905_0426579 3300037471 Bacteria 1222
896 Ga0395905_0479440 3300037471 Bacteria 1143
897 Ga0395905_0488293 3300037471 Bacteria 1131
898 Ga0395905_0579414 3300037471 Unclassified 1023
899 Ga0395905_0694232 3300037471 Bacteria 920
900 Ga0395905_1418617 3300037471 Bacteria 598
901 Ga0395905_1449031 3300037471 Bacteria 591
902 Ga0436364_0633930 3300037853 Bacteria 19511
903 Ga0395901_0000459 3300038443 Bacteria 47200
904 Ga0395901_0001546 3300038443 Bacteria 23839
905 Ga0395901_0013560 3300038443 Bacteria 8288
906 Ga0395901_0016339 3300038443 Bacteria 7558
907 Ga0395901_0050125 3300038443 Bacteria 4338
908 Ga0395901_0089406 3300038443 Bacteria 3223
909 Ga0395901_0135862 3300038443 Bacteria 2584
910 Ga0395901_0197279 3300038443 Bacteria 2110
911 Ga0395901_0252905 3300038443 Bacteria 1835
912 Ga0395901_0368721 3300038443 Bacteria 1479
913 Ga0395901_0453226 3300038443 Bacteria 1312
914 Ga0395901_0526819 3300038443 Unclassified 1200
915 Ga0395901_0707556 3300038443 Archaea 1004
916 Ga0395901_1298460 3300038443 Archaea 690
917 Ga0395901_1640956 3300038443 Bacteria 595
918 Ga0439465_0204153 3300041413 Bacteria 721
919 Ga0439449_0349612 3300042007 Bacteria 560
920 Ga0451577_0340295 3300042876 Bacteria 1361
921 Ga0466972_0053083 3300044658 Bacteria 1952
922 Ga0466965_0056678 3300044683 Bacteria 1952
923 Ga0466965_0327334 3300044683 Bacteria 836
924 Ga0466966_0044599 3300044684 Bacteria 2838
925 Ga0466966_0321333 3300044684 Bacteria 930
926 Ga0466963_0001361 3300044694 Bacteria 13074
927 Ga0466963_0007656 3300044694 Bacteria 6448
928 Ga0466963_0018379 3300044694 Bacteria 4370
929 Ga0466963_0041436 3300044694 Bacteria 3020
930 Ga0466963_0139449 3300044694 Bacteria 1679
931 Ga0466963_0312321 3300044694 Bacteria 1106
932 Ga0466963_0520454 3300044694 Bacteria 840
933 Ga0466964_0170853 3300044706 Bacteria 1024
934 Ga0466964_0223014 3300044706 Bacteria 916
935 Ga0453684_0744772 3300044712 Bacteria 1061
936 Ga0466971_0235905 3300044719 Bacteria 869
937 Ga0466957_0004650 3300044842 Bacteria 7669
938 Ga0466957_0022999 3300044842 Bacteria 3680
939 Ga0466957_0118320 3300044842 Bacteria 1687
940 Ga0466957_0182168 3300044842 Bacteria 1372
941 Ga0466957_0358238 3300044842 Bacteria 991
942 Ga0466957_0434770 3300044842 Bacteria 902
943 Ga0466957_1416239 3300044842 Unclassified 506
944 Ga0466960_0717710 3300044901 Bacteria 601
945 Ga0466959_0039218 3300045049 Bacteria 3500
946 Ga0466959_0251276 3300045049 Bacteria 1219
947 Ga0466959_0638367 3300045049 Bacteria 715
948 Ga0466958_0007407 3300045836 Bacteria 6036
949 Ga0466958_0644700 3300045836 Bacteria 689
950 Ga0466958_0976209 3300045836 Bacteria 553
951 Ga0466967_0008320 3300045976 Bacteria 7587
952 Ga0466967_0012995 3300045976 Bacteria 6406
953 Ga0466967_0017779 3300045976 Bacteria 5659
954 Ga0466967_0049155 3300045976 Bacteria 3687
955 Ga0466967_0050550 3300045976 Bacteria 3641
956 Ga0466967_0052205 3300045976 Bacteria 3587
957 Ga0466967_0056131 3300045976 Bacteria 3471
958 Ga0466967_0134714 3300045976 Bacteria 2296
959 Ga0466967_0175880 3300045976 Bacteria 2016
960 Ga0466967_0193896 3300045976 Bacteria 1921
961 Ga0466967_0359144 3300045976 Bacteria 1411
962 Ga0466967_0474207 3300045976 Bacteria 1225
963 Ga0466967_0730653 3300045976 Bacteria 981
964 Ga0466967_0780904 3300045976 Bacteria 948
965 Ga0466967_0915792 3300045976 Bacteria 872
966 Ga0466967_0935653 3300045976 Unclassified 862
967 Ga0466967_1324186 3300045976 Bacteria 717
968 Ga0466967_1665593 3300045976 Unclassified 635
969 Ga0495582_0518937 3300046473 Bacteria 689
970 Ga0495663_0012085 3300046525 Bacteria 2406
971 Ga0495598_0005598 3300046537 Bacteria 2794
972 Ga0495598_0071686 3300046537 Bacteria 1092
973 Ga0495621_0000033 3300046539 Bacteria 27008
974 Ga0495621_0000627 3300046539 Bacteria 8876
975 Ga0495633_0003092 3300046558 Bacteria 11303
976 Ga0495633_0015928 3300046558 Bacteria 3891
977 Ga0495656_0325295 3300046615 Bacteria 793
978 Ga0495659_0147998 3300046664 Bacteria 941
979 Ga0495661_0142211 3300046665 Bacteria 1304
980 Ga0495623_0051699 3300046679 Bacteria 2598
981 Ga0495669_0001314 3300046684 Bacteria 10285
982 Ga0495669_0016652 3300046684 Bacteria 3149
983 Ga0495669_0042701 3300046684 Bacteria 2016
984 Ga0495669_0200236 3300046684 Bacteria 954
985 Ga0495669_0270627 3300046684 Bacteria 817
986 Ga0495670_0002201 3300046691 Bacteria 9648
987 Ga0495677_0061182 3300047445 Bacteria 1396
988 Ga0496101_0043435 3300048904 Bacteria 3213
989 Ga0496101_0077417 3300048904 Bacteria 2451
990 Ga0496102_0095692 3300048905 Bacteria 2753
991 Ga0496102_0111474 3300048905 Bacteria 2551
992 Ga0496102_0379742 3300048905 Bacteria 1330
993 Ga0496103_0074007 3300048906 Bacteria 2135
994 Ga0496104_0909312 3300048907 Bacteria 785
995 Ga0496105_0081831 3300048908 Bacteria 2667
996 Ga0496107_0055335 3300048910 Bacteria 2866
997 Ga0496107_1012839 3300048910 Unclassified 602
998 Ga0496108_0044956 3300048911 Bacteria 3687
999 Ga0496108_0821908 3300048911 Bacteria 801
1000 Ga0496108_0937003 3300048911 Bacteria 742
1001 Ga0496108_1371885 3300048911 Unclassified 592
1002 Ga0496109_0056835 3300048912 Bacteria 3570
1003 Ga0496109_0127248 3300048912 Bacteria 2375
1004 Ga0496109_0775376 3300048912 Bacteria 897
1005 Ga0496109_1565039 3300048912 Bacteria 594
1006 Ga0496109_1637036 3300048912 Unclassified 578
1007 Ga0496110_0008910 3300048913 Bacteria 8088
1008 Ga0496110_0178246 3300048913 Bacteria 1929
1009 Ga0496110_1894744 3300048913 Bacteria 506
1010 Ga0496111_0001885 3300048914 Bacteria 12405
1011 Ga0496111_0147161 3300048914 Bacteria 1747
1012 Ga0496111_0151098 3300048914 Bacteria 1722
1013 Ga0496111_0459457 3300048914 Bacteria 939
1014 Ga0496111_1091479 3300048914 Bacteria 569
1015 Ga0496112_0152734 3300048915 Bacteria 2276
1016 Ga0496112_0277917 3300048915 Bacteria 1622
1017 Ga0496113_0013119 3300048916 Bacteria 5597
1018 Ga0496114_0058752 3300048917 Bacteria 3212
1019 Ga0496115_0001337 3300048918 Bacteria 17576
1020 Ga0501047_0228767 3300049581 Bacteria 1714
1021 Ga0501067_0002674 3300049583 Bacteria 9858
1022 Ga0501067_0585688 3300049583 Bacteria 625
1023 Ga0501068_0068941 3300049584 Bacteria 2156
1024 Ga0501069_0434204 3300049585 Bacteria 779
1025 Ga0501071_0740121 3300049587 Unclassified 757
1026 Ga0501079_0766763 3300049741 Bacteria 759
1027 Ga0501080_0015597 3300049742 Bacteria 7008
1028 Ga0501080_0321781 3300049742 Bacteria 1400
1029 nmdc:mga07m45_690082_c1 3300050496 Bacteria 587
1030 Ga0495595_0324822 3300053084 Bacteria 775
1031 Ga0501084_0779320 3300054114 Unclassified 806
1032 Ga0466962_0023013 3300061719 Bacteria 2995
1033 Ga0466962_0043031 3300061719 Bacteria 2162
1034 Ga0070680_100034188
1035 MBSR1b_contig_3052630
1036 JGI24741J21665_1005973
1037 JGI24740J21852_10000772
1038 JGI24740J21852_10020575
1039 JGI24740J21852_10035020
1040 JGI24739J22299_10000789
1041 JGI24739J22299_10055087
1042 JGI24737J22298_10016936
1043 JGI24737J22298_10031983
1044 JGI24737J22298_10060966
1045 JGI24735J21928_10001231
1046 JGI24735J21928_10003507
1047 JGI24735J21928_10038778
1048 JGI24735J21928_10042734
1049 JGI24738J21930_10007283
1050 JGI24738J21930_10023460
1051 rootH2_10085618
1052 Ga0058862_12069213
1053 Ga0065715_10122844
1054 Ga0070658_10000360
1055 Ga0070658_10011538
1056 Ga0070658_10030574
1057 Ga0070658_10249928
1058 Ga0070658_10253426
1059 Ga0070658_10276807
1060 Ga0070658_10306482
1061 Ga0070658_10345731
1062 Ga0070658_10508970
1063 Ga0070658_10690639
1064 Ga0070658_10929004
1065 Ga0070658_11664722
1066 Ga0070676_10065667
1067 Ga0070676_11095388
1068 Ga0070676_11553419
1069 Ga0070683_100007904
1070 Ga0070683_100044160
1071 Ga0070683_100068883
1072 Ga0070683_100074337
1073 Ga0070683_100105738
1074 Ga0070683_100308337
1075 Ga0070683_100617665
1076 Ga0070690_100007961
1077 Ga0070690_100125672
1078 Ga0070670_100009424
1079 Ga0070670_100017460
1080 Ga0070670_100353210
1081 Ga0070670_100465301
1082 Ga0070670_100953980
1083 Ga0070677_10002668
1084 Ga0070677_10110724
1085 Ga0070666_10002126
1086 Ga0070666_10052402
1087 Ga0070666_10444234
1088 Ga0070666_10739961
1089 Ga0070680_100003113
1090 Ga0070680_100007743
1091 Ga0070680_100010921
1092 Ga0070680_100023849
1093 Ga0070680_100029754
1094 Ga0070680_100047844
1095 Ga0070680_100075189
1096 Ga0070680_100112073
1097 Ga0070680_100205102
1098 Ga0070680_101137560
1099 Ga0070682_100002715
1100 Ga0070682_100017508
1101 Ga0070682_100083712
1102 Ga0070682_100124111
1103 Ga0070682_100496322
1104 Ga0068868_100002897
1105 Ga0068868_100093716
1106 Ga0068868_100223062
1107 Ga0068868_101699419
1108 Ga0070660_100000075
1109 Ga0070660_100008590
1110 Ga0070660_100009957
1111 Ga0070660_100077654
1112 Ga0070660_100113791
1113 Ga0070660_100150960
1114 Ga0070660_100256780
1115 Ga0070660_100276901
1116 Ga0070660_100329631
1117 Ga0070660_100901660
1118 Ga0070660_100917032
1119 Ga0070660_101128650
1120 Ga0070691_10001562
1121 Ga0070687_100314469
1122 Ga0070661_100000273
1123 Ga0070661_100007349
1124 Ga0070661_100007692
1125 Ga0070661_100023040
1126 Ga0070661_100038051
1127 Ga0070661_100042824
1128 Ga0070661_100176933
1129 Ga0070661_100339535
1130 Ga0070661_100648253
1131 Ga0070661_100825848
1132 Ga0070661_101138098
1133 Ga0070661_101263471
1134 Ga0070661_101700551
1135 Ga0070692_10041262
1136 Ga0070692_10043648
1137 Ga0070692_10068482
1138 Ga0070692_10171923
1139 Ga0070692_10309575
1140 Ga0070668_100088496
1141 Ga0070668_100114961
1142 Ga0070669_100034764
1143 Ga0070669_100071343
1144 Ga0070669_100096805
1145 Ga0070669_100149358
1146 Ga0070675_100002201
1147 Ga0070675_100003070
1148 Ga0070675_100068603
1149 Ga0070675_101369748
1150 Ga0070671_100004385
1151 Ga0070671_100010381
1152 Ga0070671_100011228
1153 Ga0070671_100053409
1154 Ga0070671_100423798
1155 Ga0070674_100051889
1156 Ga0070674_100548774
1157 Ga0070674_100785922
1158 Ga0070674_102152170
1159 Ga0070673_100018940
1160 Ga0070673_100041580
1161 Ga0070673_100062104
1162 Ga0070688_100973522
1163 Ga0070659_100000084
1164 Ga0070659_100004523
1165 Ga0070659_100034234
1166 Ga0070659_100039124
1167 Ga0070659_100078215
1168 Ga0070659_100080633
1169 Ga0070659_100109549
1170 Ga0070659_100167024
1171 Ga0070659_100212271
1172 Ga0070659_100246960
1173 Ga0070659_100266822
1174 Ga0070659_100431124
1175 Ga0070659_100472519
1176 Ga0070659_100586961
1177 Ga0070667_100001607
1178 Ga0070667_100007596
1179 Ga0070667_100073833
1180 Ga0070667_100215317
1181 Ga0070667_100224914
1182 Ga0070667_100439251
1183 Ga0070667_101395215
1184 Ga0070714_100090368
1185 Ga0070714_100120474
1186 Ga0070714_101388188
1187 Ga0070713_100465628
1188 Ga0070711_100175932
1189 Ga0070663_100008206
1190 Ga0070663_100014657
1191 Ga0070663_100021492
1192 Ga0070663_100056409
1193 Ga0070663_100075901
1194 Ga0070663_100136965
1195 Ga0070663_100400782
1196 Ga0070663_100405269
1197 Ga0070663_101562059
1198 Ga0070678_100052145
1199 Ga0070678_100214532
1200 Ga0070662_100000058
1201 Ga0070662_100002250
1202 Ga0070662_100008506
1203 Ga0070662_100032283
1204 Ga0070662_100036428
1205 Ga0070662_100057502
1206 Ga0070662_100132123
1207 Ga0070662_100210895
1208 Ga0070662_100255115
1209 Ga0070662_100484535
1210 Ga0070681_10065617
1211 Ga0070681_10091641
1212 Ga0070681_10156729
1213 Ga0070681_10158250
1214 Ga0068867_100055985
1215 Ga0068867_100130086
1216 Ga0068867_101264861
1217 Ga0070679_100030970
1218 Ga0070679_100071424
1219 Ga0070679_100099671
1220 Ga0070679_100113223
1221 Ga0070679_100209484
1222 Ga0070679_100256307
1223 Ga0070684_100002051
1224 Ga0070684_100025627
1225 Ga0070684_100027846
1226 Ga0070684_100082964
1227 Ga0070684_100102478
1228 Ga0070684_100299794
1229 Ga0070684_100575460
1230 Ga0068853_100000223
1231 Ga0068853_100015827
1232 Ga0068853_100020632
1233 Ga0068853_100029925
1234 Ga0068853_100313236
1235 Ga0068853_100570159
1236 Ga0068853_100631462
1237 Ga0068853_100916836
1238 Ga0070672_100000951
1239 Ga0070672_100034782
1240 Ga0070672_100050000
1241 Ga0070672_100475464
1242 Ga0070672_100584649
1243 Ga0070696_100406720
1244 Ga0070693_100002238
1245 Ga0070693_100078520
1246 Ga0070693_100083745
1247 Ga0070693_100496475
1248 Ga0070665_100004855
1249 Ga0070665_100018109
1250 Ga0070665_100036337
1251 Ga0070665_100712346
1252 Ga0068855_100001315
1253 Ga0068855_100008388
1254 Ga0068855_100053659
1255 Ga0068855_100087004
1256 Ga0068855_100092758
1257 Ga0068855_100132257
1258 Ga0068855_100240503
1259 Ga0068855_100264416
1260 Ga0068855_100544733
1261 Ga0068855_100549154
1262 Ga0068855_100582841
1263 Ga0068855_100658765
1264 Ga0070664_100000032
1265 Ga0070664_100001054
1266 Ga0070664_100001145
1267 Ga0070664_100018769
1268 Ga0070664_100043491
1269 Ga0070664_100249423
1270 Ga0070664_100353327
1271 Ga0070664_100379852
1272 Ga0070664_100590575
1273 Ga0070664_100752386
1274 Ga0068857_100025979
1275 Ga0068857_100041788
1276 Ga0068857_100054910
1277 Ga0068857_100097548
1278 Ga0068857_100137919
1279 Ga0068857_100219595
1280 Ga0068854_100002274
1281 Ga0068854_100010860
1282 Ga0068854_100018007
1283 Ga0068854_100022118
1284 Ga0068854_100022260
1285 Ga0068854_100051246
1286 Ga0068854_100225705
1287 Ga0068854_100329714
1288 Ga0068854_100395181
1289 Ga0068854_100459051
1290 Ga0068856_100000161
1291 Ga0068856_100030079
1292 Ga0068856_100067386
1293 Ga0068856_100223155
1294 Ga0068856_100233583
1295 Ga0068856_100481679
1296 Ga0068856_100484810
1297 Ga0068856_101156444
1298 Ga0068856_101740764
1299 Ga0068852_100002629
1300 Ga0068852_100002985
1301 Ga0068852_100008322
1302 Ga0068852_100011217
1303 Ga0068852_100137448
1304 Ga0068852_100192667
1305 Ga0068852_100331711
1306 Ga0068852_100497046
1307 Ga0068852_100523823
1308 Ga0068852_100591995
1309 Ga0068852_100729991
1310 Ga0068859_100072250
1311 Ga0068859_100262365
1312 Ga0068864_100014951
1313 Ga0068864_100080670
1314 Ga0068864_100118668
1315 Ga0068864_100379163
1316 Ga0068864_100488436
1317 Ga0068864_100496176
1318 Ga0068866_10035196
1319 Ga0068851_10012636
1320 Ga0068851_10059339
1321 Ga0068851_10061356
1322 Ga0068851_10164411
1323 Ga0068851_10197268
1324 Ga0068851_10545777
1325 Ga0068863_100021109
1326 Ga0068863_100047141
1327 Ga0068863_100052264
1328 Ga0068863_100301111
1329 Ga0068858_100001074
1330 Ga0068858_100049615
1331 Ga0068858_100137204
1332 Ga0068860_100233157
1333 Ga0068860_100787260
1334 Ga0068862_100061057
1335 Ga0081539_10048957
1336 Ga0068865_100230028
1337 Ga0097620_100072252
1338 Ga0097620_100262370
1339 Ga0105240_10017996
1340 Ga0105240_10036523
1341 Ga0105240_10144103
1342 Ga0105245_10199454
1343 Ga0105245_10253403
1344 Ga0105243_11430964
1345 Ga0105241_10066740
1346 Ga0105241_10094108
1347 Ga0105241_10109797
1348 Ga0105242_11195269
1349 Ga0105248_10000223
1350 Ga0105248_10004318
1351 Ga0105248_10016377
1352 Ga0105248_10036994
1353 Ga0105248_10052433
1354 Ga0105248_11690277
1355 Ga0105248_11771649
1356 Ga0105237_10027414
1357 Ga0105237_10353454
1358 Ga0105238_10078979
1359 Ga0105238_10159429
1360 Ga0105238_10558413
1361 Ga0105238_10671747
1362 Ga0105238_11502915
1363 Ga0105249_10242916
1364 Ga0105239_10163966
1365 Ga0105239_10385060
1366 Ga0105239_11051293
1367 Ga0105246_10965703
1368 Ga0157373_10010802
1369 Ga0157373_10020196
1370 Ga0157373_10042206
1371 Ga0157373_10056429
1372 Ga0157373_10081819
1373 Ga0157373_10140252
1374 Ga0157373_10169059
1375 Ga0157373_10460897
1376 Ga0157373_10651205
1377 Ga0157373_10762276
1378 Ga0157371_10001103
1379 Ga0157371_10026893
1380 Ga0157371_10069895
1381 Ga0157371_10073988
1382 Ga0157371_10088750
1383 Ga0157371_10107371
1384 Ga0157371_10133842
1385 Ga0157371_10208824
1386 Ga0157371_10250597
1387 Ga0157371_10382991
1388 Ga0157371_10492606
1389 Ga0157370_10001094
1390 Ga0157370_10010418
1391 Ga0157370_10046919
1392 Ga0157370_10116759
1393 Ga0157370_10202139
1394 Ga0157370_10411494
1395 Ga0157370_10443589
1396 Ga0157370_10987163
1397 Ga0157370_11145444
1398 Ga0157369_10042136
1399 Ga0157369_10068780
1400 Ga0157369_10092706
1401 Ga0157369_10244592
1402 Ga0157369_10285145
1403 Ga0157369_10396871
1404 Ga0157369_10425072
1405 Ga0157369_10458052
1406 Ga0157369_10606893
1407 Ga0157369_10639217
1408 Ga0157369_10797730
1409 Ga0157369_11246461
1410 Ga0157369_12136441
1411 Ga0157374_10098709
1412 Ga0157374_10164799
1413 Ga0157378_10178787
1414 Ga0157378_12014496
1415 Ga0163162_10616613
1416 Ga0163162_10870203
1417 Ga0163162_11970727
1418 Ga0157372_10016489
1419 Ga0157372_10051938
1420 Ga0157372_10070058
1421 Ga0157372_10117481
1422 Ga0157372_10223619
1423 Ga0157372_10365497
1424 Ga0157372_10763207
1425 Ga0157372_11593991
1426 Ga0157375_10116832
1427 Ga0157375_10123262
1428 Ga0157375_11071480
1429 Ga0163163_10000567
1430 Ga0163163_10722135
1431 Ga0157380_10316719
1432 Ga0157380_12098750
1433 Ga0157379_10164669
1434 Ga0163161_10067003
1435 Ga0163161_10453100
1436 Ga0197907_10443190
1437 Ga0206354_10469396
1438 Ga0206354_10890655
1439 Ga0206353_11539987
1440 Ga0206353_11568958
1441 Ga0213875_10005764
1442 Ga0207697_10272096
1443 Ga0207656_10146010
1444 Ga0207656_10162271
1445 Ga0207656_10589893
1446 Ga0207682_10007482
1447 Ga0207682_10117815
1448 Ga0207682_10171817
1449 Ga0207682_10537291
1450 Ga0207642_10181193
1451 Ga0207688_10138171
1452 Ga0207688_10194616
1453 Ga0207688_10305491
1454 Ga0207688_10412213
1455 Ga0207688_10527574
1456 Ga0207680_10000287
1457 Ga0207680_10000518
1458 Ga0207680_10071225
1459 Ga0207680_10502905
1460 Ga0207647_10001865
1461 Ga0207647_10011056
1462 Ga0207647_10021020
1463 Ga0207647_10026799
1464 Ga0207647_10064719
1465 Ga0207647_10186083
1466 Ga0207647_10195364
1467 Ga0207699_10048117
1468 Ga0207645_10010343
1469 Ga0207645_10097664
1470 Ga0207705_10000918
1471 Ga0207705_10002069
1472 Ga0207705_10002487
1473 Ga0207705_10004009
1474 Ga0207705_10015789
1475 Ga0207705_10060556
1476 Ga0207705_10067722
1477 Ga0207705_10079895
1478 Ga0207705_10080309
1479 Ga0207705_10148760
1480 Ga0207705_10151776
1481 Ga0207705_10194989
1482 Ga0207705_10243479
1483 Ga0207705_10516516
1484 Ga0207705_10986564
1485 Ga0207705_11005236
1486 Ga0207654_10038052
1487 Ga0207654_10043247
1488 Ga0207707_10006776
1489 Ga0207707_10026039
1490 Ga0207707_10034897
1491 Ga0207707_10050032
1492 Ga0207707_10163678
1493 Ga0207707_10287234
1494 Ga0207707_10365803
1495 Ga0207695_10175044
1496 Ga0207695_10229635
1497 Ga0207671_10311292
1498 Ga0207693_10229282
1499 Ga0207660_10006350
1500 Ga0207660_10006640
1501 Ga0207660_10009865
1502 Ga0207660_10085185
1503 Ga0207660_10114183
1504 Ga0207660_10270407
1505 Ga0207660_10451058
1506 Ga0207660_10818436
1507 Ga0207662_10657047
1508 Ga0207657_10000164
1509 Ga0207657_10003166
1510 Ga0207657_10004331
1511 Ga0207657_10008912
1512 Ga0207657_10010138
1513 Ga0207657_10020990
1514 Ga0207657_10030267
1515 Ga0207657_10034718
1516 Ga0207657_10061324
1517 Ga0207657_10200735
1518 Ga0207657_10238392
1519 Ga0207657_10290503
1520 Ga0207657_10291682
1521 Ga0207657_10531256
1522 Ga0207657_10819506
1523 Ga0207657_11167676
1524 Ga0207649_10000580
1525 Ga0207649_10002698
1526 Ga0207649_10009014
1527 Ga0207649_10010162
1528 Ga0207649_10014720
1529 Ga0207649_10080637
1530 Ga0207649_10174955
1531 Ga0207649_10289388
1532 Ga0207649_10316759
1533 Ga0207649_10355675
1534 Ga0207649_10374754
1535 Ga0207649_10451525
1536 Ga0207649_10745067
1537 Ga0207649_10812620
1538 Ga0207649_10929166
1539 Ga0207652_10002403
1540 Ga0207652_10017090
1541 Ga0207652_10072638
1542 Ga0207652_10200967
1543 Ga0207652_10417483
1544 Ga0207652_10577084
1545 Ga0207652_10755513
1546 Ga0207681_10029760
1547 Ga0207681_10048755
1548 Ga0207681_10464051
1549 Ga0207681_10695854
1550 Ga0207681_10993234
1551 Ga0207694_10002652
1552 Ga0207694_10144960
1553 Ga0207694_11114031
1554 Ga0207650_10006901
1555 Ga0207650_10022254
1556 Ga0207650_10038195
1557 Ga0207650_10114050
1558 Ga0207650_10224113
1559 Ga0207650_10234319
1560 Ga0207650_10790173
1561 Ga0207650_11100495
1562 Ga0207659_10008159
1563 Ga0207659_10043782
1564 Ga0207659_10220496
1565 Ga0207659_10988589
1566 Ga0207687_10315661
1567 Ga0207687_10371650
1568 Ga0207700_10639395
1569 Ga0207700_10745341
1570 Ga0207664_10035496
1571 Ga0207664_10177454
1572 Ga0207664_10242668
1573 Ga0207664_10309989
1574 Ga0207644_10003151
1575 Ga0207644_10004195
1576 Ga0207644_10006157
1577 Ga0207644_10028272
1578 Ga0207644_10280562
1579 Ga0207644_10295757
1580 Ga0207644_10876075
1581 Ga0207690_10000800
1582 Ga0207690_10002026
1583 Ga0207690_10003062
1584 Ga0207690_10004345
1585 Ga0207690_10006912
1586 Ga0207690_10022117
1587 Ga0207690_10031117
1588 Ga0207690_10038541
1589 Ga0207690_10177235
1590 Ga0207690_10228802
1591 Ga0207690_10418614
1592 Ga0207690_11198187
1593 Ga0207690_11275163
1594 Ga0207690_11407150
1595 Ga0207706_10000196
1596 Ga0207706_10003899
1597 Ga0207706_10005418
1598 Ga0207706_10008864
1599 Ga0207706_10014479
1600 Ga0207706_10031514
1601 Ga0207706_10082986
1602 Ga0207706_10125690
1603 Ga0207706_10147296
1604 Ga0207706_10237994
1605 Ga0207706_10314016
1606 Ga0207709_10621408
1607 Ga0207670_10748937
1608 Ga0207670_11656504
1609 Ga0207669_10053662
1610 Ga0207669_10255221
1611 Ga0207669_10342144
1612 Ga0207669_10503471
1613 Ga0207669_11606146
1614 Ga0207704_10196901
1615 Ga0207665_10009018
1616 Ga0207691_10002269
1617 Ga0207691_10018513
1618 Ga0207691_10035264
1619 Ga0207691_10202092
1620 Ga0207691_10235235
1621 Ga0207691_10490656
1622 Ga0207711_10000698
1623 Ga0207711_10000964
1624 Ga0207711_10007246
1625 Ga0207711_10007578
1626 Ga0207711_10097827
1627 Ga0207711_10117700
1628 Ga0207689_10543128
1629 Ga0207661_10003155
1630 Ga0207661_10020126
1631 Ga0207661_10022858
1632 Ga0207661_10032800
1633 Ga0207661_10152760
1634 Ga0207661_10388127
1635 Ga0207661_10893338
1636 Ga0207679_10001145
1637 Ga0207679_10004258
1638 Ga0207679_10007849
1639 Ga0207679_10058384
1640 Ga0207679_10061848
1641 Ga0207679_10111604
1642 Ga0207679_10155623
1643 Ga0207679_10215308
1644 Ga0207679_10493550
1645 Ga0207679_10575960
1646 Ga0207679_10725032
1647 Ga0207679_10918971
1648 Ga0207667_10001975
1649 Ga0207667_10012015
1650 Ga0207667_10043334
1651 Ga0207667_10074000
1652 Ga0207667_10085320
1653 Ga0207667_10138676
1654 Ga0207667_10191969
1655 Ga0207667_10209821
1656 Ga0207667_10295669
1657 Ga0207667_10495950
1658 Ga0207667_10523963
1659 Ga0207667_10723872
1660 Ga0207667_10786227
1661 Ga0207651_10088992
1662 Ga0207651_10198343
1663 Ga0207651_10324727
1664 Ga0207651_10375329
1665 Ga0207651_10893570
1666 Ga0207651_11296172
1667 Ga0207712_10300542
1668 Ga0207668_10141726
1669 Ga0207668_10165342
1670 Ga0207668_10234097
1671 Ga0207668_10566387
1672 Ga0207668_10722658
1673 Ga0207640_10005356
1674 Ga0207640_10005994
1675 Ga0207640_10031342
1676 Ga0207640_10067965
1677 Ga0207640_10075767
1678 Ga0207640_10588568
1679 Ga0207640_10666362
1680 Ga0207640_10746517
1681 Ga0207640_11498196
1682 Ga0207658_10004902
1683 Ga0207658_10010805
1684 Ga0207658_10048431
1685 Ga0207658_10062041
1686 Ga0207658_10122275
1687 Ga0207658_10229390
1688 Ga0207658_11744808
1689 Ga0207677_10007770
1690 Ga0207677_10033933
1691 Ga0207677_10046166
1692 Ga0207703_10010398
1693 Ga0207703_10038175
1694 Ga0207703_10488906
1695 Ga0207639_10000124
1696 Ga0207639_10001229
1697 Ga0207639_10001939
1698 Ga0207639_10005669
1699 Ga0207639_10015790
1700 Ga0207639_10098982
1701 Ga0207639_10100404
1702 Ga0207639_10106086
1703 Ga0207639_10994886
1704 Ga0207678_10000864
1705 Ga0207678_10009242
1706 Ga0207678_10015113
1707 Ga0207678_10030837
1708 Ga0207678_10048878
1709 Ga0207678_10068109
1710 Ga0207678_10069929
1711 Ga0207678_10292612
1712 Ga0207678_10297066
1713 Ga0207678_10998029
1714 Ga0207678_11331730
1715 Ga0207702_10000435
1716 Ga0207702_10045189
1717 Ga0207702_10067353
1718 Ga0207702_10075513
1719 Ga0207702_10201904
1720 Ga0207702_10362185
1721 Ga0207702_10406850
1722 Ga0207702_10727823
1723 Ga0207702_11109158
1724 Ga0207702_11505090
1725 Ga0207702_11645840
1726 Ga0207641_10016966
1727 Ga0207641_10318420
1728 Ga0207641_10545451
1729 Ga0207648_10020678
1730 Ga0207648_11096574
1731 Ga0207676_10054304
1732 Ga0207676_10397483
1733 Ga0207676_10399602
1734 Ga0207674_10001518
1735 Ga0207674_10001923
1736 Ga0207674_10003802
1737 Ga0207674_10007288
1738 Ga0207674_10102865
1739 Ga0207674_10196050
1740 Ga0207674_11034160
1741 Ga0207675_100358470
1742 Ga0207683_10056679
1743 Ga0207683_10352433
1744 Ga0207683_11076203
1745 Ga0207698_10001464
1746 Ga0207698_10003125
1747 Ga0207698_10029445
1748 Ga0207698_10039763
1749 Ga0207698_10066598
1750 Ga0207698_10376474
1751 Ga0207698_10406565
1752 Ga0207698_10429704
1753 Ga0207698_10570784
1754 Ga0207698_10588806
1755 Ga0207698_11148265
1756 Ga0207698_11512262
1757 Ga0209974_10044680
1758 Ga0268266_10008238
1759 Ga0268266_10126567
1760 Ga0268266_10181693
1761 Ga0268266_11292954
1762 Ga0268265_10038850
1763 Ga0268265_10043686
1764 Ga0268265_10393532
1765 Ga0268265_11120492
1766 Ga0268264_10061030
1767 Ga0268264_10235341
1768 Ga0268264_11494636
1769 Ga0316178_1024636
1770 Ga0316182_1015273
1771 Ga0316182_1436356
1772 Ga0307408_100011358
1773 Ga0307408_100028010
1774 Ga0307408_100136498
1775 Ga0307408_100150926
1776 Ga0307408_100255218
1777 Ga0307405_10160299
1778 Ga0307405_10297668
1779 Ga0307405_10349248
1780 Ga0307405_10491829
1781 Ga0307405_10556346
1782 Ga0307413_10007305
1783 Ga0307413_10014262
1784 Ga0307413_10017979
1785 Ga0307413_10026344
1786 Ga0307413_10026426
1787 Ga0307413_10108631
1788 Ga0307413_10194211
1789 Ga0307413_10194609
1790 Ga0307413_10782247
1791 Ga0307410_10000725
1792 Ga0307410_10000754
1793 Ga0307410_10018851
1794 Ga0307410_10193357
1795 Ga0307410_10377060
1796 Ga0307410_10412256
1797 Ga0307410_10518119
1798 Ga0307410_10554838
1799 Ga0307410_10948922
1800 Ga0307406_10042056
1801 Ga0307406_10069405
1802 Ga0307406_10072498
1803 Ga0307406_10098463
1804 Ga0307406_10184450
1805 Ga0307406_10481466
1806 Ga0307406_10572852
1807 Ga0307406_10589215
1808 Ga0307407_10006626
1809 Ga0307407_10025285
1810 Ga0307407_10285185
1811 Ga0307407_10403355
1812 Ga0307407_10410043
1813 Ga0307407_10591680
1814 Ga0307412_10040452
1815 Ga0307412_10057621
1816 Ga0307412_10225716
1817 Ga0307412_10319303
1818 Ga0307412_10395639
1819 Ga0307412_11234460
1820 Ga0307409_100012140
1821 Ga0307409_100029936
1822 Ga0307409_100048167
1823 Ga0307409_100048980
1824 Ga0307409_100102425
1825 Ga0307409_100209855
1826 Ga0307409_100713703
1827 Ga0307409_100844408
1828 Ga0307409_100915295
1829 Ga0307409_100922054
1830 Ga0307409_100983385
1831 Ga0307416_100146919
1832 Ga0307416_100235245
1833 Ga0307416_100327710
1834 Ga0307416_100804439
1835 Ga0307416_101452449
1836 Ga0307416_102043656
1837 Ga0307414_10003556
1838 Ga0307414_10006688
1839 Ga0307414_10013271
1840 Ga0307414_10089168
1841 Ga0307414_10113644
1842 Ga0307414_10243795
1843 Ga0307414_10300026
1844 Ga0307411_10005504
1845 Ga0307411_10008007
1846 Ga0307411_10028965
1847 Ga0307411_10029320
1848 Ga0307411_10066692
1849 Ga0307411_10076934
1850 Ga0307411_10083779
1851 Ga0307411_10139671
1852 Ga0307411_10200211
1853 Ga0307411_10585005
1854 Ga0307411_10892551
1855 Ga0307411_11513660
1856 Ga0307415_100030563
1857 Ga0307415_100039832
1858 Ga0307415_100047218
1859 Ga0307415_100047423
1860 Ga0307415_100250717
1861 Ga0307415_100335116
1862 Ga0307415_100495893
1863 Ga0307415_100529643
1864 Ga0307415_100584809
1865 Ga0373958_0006318
1866 Ga0373938_0050246
1867 Ga0373929_0116519
1868 Ga0373923_0028635
1869 Ga0373932_0011316
1870 Ga0373960_0067428
1871 Ga0373943_0167649
1872 Ga0373955_0147201
1873 Ga0373942_0231454
1874 Ga0373942_0324671
1875 Ga0373962_0191497
1876 Ga0373931_0075236
1877 Ga0373933_0101602
1878 Ga0373937_0047794
1879 Ga0373937_0637782
1880 Ga0373937_0816829
1881 Ga0395899_0004300
1882 Ga0395899_0031601
1883 Ga0395899_0055136
1884 Ga0395899_0100447
1885 Ga0395899_0217358
1886 Ga0395899_0305051
1887 Ga0395899_0438909
1888 Ga0395899_0489775
1889 Ga0395899_0712184
1890 Ga0395899_0837774
1891 Ga0395900_0015650
1892 Ga0395900_0024529
1893 Ga0395900_0031534
1894 Ga0395900_0038904
1895 Ga0395900_0049293
1896 Ga0395900_0114202
1897 Ga0395900_0128826
1898 Ga0395900_0156576
1899 Ga0395900_0263982
1900 Ga0395900_0385097
1901 Ga0395900_0552116
1902 Ga0395900_0650765
1903 Ga0395900_0706256
1904 Ga0395900_1289228
1905 Ga0395900_1620914
1906 Ga0395898_0027870
1907 Ga0395898_0102374
1908 Ga0395898_0106171
1909 Ga0395898_0124354
1910 Ga0395898_0172998
1911 Ga0395898_0433753
1912 Ga0395898_0694601
1913 Ga0395898_0736222
1914 Ga0395898_0843954
1915 Ga0395898_1214171
1916 Ga0395905_0006451
1917 Ga0395905_0014903
1918 Ga0395905_0060340
1919 Ga0395905_0073812
1920 Ga0395905_0079552
1921 Ga0395905_0116875
1922 Ga0395905_0139276
1923 Ga0395905_0145424
1924 Ga0395905_0205441
1925 Ga0395905_0318394
1926 Ga0395905_0392555
1927 Ga0395905_0403640
1928 Ga0395905_0426579
1929 Ga0395905_0479440
1930 Ga0395905_0488293
1931 Ga0395905_0579414
1932 Ga0395905_0694232
1933 Ga0395905_1418617
1934 Ga0395905_1449031
1935 Ga0436364_0633930
1936 Ga0395901_0000459
1937 Ga0395901_0001546
1938 Ga0395901_0013560
1939 Ga0395901_0016339
1940 Ga0395901_0050125
1941 Ga0395901_0089406
1942 Ga0395901_0135862
1943 Ga0395901_0197279
1944 Ga0395901_0252905
1945 Ga0395901_0368721
1946 Ga0395901_0453226
1947 Ga0395901_0526819
1948 Ga0395901_0707556
1949 Ga0395901_1298460
1950 Ga0395901_1640956
1951 Ga0439465_0204153
1952 Ga0439449_0349612
1953 Ga0451577_0340295
1954 Ga0466972_0053083
1955 Ga0466965_0056678
1956 Ga0466965_0327334
1957 Ga0466966_0044599
1958 Ga0466966_0321333
1959 Ga0466963_0001361
1960 Ga0466963_0007656
1961 Ga0466963_0018379
1962 Ga0466963_0041436
1963 Ga0466963_0139449
1964 Ga0466963_0312321
1965 Ga0466963_0520454
1966 Ga0466964_0170853
1967 Ga0466964_0223014
1968 Ga0453684_0744772
1969 Ga0466971_0235905
1970 Ga0466957_0004650
1971 Ga0466957_0022999
1972 Ga0466957_0118320
1973 Ga0466957_0182168
1974 Ga0466957_0358238
1975 Ga0466957_0434770
1976 Ga0466957_1416239
1977 Ga0466960_0717710
1978 Ga0466959_0039218
1979 Ga0466959_0251276
1980 Ga0466959_0638367
1981 Ga0466958_0007407
1982 Ga0466958_0644700
1983 Ga0466958_0976209
1984 Ga0466967_0008320
1985 Ga0466967_0012995
1986 Ga0466967_0017779
1987 Ga0466967_0049155
1988 Ga0466967_0050550
1989 Ga0466967_0052205
1990 Ga0466967_0056131
1991 Ga0466967_0134714
1992 Ga0466967_0175880
1993 Ga0466967_0193896
1994 Ga0466967_0359144
1995 Ga0466967_0474207
1996 Ga0466967_0730653
1997 Ga0466967_0780904
1998 Ga0466967_0915792
1999 Ga0466967_0935653
2000 Ga0466967_1324186
2001 Ga0466967_1665593
2002 Ga0495582_0518937
2003 Ga0495663_0012085
2004 Ga0495598_0005598
2005 Ga0495598_0071686
2006 Ga0495621_0000033
2007 Ga0495621_0000627
2008 Ga0495633_0003092
2009 Ga0495633_0015928
2010 Ga0495656_0325295
2011 Ga0495659_0147998
2012 Ga0495661_0142211
2013 Ga0495623_0051699
2014 Ga0495669_0001314
2015 Ga0495669_0016652
2016 Ga0495669_0042701
2017 Ga0495669_0200236
2018 Ga0495669_0270627
2019 Ga0495670_0002201
2020 Ga0495677_0061182
2021 Ga0496101_0043435
2022 Ga0496101_0077417
2023 Ga0496102_0095692
2024 Ga0496102_0111474
2025 Ga0496102_0379742
2026 Ga0496103_0074007
2027 Ga0496104_0909312
2028 Ga0496105_0081831
2029 Ga0496107_0055335
2030 Ga0496107_1012839
2031 Ga0496108_0044956
2032 Ga0496108_0821908
2033 Ga0496108_0937003
2034 Ga0496108_1371885
2035 Ga0496109_0056835
2036 Ga0496109_0127248
2037 Ga0496109_0775376
2038 Ga0496109_1565039
2039 Ga0496109_1637036
2040 Ga0496110_0008910
2041 Ga0496110_0178246
2042 Ga0496110_1894744
2043 Ga0496111_0001885
2044 Ga0496111_0147161
2045 Ga0496111_0151098
2046 Ga0496111_0459457
2047 Ga0496111_1091479
2048 Ga0496112_0152734
2049 Ga0496112_0277917
2050 Ga0496113_0013119
2051 Ga0496114_0058752
2052 Ga0496115_0001337
2053 Ga0501047_0228767
2054 Ga0501067_0002674
2055 Ga0501067_0585688
2056 Ga0501068_0068941
2057 Ga0501069_0434204
2058 Ga0501071_0740121
2059 Ga0501079_0766763
2060 Ga0501080_0015597
2061 Ga0501080_0321781
2062 nmdc:mga07m45_690082_c1
2063 Ga0495595_0324822
2064 Ga0501084_0779320
2065 Ga0466962_0023013
2066 Ga0466962_0043031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05071

NDUFA12

NADH ubiquinone oxidoreductase subunit NDUFA12

43

143

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jwb-assembly1.cif.gz_A structure of ndh2 from plasmodium falciparum in complex with nadh 0.8309 25 52
7aqr-assembly1.cif.gz_q cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) 0.7938 26 82
6rfq-assembly1.cif.gz_k cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.7676 25 76
8bee-assembly1.cif.gz_q cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci peripheral core) 0.7562 20 82
4tse-assembly3.cif.gz_B crystal structure of the mib repeat domain of mind bomb 1 0.7526 26 51
ID Description Score Start End Superfamily
af_I1JVU1_126_189_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8798 26 52 2.40.50.140
af_Q2G2R7_1_107_2.40.310.10 Mainly Beta;Beta Barrel;Staphostatins;beta-Barrel protease inhibitors 0.8652 25 55 2.40.310.10
5zszA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8383 24 40 3.10.180.10
af_Q8I302_30_421_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.8325 25 52 3.50.50.100
af_Q9UJX0_183_552_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8002 26 52 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C1B5E9-F1-model_v4 NADH:ubiquinone oxidoreductase subunit NDUFA12 (EC 1.6.99.3) 0.9707 20 75 GO:0006979
GO:0016020
GO:0016491
GO:0032981
AF-A0A2D6TKJ4-F1-model_v4 NADH-ubiquinone oxidoreductase 0.7643 20 106 GO:0006979
GO:0016020
GO:0032981
AF-B3SFA0-F1-model_v4 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 0.702 20 108 GO:0005743
GO:0006979
GO:0032981
GO:0045271
AF-A0A168QKT6-F1-model_v4 Uncharacterized protein 0.7009 26 61
AF-A0A3C1B5E9-F1-model_v4 NADH:ubiquinone oxidoreductase subunit NDUFA12 (EC 1.6.99.3) 0.6814 20 75 GO:0006979
GO:0016020
GO:0016491
GO:0032981

Map