F488628

General Info

Members Datasets Scaffolds Average Seq Length
1032 432 974 290

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100159013|Ga0070714_1001590132
Length 346
Sequence MGRTRADWARADSPMAQPRSRFVGKDKQRRASHGWFRCFCAWLLATTGVLLSVMEFYRPATWADALAIKAERPGARAIAGGTDVMVEINFDRARPEALLDLTGVPDLAEWSADGPVIRLGAGVPYTRVIDELGGRLPGLAMASRTVGSPQIRNRGTVGGNLGSASPAGDAHPPLLADDTVVEAASVRGTRDIPIREFYTGVKRSALAPDELIAAVRVPAADGPQQFSKVGVRNAMVIAVSSFAIALHPERGQVGTGFGSAAPXXXXAAAAEEFLAAELADRGLWESRGPLAESTVRRFGELVAEAAAPIDDVRGTAAYRRHSLAVMARRTLAWAWRSYREERQRCA

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
9 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
10 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
11 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
12 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
13 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
14 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
15 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
16 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
17 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
18 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
19 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
20 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
21 2867475112 Streptomyces sp. TM32 Isolate Unclassified
22 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
23 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
24 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
25 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
26 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
27 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
28 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
29 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
30 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
31 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
32 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
33 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
34 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
35 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
36 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
37 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
38 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
39 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
40 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
41 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
42 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
43 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
44 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
186 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
259 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
260 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
261 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
393 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
394 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
399 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
400 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
401 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
402 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
403 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
407 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
410 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
413 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
414 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
415 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
420 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
421 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
422 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
423 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
424 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
425 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
426 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
427 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
428 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
429 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
430 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
431 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
432 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.99
Metatranscriptomes 0.39
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 2.52
Nodule 0.19
Rhizoplane 4.36
Rhizosphere 87.02
Stem 0
Stem Tuber 0.1
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10020814 3300003203 Bacteria 2644
2 rootH2_10056866 3300003320 Bacteria 2873
3 JGI25160J50197_1030646 3300003354 Bacteria 1398
4 Ga0070658_10018471 3300005327 Bacteria 5583
5 Ga0070658_10202332 3300005327 Bacteria 1676
6 Ga0070683_100000230 3300005329 Bacteria 38094
7 Ga0070683_100059451 3300005329 Bacteria 3551
8 Ga0070683_100205342 3300005329 Bacteria 1871
9 Ga0070683_100540639 3300005329 Bacteria 1114
10 Ga0070680_100105043 3300005336 Bacteria 2348
11 Ga0070680_100175649 3300005336 Bacteria 1803
12 Ga0070682_100041825 3300005337 Bacteria 2826
13 Ga0070682_100328889 3300005337 Bacteria 1132
14 Ga0070660_100076325 3300005339 Bacteria 2624
15 Ga0070692_10060720 3300005345 Bacteria 1991
16 Ga0070668_100006848 3300005347 Bacteria 8450
17 Ga0070668_100189248 3300005347 Bacteria 1685
18 Ga0070675_100325709 3300005354 Bacteria 1358
19 Ga0070671_100003560 3300005355 Bacteria 12181
20 Ga0070673_100598870 3300005364 Bacteria 1005
21 Ga0070659_100207599 3300005366 Bacteria 1614
22 Ga0070659_100543496 3300005366 Bacteria 994
23 Ga0070709_10003354 3300005434 Bacteria 8608
24 Ga0070709_10017375 3300005434 Bacteria 4125
25 Ga0070709_10021354 3300005434 Bacteria 3769
26 Ga0070714_100000261 3300005435 Bacteria 41105
27 Ga0070714_100000770 3300005435 Bacteria 22708
28 Ga0070714_100001336 3300005435 Bacteria 17811
29 Ga0070714_100002123 3300005435 Bacteria 14558
30 Ga0070714_100007770 3300005435 Bacteria 8354
31 Ga0070714_100037854 3300005435 Bacteria 4055
32 Ga0070714_100057038 3300005435 Bacteria 3342
33 Ga0070714_100159013 3300005435 Bacteria 2042
34 Ga0070714_100375791 3300005435 Bacteria 1339
35 Ga0070713_100016908 3300005436 Bacteria 5497
36 Ga0070713_100035365 3300005436 Bacteria 4021
37 Ga0070713_100042584 3300005436 Bacteria 3707
38 Ga0070713_100064896 3300005436 Bacteria 3065
39 Ga0070713_100073654 3300005436 Bacteria 2891
40 Ga0070713_100155893 3300005436 Bacteria 2035
41 Ga0070713_100310710 3300005436 Bacteria 1454
42 Ga0070710_10000697 3300005437 Bacteria 15990
43 Ga0070710_10000854 3300005437 Bacteria 14611
44 Ga0070710_10048538 3300005437 Bacteria 2371
45 Ga0070710_10064924 3300005437 Bacteria 2089
46 Ga0070711_100001444 3300005439 Bacteria 13073
47 Ga0070711_100020933 3300005439 Bacteria 4223
48 Ga0070711_100194104 3300005439 Bacteria 1562
49 Ga0070705_100433242 3300005440 Bacteria 982
50 Ga0070700_100000003 3300005441 Bacteria 261247
51 Ga0070708_100000014 3300005445 Bacteria 130264
52 Ga0070708_100001201 3300005445 Bacteria 19938
53 Ga0070708_100002929 3300005445 Bacteria 13281
54 Ga0070708_100030895 3300005445 Bacteria 4633
55 Ga0070708_100055695 3300005445 Bacteria 3516
56 Ga0070708_100119080 3300005445 Bacteria 2433
57 Ga0070708_100379330 3300005445 Bacteria 1333
58 Ga0070663_100000835 3300005455 Bacteria 16664
59 Ga0070663_100004631 3300005455 Bacteria 8098
60 Ga0070681_10262212 3300005458 Bacteria 1640
61 Ga0068867_100165209 3300005459 Bacteria 1748
62 Ga0070706_100000059 3300005467 Bacteria 131531
63 Ga0070706_100000148 3300005467 Bacteria 89214
64 Ga0070706_100007618 3300005467 Bacteria 10132
65 Ga0070706_100013102 3300005467 Bacteria 7670
66 Ga0070706_100013918 3300005467 Bacteria 7435
67 Ga0070706_100025028 3300005467 Bacteria 5494
68 Ga0070706_100026320 3300005467 Bacteria 5353
69 Ga0070706_100043893 3300005467 Bacteria 4130
70 Ga0070706_100144438 3300005467 Bacteria 2222
71 Ga0070706_100170641 3300005467 Bacteria 2031
72 Ga0070707_100000024 3300005468 Bacteria 128517
73 Ga0070707_100001495 3300005468 Bacteria 22791
74 Ga0070707_100002640 3300005468 Bacteria 17057
75 Ga0070707_100013326 3300005468 Bacteria 7690
76 Ga0070707_100016035 3300005468 Bacteria 7029
77 Ga0070707_100019327 3300005468 Bacteria 6416
78 Ga0070707_100039269 3300005468 Bacteria 4523
79 Ga0070707_100050139 3300005468 Bacteria 4002
80 Ga0070707_100091365 3300005468 Bacteria 2947
81 Ga0070707_100186085 3300005468 Bacteria 2025
82 Ga0070707_100375267 3300005468 Bacteria 1382
83 Ga0070698_100002583 3300005471 Bacteria 19939
84 Ga0070698_100002617 3300005471 Bacteria 19821
85 Ga0070698_100003288 3300005471 Bacteria 17769
86 Ga0070698_100005217 3300005471 Bacteria 14207
87 Ga0070698_100006326 3300005471 Bacteria 12859
88 Ga0070698_100030982 3300005471 Bacteria 5547
89 Ga0070698_100040946 3300005471 Bacteria 4759
90 Ga0070698_100050377 3300005471 Bacteria 4246
91 Ga0070698_100114094 3300005471 Bacteria 2667
92 Ga0070698_100120737 3300005471 Bacteria 2581
93 Ga0070698_100140713 3300005471 Bacteria 2364
94 Ga0070698_100141343 3300005471 Bacteria 2358
95 Ga0070699_100000046 3300005518 Bacteria 124488
96 Ga0070699_100000108 3300005518 Bacteria 77592
97 Ga0070699_100014146 3300005518 Bacteria 6865
98 Ga0070699_100076977 3300005518 Bacteria 2904
99 Ga0070699_100255795 3300005518 Bacteria 1566
100 Ga0070699_100411407 3300005518 Bacteria 1224
101 Ga0070684_100027942 3300005535 Bacteria 4767
102 Ga0070684_100028507 3300005535 Bacteria 4724
103 Ga0070697_100000004 3300005536 Bacteria 284078
104 Ga0070697_100013956 3300005536 Bacteria 6309
105 Ga0070697_100015274 3300005536 Bacteria 6027
106 Ga0070697_100221329 3300005536 Bacteria 1613
107 Ga0070696_100140480 3300005546 Bacteria 1765
108 Ga0070665_100009447 3300005548 Bacteria 9868
109 Ga0070665_100177174 3300005548 Bacteria 2133
110 Ga0070665_100400326 3300005548 Bacteria 1381
111 Ga0070665_100528921 3300005548 Bacteria 1191
112 Ga0070704_100003527 3300005549 Bacteria 8991
113 Ga0068855_100003228 3300005563 Bacteria 19958
114 Ga0068855_100074762 3300005563 Bacteria 3935
115 Ga0070664_100178493 3300005564 Bacteria 1886
116 Ga0068857_100003813 3300005577 Bacteria 12689
117 Ga0068857_100189294 3300005577 Bacteria 1874
118 Ga0068857_100205778 3300005577 Bacteria 1795
119 Ga0068857_100237652 3300005577 Bacteria 1667
120 Ga0068854_100004870 3300005578 Bacteria 8469
121 Ga0068856_100044294 3300005614 Bacteria 4379
122 Ga0068856_100050407 3300005614 Bacteria 4104
123 Ga0068856_100053183 3300005614 Bacteria 3993
124 Ga0068856_100293476 3300005614 Bacteria 1643
125 Ga0070702_100106183 3300005615 Bacteria 1732
126 Ga0068852_100013251 3300005616 Bacteria 6304
127 Ga0068852_100032189 3300005616 Bacteria 4339
128 Ga0068859_100026922 3300005617 Bacteria 5768
129 Ga0068864_100371197 3300005618 Bacteria 1354
130 Ga0068866_10086795 3300005718 Bacteria 1694
131 Ga0068863_100069219 3300005841 Bacteria 3337
132 Ga0068863_100164044 3300005841 Bacteria 2130
133 Ga0068858_100014268 3300005842 Bacteria 7491
134 Ga0068860_100091443 3300005843 Bacteria 2899
135 Ga0081455_10000011 3300005937 Bacteria 203132
136 Ga0081455_10001379 3300005937 Bacteria 30031
137 Ga0081455_10002490 3300005937 Bacteria 21865
138 Ga0081455_10010065 3300005937 Bacteria 9653
139 Ga0081538_10000096 3300005981 Bacteria 85350
140 Ga0081538_10000683 3300005981 Bacteria 37259
141 Ga0081538_10003211 3300005981 Bacteria 15539
142 Ga0081538_10015613 3300005981 Bacteria 5868
143 Ga0081538_10045506 3300005981 Bacteria 2719
144 Ga0081540_1001167 3300005983 Bacteria 23071
145 Ga0081540_1035454 3300005983 Bacteria 2675
146 Ga0081539_10000031 3300005985 Bacteria 313232
147 Ga0081539_10000125 3300005985 Bacteria 180646
148 Ga0081539_10000880 3300005985 Bacteria 57394
149 Ga0081539_10001247 3300005985 Bacteria 45247
150 Ga0081539_10005361 3300005985 Bacteria 13136
151 Ga0081539_10019294 3300005985 Bacteria 4675
152 Ga0081539_10043244 3300005985 Bacteria 2614
153 Ga0081539_10055623 3300005985 Bacteria 2200
154 Ga0070717_10007065 3300006028 Bacteria 8317
155 Ga0070717_10008992 3300006028 Bacteria 7492
156 Ga0070717_10022617 3300006028 Bacteria 4970
157 Ga0070717_10054698 3300006028 Bacteria 3292
158 Ga0070717_10064309 3300006028 Bacteria 3047
159 Ga0070717_10406454 3300006028 Bacteria 1224
160 Ga0075365_10041752 3300006038 Bacteria 2998
161 Ga0070715_10003954 3300006163 Bacteria 4797
162 Ga0070716_100000595 3300006173 Bacteria 15242
163 Ga0070716_100001061 3300006173 Bacteria 12045
164 Ga0070716_100001465 3300006173 Bacteria 10523
165 Ga0070712_100001269 3300006175 Bacteria 15240
166 Ga0070712_100003884 3300006175 Bacteria 9203
167 Ga0070712_100066882 3300006175 Bacteria 2556
168 Ga0070712_100260480 3300006175 Bacteria 1389
169 Ga0097621_100447613 3300006237 Bacteria 1163
170 Ga0068871_100058876 3300006358 Bacteria 3129
171 Ga0068871_100208787 3300006358 Bacteria 1688
172 Ga0075428_100001352 3300006844 Bacteria 26013
173 Ga0075428_100050775 3300006844 Bacteria 4548
174 Ga0075428_100081251 3300006844 Bacteria 3537
175 Ga0075428_100228842 3300006844 Bacteria 2006
176 Ga0075428_100421086 3300006844 Bacteria 1431
177 Ga0075430_100000841 3300006846 Bacteria 24051
178 Ga0075430_100001655 3300006846 Bacteria 18191
179 Ga0075430_100041988 3300006846 Bacteria 3868
180 Ga0075430_100195235 3300006846 Bacteria 1682
181 Ga0075431_100001081 3300006847 Bacteria 24380
182 Ga0075431_100001242 3300006847 Bacteria 23127
183 Ga0075431_100001775 3300006847 Bacteria 20331
184 Ga0075431_100141635 3300006847 Bacteria 2479
185 Ga0075431_100324049 3300006847 Bacteria 1553
186 Ga0075433_10027137 3300006852 Bacteria 4855
187 Ga0075433_10045051 3300006852 Bacteria 3833
188 Ga0075434_100077178 3300006871 Bacteria 3326
189 Ga0075434_100084877 3300006871 Bacteria 3165
190 Ga0075434_100291622 3300006871 Bacteria 1651
191 Ga0075429_100000965 3300006880 Bacteria 22839
192 Ga0075429_100003370 3300006880 Bacteria 13623
193 Ga0075429_100024528 3300006880 Bacteria 5232
194 Ga0075429_100231364 3300006880 Bacteria 1619
195 Ga0068865_100060094 3300006881 Bacteria 2660
196 Ga0068865_100297947 3300006881 Bacteria 1290
197 Ga0075436_100066555 3300006914 Bacteria 2490
198 Ga0075436_100131142 3300006914 Bacteria 1758
199 Ga0075436_100153198 3300006914 Bacteria 1623
200 Ga0097620_100026922 3300006931 Bacteria 5768
201 Ga0075435_100062794 3300007076 Bacteria 3015
202 Ga0075435_100083185 3300007076 Bacteria 2631
203 Ga0075435_100167264 3300007076 Bacteria 1854
204 Ga0105240_10018527 3300009093 Bacteria 9345
205 Ga0111539_10025324 3300009094 Bacteria 7273
206 Ga0111539_10078454 3300009094 Bacteria 3885
207 Ga0111539_10133624 3300009094 Bacteria 2905
208 Ga0105245_10056611 3300009098 Bacteria 3525
209 Ga0105247_10069278 3300009101 Bacteria 2201
210 Ga0114129_10000058 3300009147 Bacteria 99035
211 Ga0114129_10005485 3300009147 Bacteria 17929
212 Ga0114129_10155995 3300009147 Bacteria 3122
213 Ga0114129_10169762 3300009147 Bacteria 2975
214 Ga0114129_10745257 3300009147 Bacteria 1254
215 Ga0105241_10027630 3300009174 Bacteria 4226
216 Ga0105241_10194552 3300009174 Bacteria 1690
217 Ga0105242_10366346 3300009176 Bacteria 1335
218 Ga0105248_10195572 3300009177 Bacteria 2278
219 Ga0105248_10308662 3300009177 Bacteria 1781
220 Ga0105237_10008954 3300009545 Bacteria 10776
221 Ga0105237_10159166 3300009545 Bacteria 2256
222 Ga0105238_10019534 3300009551 Bacteria 6900
223 Ga0105238_10267385 3300009551 Bacteria 1690
224 Ga0105238_10642741 3300009551 Bacteria 1070
225 Ga0105249_10129478 3300009553 Bacteria 2407
226 Ga0105239_10094560 3300010375 Bacteria 3301
227 Ga0105239_10205977 3300010375 Bacteria 2204
228 Ga0105246_10002872 3300011119 Bacteria 10424
229 Ga0157371_10211198 3300013102 Bacteria 1393
230 Ga0157369_10036202 3300013105 Bacteria 5409
231 Ga0157369_10825311 3300013105 Bacteria 952
232 Ga0157374_10212197 3300013296 Bacteria 1898
233 Ga0163162_10066253 3300013306 Bacteria 3660
234 Ga0163162_10194445 3300013306 Bacteria 2157
235 Ga0163162_10214220 3300013306 Bacteria 2056
236 Ga0157372_10001996 3300013307 Bacteria 22167
237 Ga0157372_10164374 3300013307 Bacteria 2566
238 Ga0157372_10322389 3300013307 Bacteria 1799
239 Ga0157375_10005616 3300013308 Bacteria 10919
240 Ga0157375_10053521 3300013308 Bacteria 3972
241 Ga0157375_10136323 3300013308 Bacteria 2578
242 Ga0157375_10406521 3300013308 Bacteria 1528
243 Ga0163163_10071420 3300014325 Bacteria 3459
244 Ga0182008_10182663 3300014497 Bacteria 1062
245 Ga0157379_10046583 3300014968 Bacteria 3868
246 Ga0157379_10097932 3300014968 Bacteria 2633
247 Ga0157376_10483217 3300014969 Bacteria 1214
248 Ga0206353_10382620 3300020082 Bacteria 1148
249 Ga0206353_11255998 3300020082 Bacteria 2894
250 Ga0206353_11258446 3300020082 Bacteria 7367
251 Ga0213874_10091327 3300021377 Bacteria 1001
252 Ga0213875_10000478 3300021388 Bacteria 34042
253 Ga0213875_10009768 3300021388 Bacteria 4844
254 Ga0213875_10048149 3300021388 Bacteria 2000
255 Ga0213875_10099926 3300021388 Bacteria 1354
256 Ga0207426_1000499 3300025302 Bacteria 58455
257 Ga0207426_1007355 3300025302 Bacteria 4623
258 Ga0207692_10004546 3300025898 Bacteria 5504
259 Ga0207692_10023163 3300025898 Bacteria 2868
260 Ga0207692_10075628 3300025898 Bacteria 1787
261 Ga0207647_10030164 3300025904 Bacteria 3501
262 Ga0207685_10001463 3300025905 Bacteria 4968
263 Ga0207685_10004658 3300025905 Bacteria 3520
264 Ga0207685_10072438 3300025905 Bacteria 1401
265 Ga0207685_10103183 3300025905 Bacteria 1223
266 Ga0207699_10001508 3300025906 Bacteria 11046
267 Ga0207699_10001939 3300025906 Bacteria 9748
268 Ga0207699_10011039 3300025906 Bacteria 4550
269 Ga0207699_10018952 3300025906 Bacteria 3657
270 Ga0207705_10189322 3300025909 Bacteria 1555
271 Ga0207684_10000002 3300025910 Bacteria 1042751
272 Ga0207684_10002291 3300025910 Bacteria 19467
273 Ga0207684_10002641 3300025910 Bacteria 17935
274 Ga0207684_10002850 3300025910 Bacteria 17173
275 Ga0207684_10008669 3300025910 Bacteria 9026
276 Ga0207684_10018622 3300025910 Bacteria 5945
277 Ga0207684_10022633 3300025910 Bacteria 5364
278 Ga0207684_10089133 3300025910 Bacteria 2628
279 Ga0207684_10311106 3300025910 Bacteria 1358
280 Ga0207684_10340073 3300025910 Bacteria 1292
281 Ga0207707_10187999 3300025912 Bacteria 1802
282 Ga0207695_10003301 3300025913 Bacteria 22902
283 Ga0207671_10000530 3300025914 Bacteria 51452
284 Ga0207693_10002126 3300025915 Bacteria 17279
285 Ga0207693_10024034 3300025915 Bacteria 4838
286 Ga0207693_10048025 3300025915 Bacteria 3353
287 Ga0207693_10261780 3300025915 Bacteria 1356
288 Ga0207693_10268076 3300025915 Bacteria 1338
289 Ga0207663_10001522 3300025916 Bacteria 10839
290 Ga0207663_10026213 3300025916 Bacteria 3380
291 Ga0207663_10126979 3300025916 Bacteria 1756
292 Ga0207663_10130246 3300025916 Bacteria 1737
293 Ga0207660_10415032 3300025917 Bacteria 1085
294 Ga0207657_10044330 3300025919 Bacteria 3910
295 Ga0207657_10232922 3300025919 Bacteria 1472
296 Ga0207652_10103736 3300025921 Bacteria 2514
297 Ga0207652_10148697 3300025921 Bacteria 2097
298 Ga0207646_10000127 3300025922 Bacteria 103693
299 Ga0207646_10000636 3300025922 Bacteria 45698
300 Ga0207646_10001890 3300025922 Bacteria 25222
301 Ga0207646_10002282 3300025922 Bacteria 22805
302 Ga0207646_10002637 3300025922 Bacteria 21065
303 Ga0207646_10004843 3300025922 Bacteria 14422
304 Ga0207646_10005535 3300025922 Bacteria 13275
305 Ga0207646_10011947 3300025922 Bacteria 8374
306 Ga0207646_10023563 3300025922 Bacteria 5652
307 Ga0207646_10044142 3300025922 Bacteria 4001
308 Ga0207646_10065517 3300025922 Bacteria 3244
309 Ga0207646_10133234 3300025922 Bacteria 2237
310 Ga0207646_10139688 3300025922 Bacteria 2181
311 Ga0207646_10166926 3300025922 Bacteria 1987
312 Ga0207646_10466250 3300025922 Bacteria 1139
313 Ga0207694_10009232 3300025924 Bacteria 7442
314 Ga0207694_10401490 3300025924 Bacteria 1140
315 Ga0207659_10297901 3300025926 Bacteria 1324
316 Ga0207687_10018827 3300025927 Bacteria 4565
317 Ga0207700_10000518 3300025928 Bacteria 22664
318 Ga0207700_10003056 3300025928 Bacteria 9654
319 Ga0207700_10005407 3300025928 Bacteria 7635
320 Ga0207700_10014702 3300025928 Bacteria 5138
321 Ga0207700_10016541 3300025928 Bacteria 4903
322 Ga0207700_10027370 3300025928 Bacteria 3991
323 Ga0207700_10050721 3300025928 Bacteria 3093
324 Ga0207700_10084221 3300025928 Bacteria 2492
325 Ga0207664_10001398 3300025929 Bacteria 15864
326 Ga0207664_10001442 3300025929 Bacteria 15635
327 Ga0207664_10004201 3300025929 Bacteria 9734
328 Ga0207664_10005044 3300025929 Bacteria 8986
329 Ga0207664_10005696 3300025929 Bacteria 8515
330 Ga0207664_10026984 3300025929 Bacteria 4348
331 Ga0207664_10040219 3300025929 Bacteria 3634
332 Ga0207664_10061820 3300025929 Bacteria 2989
333 Ga0207664_10064871 3300025929 Bacteria 2922
334 Ga0207664_10137800 3300025929 Bacteria 2061
335 Ga0207664_10181544 3300025929 Bacteria 1807
336 Ga0207664_10518450 3300025929 Bacteria 1068
337 Ga0207644_10004903 3300025931 Bacteria 8721
338 Ga0207686_10243978 3300025934 Bacteria 1309
339 Ga0207665_10000328 3300025939 Bacteria 32913
340 Ga0207665_10003721 3300025939 Bacteria 10187
341 Ga0207665_10009995 3300025939 Bacteria 6230
342 Ga0207665_10013943 3300025939 Bacteria 5287
343 Ga0207665_10082244 3300025939 Bacteria 2219
344 Ga0207665_10096508 3300025939 Bacteria 2056
345 Ga0207691_10439271 3300025940 Bacteria 1111
346 Ga0207661_10002423 3300025944 Bacteria 12856
347 Ga0207661_10018617 3300025944 Bacteria 5162
348 Ga0207661_10050929 3300025944 Bacteria 3302
349 Ga0207679_10117532 3300025945 Bacteria 2110
350 Ga0207679_10431708 3300025945 Bacteria 1165
351 Ga0207667_10021913 3300025949 Bacteria 7072
352 Ga0207667_10106607 3300025949 Bacteria 2890
353 Ga0207712_10137887 3300025961 Bacteria 1868
354 Ga0207668_10112720 3300025972 Bacteria 2044
355 Ga0207640_10024260 3300025981 Bacteria 3657
356 Ga0207677_10560809 3300026023 Bacteria 997
357 Ga0207678_10000168 3300026067 Bacteria 55114
358 Ga0207678_10006715 3300026067 Bacteria 10206
359 Ga0207708_10000002 3300026075 Bacteria 411071
360 Ga0207702_10027777 3300026078 Bacteria 4701
361 Ga0207702_10031245 3300026078 Bacteria 4438
362 Ga0207702_10079375 3300026078 Bacteria 2844
363 Ga0207702_10207185 3300026078 Bacteria 1821
364 Ga0207641_10043512 3300026088 Bacteria 3772
365 Ga0207676_10359496 3300026095 Bacteria 1349
366 Ga0207674_10015760 3300026116 Bacteria 8291
367 Ga0207674_10229391 3300026116 Bacteria 1805
368 Ga0207683_10072497 3300026121 Bacteria 3046
369 Ga0207683_10174424 3300026121 Bacteria 1948
370 Ga0207683_10283032 3300026121 Bacteria 1515
371 Ga0207683_10371623 3300026121 Bacteria 1314
372 Ga0207698_10074845 3300026142 Bacteria 2703
373 Ga0207698_10411798 3300026142 Bacteria 1295
374 Ga0268266_10005053 3300028379 Bacteria 12451
375 Ga0268266_10163626 3300028379 Bacteria 2014
376 Ga0268266_10428405 3300028379 Bacteria 1255
377 Ga0268264_10007538 3300028381 Bacteria 9078
378 Ga0268264_10117203 3300028381 Bacteria 2342
379 Ga0265326_10002290 3300028558 Bacteria 6474
380 Ga0265319_1001647 3300028563 Bacteria 12952
381 Ga0265334_10031727 3300028573 Bacteria 2110
382 Ga0265334_10053025 3300028573 Bacteria 1550
383 Ga0265318_10000251 3300028577 Bacteria 46650
384 Ga0265323_10085974 3300028653 Bacteria 1057
385 Ga0265322_10001581 3300028654 Bacteria 7308
386 Ga0265336_10050538 3300028666 Bacteria 1257
387 Ga0307517_10003710 3300028786 Bacteria 23732
388 Ga0307517_10149923 3300028786 Bacteria 1604
389 Ga0307515_10055673 3300028794 Bacteria 5772
390 Ga0307515_10058294 3300028794 Bacteria 5564
391 Ga0265338_10003462 3300028800 Bacteria 22216
392 Ga0265338_10022191 3300028800 Bacteria 6583
393 Ga0307511_10105972 3300030521 Bacteria 1817
394 Ga0307512_10002471 3300030522 Bacteria 23281
395 Ga0307512_10029546 3300030522 Bacteria 4785
396 Ga0316176_1098424 3300030732 Bacteria 2352
397 Ga0265330_10000873 3300031235 Bacteria 18828
398 Ga0265328_10016149 3300031239 Bacteria 2909
399 Ga0265320_10020167 3300031240 Bacteria 3622
400 Ga0265325_10000549 3300031241 Bacteria 27215
401 Ga0265329_10007314 3300031242 Bacteria 4282
402 Ga0265339_10001224 3300031249 Bacteria 19295
403 Ga0265339_10048399 3300031249 Bacteria 2331
404 Ga0265331_10002901 3300031250 Bacteria 11329
405 Ga0265327_10007522 3300031251 Bacteria 8388
406 Ga0265316_10059650 3300031344 Bacteria 2966
407 Ga0307513_10004399 3300031456 Bacteria 18811
408 Ga0307509_10163490 3300031507 Bacteria 2119
409 Ga0307408_100192736 3300031548 Bacteria 1643
410 Ga0265313_10001573 3300031595 Bacteria 21174
411 Ga0307508_10016728 3300031616 Bacteria 6672
412 Ga0307508_10025972 3300031616 Bacteria 5310
413 Ga0265314_10003084 3300031711 Bacteria 16422
414 Ga0265314_10223998 3300031711 Bacteria 1095
415 Ga0265342_10050564 3300031712 Bacteria 2482
416 Ga0307516_10039706 3300031730 Bacteria 4690
417 Ga0307405_10005187 3300031731 Bacteria 6253
418 Ga0307405_10145531 3300031731 Bacteria 1659
419 Ga0307405_10503374 3300031731 Bacteria 971
420 Ga0307413_10060041 3300031824 Bacteria 2339
421 Ga0307413_10190450 3300031824 Bacteria 1472
422 Ga0307413_10271870 3300031824 Bacteria 1269
423 Ga0307518_10000753 3300031838 Bacteria 24372
424 Ga0307410_10009253 3300031852 Bacteria 5515
425 Ga0307410_10182015 3300031852 Bacteria 1591
426 Ga0307410_10488949 3300031852 Bacteria 1011
427 Ga0307406_10040475 3300031901 Bacteria 2898
428 Ga0307406_10062946 3300031901 Bacteria 2401
429 Ga0307406_10066450 3300031901 Bacteria 2347
430 Ga0307406_10188219 3300031901 Bacteria 1509
431 Ga0307407_10016313 3300031903 Bacteria 3696
432 Ga0307407_10051293 3300031903 Bacteria 2364
433 Ga0307407_10251655 3300031903 Bacteria 1211
434 Ga0307407_10256360 3300031903 Bacteria 1201
435 Ga0307412_10031488 3300031911 Bacteria 3351
436 Ga0307412_10172566 3300031911 Bacteria 1618
437 Ga0307409_100000071 3300031995 Bacteria 36779
438 Ga0307409_100024549 3300031995 Bacteria 4207
439 Ga0307409_100057751 3300031995 Bacteria 3009
440 Ga0307409_100089250 3300031995 Bacteria 2519
441 Ga0307409_100102196 3300031995 Bacteria 2381
442 Ga0307409_100131220 3300031995 Bacteria 2141
443 Ga0307409_100163008 3300031995 Bacteria 1952
444 Ga0307409_100414433 3300031995 Bacteria 1290
445 Ga0307409_100449796 3300031995 Bacteria 1243
446 Ga0307409_100462483 3300031995 Bacteria 1227
447 Ga0307416_100001030 3300032002 Bacteria 14792
448 Ga0307416_100004996 3300032002 Bacteria 8089
449 Ga0307416_100048502 3300032002 Bacteria 3370
450 Ga0307416_100369102 3300032002 Bacteria 1460
451 Ga0307416_100378104 3300032002 Bacteria 1445
452 Ga0307416_100463641 3300032002 Bacteria 1323
453 Ga0307416_100505111 3300032002 Bacteria 1274
454 Ga0307414_10008167 3300032004 Bacteria 5918
455 Ga0307414_10012761 3300032004 Bacteria 4983
456 Ga0307414_10039837 3300032004 Bacteria 3169
457 Ga0307414_10201324 3300032004 Bacteria 1620
458 Ga0307414_10276068 3300032004 Bacteria 1410
459 Ga0307414_10561185 3300032004 Bacteria 1019
460 Ga0307411_10222463 3300032005 Bacteria 1465
461 Ga0307411_10291205 3300032005 Bacteria 1305
462 Ga0307415_100000029 3300032126 Bacteria 60960
463 Ga0307415_100003722 3300032126 Bacteria 7805
464 Ga0307415_100052011 3300032126 Bacteria 2783
465 Ga0307415_100234480 3300032126 Bacteria 1480
466 Ga0307507_10035050 3300033179 Bacteria 5166
467 Ga0307507_10041429 3300033179 Bacteria 4607
468 Ga0307507_10050953 3300033179 Bacteria 3989
469 Ga0307507_10060094 3300033179 Bacteria 3552
470 Ga0307507_10141064 3300033179 Bacteria 1847
471 Ga0307510_10109379 3300033180 Bacteria 2513
472 Ga0307510_10308021 3300033180 Bacteria 1044
473 Ga0373959_0009704 3300034820 Bacteria 1668
474 Ga0373938_0007787 3300034957 Bacteria 1895
475 Ga0373926_0000519 3300035083 Bacteria 10262
476 Ga0373926_0096018 3300035083 Bacteria 1106
477 Ga0373934_0000021 3300035086 Bacteria 53680
478 Ga0373934_0024594 3300035086 Bacteria 2329
479 Ga0373934_0098490 3300035086 Bacteria 1181
480 Ga0373944_0068460 3300035089 Bacteria 1152
481 Ga0373923_0004679 3300035111 Bacteria 4563
482 Ga0373923_0010612 3300035111 Bacteria 3357
483 Ga0373936_0004294 3300035113 Bacteria 5385
484 Ga0373953_0000328 3300035117 Bacteria 12808
485 Ga0373953_0015221 3300035117 Bacteria 2782
486 Ga0373953_0053827 3300035117 Bacteria 1632
487 Ga0373954_0000423 3300035118 Bacteria 15767
488 Ga0373954_0065264 3300035118 Bacteria 1722
489 Ga0373956_0000073 3300035119 Bacteria 32947
490 Ga0373956_0040603 3300035119 Bacteria 2064
491 Ga0373957_0001129 3300035120 Bacteria 7067
492 Ga0373957_0002490 3300035120 Bacteria 5273
493 Ga0373957_0033523 3300035120 Bacteria 1897
494 Ga0373960_0010343 3300035121 Bacteria 2277
495 Ga0373946_0030361 3300035171 Bacteria 2157
496 Ga0373946_0088180 3300035171 Bacteria 1370
497 Ga0373946_0106513 3300035171 Bacteria 1263
498 Ga0373955_0000125 3300035172 Bacteria 30520
499 Ga0373955_0018959 3300035172 Bacteria 3431
500 Ga0373955_0053354 3300035172 Bacteria 2207
501 Ga0373955_0060314 3300035172 Bacteria 2092
502 Ga0373955_0110222 3300035172 Bacteria 1591
503 Ga0373955_0136826 3300035172 Bacteria 1433
504 Ga0373961_0040398 3300035241 Bacteria 1344
505 Ga0373924_0000419 3300035410 Bacteria 12985
506 Ga0373924_0009943 3300035410 Bacteria 3499
507 Ga0373924_0092327 3300035410 Bacteria 1296
508 Ga0373924_0113884 3300035410 Bacteria 1170
509 Ga0373931_0143690 3300035691 Bacteria 1385
510 Ga0373935_0013995 3300035692 Bacteria 4844
511 Ga0373935_0123081 3300035692 Bacteria 1735
512 Ga0373933_0001491 3300035724 Bacteria 13704
513 Ga0373933_0016762 3300035724 Bacteria 4103
514 Ga0373933_0034210 3300035724 Bacteria 2960
515 Ga0373933_0045281 3300035724 Bacteria 2608
516 Ga0373947_0000012 3300035725 Bacteria 155188
517 Ga0373947_0016297 3300035725 Bacteria 4272
518 Ga0373947_0291208 3300035725 Bacteria 1087
519 Ga0373937_0000169 3300036401 Bacteria 63595
520 Ga0373937_0007973 3300036401 Bacteria 9182
521 Ga0373937_0021311 3300036401 Bacteria 5816
522 Ga0373937_0033154 3300036401 Bacteria 4688
523 Ga0373937_0263563 3300036401 Bacteria 1625
524 Ga0373925_0146670 3300037068 Bacteria 1850
525 Ga0395899_0364632 3300037312 Bacteria 963
526 Ga0395900_0028475 3300037418 Bacteria 5723
527 Ga0395900_0179248 3300037418 Bacteria 2154
528 Ga0395900_0394700 3300037418 Bacteria 1349
529 Ga0395898_0141809 3300037466 Bacteria 2300
530 Ga0395898_0170849 3300037466 Bacteria 2078
531 Ga0436364_0383821 3300037853 Bacteria 1564
532 Ga0436364_0771738 3300037853 Bacteria 63638
533 Ga0436364_0776813 3300037853 Bacteria 1126
534 Ga0436364_1115153 3300037853 Bacteria 2069
535 Ga0395901_0094169 3300038443 Bacteria 3137
536 Ga0395901_0114765 3300038443 Bacteria 2829
537 Ga0395901_0355088 3300038443 Bacteria 1512
538 Ga0395901_0549672 3300038443 Bacteria 1170
539 Ga0436363_0330691 3300039450 Bacteria 1863
540 Ga0436363_1688649 3300039450 Bacteria 1522
541 Ga0439439_0015490 3300041406 Bacteria 1863
542 Ga0439466_0027522 3300041411 Bacteria 1969
543 Ga0451853_0418742 3300041512 Bacteria 8558
544 Ga0439433_0003783 3300041999 Bacteria 3253
545 Ga0439449_0000547 3300042007 Bacteria 14102
546 Ga0439449_0026449 3300042007 Bacteria 2166
547 Ga0439455_0015758 3300042012 Bacteria 1741
548 Ga0439463_012907 3300042016 Bacteria 2054
549 Ga0450894_000030 3300042131 Bacteria 20068
550 Ga0450896_002861 3300042133 Bacteria 2257
551 Ga0450908_018391 3300042184 Bacteria 1236
552 Ga0439440_0019313 3300042993 Bacteria 1519
553 Ga0466969_0001393 3300044656 Bacteria 13038
554 Ga0466969_0001519 3300044656 Bacteria 12499
555 Ga0466969_0011231 3300044656 Bacteria 4740
556 Ga0466969_0027492 3300044656 Bacteria 2913
557 Ga0466969_0034637 3300044656 Bacteria 2558
558 Ga0466972_0004598 3300044658 Bacteria 6918
559 Ga0466972_0018756 3300044658 Bacteria 3457
560 Ga0466972_0042721 3300044658 Bacteria 2202
561 Ga0466965_0000947 3300044683 Bacteria 11168
562 Ga0466965_0002500 3300044683 Bacteria 7823
563 Ga0466965_0133587 3300044683 Bacteria 1288
564 Ga0466966_0002213 3300044684 Bacteria 12648
565 Ga0466966_0039397 3300044684 Bacteria 3043
566 Ga0466966_0040037 3300044684 Bacteria 3016
567 Ga0466961_0014213 3300044693 Bacteria 5109
568 Ga0466961_0075824 3300044693 Bacteria 2131
569 Ga0466961_0079663 3300044693 Bacteria 2074
570 Ga0466961_0237177 3300044693 Bacteria 1122
571 Ga0466963_0022444 3300044694 Bacteria 3997
572 Ga0466963_0063650 3300044694 Bacteria 2469
573 Ga0466963_0095896 3300044694 Bacteria 2025
574 Ga0466963_0140822 3300044694 Bacteria 1671
575 Ga0466963_0165563 3300044694 Bacteria 1540
576 Ga0466964_0038411 3300044706 Bacteria 1925
577 Ga0466964_0115185 3300044706 Bacteria 1204
578 Ga0466971_0000368 3300044719 Bacteria 17381
579 Ga0466971_0009808 3300044719 Bacteria 4180
580 Ga0466968_0012689 3300044735 Bacteria 3305
581 Ga0466968_0086609 3300044735 Bacteria 1383
582 Ga0466970_0004353 3300044765 Bacteria 6974
583 Ga0466970_0077750 3300044765 Bacteria 1789
584 Ga0466970_0180022 3300044765 Bacteria 1173
585 Ga0466957_0033625 3300044842 Bacteria 3076
586 Ga0466957_0038565 3300044842 Bacteria 2879
587 Ga0466957_0213611 3300044842 Bacteria 1271
588 Ga0466960_0000646 3300044901 Bacteria 12081
589 Ga0466960_0014072 3300044901 Bacteria 3414
590 Ga0466960_0107141 3300044901 Bacteria 1447
591 Ga0466960_0158726 3300044901 Bacteria 1213
592 Ga0466959_0001945 3300045049 Bacteria 13009
593 Ga0466959_0007600 3300045049 Bacteria 7615
594 Ga0466959_0041292 3300045049 Bacteria 3405
595 Ga0466959_0049520 3300045049 Bacteria 3087
596 Ga0451576_0046870 3300045051 Bacteria 4549
597 Ga0466958_0008607 3300045836 Bacteria 5664
598 Ga0466958_0048578 3300045836 Bacteria 2565
599 Ga0466958_0065679 3300045836 Bacteria 2214
600 Ga0466967_0000767 3300045976 Bacteria 16624
601 Ga0466967_0007908 3300045976 Bacteria 7731
602 Ga0466967_0078227 3300045976 Bacteria 2979
603 Ga0466967_0079181 3300045976 Bacteria 2962
604 Ga0466967_0090629 3300045976 Bacteria 2778
605 Ga0466967_0106994 3300045976 Bacteria 2565
606 Ga0466967_0161671 3300045976 Bacteria 2102
607 Ga0466967_0214119 3300045976 Bacteria 1828
608 Ga0466967_0346449 3300045976 Bacteria 1437
609 Ga0466967_0348110 3300045976 Bacteria 1434
610 Ga0466967_0403108 3300045976 Bacteria 1331
611 Ga0466967_0479042 3300045976 Bacteria 1219
612 Ga0466967_0549385 3300045976 Bacteria 1137
613 Ga0495592_0000070 3300046454 Bacteria 93255
614 Ga0495592_0004032 3300046454 Bacteria 10669
615 Ga0495592_0013978 3300046454 Bacteria 6097
616 Ga0495592_0111702 3300046454 Bacteria 1933
617 Ga0495592_0162615 3300046454 Bacteria 1534
618 Ga0495603_0041124 3300046455 Bacteria 2765
619 Ga0495603_0164913 3300046455 Bacteria 1284
620 Ga0495590_0028614 3300046457 Bacteria 1954
621 Ga0495629_0013328 3300046459 Bacteria 5931
622 Ga0495629_0042855 3300046459 Bacteria 3179
623 Ga0495641_0005969 3300046461 Bacteria 8026
624 Ga0495651_0000042 3300046462 Bacteria 93255
625 Ga0495651_0005798 3300046462 Bacteria 9426
626 Ga0495651_0022065 3300046462 Bacteria 4950
627 Ga0495651_0028953 3300046462 Bacteria 4319
628 Ga0495651_0032487 3300046462 Bacteria 4070
629 Ga0495651_0038132 3300046462 Bacteria 3742
630 Ga0495651_0146117 3300046462 Bacteria 1709
631 Ga0495653_0003317 3300046463 Bacteria 12925
632 Ga0495653_0031568 3300046463 Bacteria 4210
633 Ga0495653_0031576 3300046463 Bacteria 4209
634 Ga0495653_0085186 3300046463 Bacteria 2325
635 Ga0495650_0021622 3300046471 Bacteria 3103
636 Ga0495580_0011800 3300046472 Bacteria 6745
637 Ga0495662_0002341 3300046476 Bacteria 9547
638 Ga0495662_0008311 3300046476 Bacteria 5105
639 Ga0495662_0045589 3300046476 Bacteria 2116
640 Ga0495662_0100866 3300046476 Bacteria 1412
641 Ga0495664_0001695 3300046477 Bacteria 11711
642 Ga0495664_0002877 3300046477 Bacteria 9276
643 Ga0495664_0014217 3300046477 Bacteria 4509
644 Ga0495664_0047702 3300046477 Bacteria 2542
645 Ga0495594_0042224 3300046499 Bacteria 2497
646 Ga0495607_0153336 3300046501 Bacteria 1177
647 Ga0495608_0000054 3300046511 Bacteria 93255
648 Ga0495608_0003305 3300046511 Bacteria 11527
649 Ga0495608_0013648 3300046511 Bacteria 5636
650 Ga0495608_0026966 3300046511 Bacteria 3912
651 Ga0495608_0027784 3300046511 Bacteria 3847
652 Ga0495618_0025440 3300046514 Bacteria 3673
653 Ga0495618_0029916 3300046514 Bacteria 3400
654 Ga0495618_0066094 3300046514 Bacteria 2298
655 Ga0495618_0155516 3300046514 Bacteria 1459
656 Ga0495628_0001347 3300046516 Bacteria 22500
657 Ga0495628_0008742 3300046516 Bacteria 8669
658 Ga0495628_0070586 3300046516 Bacteria 2723
659 Ga0495628_0144248 3300046516 Bacteria 1816
660 Ga0495628_0402929 3300046516 Bacteria 999
661 Ga0495630_0015629 3300046517 Bacteria 5546
662 Ga0495630_0022964 3300046517 Bacteria 4608
663 Ga0495630_0034683 3300046517 Bacteria 3768
664 Ga0495630_0093672 3300046517 Bacteria 2270
665 Ga0495632_0053454 3300046519 Bacteria 1983
666 Ga0495643_0001950 3300046522 Bacteria 17355
667 Ga0495666_0006058 3300046526 Bacteria 6090
668 Ga0495666_0084350 3300046526 Bacteria 1501
669 Ga0495652_0000119 3300046529 Bacteria 85582
670 Ga0495652_0012613 3300046529 Bacteria 7617
671 Ga0495652_0022390 3300046529 Bacteria 5605
672 Ga0495652_0127208 3300046529 Bacteria 2022
673 Ga0495665_0000841 3300046531 Bacteria 16056
674 Ga0495665_0001405 3300046531 Bacteria 12895
675 Ga0495665_0071471 3300046531 Bacteria 1827
676 Ga0495640_0005739 3300046533 Bacteria 9865
677 Ga0495640_0007423 3300046533 Bacteria 8621
678 Ga0495640_0016595 3300046533 Bacteria 5506
679 Ga0495640_0023486 3300046533 Bacteria 4490
680 Ga0495640_0073012 3300046533 Bacteria 2297
681 Ga0495640_0229997 3300046533 Bacteria 1166
682 Ga0495586_0003139 3300046535 Bacteria 8891
683 Ga0495586_0059581 3300046535 Bacteria 2074
684 Ga0495587_0000374 3300046536 Bacteria 31849
685 Ga0495587_0007080 3300046536 Bacteria 7274
686 Ga0495645_0004499 3300046543 Bacteria 9510
687 Ga0495645_0005026 3300046543 Bacteria 9062
688 Ga0495645_0043653 3300046543 Bacteria 3270
689 Ga0495645_0067098 3300046543 Bacteria 2590
690 Ga0495645_0164977 3300046543 Bacteria 1528
691 Ga0495645_0216205 3300046543 Bacteria 1291
692 Ga0495667_0000114 3300046559 Bacteria 58520
693 Ga0495667_0012288 3300046559 Bacteria 5803
694 Ga0495667_0013427 3300046559 Bacteria 5546
695 Ga0495667_0016983 3300046559 Bacteria 4914
696 Ga0495667_0024286 3300046559 Bacteria 4082
697 Ga0495667_0123047 3300046559 Bacteria 1674
698 Ga0495656_0038922 3300046615 Bacteria 1972
699 Ga0495668_0000632 3300046616 Bacteria 42377
700 Ga0495634_0013542 3300046642 Bacteria 5890
701 Ga0495634_0018221 3300046642 Bacteria 5001
702 Ga0495634_0020934 3300046642 Bacteria 4632
703 Ga0495625_0000797 3300046660 Bacteria 43641
704 Ga0495635_0169439 3300046663 Bacteria 1485
705 Ga0495661_0167380 3300046665 Bacteria 1175
706 Ga0495588_0091949 3300046674 Bacteria 1590
707 Ga0495657_0000067 3300046675 Bacteria 93255
708 Ga0495657_0008842 3300046675 Bacteria 7668
709 Ga0495657_0009938 3300046675 Bacteria 7180
710 Ga0495657_0010350 3300046675 Bacteria 7021
711 Ga0495657_0014048 3300046675 Bacteria 5882
712 Ga0495657_0114000 3300046675 Bacteria 1709
713 Ga0495657_0179996 3300046675 Bacteria 1298
714 Ga0495599_0000042 3300046678 Bacteria 94912
715 Ga0495599_0003479 3300046678 Bacteria 9214
716 Ga0495599_0008444 3300046678 Bacteria 6260
717 Ga0495599_0146158 3300046678 Bacteria 1465
718 Ga0495623_0000522 3300046679 Bacteria 25418
719 Ga0495623_0037650 3300046679 Bacteria 3094
720 Ga0495623_0084230 3300046679 Bacteria 1962
721 Ga0495623_0109597 3300046679 Bacteria 1674
722 Ga0495646_0029012 3300046680 Bacteria 3461
723 Ga0495646_0098230 3300046680 Bacteria 1682
724 Ga0495646_0134089 3300046680 Bacteria 1391
725 Ga0495658_0009574 3300046683 Bacteria 4832
726 Ga0495613_0004179 3300046689 Bacteria 10809
727 Ga0495613_0019996 3300046689 Bacteria 4989
728 Ga0495624_0060790 3300046690 Bacteria 2368
729 Ga0495624_0075676 3300046690 Bacteria 2090
730 Ga0495624_0177746 3300046690 Bacteria 1298
731 Ga0495670_0013201 3300046691 Bacteria 4063
732 Ga0495589_0011288 3300046794 Bacteria 4637
733 Ga0495600_0012627 3300046809 Bacteria 5287
734 Ga0495600_0014145 3300046809 Bacteria 5026
735 Ga0495600_0035048 3300046809 Bacteria 3259
736 Ga0495660_0015609 3300046810 Bacteria 4388
737 Ga0495581_0003301 3300047315 Bacteria 9269
738 Ga0495581_0007284 3300047315 Bacteria 6400
739 Ga0495581_0024807 3300047315 Bacteria 3475
740 Ga0495604_0000121 3300047317 Bacteria 65991
741 Ga0495604_0002938 3300047317 Bacteria 13655
742 Ga0495604_0003376 3300047317 Bacteria 12733
743 Ga0495604_0003492 3300047317 Bacteria 12528
744 Ga0495604_0023093 3300047317 Bacteria 4963
745 Ga0495604_0038784 3300047317 Bacteria 3748
746 Ga0495604_0087252 3300047317 Bacteria 2324
747 Ga0495604_0232316 3300047317 Bacteria 1264
748 Ga0495674_0006966 3300047319 Bacteria 10815
749 Ga0495674_0041694 3300047319 Bacteria 4098
750 Ga0495674_0062397 3300047319 Bacteria 3245
751 Ga0495674_0094211 3300047319 Bacteria 2554
752 Ga0495676_0013435 3300047321 Bacteria 7357
753 Ga0495676_0057269 3300047321 Bacteria 3076
754 Ga0495680_0000054 3300047322 Bacteria 93244
755 Ga0495680_0007021 3300047322 Bacteria 10384
756 Ga0495680_0034597 3300047322 Bacteria 4077
757 Ga0495680_0091405 3300047322 Bacteria 2281
758 Ga0495680_0136922 3300047322 Bacteria 1795
759 Ga0495683_0029464 3300047323 Bacteria 2805
760 Ga0495675_0000346 3300047444 Bacteria 32587
761 Ga0495675_0003295 3300047444 Bacteria 9708
762 Ga0495675_0003780 3300047444 Bacteria 9153
763 Ga0495675_0012881 3300047444 Bacteria 5270
764 Ga0495675_0017543 3300047444 Bacteria 4537
765 Ga0495675_0024610 3300047444 Bacteria 3839
766 Ga0495675_0114393 3300047444 Bacteria 1683
767 Ga0495685_000223 3300047447 Bacteria 19334
768 Ga0495681_0000654 3300047470 Bacteria 26355
769 Ga0495684_0015097 3300047471 Bacteria 5948
770 Ga0495684_0020685 3300047471 Bacteria 5070
771 Ga0495684_0032859 3300047471 Bacteria 3985
772 Ga0495684_0033418 3300047471 Bacteria 3944
773 Ga0495684_0121422 3300047471 Bacteria 1967
774 Ga0495684_0156602 3300047471 Bacteria 1701
775 Ga0495684_0209143 3300047471 Bacteria 1435
776 Ga0495684_0350267 3300047471 Bacteria 1048
777 Ga0495593_0004457 3300047673 Bacteria 8322
778 Ga0495593_0025558 3300047673 Bacteria 3268
779 Ga0495593_0056538 3300047673 Bacteria 2062
780 Ga0495602_0000083 3300048088 Bacteria 93242
781 Ga0495602_0008130 3300048088 Bacteria 10954
782 Ga0495602_0022114 3300048088 Bacteria 6232
783 Ga0495602_0049974 3300048088 Bacteria 3740
784 Ga0495602_0090966 3300048088 Bacteria 2532
785 Ga0495626_0000581 3300048091 Bacteria 36264
786 Ga0496100_0126154 3300048903 Bacteria 1796
787 Ga0496100_0341163 3300048903 Bacteria 1130
788 Ga0496101_0110785 3300048904 Bacteria 2066
789 Ga0496102_0022743 3300048905 Bacteria 5557
790 Ga0496102_0091395 3300048905 Bacteria 2817
791 Ga0496102_0357441 3300048905 Bacteria 1375
792 Ga0496102_0505222 3300048905 Bacteria 1131
793 Ga0496102_0548913 3300048905 Bacteria 1078
794 Ga0496103_0111620 3300048906 Bacteria 1737
795 Ga0496104_0000600 3300048907 Bacteria 30850
796 Ga0496104_0050173 3300048907 Bacteria 3937
797 Ga0496104_0188724 3300048907 Bacteria 1972
798 Ga0496105_0011198 3300048908 Bacteria 7076
799 Ga0496105_0075457 3300048908 Bacteria 2784
800 Ga0496105_0091725 3300048908 Bacteria 2508
801 Ga0496105_0098448 3300048908 Bacteria 2415
802 Ga0496106_0149256 3300048909 Bacteria 1843
803 Ga0496106_0200629 3300048909 Bacteria 1587
804 Ga0496106_0343267 3300048909 Bacteria 1199
805 Ga0496107_0070168 3300048910 Bacteria 2544
806 Ga0496107_0237196 3300048910 Bacteria 1357
807 Ga0496107_0305996 3300048910 Bacteria 1183
808 Ga0496108_0050723 3300048911 Bacteria 3474
809 Ga0496108_0071004 3300048911 Bacteria 2938
810 Ga0496108_0076762 3300048911 Bacteria 2824
811 Ga0496108_0252088 3300048911 Bacteria 1535
812 Ga0496108_0316972 3300048911 Bacteria 1359
813 Ga0496109_0010422 3300048912 Bacteria 7939
814 Ga0496109_0018991 3300048912 Bacteria 6054
815 Ga0496109_0131677 3300048912 Bacteria 2334
816 Ga0496109_0245531 3300048912 Bacteria 1685
817 Ga0496110_0029877 3300048913 Bacteria 4696
818 Ga0496110_0260791 3300048913 Bacteria 1577
819 Ga0496111_0041212 3300048914 Bacteria 3313
820 Ga0496111_0075282 3300048914 Bacteria 2459
821 Ga0496111_0207339 3300048914 Bacteria 1456
822 Ga0496112_0015213 3300048915 Bacteria 7171
823 Ga0496112_0024759 3300048915 Bacteria 5755
824 Ga0496113_0013081 3300048916 Bacteria 5604
825 Ga0496113_0058609 3300048916 Bacteria 2898
826 Ga0496113_0071667 3300048916 Bacteria 2636
827 Ga0496113_0211415 3300048916 Bacteria 1544
828 Ga0496113_0283687 3300048916 Bacteria 1324
829 Ga0496114_0084678 3300048917 Bacteria 2685
830 Ga0496115_0061249 3300048918 Bacteria 3034
831 Ga0501306_016613 3300049127 Bacteria 991
832 Ga0501031_0007875 3300049568 Bacteria 6934
833 Ga0501031_0051483 3300049568 Bacteria 2682
834 Ga0501031_0094205 3300049568 Bacteria 1954
835 Ga0501032_0011354 3300049569 Bacteria 6398
836 Ga0501034_0001939 3300049571 Bacteria 26203
837 Ga0501034_0018672 3300049571 Bacteria 7107
838 Ga0501034_0030498 3300049571 Bacteria 5482
839 Ga0501036_0014365 3300049572 Bacteria 6593
840 Ga0501036_0091441 3300049572 Bacteria 2570
841 Ga0501036_0139400 3300049572 Bacteria 2047
842 Ga0501037_0069864 3300049573 Bacteria 2556
843 Ga0501037_0153098 3300049573 Bacteria 1647
844 Ga0501037_0166246 3300049573 Bacteria 1571
845 Ga0501037_0314737 3300049573 Bacteria 1085
846 Ga0501038_0007410 3300049574 Bacteria 10120
847 Ga0501039_0069388 3300049575 Bacteria 2737
848 Ga0501039_0071197 3300049575 Bacteria 2702
849 Ga0501039_0127215 3300049575 Bacteria 1999
850 Ga0501039_0151585 3300049575 Bacteria 1821
851 Ga0501040_0002194 3300049576 Bacteria 12583
852 Ga0501040_0012124 3300049576 Bacteria 5644
853 Ga0501041_0011862 3300049577 Bacteria 5159
854 Ga0501041_0198609 3300049577 Bacteria 1257
855 Ga0501042_0006044 3300049578 Bacteria 7840
856 Ga0501042_0011625 3300049578 Bacteria 5947
857 Ga0501042_0045520 3300049578 Bacteria 3127
858 Ga0501042_0182028 3300049578 Bacteria 1516
859 Ga0501043_0001474 3300049579 Bacteria 20563
860 Ga0501043_0015282 3300049579 Bacteria 6013
861 Ga0501046_0044949 3300049580 Bacteria 3511
862 Ga0501047_0000023 3300049581 Bacteria 240478
863 Ga0501047_0001834 3300049581 Bacteria 20518
864 Ga0501047_0079764 3300049581 Bacteria 3147
865 Ga0501048_0002840 3300049582 Bacteria 13223
866 Ga0501048_0107090 3300049582 Bacteria 1973
867 Ga0501048_0176683 3300049582 Bacteria 1513
868 Ga0501069_0199898 3300049585 Bacteria 1158
869 Ga0501071_0073222 3300049587 Bacteria 2498
870 Ga0501071_0092974 3300049587 Bacteria 2217
871 Ga0501071_0110459 3300049587 Bacteria 2032
872 Ga0501072_0043733 3300049588 Bacteria 3521
873 Ga0501074_0007659 3300049590 Bacteria 7818
874 Ga0501074_0041280 3300049590 Bacteria 3341
875 Ga0501074_0101347 3300049590 Bacteria 2061
876 Ga0501075_0219358 3300049591 Bacteria 1451
877 Ga0501075_0555235 3300049591 Bacteria 876
878 Ga0501076_0045545 3300049592 Bacteria 3463
879 Ga0501076_0130345 3300049592 Bacteria 2039
880 Ga0501076_0416498 3300049592 Bacteria 1105
881 Ga0501077_0017748 3300049593 Bacteria 4496
882 Ga0501079_0010899 3300049741 Bacteria 6924
883 Ga0501079_0041476 3300049741 Bacteria 3553
884 Ga0501079_0042074 3300049741 Bacteria 3528
885 Ga0501079_0267014 3300049741 Bacteria 1338
886 Ga0501081_0037174 3300049743 Bacteria 3322
887 Ga0501081_0091440 3300049743 Bacteria 2140
888 Ga0501081_0250121 3300049743 Bacteria 1294
889 Ga0501035_0226776 3300049822 Bacteria 1593
890 Ga0501035_0233074 3300049822 Bacteria 1568
891 Ga0501035_0374713 3300049822 Bacteria 1188
892 Ga0501044_0181917 3300049823 Bacteria 2068
893 Ga0501044_0378228 3300049823 Bacteria 1331
894 Ga0501045_0022982 3300049824 Bacteria 4468
895 Ga0501045_0030175 3300049824 Bacteria 3923
896 Ga0501045_0039769 3300049824 Bacteria 3422
897 Ga0501045_0138439 3300049824 Bacteria 1810
898 Ga0501045_0155953 3300049824 Bacteria 1699
899 Ga0501045_0518563 3300049824 Bacteria 885
900 nmdc:mga00v17_62994_c1 3300050491 Bacteria 2283
901 nmdc:mga0yw44_74322_c1 3300050492 Bacteria 2117
902 nmdc:mga05p37_123417_c1 3300050507 Bacteria 3181
903 nmdc:mga05p37_1328_c1 3300050507 Bacteria 28757
904 nmdc:mga05p37_4688_c1 3300050507 Bacteria 15972
905 nmdc:mga05p37_7379_c1 3300050507 Bacteria 12968
906 nmdc:mga05p37_845639_c1 3300050507 Bacteria 995
907 nmdc:mga09592_122501_c1 3300050508 Bacteria 2234
908 nmdc:mga09592_30_c2 3300050508 Bacteria 42688
909 nmdc:mga09592_583_c1 3300050508 Bacteria 27626
910 nmdc:mga09592_8037_c1 3300050508 Bacteria 8579
911 nmdc:mga0qj67_183351_c1 3300050509 Bacteria 1700
912 nmdc:mga0qj67_1_c2 3300050509 Bacteria 129768
913 nmdc:mga0qj67_223_c1 3300050509 Bacteria 38690
914 nmdc:mga0qj67_49588_c1 3300050509 Bacteria 3318
915 nmdc:mga06r32_142077_c1 3300050510 Bacteria 2377
916 nmdc:mga06r32_1579_c1 3300050510 Bacteria 20534
917 nmdc:mga06r32_263_c5 3300050510 Bacteria 13218
918 nmdc:mga06r32_30416_c1 3300050510 Bacteria 5066
919 nmdc:mga06r32_34_c2 3300050510 Bacteria 56571
920 nmdc:mga06r32_402783_c1 3300050510 Bacteria 1350
921 nmdc:mga06r32_5723_c1 3300050510 Bacteria 11194
922 nmdc:mga08y16_931422_c1 3300050511 Bacteria 853
923 nmdc:mga0n895_155986_c1 3300050512 Bacteria 2313
924 nmdc:mga08x19_148050_c1 3300050514 Bacteria 1589
925 nmdc:mga08x19_277246_c1 3300050514 Bacteria 1161
926 nmdc:mga08x19_46012_c1 3300050514 Bacteria 2790
927 nmdc:mga0a205_175159_c1 3300050515 Bacteria 2041
928 nmdc:mga0a205_67448_c1 3300050515 Bacteria 3457
929 nmdc:mga0a205_76505_c1 3300050515 Bacteria 3234
930 Ga0495601_0001268 3300053077 Bacteria 13834
931 Ga0495601_0014999 3300053077 Bacteria 4680
932 Ga0495601_0027000 3300053077 Bacteria 3548
933 Ga0495601_0072017 3300053077 Bacteria 2207
934 Ga0495601_0156035 3300053077 Bacteria 1490
935 Ga0495612_0011735 3300053078 Bacteria 3531
936 Ga0495612_0018995 3300053078 Bacteria 2751
937 Ga0495655_0053454 3300053083 Bacteria 1077
938 Ga0495655_0062623 3300053083 Bacteria 1019
939 Ga0495595_0003474 3300053084 Bacteria 6257
940 Ga0495595_0012738 3300053084 Bacteria 3542
941 Ga0495595_0023439 3300053084 Bacteria 2717
942 Ga0495619_0010437 3300053085 Bacteria 5845
943 Ga0495619_0050201 3300053085 Bacteria 2753
944 Ga0495619_0058001 3300053085 Bacteria 2569
945 Ga0500578_0012829 3300053086 Bacteria 5407
946 Ga0500644_0009800 3300053088 Bacteria 2574
947 Ga0500646_0019284 3300053090 Bacteria 1804
948 Ga0500654_046647 3300053099 Bacteria 2387
949 Ga0500569_008053 3300053109 Bacteria 2395
950 Ga0500614_015709 3300053123 Bacteria 1690
951 Ga0500621_032779 3300053126 Bacteria 2071
952 Ga0500652_003585 3300053131 Bacteria 4712
953 Ga0500658_0016919 3300053134 Bacteria 2719
954 Ga0500559_0007533 3300053136 Bacteria 4816
955 Ga0500561_0002620 3300053137 Bacteria 3046
956 Ga0500573_0016388 3300053140 Bacteria 4207
957 Ga0500577_0116361 3300053142 Bacteria 1108
958 Ga0500600_0012729 3300053149 Bacteria 5107
959 Ga0500603_034744 3300053150 Bacteria 1319
960 Ga0500616_0103025 3300053153 Bacteria 1391
961 Ga0500633_0000265 3300053160 Bacteria 7634
962 Ga0500634_0004205 3300053161 Bacteria 6606
963 Ga0500656_003629 3300053732 Bacteria 1453
964 Ga0500587_000082 3300053739 Bacteria 8076
965 Ga0501084_0011699 3300054114 Bacteria 7264
966 Ga0501084_0081969 3300054114 Bacteria 2706
967 Ga0501084_0085914 3300054114 Bacteria 2641
968 Ga0501082_0030856 3300060353 Bacteria 4620
969 Ga0466962_0000748 3300061719 Bacteria 14566
970 Ga0466962_0023613 3300061719 Bacteria 2955
971 Ga0466962_0032289 3300061719 Bacteria 2506
972 Ga0466962_0150991 3300061719 Bacteria 1127
973 Ga0530510_0008024 3300061734 Bacteria 7364
974 Ga0530510_0128825 3300061734 Bacteria 1861

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0291208 Ga0373947_0291208_342_1076 238
2 3300005435 Ga0070714_100037854 Ga0070714_1000378542 251
3 3300025939 Ga0207665_10013943 Ga0207665_100139434 251
4 3300046516 Ga0495628_0402929 Ga0495628_0402929_46_822 256
5 3300049591 Ga0501075_0555235 Ga0501075_0555235_86_856 256
6 3300044694 Ga0466963_0140822 Ga0466963_0140822_822_1613 257
7 3300050511 nmdc:mga08y16_931422_c1 nmdc:mga08y16_931422_c1_67_843 257
8 3300049824 Ga0501045_0518563 Ga0501045_0518563_23_823 264
9 3300035113 Ga0373936_0004294 Ga0373936_0004294_220_1101 270
10 3300035117 Ga0373953_0015221 Ga0373953_0015221_983_1864 270
11 3300035118 Ga0373954_0065264 Ga0373954_0065264_481_1362 270
12 3300035119 Ga0373956_0040603 Ga0373956_0040603_695_1576 270
13 3300035120 Ga0373957_0002490 Ga0373957_0002490_1066_1947 270
14 3300035172 Ga0373955_0053354 Ga0373955_0053354_966_1847 270
15 3300035410 Ga0373924_0009943 Ga0373924_0009943_1628_2509 270
16 3300035692 Ga0373935_0013995 Ga0373935_0013995_983_1864 270
17 3300035724 Ga0373933_0045281 Ga0373933_0045281_489_1370 270
18 3300035725 Ga0373947_0016297 Ga0373947_0016297_543_1424 270
19 3300036401 Ga0373937_0033154 Ga0373937_0033154_3327_4208 270
20 3300046454 Ga0495592_0013978 Ga0495592_0013978_1545_2426 270
21 3300046461 Ga0495641_0005969 Ga0495641_0005969_192_1073 270
22 3300046462 Ga0495651_0146117 Ga0495651_0146117_489_1370 270
23 3300046463 Ga0495653_0085186 Ga0495653_0085186_341_1222 270
24 3300046476 Ga0495662_0008311 Ga0495662_0008311_804_1685 270
25 3300046477 Ga0495664_0001695 Ga0495664_0001695_8629_9510 270
26 3300046511 Ga0495608_0026966 Ga0495608_0026966_2543_3424 270
27 3300046516 Ga0495628_0070586 Ga0495628_0070586_1104_1985 270
28 3300046517 Ga0495630_0093672 Ga0495630_0093672_1245_2126 270
29 3300046529 Ga0495652_0012613 Ga0495652_0012613_4979_5860 270
30 3300046531 Ga0495665_0000841 Ga0495665_0000841_2681_3562 270
31 3300046533 Ga0495640_0007423 Ga0495640_0007423_4760_5641 270
32 3300046535 Ga0495586_0059581 Ga0495586_0059581_379_1260 270
33 3300046536 Ga0495587_0007080 Ga0495587_0007080_1544_2425 270
34 3300046543 Ga0495645_0043653 Ga0495645_0043653_1414_2295 270
35 3300046642 Ga0495634_0020934 Ga0495634_0020934_2644_3525 270
36 3300046675 Ga0495657_0008842 Ga0495657_0008842_1811_2692 270
37 3300046678 Ga0495599_0008444 Ga0495599_0008444_66_947 270
38 3300046683 Ga0495658_0009574 Ga0495658_0009574_2045_2926 270
39 3300046690 Ga0495624_0075676 Ga0495624_0075676_722_1603 270
40 3300047315 Ga0495581_0003301 Ga0495581_0003301_6962_7843 270
41 3300047317 Ga0495604_0087252 Ga0495604_0087252_1104_1985 270
42 3300047319 Ga0495674_0062397 Ga0495674_0062397_1245_2126 270
43 3300047322 Ga0495680_0091405 Ga0495680_0091405_482_1363 270
44 3300047444 Ga0495675_0003295 Ga0495675_0003295_4248_5129 270
45 3300047471 Ga0495684_0209143 Ga0495684_0209143_66_947 270
46 3300047673 Ga0495593_0004457 Ga0495593_0004457_6924_7805 270
47 3300053085 Ga0495619_0010437 Ga0495619_0010437_589_1470 270
48 3300046615 Ga0495656_0038922 Ga0495656_0038922_405_1277 271
49 3300005435 Ga0070714_100007770 Ga0070714_1000077701 272
50 3300005436 Ga0070713_100155893 Ga0070713_1001558933 272
51 3300009094 Ga0111539_10078454 Ga0111539_100784543 272
52 3300025928 Ga0207700_10005407 Ga0207700_100054075 272
53 3300025929 Ga0207664_10040219 Ga0207664_100402193 272
54 3300035117 Ga0373953_0053827 Ga0373953_0053827_331_1365 272
55 3300035172 Ga0373955_0018959 Ga0373955_0018959_2099_3133 272
56 3300035724 Ga0373933_0034210 Ga0373933_0034210_1225_2259 272
57 3300036401 Ga0373937_0007973 Ga0373937_0007973_4330_5364 272
58 3300046463 Ga0495653_0031568 Ga0495653_0031568_2644_3678 272
59 3300046559 Ga0495667_0013427 Ga0495667_0013427_4432_5466 272
60 3300047317 Ga0495604_0038784 Ga0495604_0038784_887_1768 272
61 3300047471 Ga0495684_0156602 Ga0495684_0156602_171_1205 272
62 3300050514 nmdc:mga08x19_148050_c1 nmdc:mga08x19_148050_c1_626_1507 272
63 3300005355 Ga0070671_100003560 Ga0070671_1000035609 273
64 3300005841 Ga0068863_100164044 Ga0068863_1001640442 273
65 3300025931 Ga0207644_10004903 Ga0207644_100049036 273
66 3300026088 Ga0207641_10043512 Ga0207641_100435123 273
67 3300028381 Ga0268264_10007538 Ga0268264_100075386 273
68 3300005467 Ga0070706_100144438 Ga0070706_1001444382 274
69 3300005536 Ga0070697_100000004 Ga0070697_100000004276 274
70 3300005548 Ga0070665_100009447 Ga0070665_1000094472 274
71 3300028379 Ga0268266_10005053 Ga0268266_1000505310 274
72 3300044658 Ga0466972_0004598 Ga0466972_0004598_3804_4685 274
73 3300044683 Ga0466965_0000947 Ga0466965_0000947_5865_6746 274
74 3300044693 Ga0466961_0237177 Ga0466961_0237177_156_1040 274
75 3300044765 Ga0466970_0004353 Ga0466970_0004353_1297_2178 274
76 3300044842 Ga0466957_0038565 Ga0466957_0038565_650_1531 274
77 3300044901 Ga0466960_0014072 Ga0466960_0014072_578_1459 274
78 3300006844 Ga0075428_100001352 Ga0075428_10000135212 276
79 3300006846 Ga0075430_100000841 Ga0075430_10000084111 276
80 3300006847 Ga0075431_100001081 Ga0075431_10000108113 276
81 3300006880 Ga0075429_100000965 Ga0075429_10000096512 276
82 3300009147 Ga0114129_10000058 Ga0114129_1000005823 276
83 3300050507 nmdc:mga05p37_1328_c1 nmdc:mga05p37_1328_c1_12265_13131 276
84 3300050508 nmdc:mga09592_30_c2 nmdc:mga09592_30_c2_32134_33000 276
85 3300050509 nmdc:mga0qj67_1_c2 nmdc:mga0qj67_1_c2_32283_33149 276
86 3300050510 nmdc:mga06r32_34_c2 nmdc:mga06r32_34_c2_32283_33149 276
87 iso_pu_bacteria 2899370129 2899373272 276
88 3300021388 Ga0213875_10000478 Ga0213875_1000047826 277
89 3300037853 Ga0436364_0383821 Ga0436364_0383821_236_1150 277
90 3300037853 Ga0436364_0771738 Ga0436364_0771738_28672_29550 277
91 iso_pu_bacteria 2791354901 2791911583 277
92 iso_pu_bacteria 2887478801 2887483427 277
93 iso_pu_bacteria 2895427314 2895438051 277
94 3300005985 Ga0081539_10000031 Ga0081539_1000003147 278
95 3300049575 Ga0501039_0151585 Ga0501039_0151585_906_1742 278
96 3300049577 Ga0501041_0198609 Ga0501041_0198609_67_903 278
97 3300049578 Ga0501042_0045520 Ga0501042_0045520_1940_2776 278
98 3300049587 Ga0501071_0092974 Ga0501071_0092974_109_945 278
99 3300049741 Ga0501079_0042074 Ga0501079_0042074_1219_2055 278
100 3300049743 Ga0501081_0250121 Ga0501081_0250121_340_1176 278
101 3300050510 nmdc:mga06r32_263_c5 nmdc:mga06r32_263_c5_6117_7046 278
102 3300054114 Ga0501084_0081969 Ga0501084_0081969_328_1164 278
103 iso_pu_bacteria 2738543034 2739363871 278
104 iso_pu_bacteria 2904770941 2904771926 278
105 iso_pu_bacteria 2974315732 2974317222 278
106 iso_pu_bacteria 2984523437 2984525428 278
107 3300026095 Ga0207676_10359496 Ga0207676_103594962 279
108 3300053088 Ga0500644_0009800 Ga0500644_0009800_222_1064 279
109 3300053142 Ga0500577_0116361 Ga0500577_0116361_46_888 279
110 iso_pu_bacteria 2551306166 2552112696 279
111 iso_pu_bacteria 3002998708 3002999734 279
112 3300005435 Ga0070714_100000261 Ga0070714_10000026132 280
113 3300005471 Ga0070698_100002617 Ga0070698_1000026174 280
114 3300025929 Ga0207664_10001442 Ga0207664_100014426 280
115 3300033179 Ga0307507_10035050 Ga0307507_100350502 280
116 3300049568 Ga0501031_0051483 Ga0501031_0051483_1792_2634 280
117 3300049571 Ga0501034_0001939 Ga0501034_0001939_2469_3350 280
118 3300049572 Ga0501036_0091441 Ga0501036_0091441_263_1144 280
119 3300049572 Ga0501036_0139400 Ga0501036_0139400_585_1427 280
120 3300049573 Ga0501037_0069864 Ga0501037_0069864_93_974 280
121 3300049574 Ga0501038_0007410 Ga0501038_0007410_6156_7037 280
122 3300049575 Ga0501039_0069388 Ga0501039_0069388_665_1507 280
123 3300049576 Ga0501040_0012124 Ga0501040_0012124_417_1259 280
124 3300049577 Ga0501041_0011862 Ga0501041_0011862_2090_2932 280
125 3300049578 Ga0501042_0006044 Ga0501042_0006044_5246_6127 280
126 3300049579 Ga0501043_0001474 Ga0501043_0001474_5079_5960 280
127 3300049581 Ga0501047_0001834 Ga0501047_0001834_4138_5019 280
128 3300049582 Ga0501048_0002840 Ga0501048_0002840_5836_6717 280
129 3300049582 Ga0501048_0107090 Ga0501048_0107090_484_1326 280
130 3300049587 Ga0501071_0073222 Ga0501071_0073222_500_1342 280
131 3300049588 Ga0501072_0043733 Ga0501072_0043733_1844_2686 280
132 3300049590 Ga0501074_0007659 Ga0501074_0007659_4685_5566 280
133 3300049590 Ga0501074_0101347 Ga0501074_0101347_512_1354 280
134 3300049592 Ga0501076_0045545 Ga0501076_0045545_531_1373 280
135 3300049593 Ga0501077_0017748 Ga0501077_0017748_2914_3756 280
136 3300049741 Ga0501079_0041476 Ga0501079_0041476_2125_2967 280
137 3300049822 Ga0501035_0374713 Ga0501035_0374713_233_1075 280
138 3300049824 Ga0501045_0039769 Ga0501045_0039769_2117_2959 280
139 3300054114 Ga0501084_0011699 Ga0501084_0011699_4741_5583 280
140 3300060353 Ga0501082_0030856 Ga0501082_0030856_1596_2438 280
141 3300061734 Ga0530510_0008024 Ga0530510_0008024_1305_2147 280
142 iso_pu_bacteria 2585427649 2586059268 280
143 iso_pu_bacteria 2622736626 2623589900 280
144 iso_pu_bacteria 2795385470 2795783127 280
145 iso_pu_bacteria 2808606522 2809591972 280
146 iso_pu_bacteria 2863067949 2863068703 280
147 iso_pu_bacteria 2866612099 2866616824 280
148 iso_pu_bacteria 2915768154 2915773990 280
149 iso_pu_bacteria 2997451912 2997459333 280
150 iso_pu_bacteria 8003314358 8003321503 280
151 iso_pu_bacteria 8047710418 8047718728 280
152 iso_pu_bacteria 8055066027 8055067287 280
153 iso_pu_bacteria 8055172936 8055179450 280
154 iso_pu_bacteria 8056207758 8056212896 280
155 3300005329 Ga0070683_100205342 Ga0070683_1002053422 281
156 3300005354 Ga0070675_100325709 Ga0070675_1003257091 281
157 3300005459 Ga0068867_100165209 Ga0068867_1001652092 281
158 3300005468 Ga0070707_100016035 Ga0070707_1000160355 281
159 3300005471 Ga0070698_100050377 Ga0070698_1000503775 281
160 3300005518 Ga0070699_100076977 Ga0070699_1000769772 281
161 3300005536 Ga0070697_100221329 Ga0070697_1002213291 281
162 3300005548 Ga0070665_100400326 Ga0070665_1004003262 281
163 3300005564 Ga0070664_100178493 Ga0070664_1001784933 281
164 3300005615 Ga0070702_100106183 Ga0070702_1001061832 281
165 3300005985 Ga0081539_10000125 Ga0081539_10000125132 281
166 3300006880 Ga0075429_100231364 Ga0075429_1002313642 281
167 3300006881 Ga0068865_100297947 Ga0068865_1002979472 281
168 3300007076 Ga0075435_100167264 Ga0075435_1001672642 281
169 3300025898 Ga0207692_10004546 Ga0207692_100045467 281
170 3300025922 Ga0207646_10000127 Ga0207646_1000012774 281
171 3300025926 Ga0207659_10297901 Ga0207659_102979012 281
172 3300025928 Ga0207700_10050721 Ga0207700_100507212 281
173 3300025945 Ga0207679_10117532 Ga0207679_101175323 281
174 3300025972 Ga0207668_10112720 Ga0207668_101127202 281
175 3300028794 Ga0307515_10055673 Ga0307515_100556734 281
176 3300030522 Ga0307512_10029546 Ga0307512_100295462 281
177 3300030732 Ga0316176_1098424 Ga0316176_10984243 281
178 3300031995 Ga0307409_100462483 Ga0307409_1004624832 281
179 3300042012 Ga0439455_0015758 Ga0439455_0015758_636_1493 281
180 3300044658 Ga0466972_0042721 Ga0466972_0042721_1053_1913 281
181 3300044683 Ga0466965_0002500 Ga0466965_0002500_3988_4848 281
182 3300044735 Ga0466968_0012689 Ga0466968_0012689_1638_2498 281
183 3300044901 Ga0466960_0000646 Ga0466960_0000646_1457_2317 281
184 3300046616 Ga0495668_0000632 Ga0495668_0000632_4674_5525 281
185 3300046660 Ga0495625_0000797 Ga0495625_0000797_38111_38962 281
186 3300047323 Ga0495683_0029464 Ga0495683_0029464_1850_2701 281
187 3300048091 Ga0495626_0000581 Ga0495626_0000581_4693_5544 281
188 3300050508 nmdc:mga09592_122501_c1 nmdc:mga09592_122501_c1_1187_2053 281
189 iso_pu_bacteria 2802429296 2804848734 281
190 iso_pu_bacteria 8025413630 8025417980 281
191 iso_pu_bacteria 8056447290 8056447295 281
192 iso_pu_bacteria 8056667051 8056667145 281
193 3300005455 Ga0070663_100004631 Ga0070663_1000046316 282
194 3300005617 Ga0068859_100026922 Ga0068859_1000269223 282
195 3300006844 Ga0075428_100228842 Ga0075428_1002288422 282
196 3300006847 Ga0075431_100324049 Ga0075431_1003240491 282
197 3300006931 Ga0097620_100026922 Ga0097620_1000269223 282
198 3300009147 Ga0114129_10169762 Ga0114129_101697621 282
199 3300026067 Ga0207678_10000168 Ga0207678_100001686 282
200 3300031824 Ga0307413_10271870 Ga0307413_102718702 282
201 3300044706 Ga0466964_0115185 Ga0466964_0115185_310_1170 282
202 3300044719 Ga0466971_0009808 Ga0466971_0009808_2596_3465 282
203 3300045976 Ga0466967_0078227 Ga0466967_0078227_1525_2373 282
204 3300045976 Ga0466967_0090629 Ga0466967_0090629_1781_2641 282
205 3300049581 Ga0501047_0079764 Ga0501047_0079764_866_1738 282
206 3300050491 nmdc:mga00v17_62994_c1 nmdc:mga00v17_62994_c1_1156_2022 282
207 3300050507 nmdc:mga05p37_123417_c1 nmdc:mga05p37_123417_c1_506_1369 282
208 3300050510 nmdc:mga06r32_402783_c1 nmdc:mga06r32_402783_c1_84_941 282
209 iso_pu_bacteria 2751185734 2753073625 282
210 iso_pu_bacteria 2862178590 2862182465 282
211 iso_pu_bacteria 2862382967 2862386444 282
212 iso_pu_bacteria 2863404153 2863409505 282
213 iso_pu_bacteria 2867475112 2867479776 282
214 iso_pu_bacteria 2870721527 2870725570 282
215 iso_pu_bacteria 2870782633 2870789073 282
216 iso_pu_bacteria 2912723979 2912729388 282
217 iso_pu_bacteria 2912757875 2912763748 282
218 iso_pu_bacteria 2917736166 2917738750 282
219 iso_pu_bacteria 2935390628 2935391243 282
220 iso_pu_bacteria 2954002825 2954010175 282
221 iso_pu_bacteria 2954711539 2954713471 282
222 iso_pu_bacteria 2954749733 2954757255 282
223 iso_pu_bacteria 2990059506 2990067849 282
224 iso_pu_bacteria 2990088156 2990089669 282
225 iso_pu_bacteria 3006486233 3006487579 282
226 iso_pu_bacteria 8008558824 8008563777 282
227 iso_pu_bacteria 8008574985 8008576392 282
228 iso_pu_bacteria 8023623736 8023624116 282
229 iso_pu_bacteria 8054160619 8054163033 282
230 3300005468 Ga0070707_100091365 Ga0070707_1000913653 283
231 3300005577 Ga0068857_100189294 Ga0068857_1001892942 283
232 3300005614 Ga0068856_100293476 Ga0068856_1002934762 283
233 3300006846 Ga0075430_100001655 Ga0075430_10000165512 283
234 3300025905 Ga0207685_10103183 Ga0207685_101031832 283
235 3300028558 Ga0265326_10002290 Ga0265326_100022904 283
236 3300028563 Ga0265319_1001647 Ga0265319_10016478 283
237 3300028573 Ga0265334_10031727 Ga0265334_100317272 283
238 3300028573 Ga0265334_10053025 Ga0265334_100530252 283
239 3300028577 Ga0265318_10000251 Ga0265318_1000025139 283
240 3300028653 Ga0265323_10085974 Ga0265323_100859742 283
241 3300028654 Ga0265322_10001581 Ga0265322_100015814 283
242 3300028666 Ga0265336_10050538 Ga0265336_100505382 283
243 3300028800 Ga0265338_10003462 Ga0265338_1000346219 283
244 3300028800 Ga0265338_10022191 Ga0265338_100221914 283
245 3300031235 Ga0265330_10000873 Ga0265330_100008733 283
246 3300031239 Ga0265328_10016149 Ga0265328_100161493 283
247 3300031240 Ga0265320_10020167 Ga0265320_100201673 283
248 3300031241 Ga0265325_10000549 Ga0265325_1000054915 283
249 3300031242 Ga0265329_10007314 Ga0265329_100073142 283
250 3300031249 Ga0265339_10001224 Ga0265339_100012243 283
251 3300031249 Ga0265339_10048399 Ga0265339_100483992 283
252 3300031250 Ga0265331_10002901 Ga0265331_100029012 283
253 3300031251 Ga0265327_10007522 Ga0265327_100075222 283
254 3300031344 Ga0265316_10059650 Ga0265316_100596502 283
255 3300031595 Ga0265313_10001573 Ga0265313_1000157312 283
256 3300031711 Ga0265314_10003084 Ga0265314_100030843 283
257 3300031711 Ga0265314_10223998 Ga0265314_102239982 283
258 3300031712 Ga0265342_10050564 Ga0265342_100505643 283
259 3300031731 Ga0307405_10005187 Ga0307405_100051875 283
260 3300031824 Ga0307413_10060041 Ga0307413_100600412 283
261 3300031852 Ga0307410_10488949 Ga0307410_104889491 283
262 3300031901 Ga0307406_10062946 Ga0307406_100629463 283
263 3300031901 Ga0307406_10188219 Ga0307406_101882192 283
264 3300031903 Ga0307407_10016313 Ga0307407_100163133 283
265 3300031911 Ga0307412_10031488 Ga0307412_100314883 283
266 3300031995 Ga0307409_100000071 Ga0307409_1000000713 283
267 3300031995 Ga0307409_100024549 Ga0307409_1000245494 283
268 3300032002 Ga0307416_100001030 Ga0307416_1000010304 283
269 3300032002 Ga0307416_100505111 Ga0307416_1005051112 283
270 3300032005 Ga0307411_10222463 Ga0307411_102224632 283
271 3300032005 Ga0307411_10291205 Ga0307411_102912052 283
272 3300032126 Ga0307415_100000029 Ga0307415_10000002919 283
273 3300033179 Ga0307507_10041429 Ga0307507_100414295 283
274 3300033179 Ga0307507_10060094 Ga0307507_100600942 283
275 3300035172 Ga0373955_0110222 Ga0373955_0110222_433_1290 283
276 3300038443 Ga0395901_0114765 Ga0395901_0114765_912_1775 283
277 3300044693 Ga0466961_0079663 Ga0466961_0079663_214_1071 283
278 3300044694 Ga0466963_0022444 Ga0466963_0022444_2221_3078 283
279 3300044694 Ga0466963_0165563 Ga0466963_0165563_479_1342 283
280 3300044842 Ga0466957_0033625 Ga0466957_0033625_1831_2688 283
281 3300045836 Ga0466958_0048578 Ga0466958_0048578_1422_2279 283
282 3300045976 Ga0466967_0007908 Ga0466967_0007908_4006_4869 283
283 3300045976 Ga0466967_0161671 Ga0466967_0161671_1100_1963 283
284 3300045976 Ga0466967_0403108 Ga0466967_0403108_393_1247 283
285 3300046511 Ga0495608_0013648 Ga0495608_0013648_1253_2110 283
286 3300046533 Ga0495640_0229997 Ga0495640_0229997_79_948 283
287 3300046559 Ga0495667_0016983 Ga0495667_0016983_2739_3596 283
288 3300046663 Ga0495635_0169439 Ga0495635_0169439_196_1053 283
289 3300046675 Ga0495657_0179996 Ga0495657_0179996_289_1146 283
290 3300047317 Ga0495604_0232316 Ga0495604_0232316_273_1142 283
291 3300047322 Ga0495680_0034597 Ga0495680_0034597_491_1348 283
292 3300047471 Ga0495684_0032859 Ga0495684_0032859_1961_2818 283
293 3300047471 Ga0495684_0350267 Ga0495684_0350267_32_889 283
294 3300048905 Ga0496102_0548913 Ga0496102_0548913_162_1025 283
295 3300048909 Ga0496106_0200629 Ga0496106_0200629_248_1111 283
296 3300048910 Ga0496107_0070168 Ga0496107_0070168_1574_2437 283
297 3300048914 Ga0496111_0041212 Ga0496111_0041212_361_1224 283
298 3300048916 Ga0496113_0283687 Ga0496113_0283687_267_1130 283
299 3300049587 Ga0501071_0110459 Ga0501071_0110459_736_1599 283
300 3300049592 Ga0501076_0416498 Ga0501076_0416498_85_948 283
301 3300049741 Ga0501079_0267014 Ga0501079_0267014_459_1322 283
302 3300049824 Ga0501045_0030175 Ga0501045_0030175_2046_2909 283
303 3300050509 nmdc:mga0qj67_183351_c1 nmdc:mga0qj67_183351_c1_76_936 283
304 3300050509 nmdc:mga0qj67_223_c1 nmdc:mga0qj67_223_c1_12529_13422 283
305 3300053085 Ga0495619_0058001 Ga0495619_0058001_1431_2288 283
306 3300061719 Ga0466962_0023613 Ga0466962_0023613_1317_2174 283
307 iso_pu_bacteria 2643221601 2644019577 283
308 iso_pu_bacteria 2643221631 2644180536 283
309 iso_pu_bacteria 2816332119 2816427621 283
310 iso_pu_bacteria 8053945823 8053946589 283
311 3300003354 JGI25160J50197_1030646 JGI25160J50197_10306462 284
312 3300005327 Ga0070658_10018471 Ga0070658_100184714 284
313 3300005329 Ga0070683_100000230 Ga0070683_1000002306 284
314 3300005337 Ga0070682_100041825 Ga0070682_1000418253 284
315 3300005339 Ga0070660_100076325 Ga0070660_1000763253 284
316 3300005345 Ga0070692_10060720 Ga0070692_100607202 284
317 3300005347 Ga0070668_100006848 Ga0070668_1000068485 284
318 3300005347 Ga0070668_100189248 Ga0070668_1001892482 284
319 3300005366 Ga0070659_100543496 Ga0070659_1005434961 284
320 3300005445 Ga0070708_100055695 Ga0070708_1000556952 284
321 3300005445 Ga0070708_100119080 Ga0070708_1001190803 284
322 3300005455 Ga0070663_100000835 Ga0070663_1000008353 284
323 3300005518 Ga0070699_100014146 Ga0070699_1000141463 284
324 3300005535 Ga0070684_100027942 Ga0070684_1000279424 284
325 3300005548 Ga0070665_100177174 Ga0070665_1001771743 284
326 3300005563 Ga0068855_100003228 Ga0068855_10000322816 284
327 3300005563 Ga0068855_100074762 Ga0068855_1000747625 284
328 3300005577 Ga0068857_100003813 Ga0068857_1000038135 284
329 3300005577 Ga0068857_100205778 Ga0068857_1002057782 284
330 3300005578 Ga0068854_100004870 Ga0068854_1000048703 284
331 3300005614 Ga0068856_100050407 Ga0068856_1000504072 284
332 3300005614 Ga0068856_100053183 Ga0068856_1000531832 284
333 3300005616 Ga0068852_100013251 Ga0068852_1000132516 284
334 3300005616 Ga0068852_100032189 Ga0068852_1000321895 284
335 3300005718 Ga0068866_10086795 Ga0068866_100867952 284
336 3300005842 Ga0068858_100014268 Ga0068858_1000142685 284
337 3300005843 Ga0068860_100091443 Ga0068860_1000914434 284
338 3300005937 Ga0081455_10000011 Ga0081455_10000011155 284
339 3300005983 Ga0081540_1035454 Ga0081540_10354544 284
340 3300006358 Ga0068871_100058876 Ga0068871_1000588762 284
341 3300006846 Ga0075430_100195235 Ga0075430_1001952352 284
342 3300006847 Ga0075431_100141635 Ga0075431_1001416353 284
343 3300006881 Ga0068865_100060094 Ga0068865_1000600942 284
344 3300006914 Ga0075436_100066555 Ga0075436_1000665553 284
345 3300009093 Ga0105240_10018527 Ga0105240_100185275 284
346 3300009098 Ga0105245_10056611 Ga0105245_100566113 284
347 3300009174 Ga0105241_10027630 Ga0105241_100276304 284
348 3300009176 Ga0105242_10366346 Ga0105242_103663462 284
349 3300009545 Ga0105237_10008954 Ga0105237_100089547 284
350 3300009551 Ga0105238_10019534 Ga0105238_100195344 284
351 3300009551 Ga0105238_10267385 Ga0105238_102673852 284
352 3300010375 Ga0105239_10094560 Ga0105239_100945602 284
353 3300010375 Ga0105239_10205977 Ga0105239_102059772 284
354 3300011119 Ga0105246_10002872 Ga0105246_1000287210 284
355 3300013105 Ga0157369_10036202 Ga0157369_100362021 284
356 3300013306 Ga0163162_10066253 Ga0163162_100662533 284
357 3300013307 Ga0157372_10001996 Ga0157372_1000199617 284
358 3300013308 Ga0157375_10053521 Ga0157375_100535212 284
359 3300014968 Ga0157379_10046583 Ga0157379_100465835 284
360 3300020082 Ga0206353_10382620 Ga0206353_103826201 284
361 3300021388 Ga0213875_10048149 Ga0213875_100481492 284
362 3300025302 Ga0207426_1000499 Ga0207426_100049923 284
363 3300025302 Ga0207426_1007355 Ga0207426_10073552 284
364 3300025904 Ga0207647_10030164 Ga0207647_100301642 284
365 3300025913 Ga0207695_10003301 Ga0207695_1000330116 284
366 3300025914 Ga0207671_10000530 Ga0207671_1000053045 284
367 3300025919 Ga0207657_10044330 Ga0207657_100443305 284
368 3300025922 Ga0207646_10002637 Ga0207646_1000263715 284
369 3300025922 Ga0207646_10004843 Ga0207646_100048435 284
370 3300025924 Ga0207694_10009232 Ga0207694_100092325 284
371 3300025927 Ga0207687_10018827 Ga0207687_100188273 284
372 3300025929 Ga0207664_10518450 Ga0207664_105184501 284
373 3300025934 Ga0207686_10243978 Ga0207686_102439782 284
374 3300025944 Ga0207661_10002423 Ga0207661_100024237 284
375 3300025949 Ga0207667_10021913 Ga0207667_100219132 284
376 3300025949 Ga0207667_10106607 Ga0207667_101066073 284
377 3300025981 Ga0207640_10024260 Ga0207640_100242605 284
378 3300026067 Ga0207678_10006715 Ga0207678_100067158 284
379 3300026078 Ga0207702_10027777 Ga0207702_100277774 284
380 3300026078 Ga0207702_10079375 Ga0207702_100793752 284
381 3300026116 Ga0207674_10015760 Ga0207674_100157605 284
382 3300026116 Ga0207674_10229391 Ga0207674_102293912 284
383 3300026121 Ga0207683_10072497 Ga0207683_100724973 284
384 3300026121 Ga0207683_10371623 Ga0207683_103716231 284
385 3300026142 Ga0207698_10074845 Ga0207698_100748453 284
386 3300028379 Ga0268266_10163626 Ga0268266_101636262 284
387 3300028786 Ga0307517_10149923 Ga0307517_101499232 284
388 3300028794 Ga0307515_10058294 Ga0307515_100582943 284
389 3300031731 Ga0307405_10145531 Ga0307405_101455312 284
390 3300031731 Ga0307405_10503374 Ga0307405_105033741 284
391 3300031824 Ga0307413_10190450 Ga0307413_101904502 284
392 3300031838 Ga0307518_10000753 Ga0307518_1000075325 284
393 3300031911 Ga0307412_10172566 Ga0307412_101725662 284
394 3300031995 Ga0307409_100102196 Ga0307409_1001021963 284
395 3300031995 Ga0307409_100163008 Ga0307409_1001630082 284
396 3300032002 Ga0307416_100004996 Ga0307416_1000049964 284
397 3300032004 Ga0307414_10201324 Ga0307414_102013242 284
398 3300032126 Ga0307415_100003722 Ga0307415_1000037224 284
399 3300032126 Ga0307415_100234480 Ga0307415_1002344802 284
400 3300033179 Ga0307507_10050953 Ga0307507_100509534 284
401 3300033179 Ga0307507_10141064 Ga0307507_101410643 284
402 3300033180 Ga0307510_10109379 Ga0307510_101093793 284
403 3300037853 Ga0436364_1115153 Ga0436364_1115153_307_1182 284
404 3300038443 Ga0395901_0549672 Ga0395901_0549672_256_1113 284
405 3300044656 Ga0466969_0001519 Ga0466969_0001519_6064_6933 284
406 3300044656 Ga0466969_0011231 Ga0466969_0011231_3075_3947 284
407 3300044658 Ga0466972_0018756 Ga0466972_0018756_567_1436 284
408 3300044684 Ga0466966_0039397 Ga0466966_0039397_2148_3017 284
409 3300044693 Ga0466961_0014213 Ga0466961_0014213_1232_2101 284
410 3300044693 Ga0466961_0075824 Ga0466961_0075824_1077_1949 284
411 3300044719 Ga0466971_0000368 Ga0466971_0000368_3905_4774 284
412 3300044735 Ga0466968_0086609 Ga0466968_0086609_222_1091 284
413 3300044765 Ga0466970_0077750 Ga0466970_0077750_11_883 284
414 3300044765 Ga0466970_0180022 Ga0466970_0180022_137_1006 284
415 3300045049 Ga0466959_0001945 Ga0466959_0001945_10935_11804 284
416 3300045051 Ga0451576_0046870 Ga0451576_0046870_2005_2865 284
417 3300045836 Ga0466958_0008607 Ga0466958_0008607_1114_1983 284
418 3300046462 Ga0495651_0005798 Ga0495651_0005798_5184_6053 284
419 3300046516 Ga0495628_0008742 Ga0495628_0008742_3290_4159 284
420 3300048905 Ga0496102_0091395 Ga0496102_0091395_1053_1913 284
421 3300048906 Ga0496103_0111620 Ga0496103_0111620_852_1712 284
422 3300048909 Ga0496106_0343267 Ga0496106_0343267_219_1079 284
423 3300048910 Ga0496107_0305996 Ga0496107_0305996_273_1133 284
424 3300048912 Ga0496109_0245531 Ga0496109_0245531_213_1073 284
425 3300048913 Ga0496110_0260791 Ga0496110_0260791_646_1506 284
426 3300048914 Ga0496111_0075282 Ga0496111_0075282_403_1263 284
427 3300049824 Ga0501045_0155953 Ga0501045_0155953_648_1508 284
428 3300050509 nmdc:mga0qj67_49588_c1 nmdc:mga0qj67_49588_c1_1743_2609 284
429 3300050510 nmdc:mga06r32_142077_c1 nmdc:mga06r32_142077_c1_869_1741 284
430 3300050514 nmdc:mga08x19_46012_c1 nmdc:mga08x19_46012_c1_718_1578 284
431 3300053077 Ga0495601_0001268 Ga0495601_0001268_9109_9978 284
432 3300053077 Ga0495601_0027000 Ga0495601_0027000_734_1606 284
433 3300053078 Ga0495612_0018995 Ga0495612_0018995_1695_2564 284
434 3300061719 Ga0466962_0000748 Ga0466962_0000748_7772_8641 284
435 iso_pu_bacteria 2558860112 2558913113 284
436 iso_pu_bacteria 2816332139 2816510689 284
437 iso_pu_bacteria 2818991472 2819739210 284
438 iso_pu_bacteria 2866612099 2866617782 284
439 iso_pu_bacteria 2899359706 2899364092 284
440 iso_pu_bacteria 2995463766 2995470976 284
441 3300005445 Ga0070708_100000014 Ga0070708_10000001461 285
442 3300005467 Ga0070706_100000059 Ga0070706_10000005941 285
443 3300005467 Ga0070706_100043893 Ga0070706_1000438933 285
444 3300005468 Ga0070707_100000024 Ga0070707_10000002437 285
445 3300005518 Ga0070699_100000046 Ga0070699_10000004641 285
446 3300005518 Ga0070699_100255795 Ga0070699_1002557951 285
447 3300005549 Ga0070704_100003527 Ga0070704_1000035272 285
448 3300005937 Ga0081455_10010065 Ga0081455_100100657 285
449 3300005981 Ga0081538_10000096 Ga0081538_1000009624 285
450 3300005981 Ga0081538_10000683 Ga0081538_1000068329 285
451 3300005981 Ga0081538_10045506 Ga0081538_100455063 285
452 3300006028 Ga0070717_10406454 Ga0070717_104064542 285
453 3300032002 Ga0307416_100463641 Ga0307416_1004636412 285
454 3300042016 Ga0439463_012907 Ga0439463_012907_38_895 285
455 3300042993 Ga0439440_0019313 Ga0439440_0019313_205_1074 285
456 3300046454 Ga0495592_0162615 Ga0495592_0162615_544_1440 285
457 3300046559 Ga0495667_0024286 Ga0495667_0024286_929_1825 285
458 3300046642 Ga0495634_0013542 Ga0495634_0013542_1742_2638 285
459 3300046675 Ga0495657_0010350 Ga0495657_0010350_3230_4126 285
460 3300049573 Ga0501037_0166246 Ga0501037_0166246_401_1270 285
461 3300049575 Ga0501039_0071197 Ga0501039_0071197_351_1220 285
462 3300049576 Ga0501040_0002194 Ga0501040_0002194_1150_2019 285
463 3300049582 Ga0501048_0176683 Ga0501048_0176683_399_1268 285
464 3300049590 Ga0501074_0041280 Ga0501074_0041280_1355_2224 285
465 3300049592 Ga0501076_0130345 Ga0501076_0130345_195_1064 285
466 3300049741 Ga0501079_0010899 Ga0501079_0010899_3447_4316 285
467 3300049743 Ga0501081_0091440 Ga0501081_0091440_691_1560 285
468 3300049824 Ga0501045_0022982 Ga0501045_0022982_3504_4373 285
469 3300054114 Ga0501084_0085914 Ga0501084_0085914_1172_2041 285
470 3300061734 Ga0530510_0128825 Ga0530510_0128825_388_1257 285
471 3300005329 Ga0070683_100540639 Ga0070683_1005406391 286
472 3300005434 Ga0070709_10017375 Ga0070709_100173753 286
473 3300005435 Ga0070714_100001336 Ga0070714_1000013366 286
474 3300005435 Ga0070714_100159013 Ga0070714_1001590132 286
475 3300005436 Ga0070713_100035365 Ga0070713_1000353653 286
476 3300005436 Ga0070713_100073654 Ga0070713_1000736542 286
477 3300005436 Ga0070713_100310710 Ga0070713_1003107102 286
478 3300005437 Ga0070710_10000854 Ga0070710_1000085413 286
479 3300005439 Ga0070711_100020933 Ga0070711_1000209332 286
480 3300005467 Ga0070706_100007618 Ga0070706_1000076182 286
481 3300005467 Ga0070706_100013918 Ga0070706_1000139183 286
482 3300005468 Ga0070707_100039269 Ga0070707_1000392693 286
483 3300005471 Ga0070698_100040946 Ga0070698_1000409462 286
484 3300005471 Ga0070698_100140713 Ga0070698_1001407131 286
485 3300005536 Ga0070697_100013956 Ga0070697_1000139564 286
486 3300005983 Ga0081540_1001167 Ga0081540_100116723 286
487 3300006028 Ga0070717_10022617 Ga0070717_100226173 286
488 3300006028 Ga0070717_10054698 Ga0070717_100546984 286
489 3300006028 Ga0070717_10064309 Ga0070717_100643092 286
490 3300006038 Ga0075365_10041752 Ga0075365_100417523 286
491 3300006173 Ga0070716_100001061 Ga0070716_1000010614 286
492 3300006175 Ga0070712_100003884 Ga0070712_1000038847 286
493 3300006844 Ga0075428_100081251 Ga0075428_1000812512 286
494 3300006852 Ga0075433_10027137 Ga0075433_100271372 286
495 3300006852 Ga0075433_10045051 Ga0075433_100450512 286
496 3300006871 Ga0075434_100077178 Ga0075434_1000771783 286
497 3300007076 Ga0075435_100083185 Ga0075435_1000831852 286
498 3300009147 Ga0114129_10005485 Ga0114129_1000548512 286
499 3300009177 Ga0105248_10195572 Ga0105248_101955722 286
500 3300013296 Ga0157374_10212197 Ga0157374_102121972 286
501 3300013306 Ga0163162_10214220 Ga0163162_102142202 286
502 3300013308 Ga0157375_10005616 Ga0157375_100056162 286
503 3300014325 Ga0163163_10071420 Ga0163163_100714203 286
504 3300021388 Ga0213875_10009768 Ga0213875_100097685 286
505 3300025898 Ga0207692_10023163 Ga0207692_100231632 286
506 3300025906 Ga0207699_10001508 Ga0207699_100015082 286
507 3300025910 Ga0207684_10002850 Ga0207684_1000285016 286
508 3300025915 Ga0207693_10048025 Ga0207693_100480252 286
509 3300025928 Ga0207700_10014702 Ga0207700_100147022 286
510 3300025929 Ga0207664_10005044 Ga0207664_100050445 286
511 3300025929 Ga0207664_10005696 Ga0207664_100056962 286
512 3300025939 Ga0207665_10003721 Ga0207665_100037212 286
513 3300025940 Ga0207691_10439271 Ga0207691_104392711 286
514 3300025944 Ga0207661_10050929 Ga0207661_100509291 286
515 3300025945 Ga0207679_10431708 Ga0207679_104317081 286
516 3300026142 Ga0207698_10411798 Ga0207698_104117982 286
517 3300028379 Ga0268266_10428405 Ga0268266_104284052 286
518 3300028786 Ga0307517_10003710 Ga0307517_100037104 286
519 3300030521 Ga0307511_10105972 Ga0307511_101059721 286
520 3300030522 Ga0307512_10002471 Ga0307512_100024716 286
521 3300031507 Ga0307509_10163490 Ga0307509_101634903 286
522 3300031616 Ga0307508_10016728 Ga0307508_100167283 286
523 3300031616 Ga0307508_10025972 Ga0307508_100259723 286
524 3300031730 Ga0307516_10039706 Ga0307516_100397064 286
525 3300033180 Ga0307510_10308021 Ga0307510_103080211 286
526 3300035083 Ga0373926_0096018 Ga0373926_0096018_68_949 286
527 3300035086 Ga0373934_0000021 Ga0373934_0000021_5348_6229 286
528 3300035111 Ga0373923_0004679 Ga0373923_0004679_1134_2015 286
529 3300035117 Ga0373953_0000328 Ga0373953_0000328_368_1249 286
530 3300035118 Ga0373954_0000423 Ga0373954_0000423_14506_15387 286
531 3300035119 Ga0373956_0000073 Ga0373956_0000073_5213_6094 286
532 3300035120 Ga0373957_0001129 Ga0373957_0001129_5369_6250 286
533 3300035172 Ga0373955_0000125 Ga0373955_0000125_21170_22051 286
534 3300035410 Ga0373924_0000419 Ga0373924_0000419_6773_7654 286
535 3300035410 Ga0373924_0092327 Ga0373924_0092327_186_1067 286
536 3300035724 Ga0373933_0001491 Ga0373933_0001491_7448_8329 286
537 3300036401 Ga0373937_0000169 Ga0373937_0000169_57339_58220 286
538 3300036401 Ga0373937_0263563 Ga0373937_0263563_399_1280 286
539 3300041406 Ga0439439_0015490 Ga0439439_0015490_634_1524 286
540 3300041411 Ga0439466_0027522 Ga0439466_0027522_594_1484 286
541 3300041512 Ga0451853_0418742 Ga0451853_0418742_5173_6060 286
542 3300041999 Ga0439433_0003783 Ga0439433_0003783_1180_2154 286
543 3300042007 Ga0439449_0000547 Ga0439449_0000547_9658_10548 286
544 3300042007 Ga0439449_0026449 Ga0439449_0026449_600_1472 286
545 3300042131 Ga0450894_000030 Ga0450894_000030_3314_4204 286
546 3300042133 Ga0450896_002861 Ga0450896_002861_842_1732 286
547 3300042184 Ga0450908_018391 Ga0450908_018391_261_1151 286
548 3300045976 Ga0466967_0106994 Ga0466967_0106994_1651_2520 286
549 3300045976 Ga0466967_0346449 Ga0466967_0346449_535_1425 286
550 3300046454 Ga0495592_0000070 Ga0495592_0000070_5376_6257 286
551 3300046455 Ga0495603_0164913 Ga0495603_0164913_201_1088 286
552 3300046457 Ga0495590_0028614 Ga0495590_0028614_639_1526 286
553 3300046459 Ga0495629_0013328 Ga0495629_0013328_1388_2275 286
554 3300046462 Ga0495651_0000042 Ga0495651_0000042_86999_87880 286
555 3300046462 Ga0495651_0038132 Ga0495651_0038132_2700_3596 286
556 3300046463 Ga0495653_0031576 Ga0495653_0031576_1074_1955 286
557 3300046499 Ga0495594_0042224 Ga0495594_0042224_755_1642 286
558 3300046501 Ga0495607_0153336 Ga0495607_0153336_257_1144 286
559 3300046511 Ga0495608_0000054 Ga0495608_0000054_86999_87880 286
560 3300046514 Ga0495618_0029916 Ga0495618_0029916_922_1818 286
561 3300046516 Ga0495628_0001347 Ga0495628_0001347_5351_6232 286
562 3300046516 Ga0495628_0144248 Ga0495628_0144248_667_1548 286
563 3300046519 Ga0495632_0053454 Ga0495632_0053454_868_1755 286
564 3300046522 Ga0495643_0001950 Ga0495643_0001950_13824_14711 286
565 3300046526 Ga0495666_0084350 Ga0495666_0084350_475_1371 286
566 3300046529 Ga0495652_0000119 Ga0495652_0000119_5361_6242 286
567 3300046529 Ga0495652_0127208 Ga0495652_0127208_364_1260 286
568 3300046533 Ga0495640_0023486 Ga0495640_0023486_1403_2299 286
569 3300046536 Ga0495587_0000374 Ga0495587_0000374_27043_27924 286
570 3300046543 Ga0495645_0164977 Ga0495645_0164977_377_1258 286
571 3300046559 Ga0495667_0000114 Ga0495667_0000114_5376_6257 286
572 3300046665 Ga0495661_0167380 Ga0495661_0167380_182_1069 286
573 3300046675 Ga0495657_0000067 Ga0495657_0000067_86999_87880 286
574 3300046675 Ga0495657_0114000 Ga0495657_0114000_596_1630 286
575 3300046678 Ga0495599_0000042 Ga0495599_0000042_7033_7914 286
576 3300046679 Ga0495623_0000522 Ga0495623_0000522_5314_6195 286
577 3300046679 Ga0495623_0084230 Ga0495623_0084230_975_1856 286
578 3300046680 Ga0495646_0029012 Ga0495646_0029012_1110_1991 286
579 3300046691 Ga0495670_0013201 Ga0495670_0013201_300_1187 286
580 3300046794 Ga0495589_0011288 Ga0495589_0011288_1126_2013 286
581 3300046809 Ga0495600_0014145 Ga0495600_0014145_1636_2517 286
582 3300046809 Ga0495600_0035048 Ga0495600_0035048_1389_2285 286
583 3300046810 Ga0495660_0015609 Ga0495660_0015609_3156_4043 286
584 3300047317 Ga0495604_0000121 Ga0495604_0000121_5376_6257 286
585 3300047321 Ga0495676_0013435 Ga0495676_0013435_2213_3109 286
586 3300047322 Ga0495680_0000054 Ga0495680_0000054_86988_87869 286
587 3300047444 Ga0495675_0000346 Ga0495675_0000346_5366_6247 286
588 3300047444 Ga0495675_0114393 Ga0495675_0114393_608_1540 286
589 3300047447 Ga0495685_000223 Ga0495685_000223_7662_8549 286
590 3300047470 Ga0495681_0000654 Ga0495681_0000654_18078_18965 286
591 3300048088 Ga0495602_0000083 Ga0495602_0000083_86999_87880 286
592 3300048088 Ga0495602_0008130 Ga0495602_0008130_9468_10349 286
593 3300048903 Ga0496100_0341163 Ga0496100_0341163_14_889 286
594 3300048904 Ga0496101_0110785 Ga0496101_0110785_1155_2030 286
595 3300048908 Ga0496105_0098448 Ga0496105_0098448_1338_2213 286
596 3300048911 Ga0496108_0050723 Ga0496108_0050723_698_1573 286
597 3300048911 Ga0496108_0071004 Ga0496108_0071004_1893_2783 286
598 3300048912 Ga0496109_0010422 Ga0496109_0010422_3789_4679 286
599 3300048912 Ga0496109_0131677 Ga0496109_0131677_552_1427 286
600 3300048914 Ga0496111_0207339 Ga0496111_0207339_341_1216 286
601 3300048915 Ga0496112_0015213 Ga0496112_0015213_3050_3925 286
602 3300048916 Ga0496113_0211415 Ga0496113_0211415_360_1235 286
603 3300049127 Ga0501306_016613 Ga0501306_016613_21_911 286
604 3300049568 Ga0501031_0007875 Ga0501031_0007875_4107_4994 286
605 3300049569 Ga0501032_0011354 Ga0501032_0011354_173_1069 286
606 3300049571 Ga0501034_0030498 Ga0501034_0030498_4551_5447 286
607 3300049573 Ga0501037_0314737 Ga0501037_0314737_155_1045 286
608 3300049578 Ga0501042_0182028 Ga0501042_0182028_388_1278 286
609 3300049579 Ga0501043_0015282 Ga0501043_0015282_2736_3632 286
610 3300049580 Ga0501046_0044949 Ga0501046_0044949_597_1463 286
611 3300049581 Ga0501047_0000023 Ga0501047_0000023_37507_38397 286
612 3300049591 Ga0501075_0219358 Ga0501075_0219358_230_1096 286
613 3300049743 Ga0501081_0037174 Ga0501081_0037174_366_1232 286
614 3300049822 Ga0501035_0226776 Ga0501035_0226776_292_1188 286
615 3300049823 Ga0501044_0181917 Ga0501044_0181917_406_1302 286
616 3300049823 Ga0501044_0378228 Ga0501044_0378228_168_1064 286
617 3300050492 nmdc:mga0yw44_74322_c1 nmdc:mga0yw44_74322_c1_402_1340 286
618 3300050507 nmdc:mga05p37_845639_c1 nmdc:mga05p37_845639_c1_32_913 286
619 3300050515 nmdc:mga0a205_175159_c1 nmdc:mga0a205_175159_c1_409_1290 286
620 3300050515 nmdc:mga0a205_67448_c1 nmdc:mga0a205_67448_c1_1661_2542 286
621 3300053083 Ga0495655_0053454 Ga0495655_0053454_37_924 286
622 3300053083 Ga0495655_0062623 Ga0495655_0062623_109_999 286
623 3300053084 Ga0495595_0003474 Ga0495595_0003474_1554_2435 286
624 3300053086 Ga0500578_0012829 Ga0500578_0012829_624_1511 286
625 3300053090 Ga0500646_0019284 Ga0500646_0019284_609_1496 286
626 3300053099 Ga0500654_046647 Ga0500654_046647_348_1235 286
627 3300053109 Ga0500569_008053 Ga0500569_008053_461_1348 286
628 3300053123 Ga0500614_015709 Ga0500614_015709_346_1299 286
629 3300053126 Ga0500621_032779 Ga0500621_032779_367_1254 286
630 3300053131 Ga0500652_003585 Ga0500652_003585_2635_3522 286
631 3300053134 Ga0500658_0016919 Ga0500658_0016919_902_1789 286
632 3300053136 Ga0500559_0007533 Ga0500559_0007533_1038_1916 286
633 3300053137 Ga0500561_0002620 Ga0500561_0002620_1037_1924 286
634 3300053149 Ga0500600_0012729 Ga0500600_0012729_752_1639 286
635 3300053150 Ga0500603_034744 Ga0500603_034744_60_947 286
636 3300053153 Ga0500616_0103025 Ga0500616_0103025_303_1190 286
637 3300053160 Ga0500633_0000265 Ga0500633_0000265_2521_3408 286
638 3300053161 Ga0500634_0004205 Ga0500634_0004205_1391_2278 286
639 3300053732 Ga0500656_003629 Ga0500656_003629_214_1101 286
640 3300053739 Ga0500587_000082 Ga0500587_000082_1433_2320 286
641 3300061719 Ga0466962_0150991 Ga0466962_0150991_41_931 286
642 3300005329 Ga0070683_100059451 Ga0070683_1000594512 287
643 3300005336 Ga0070680_100105043 Ga0070680_1001050432 287
644 3300005366 Ga0070659_100207599 Ga0070659_1002075992 287
645 3300005435 Ga0070714_100002123 Ga0070714_1000021232 287
646 3300005435 Ga0070714_100057038 Ga0070714_1000570382 287
647 3300005436 Ga0070713_100042584 Ga0070713_1000425842 287
648 3300005468 Ga0070707_100019327 Ga0070707_1000193275 287
649 3300005468 Ga0070707_100186085 Ga0070707_1001860853 287
650 3300006175 Ga0070712_100066882 Ga0070712_1000668823 287
651 3300006914 Ga0075436_100131142 Ga0075436_1001311422 287
652 3300009553 Ga0105249_10129478 Ga0105249_101294782 287
653 3300013307 Ga0157372_10164374 Ga0157372_101643743 287
654 3300013307 Ga0157372_10322389 Ga0157372_103223892 287
655 3300014497 Ga0182008_10182663 Ga0182008_101826632 287
656 3300025915 Ga0207693_10268076 Ga0207693_102680762 287
657 3300025916 Ga0207663_10126979 Ga0207663_101269792 287
658 3300025917 Ga0207660_10415032 Ga0207660_104150322 287
659 3300025922 Ga0207646_10166926 Ga0207646_101669262 287
660 3300025924 Ga0207694_10401490 Ga0207694_104014902 287
661 3300025929 Ga0207664_10061820 Ga0207664_100618203 287
662 3300025929 Ga0207664_10181544 Ga0207664_101815441 287
663 3300025944 Ga0207661_10018617 Ga0207661_100186175 287
664 3300025961 Ga0207712_10137887 Ga0207712_101378872 287
665 3300046690 Ga0495624_0177746 Ga0495624_0177746_29_919 287
666 3300047317 Ga0495604_0003376 Ga0495604_0003376_7239_8126 287
667 3300047322 Ga0495680_0136922 Ga0495680_0136922_99_968 287
668 3300047444 Ga0495675_0012881 Ga0495675_0012881_3276_4163 287
669 3300048905 Ga0496102_0505222 Ga0496102_0505222_234_1121 287
670 3300049578 Ga0501042_0011625 Ga0501042_0011625_914_1963 287
671 3300050514 nmdc:mga08x19_277246_c1 nmdc:mga08x19_277246_c1_49_1014 287
672 3300053140 Ga0500573_0016388 Ga0500573_0016388_1239_2171 287
673 3300003203 JGI25406J46586_10020814 JGI25406J46586_100208143 288
674 3300003320 rootH2_10056866 rootH2_100568662 288
675 3300005327 Ga0070658_10202332 Ga0070658_102023323 288
676 3300005336 Ga0070680_100175649 Ga0070680_1001756493 288
677 3300005337 Ga0070682_100328889 Ga0070682_1003288891 288
678 3300005364 Ga0070673_100598870 Ga0070673_1005988701 288
679 3300005434 Ga0070709_10003354 Ga0070709_100033547 288
680 3300005434 Ga0070709_10021354 Ga0070709_100213542 288
681 3300005435 Ga0070714_100000770 Ga0070714_10000077014 288
682 3300005435 Ga0070714_100375791 Ga0070714_1003757911 288
683 3300005436 Ga0070713_100016908 Ga0070713_1000169083 288
684 3300005436 Ga0070713_100064896 Ga0070713_1000648961 288
685 3300005437 Ga0070710_10000697 Ga0070710_1000069711 288
686 3300005437 Ga0070710_10048538 Ga0070710_100485382 288
687 3300005437 Ga0070710_10064924 Ga0070710_100649243 288
688 3300005439 Ga0070711_100001444 Ga0070711_1000014446 288
689 3300005439 Ga0070711_100194104 Ga0070711_1001941041 288
690 3300005440 Ga0070705_100433242 Ga0070705_1004332421 288
691 3300005441 Ga0070700_100000003 Ga0070700_100000003108 288
692 3300005445 Ga0070708_100001201 Ga0070708_1000012014 288
693 3300005445 Ga0070708_100002929 Ga0070708_1000029299 288
694 3300005445 Ga0070708_100030895 Ga0070708_1000308952 288
695 3300005445 Ga0070708_100379330 Ga0070708_1003793301 288
696 3300005458 Ga0070681_10262212 Ga0070681_102622122 288
697 3300005467 Ga0070706_100000148 Ga0070706_10000014843 288
698 3300005467 Ga0070706_100013102 Ga0070706_1000131025 288
699 3300005467 Ga0070706_100025028 Ga0070706_1000250283 288
700 3300005467 Ga0070706_100026320 Ga0070706_1000263203 288
701 3300005467 Ga0070706_100170641 Ga0070706_1001706412 288
702 3300005468 Ga0070707_100001495 Ga0070707_1000014955 288
703 3300005468 Ga0070707_100002640 Ga0070707_10000264011 288
704 3300005468 Ga0070707_100013326 Ga0070707_1000133264 288
705 3300005468 Ga0070707_100050139 Ga0070707_1000501396 288
706 3300005468 Ga0070707_100375267 Ga0070707_1003752672 288
707 3300005471 Ga0070698_100002583 Ga0070698_10000258312 288
708 3300005471 Ga0070698_100003288 Ga0070698_10000328815 288
709 3300005471 Ga0070698_100005217 Ga0070698_1000052173 288
710 3300005471 Ga0070698_100006326 Ga0070698_1000063262 288
711 3300005471 Ga0070698_100030982 Ga0070698_1000309827 288
712 3300005471 Ga0070698_100114094 Ga0070698_1001140942 288
713 3300005471 Ga0070698_100120737 Ga0070698_1001207372 288
714 3300005471 Ga0070698_100141343 Ga0070698_1001413431 288
715 3300005518 Ga0070699_100000108 Ga0070699_10000010846 288
716 3300005518 Ga0070699_100411407 Ga0070699_1004114071 288
717 3300005535 Ga0070684_100028507 Ga0070684_1000285074 288
718 3300005536 Ga0070697_100015274 Ga0070697_1000152744 288
719 3300005546 Ga0070696_100140480 Ga0070696_1001404801 288
720 3300005548 Ga0070665_100528921 Ga0070665_1005289211 288
721 3300005577 Ga0068857_100237652 Ga0068857_1002376522 288
722 3300005614 Ga0068856_100044294 Ga0068856_1000442942 288
723 3300005618 Ga0068864_100371197 Ga0068864_1003711972 288
724 3300005841 Ga0068863_100069219 Ga0068863_1000692193 288
725 3300005937 Ga0081455_10001379 Ga0081455_100013794 288
726 3300005937 Ga0081455_10002490 Ga0081455_1000249015 288
727 3300005981 Ga0081538_10003211 Ga0081538_1000321114 288
728 3300005981 Ga0081538_10015613 Ga0081538_100156133 288
729 3300005985 Ga0081539_10000880 Ga0081539_1000088049 288
730 3300005985 Ga0081539_10001247 Ga0081539_1000124719 288
731 3300005985 Ga0081539_10005361 Ga0081539_1000536111 288
732 3300005985 Ga0081539_10019294 Ga0081539_100192942 288
733 3300005985 Ga0081539_10043244 Ga0081539_100432442 288
734 3300005985 Ga0081539_10055623 Ga0081539_100556232 288
735 3300006028 Ga0070717_10007065 Ga0070717_100070652 288
736 3300006028 Ga0070717_10008992 Ga0070717_100089924 288
737 3300006163 Ga0070715_10003954 Ga0070715_100039544 288
738 3300006173 Ga0070716_100000595 Ga0070716_1000005958 288
739 3300006173 Ga0070716_100001465 Ga0070716_1000014652 288
740 3300006175 Ga0070712_100001269 Ga0070712_1000012696 288
741 3300006175 Ga0070712_100260480 Ga0070712_1002604802 288
742 3300006237 Ga0097621_100447613 Ga0097621_1004476131 288
743 3300006358 Ga0068871_100208787 Ga0068871_1002087872 288
744 3300006844 Ga0075428_100050775 Ga0075428_1000507754 288
745 3300006844 Ga0075428_100421086 Ga0075428_1004210862 288
746 3300006846 Ga0075430_100041988 Ga0075430_1000419881 288
747 3300006847 Ga0075431_100001242 Ga0075431_10000124214 288
748 3300006847 Ga0075431_100001775 Ga0075431_1000017759 288
749 3300006871 Ga0075434_100084877 Ga0075434_1000848773 288
750 3300006871 Ga0075434_100291622 Ga0075434_1002916222 288
751 3300006880 Ga0075429_100003370 Ga0075429_10000337011 288
752 3300006880 Ga0075429_100024528 Ga0075429_1000245283 288
753 3300006914 Ga0075436_100153198 Ga0075436_1001531982 288
754 3300007076 Ga0075435_100062794 Ga0075435_1000627943 288
755 3300009094 Ga0111539_10025324 Ga0111539_100253242 288
756 3300009094 Ga0111539_10133624 Ga0111539_101336243 288
757 3300009101 Ga0105247_10069278 Ga0105247_100692782 288
758 3300009147 Ga0114129_10155995 Ga0114129_101559952 288
759 3300009147 Ga0114129_10745257 Ga0114129_107452572 288
760 3300009174 Ga0105241_10194552 Ga0105241_101945522 288
761 3300009177 Ga0105248_10308662 Ga0105248_103086622 288
762 3300009545 Ga0105237_10159166 Ga0105237_101591662 288
763 3300009551 Ga0105238_10642741 Ga0105238_106427412 288
764 3300013102 Ga0157371_10211198 Ga0157371_102111982 288
765 3300013105 Ga0157369_10825311 Ga0157369_108253111 288
766 3300013306 Ga0163162_10194445 Ga0163162_101944453 288
767 3300013308 Ga0157375_10136323 Ga0157375_101363232 288
768 3300013308 Ga0157375_10406521 Ga0157375_104065212 288
769 3300014968 Ga0157379_10097932 Ga0157379_100979323 288
770 3300014969 Ga0157376_10483217 Ga0157376_104832171 288
771 3300020082 Ga0206353_11255998 Ga0206353_112559981 288
772 3300020082 Ga0206353_11258446 Ga0206353_112584466 288
773 3300021377 Ga0213874_10091327 Ga0213874_100913271 288
774 3300021388 Ga0213875_10099926 Ga0213875_100999261 288
775 3300025898 Ga0207692_10075628 Ga0207692_100756282 288
776 3300025905 Ga0207685_10001463 Ga0207685_100014634 288
777 3300025905 Ga0207685_10004658 Ga0207685_100046583 288
778 3300025905 Ga0207685_10072438 Ga0207685_100724382 288
779 3300025906 Ga0207699_10001939 Ga0207699_100019393 288
780 3300025906 Ga0207699_10011039 Ga0207699_100110395 288
781 3300025906 Ga0207699_10018952 Ga0207699_100189523 288
782 3300025909 Ga0207705_10189322 Ga0207705_101893222 288
783 3300025910 Ga0207684_10000002 Ga0207684_10000002735 288
784 3300025910 Ga0207684_10002291 Ga0207684_100022917 288
785 3300025910 Ga0207684_10002641 Ga0207684_1000264113 288
786 3300025910 Ga0207684_10008669 Ga0207684_100086697 288
787 3300025910 Ga0207684_10018622 Ga0207684_100186223 288
788 3300025910 Ga0207684_10022633 Ga0207684_100226333 288
789 3300025910 Ga0207684_10089133 Ga0207684_100891333 288
790 3300025910 Ga0207684_10311106 Ga0207684_103111062 288
791 3300025910 Ga0207684_10340073 Ga0207684_103400732 288
792 3300025912 Ga0207707_10187999 Ga0207707_101879992 288
793 3300025915 Ga0207693_10002126 Ga0207693_1000212614 288
794 3300025915 Ga0207693_10024034 Ga0207693_100240342 288
795 3300025915 Ga0207693_10261780 Ga0207693_102617802 288
796 3300025916 Ga0207663_10001522 Ga0207663_100015226 288
797 3300025916 Ga0207663_10026213 Ga0207663_100262131 288
798 3300025916 Ga0207663_10130246 Ga0207663_101302461 288
799 3300025919 Ga0207657_10232922 Ga0207657_102329222 288
800 3300025921 Ga0207652_10103736 Ga0207652_101037363 288
801 3300025921 Ga0207652_10148697 Ga0207652_101486972 288
802 3300025922 Ga0207646_10000636 Ga0207646_1000063630 288
803 3300025922 Ga0207646_10001890 Ga0207646_100018905 288
804 3300025922 Ga0207646_10002282 Ga0207646_1000228217 288
805 3300025922 Ga0207646_10005535 Ga0207646_100055355 288
806 3300025922 Ga0207646_10011947 Ga0207646_100119475 288
807 3300025922 Ga0207646_10023563 Ga0207646_100235636 288
808 3300025922 Ga0207646_10044142 Ga0207646_100441425 288
809 3300025922 Ga0207646_10065517 Ga0207646_100655173 288
810 3300025922 Ga0207646_10133234 Ga0207646_101332342 288
811 3300025922 Ga0207646_10139688 Ga0207646_101396882 288
812 3300025922 Ga0207646_10466250 Ga0207646_104662502 288
813 3300025928 Ga0207700_10000518 Ga0207700_1000051814 288
814 3300025928 Ga0207700_10003056 Ga0207700_100030563 288
815 3300025928 Ga0207700_10016541 Ga0207700_100165413 288
816 3300025928 Ga0207700_10027370 Ga0207700_100273703 288
817 3300025928 Ga0207700_10084221 Ga0207700_100842211 288
818 3300025929 Ga0207664_10001398 Ga0207664_100013988 288
819 3300025929 Ga0207664_10004201 Ga0207664_100042017 288
820 3300025929 Ga0207664_10026984 Ga0207664_100269845 288
821 3300025929 Ga0207664_10064871 Ga0207664_100648713 288
822 3300025929 Ga0207664_10137800 Ga0207664_101378002 288
823 3300025939 Ga0207665_10000328 Ga0207665_1000032821 288
824 3300025939 Ga0207665_10009995 Ga0207665_100099954 288
825 3300025939 Ga0207665_10082244 Ga0207665_100822443 288
826 3300025939 Ga0207665_10096508 Ga0207665_100965083 288
827 3300026023 Ga0207677_10560809 Ga0207677_105608091 288
828 3300026075 Ga0207708_10000002 Ga0207708_10000002247 288
829 3300026078 Ga0207702_10031245 Ga0207702_100312452 288
830 3300026078 Ga0207702_10207185 Ga0207702_102071852 288
831 3300026121 Ga0207683_10174424 Ga0207683_101744242 288
832 3300026121 Ga0207683_10283032 Ga0207683_102830322 288
833 3300028381 Ga0268264_10117203 Ga0268264_101172032 288
834 3300031456 Ga0307513_10004399 Ga0307513_100043992 288
835 3300031548 Ga0307408_100192736 Ga0307408_1001927362 288
836 3300031852 Ga0307410_10009253 Ga0307410_100092535 288
837 3300031852 Ga0307410_10182015 Ga0307410_101820151 288
838 3300031901 Ga0307406_10040475 Ga0307406_100404752 288
839 3300031901 Ga0307406_10066450 Ga0307406_100664502 288
840 3300031903 Ga0307407_10051293 Ga0307407_100512931 288
841 3300031903 Ga0307407_10251655 Ga0307407_102516551 288
842 3300031903 Ga0307407_10256360 Ga0307407_102563602 288
843 3300031995 Ga0307409_100057751 Ga0307409_1000577513 288
844 3300031995 Ga0307409_100089250 Ga0307409_1000892501 288
845 3300031995 Ga0307409_100131220 Ga0307409_1001312202 288
846 3300031995 Ga0307409_100414433 Ga0307409_1004144331 288
847 3300031995 Ga0307409_100449796 Ga0307409_1004497961 288
848 3300032002 Ga0307416_100048502 Ga0307416_1000485022 288
849 3300032002 Ga0307416_100369102 Ga0307416_1003691022 288
850 3300032002 Ga0307416_100378104 Ga0307416_1003781042 288
851 3300032004 Ga0307414_10008167 Ga0307414_100081672 288
852 3300032004 Ga0307414_10012761 Ga0307414_100127613 288
853 3300032004 Ga0307414_10039837 Ga0307414_100398372 288
854 3300032004 Ga0307414_10276068 Ga0307414_102760681 288
855 3300032004 Ga0307414_10561185 Ga0307414_105611851 288
856 3300032126 Ga0307415_100052011 Ga0307415_1000520113 288
857 3300034820 Ga0373959_0009704 Ga0373959_0009704_50_916 288
858 3300034957 Ga0373938_0007787 Ga0373938_0007787_476_1342 288
859 3300035083 Ga0373926_0000519 Ga0373926_0000519_1102_2010 288
860 3300035086 Ga0373934_0024594 Ga0373934_0024594_445_1311 288
861 3300035086 Ga0373934_0098490 Ga0373934_0098490_234_1103 288
862 3300035089 Ga0373944_0068460 Ga0373944_0068460_242_1108 288
863 3300035111 Ga0373923_0010612 Ga0373923_0010612_1784_2650 288
864 3300035120 Ga0373957_0033523 Ga0373957_0033523_692_1558 288
865 3300035121 Ga0373960_0010343 Ga0373960_0010343_446_1312 288
866 3300035171 Ga0373946_0030361 Ga0373946_0030361_1003_1911 288
867 3300035171 Ga0373946_0088180 Ga0373946_0088180_136_1005 288
868 3300035171 Ga0373946_0106513 Ga0373946_0106513_268_1134 288
869 3300035172 Ga0373955_0060314 Ga0373955_0060314_107_976 288
870 3300035172 Ga0373955_0136826 Ga0373955_0136826_198_1064 288
871 3300035241 Ga0373961_0040398 Ga0373961_0040398_442_1308 288
872 3300035410 Ga0373924_0113884 Ga0373924_0113884_31_900 288
873 3300035691 Ga0373931_0143690 Ga0373931_0143690_69_935 288
874 3300035692 Ga0373935_0123081 Ga0373935_0123081_751_1617 288
875 3300035724 Ga0373933_0016762 Ga0373933_0016762_214_1080 288
876 3300035725 Ga0373947_0000012 Ga0373947_0000012_70441_71349 288
877 3300036401 Ga0373937_0021311 Ga0373937_0021311_2905_3771 288
878 3300037068 Ga0373925_0146670 Ga0373925_0146670_946_1812 288
879 3300037312 Ga0395899_0364632 Ga0395899_0364632_22_906 288
880 3300037418 Ga0395900_0028475 Ga0395900_0028475_2563_3519 288
881 3300037418 Ga0395900_0179248 Ga0395900_0179248_778_1662 288
882 3300037418 Ga0395900_0394700 Ga0395900_0394700_45_917 288
883 3300037466 Ga0395898_0141809 Ga0395898_0141809_386_1270 288
884 3300037466 Ga0395898_0170849 Ga0395898_0170849_638_1510 288
885 3300037853 Ga0436364_0776813 Ga0436364_0776813_90_956 288
886 3300038443 Ga0395901_0094169 Ga0395901_0094169_1731_2603 288
887 3300038443 Ga0395901_0355088 Ga0395901_0355088_332_1204 288
888 3300039450 Ga0436363_0330691 Ga0436363_0330691_450_1316 288
889 3300039450 Ga0436363_1688649 Ga0436363_1688649_618_1484 288
890 3300044656 Ga0466969_0001393 Ga0466969_0001393_7389_8294 288
891 3300044656 Ga0466969_0027492 Ga0466969_0027492_955_1839 288
892 3300044656 Ga0466969_0034637 Ga0466969_0034637_18_923 288
893 3300044683 Ga0466965_0133587 Ga0466965_0133587_219_1091 288
894 3300044684 Ga0466966_0002213 Ga0466966_0002213_4716_5621 288
895 3300044684 Ga0466966_0040037 Ga0466966_0040037_494_1378 288
896 3300044694 Ga0466963_0063650 Ga0466963_0063650_1429_2313 288
897 3300044694 Ga0466963_0095896 Ga0466963_0095896_244_1128 288
898 3300044706 Ga0466964_0038411 Ga0466964_0038411_477_1361 288
899 3300044842 Ga0466957_0213611 Ga0466957_0213611_258_1142 288
900 3300044901 Ga0466960_0107141 Ga0466960_0107141_19_891 288
901 3300044901 Ga0466960_0158726 Ga0466960_0158726_263_1147 288
902 3300045049 Ga0466959_0007600 Ga0466959_0007600_5165_6070 288
903 3300045049 Ga0466959_0041292 Ga0466959_0041292_843_1727 288
904 3300045049 Ga0466959_0049520 Ga0466959_0049520_368_1252 288
905 3300045836 Ga0466958_0065679 Ga0466958_0065679_720_1604 288
906 3300045976 Ga0466967_0000767 Ga0466967_0000767_7268_8164 288
907 3300045976 Ga0466967_0079181 Ga0466967_0079181_30_914 288
908 3300045976 Ga0466967_0214119 Ga0466967_0214119_740_1624 288
909 3300045976 Ga0466967_0348110 Ga0466967_0348110_257_1165 288
910 3300045976 Ga0466967_0479042 Ga0466967_0479042_172_1038 288
911 3300045976 Ga0466967_0549385 Ga0466967_0549385_104_988 288
912 3300046454 Ga0495592_0004032 Ga0495592_0004032_3401_4309 288
913 3300046454 Ga0495592_0111702 Ga0495592_0111702_234_1103 288
914 3300046455 Ga0495603_0041124 Ga0495603_0041124_1520_2386 288
915 3300046459 Ga0495629_0042855 Ga0495629_0042855_1183_2052 288
916 3300046462 Ga0495651_0022065 Ga0495651_0022065_1533_2402 288
917 3300046462 Ga0495651_0028953 Ga0495651_0028953_2536_3444 288
918 3300046462 Ga0495651_0032487 Ga0495651_0032487_94_960 288
919 3300046463 Ga0495653_0003317 Ga0495653_0003317_6414_7322 288
920 3300046471 Ga0495650_0021622 Ga0495650_0021622_1923_2792 288
921 3300046472 Ga0495580_0011800 Ga0495580_0011800_3243_4151 288
922 3300046476 Ga0495662_0002341 Ga0495662_0002341_6486_7394 288
923 3300046476 Ga0495662_0045589 Ga0495662_0045589_1231_2097 288
924 3300046476 Ga0495662_0100866 Ga0495662_0100866_168_1037 288
925 3300046477 Ga0495664_0002877 Ga0495664_0002877_3150_4016 288
926 3300046477 Ga0495664_0014217 Ga0495664_0014217_1330_2199 288
927 3300046477 Ga0495664_0047702 Ga0495664_0047702_398_1264 288
928 3300046511 Ga0495608_0003305 Ga0495608_0003305_3221_4129 288
929 3300046511 Ga0495608_0027784 Ga0495608_0027784_2046_2912 288
930 3300046514 Ga0495618_0025440 Ga0495618_0025440_364_1233 288
931 3300046514 Ga0495618_0066094 Ga0495618_0066094_236_1102 288
932 3300046514 Ga0495618_0155516 Ga0495618_0155516_270_1178 288
933 3300046517 Ga0495630_0015629 Ga0495630_0015629_1400_2266 288
934 3300046517 Ga0495630_0022964 Ga0495630_0022964_2490_3398 288
935 3300046517 Ga0495630_0034683 Ga0495630_0034683_452_1321 288
936 3300046526 Ga0495666_0006058 Ga0495666_0006058_1501_2409 288
937 3300046529 Ga0495652_0022390 Ga0495652_0022390_262_1170 288
938 3300046531 Ga0495665_0001405 Ga0495665_0001405_6410_7318 288
939 3300046531 Ga0495665_0071471 Ga0495665_0071471_717_1586 288
940 3300046533 Ga0495640_0005739 Ga0495640_0005739_2362_3270 288
941 3300046533 Ga0495640_0016595 Ga0495640_0016595_1956_2822 288
942 3300046533 Ga0495640_0073012 Ga0495640_0073012_1220_2086 288
943 3300046535 Ga0495586_0003139 Ga0495586_0003139_7179_8087 288
944 3300046543 Ga0495645_0004499 Ga0495645_0004499_206_1111 288
945 3300046543 Ga0495645_0005026 Ga0495645_0005026_1004_1912 288
946 3300046543 Ga0495645_0067098 Ga0495645_0067098_304_1173 288
947 3300046543 Ga0495645_0216205 Ga0495645_0216205_165_1031 288
948 3300046559 Ga0495667_0012288 Ga0495667_0012288_166_1032 288
949 3300046559 Ga0495667_0123047 Ga0495667_0123047_262_1170 288
950 3300046642 Ga0495634_0018221 Ga0495634_0018221_3826_4692 288
951 3300046674 Ga0495588_0091949 Ga0495588_0091949_389_1258 288
952 3300046675 Ga0495657_0009938 Ga0495657_0009938_465_1331 288
953 3300046675 Ga0495657_0014048 Ga0495657_0014048_4683_5591 288
954 3300046678 Ga0495599_0003479 Ga0495599_0003479_756_1625 288
955 3300046678 Ga0495599_0146158 Ga0495599_0146158_121_987 288
956 3300046679 Ga0495623_0037650 Ga0495623_0037650_1353_2219 288
957 3300046679 Ga0495623_0109597 Ga0495623_0109597_262_1170 288
958 3300046680 Ga0495646_0098230 Ga0495646_0098230_341_1207 288
959 3300046680 Ga0495646_0134089 Ga0495646_0134089_301_1167 288
960 3300046689 Ga0495613_0004179 Ga0495613_0004179_4026_4934 288
961 3300046689 Ga0495613_0019996 Ga0495613_0019996_2788_3654 288
962 3300046690 Ga0495624_0060790 Ga0495624_0060790_495_1364 288
963 3300046809 Ga0495600_0012627 Ga0495600_0012627_2868_3737 288
964 3300047315 Ga0495581_0007284 Ga0495581_0007284_539_1447 288
965 3300047315 Ga0495581_0024807 Ga0495581_0024807_748_1617 288
966 3300047317 Ga0495604_0002938 Ga0495604_0002938_7038_7946 288
967 3300047317 Ga0495604_0003492 Ga0495604_0003492_7552_8418 288
968 3300047317 Ga0495604_0023093 Ga0495604_0023093_3361_4230 288
969 3300047319 Ga0495674_0006966 Ga0495674_0006966_7600_8466 288
970 3300047319 Ga0495674_0041694 Ga0495674_0041694_1980_2888 288
971 3300047319 Ga0495674_0094211 Ga0495674_0094211_833_1702 288
972 3300047321 Ga0495676_0057269 Ga0495676_0057269_1010_1876 288
973 3300047322 Ga0495680_0007021 Ga0495680_0007021_201_1067 288
974 3300047444 Ga0495675_0003780 Ga0495675_0003780_2536_3444 288
975 3300047444 Ga0495675_0017543 Ga0495675_0017543_2903_3769 288
976 3300047444 Ga0495675_0024610 Ga0495675_0024610_638_1543 288
977 3300047471 Ga0495684_0015097 Ga0495684_0015097_2536_3444 288
978 3300047471 Ga0495684_0020685 Ga0495684_0020685_1334_2203 288
979 3300047471 Ga0495684_0033418 Ga0495684_0033418_1002_1868 288
980 3300047471 Ga0495684_0121422 Ga0495684_0121422_166_1032 288
981 3300047673 Ga0495593_0025558 Ga0495593_0025558_2126_2992 288
982 3300047673 Ga0495593_0056538 Ga0495593_0056538_151_1059 288
983 3300048088 Ga0495602_0022114 Ga0495602_0022114_2013_2882 288
984 3300048088 Ga0495602_0049974 Ga0495602_0049974_807_1715 288
985 3300048088 Ga0495602_0090966 Ga0495602_0090966_1650_2516 288
986 3300048903 Ga0496100_0126154 Ga0496100_0126154_897_1763 288
987 3300048905 Ga0496102_0022743 Ga0496102_0022743_3550_4416 288
988 3300048905 Ga0496102_0357441 Ga0496102_0357441_56_925 288
989 3300048907 Ga0496104_0000600 Ga0496104_0000600_6268_7134 288
990 3300048907 Ga0496104_0050173 Ga0496104_0050173_27_893 288
991 3300048907 Ga0496104_0188724 Ga0496104_0188724_1003_1872 288
992 3300048908 Ga0496105_0011198 Ga0496105_0011198_3544_4410 288
993 3300048908 Ga0496105_0075457 Ga0496105_0075457_1553_2422 288
994 3300048908 Ga0496105_0091725 Ga0496105_0091725_491_1357 288
995 3300048909 Ga0496106_0149256 Ga0496106_0149256_132_998 288
996 3300048910 Ga0496107_0237196 Ga0496107_0237196_319_1185 288
997 3300048911 Ga0496108_0076762 Ga0496108_0076762_847_1713 288
998 3300048911 Ga0496108_0252088 Ga0496108_0252088_64_933 288
999 3300048911 Ga0496108_0316972 Ga0496108_0316972_132_998 288
1000 3300048912 Ga0496109_0018991 Ga0496109_0018991_1761_2627 288
1001 3300048913 Ga0496110_0029877 Ga0496110_0029877_1494_2363 288
1002 3300048915 Ga0496112_0024759 Ga0496112_0024759_3639_4505 288
1003 3300048916 Ga0496113_0013081 Ga0496113_0013081_692_1558 288
1004 3300048916 Ga0496113_0058609 Ga0496113_0058609_329_1195 288
1005 3300048916 Ga0496113_0071667 Ga0496113_0071667_904_1773 288
1006 3300048917 Ga0496114_0084678 Ga0496114_0084678_1139_2005 288
1007 3300048918 Ga0496115_0061249 Ga0496115_0061249_1418_2284 288
1008 3300049568 Ga0501031_0094205 Ga0501031_0094205_248_1141 288
1009 3300049571 Ga0501034_0018672 Ga0501034_0018672_5260_6153 288
1010 3300049572 Ga0501036_0014365 Ga0501036_0014365_3785_4678 288
1011 3300049573 Ga0501037_0153098 Ga0501037_0153098_346_1239 288
1012 3300049575 Ga0501039_0127215 Ga0501039_0127215_45_920 288
1013 3300049585 Ga0501069_0199898 Ga0501069_0199898_51_938 288
1014 3300049822 Ga0501035_0233074 Ga0501035_0233074_656_1549 288
1015 3300049824 Ga0501045_0138439 Ga0501045_0138439_347_1240 288
1016 3300050507 nmdc:mga05p37_4688_c1 nmdc:mga05p37_4688_c1_14267_15136 288
1017 3300050507 nmdc:mga05p37_7379_c1 nmdc:mga05p37_7379_c1_965_1843 288
1018 3300050508 nmdc:mga09592_583_c1 nmdc:mga09592_583_c1_2063_2932 288
1019 3300050508 nmdc:mga09592_8037_c1 nmdc:mga09592_8037_c1_4402_5280 288
1020 3300050510 nmdc:mga06r32_1579_c1 nmdc:mga06r32_1579_c1_15690_16559 288
1021 3300050510 nmdc:mga06r32_30416_c1 nmdc:mga06r32_30416_c1_3743_4621 288
1022 3300050510 nmdc:mga06r32_5723_c1 nmdc:mga06r32_5723_c1_8201_9070 288
1023 3300050512 nmdc:mga0n895_155986_c1 nmdc:mga0n895_155986_c1_886_1755 288
1024 3300050515 nmdc:mga0a205_76505_c1 nmdc:mga0a205_76505_c1_720_1586 288
1025 3300053077 Ga0495601_0014999 Ga0495601_0014999_740_1606 288
1026 3300053077 Ga0495601_0072017 Ga0495601_0072017_958_1827 288
1027 3300053077 Ga0495601_0156035 Ga0495601_0156035_282_1148 288
1028 3300053078 Ga0495612_0011735 Ga0495612_0011735_2501_3367 288
1029 3300053084 Ga0495595_0012738 Ga0495595_0012738_1328_2197 288
1030 3300053084 Ga0495595_0023439 Ga0495595_0023439_1327_2193 288
1031 3300053085 Ga0495619_0050201 Ga0495619_0050201_1682_2590 288
1032 3300061719 Ga0466962_0032289 Ga0466962_0032289_95_979 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

52

220

0.97

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

225

334

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.8981 1 281
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8918 1 285
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.8891 1 285
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8886 1 284
1jrp-assembly2.cif.gz_G crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus 0.8859 3 278
ID Description Score Start End Superfamily
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9611 54 165 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.956 54 165 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9524 53 165 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9477 54 165 3.30.465.10
1jroG04 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9452 54 165 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A535DE55-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.972 34 287 GO:0016491
GO:0071949
AF-A0A066YPD3-F1-model_v4 Carbon-monoxide dehydrogenase 0.9718 1 122 GO:0016491
GO:0071949
AF-A0A1C4T952-F1-model_v4 deleted 0.9659 1 258
AF-A0A7V9E9V3-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9616 135 287
AF-A0A7W7LZ93-F1-model_v4 CO/xanthine dehydrogenase Mo-binding subunit 0.9615 1 122 GO:0005506
GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.24 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map