F488628
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1032 | 432 | 974 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100159013|Ga0070714_1001590132 |
| Length | 346 |
| Sequence | MGRTRADWARADSPMAQPRSRFVGKDKQRRASHGWFRCFCAWLLATTGVLLSVMEFYRPATWADALAIKAERPGARAIAGGTDVMVEINFDRARPEALLDLTGVPDLAEWSADGPVIRLGAGVPYTRVIDELGGRLPGLAMASRTVGSPQIRNRGTVGGNLGSASPAGDAHPPLLADDTVVEAASVRGTRDIPIREFYTGVKRSALAPDELIAAVRVPAADGPQQFSKVGVRNAMVIAVSSFAIALHPERGQVGTGFGSAAPXXXXAAAAEEFLAAELADRGLWESRGPLAESTVRRFGELVAEAAAPIDDVRGTAAYRRHSLAVMARRTLAWAWRSYREERQRCA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 5 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 6 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 7 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 8 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 9 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 10 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 11 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 12 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 13 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 14 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 15 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 16 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 17 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 18 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 19 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 20 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 21 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 22 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 23 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 24 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 25 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 26 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 27 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 28 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 29 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 30 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 31 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 32 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 33 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 34 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 35 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 36 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 37 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 38 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 39 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 40 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 41 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 42 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 43 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 44 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 192 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 193 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 257 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 258 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 259 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 260 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 261 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 262 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 263 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 397 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 399 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 402 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 403 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 408 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 410 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 413 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 415 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 420 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 421 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 422 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 423 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 424 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 425 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 426 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 427 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 428 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 429 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 430 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 431 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 432 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.99 |
| Metatranscriptomes | 0.39 |
| Isolates | 5.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 2.52 |
| Nodule | 0.19 |
| Rhizoplane | 4.36 |
| Rhizosphere | 87.02 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 5.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10020814 | 3300003203 | Bacteria | 2644 |
| 2 | rootH2_10056866 | 3300003320 | Bacteria | 2873 |
| 3 | JGI25160J50197_1030646 | 3300003354 | Bacteria | 1398 |
| 4 | Ga0070658_10018471 | 3300005327 | Bacteria | 5583 |
| 5 | Ga0070658_10202332 | 3300005327 | Bacteria | 1676 |
| 6 | Ga0070683_100000230 | 3300005329 | Bacteria | 38094 |
| 7 | Ga0070683_100059451 | 3300005329 | Bacteria | 3551 |
| 8 | Ga0070683_100205342 | 3300005329 | Bacteria | 1871 |
| 9 | Ga0070683_100540639 | 3300005329 | Bacteria | 1114 |
| 10 | Ga0070680_100105043 | 3300005336 | Bacteria | 2348 |
| 11 | Ga0070680_100175649 | 3300005336 | Bacteria | 1803 |
| 12 | Ga0070682_100041825 | 3300005337 | Bacteria | 2826 |
| 13 | Ga0070682_100328889 | 3300005337 | Bacteria | 1132 |
| 14 | Ga0070660_100076325 | 3300005339 | Bacteria | 2624 |
| 15 | Ga0070692_10060720 | 3300005345 | Bacteria | 1991 |
| 16 | Ga0070668_100006848 | 3300005347 | Bacteria | 8450 |
| 17 | Ga0070668_100189248 | 3300005347 | Bacteria | 1685 |
| 18 | Ga0070675_100325709 | 3300005354 | Bacteria | 1358 |
| 19 | Ga0070671_100003560 | 3300005355 | Bacteria | 12181 |
| 20 | Ga0070673_100598870 | 3300005364 | Bacteria | 1005 |
| 21 | Ga0070659_100207599 | 3300005366 | Bacteria | 1614 |
| 22 | Ga0070659_100543496 | 3300005366 | Bacteria | 994 |
| 23 | Ga0070709_10003354 | 3300005434 | Bacteria | 8608 |
| 24 | Ga0070709_10017375 | 3300005434 | Bacteria | 4125 |
| 25 | Ga0070709_10021354 | 3300005434 | Bacteria | 3769 |
| 26 | Ga0070714_100000261 | 3300005435 | Bacteria | 41105 |
| 27 | Ga0070714_100000770 | 3300005435 | Bacteria | 22708 |
| 28 | Ga0070714_100001336 | 3300005435 | Bacteria | 17811 |
| 29 | Ga0070714_100002123 | 3300005435 | Bacteria | 14558 |
| 30 | Ga0070714_100007770 | 3300005435 | Bacteria | 8354 |
| 31 | Ga0070714_100037854 | 3300005435 | Bacteria | 4055 |
| 32 | Ga0070714_100057038 | 3300005435 | Bacteria | 3342 |
| 33 | Ga0070714_100159013 | 3300005435 | Bacteria | 2042 |
| 34 | Ga0070714_100375791 | 3300005435 | Bacteria | 1339 |
| 35 | Ga0070713_100016908 | 3300005436 | Bacteria | 5497 |
| 36 | Ga0070713_100035365 | 3300005436 | Bacteria | 4021 |
| 37 | Ga0070713_100042584 | 3300005436 | Bacteria | 3707 |
| 38 | Ga0070713_100064896 | 3300005436 | Bacteria | 3065 |
| 39 | Ga0070713_100073654 | 3300005436 | Bacteria | 2891 |
| 40 | Ga0070713_100155893 | 3300005436 | Bacteria | 2035 |
| 41 | Ga0070713_100310710 | 3300005436 | Bacteria | 1454 |
| 42 | Ga0070710_10000697 | 3300005437 | Bacteria | 15990 |
| 43 | Ga0070710_10000854 | 3300005437 | Bacteria | 14611 |
| 44 | Ga0070710_10048538 | 3300005437 | Bacteria | 2371 |
| 45 | Ga0070710_10064924 | 3300005437 | Bacteria | 2089 |
| 46 | Ga0070711_100001444 | 3300005439 | Bacteria | 13073 |
| 47 | Ga0070711_100020933 | 3300005439 | Bacteria | 4223 |
| 48 | Ga0070711_100194104 | 3300005439 | Bacteria | 1562 |
| 49 | Ga0070705_100433242 | 3300005440 | Bacteria | 982 |
| 50 | Ga0070700_100000003 | 3300005441 | Bacteria | 261247 |
| 51 | Ga0070708_100000014 | 3300005445 | Bacteria | 130264 |
| 52 | Ga0070708_100001201 | 3300005445 | Bacteria | 19938 |
| 53 | Ga0070708_100002929 | 3300005445 | Bacteria | 13281 |
| 54 | Ga0070708_100030895 | 3300005445 | Bacteria | 4633 |
| 55 | Ga0070708_100055695 | 3300005445 | Bacteria | 3516 |
| 56 | Ga0070708_100119080 | 3300005445 | Bacteria | 2433 |
| 57 | Ga0070708_100379330 | 3300005445 | Bacteria | 1333 |
| 58 | Ga0070663_100000835 | 3300005455 | Bacteria | 16664 |
| 59 | Ga0070663_100004631 | 3300005455 | Bacteria | 8098 |
| 60 | Ga0070681_10262212 | 3300005458 | Bacteria | 1640 |
| 61 | Ga0068867_100165209 | 3300005459 | Bacteria | 1748 |
| 62 | Ga0070706_100000059 | 3300005467 | Bacteria | 131531 |
| 63 | Ga0070706_100000148 | 3300005467 | Bacteria | 89214 |
| 64 | Ga0070706_100007618 | 3300005467 | Bacteria | 10132 |
| 65 | Ga0070706_100013102 | 3300005467 | Bacteria | 7670 |
| 66 | Ga0070706_100013918 | 3300005467 | Bacteria | 7435 |
| 67 | Ga0070706_100025028 | 3300005467 | Bacteria | 5494 |
| 68 | Ga0070706_100026320 | 3300005467 | Bacteria | 5353 |
| 69 | Ga0070706_100043893 | 3300005467 | Bacteria | 4130 |
| 70 | Ga0070706_100144438 | 3300005467 | Bacteria | 2222 |
| 71 | Ga0070706_100170641 | 3300005467 | Bacteria | 2031 |
| 72 | Ga0070707_100000024 | 3300005468 | Bacteria | 128517 |
| 73 | Ga0070707_100001495 | 3300005468 | Bacteria | 22791 |
| 74 | Ga0070707_100002640 | 3300005468 | Bacteria | 17057 |
| 75 | Ga0070707_100013326 | 3300005468 | Bacteria | 7690 |
| 76 | Ga0070707_100016035 | 3300005468 | Bacteria | 7029 |
| 77 | Ga0070707_100019327 | 3300005468 | Bacteria | 6416 |
| 78 | Ga0070707_100039269 | 3300005468 | Bacteria | 4523 |
| 79 | Ga0070707_100050139 | 3300005468 | Bacteria | 4002 |
| 80 | Ga0070707_100091365 | 3300005468 | Bacteria | 2947 |
| 81 | Ga0070707_100186085 | 3300005468 | Bacteria | 2025 |
| 82 | Ga0070707_100375267 | 3300005468 | Bacteria | 1382 |
| 83 | Ga0070698_100002583 | 3300005471 | Bacteria | 19939 |
| 84 | Ga0070698_100002617 | 3300005471 | Bacteria | 19821 |
| 85 | Ga0070698_100003288 | 3300005471 | Bacteria | 17769 |
| 86 | Ga0070698_100005217 | 3300005471 | Bacteria | 14207 |
| 87 | Ga0070698_100006326 | 3300005471 | Bacteria | 12859 |
| 88 | Ga0070698_100030982 | 3300005471 | Bacteria | 5547 |
| 89 | Ga0070698_100040946 | 3300005471 | Bacteria | 4759 |
| 90 | Ga0070698_100050377 | 3300005471 | Bacteria | 4246 |
| 91 | Ga0070698_100114094 | 3300005471 | Bacteria | 2667 |
| 92 | Ga0070698_100120737 | 3300005471 | Bacteria | 2581 |
| 93 | Ga0070698_100140713 | 3300005471 | Bacteria | 2364 |
| 94 | Ga0070698_100141343 | 3300005471 | Bacteria | 2358 |
| 95 | Ga0070699_100000046 | 3300005518 | Bacteria | 124488 |
| 96 | Ga0070699_100000108 | 3300005518 | Bacteria | 77592 |
| 97 | Ga0070699_100014146 | 3300005518 | Bacteria | 6865 |
| 98 | Ga0070699_100076977 | 3300005518 | Bacteria | 2904 |
| 99 | Ga0070699_100255795 | 3300005518 | Bacteria | 1566 |
| 100 | Ga0070699_100411407 | 3300005518 | Bacteria | 1224 |
| 101 | Ga0070684_100027942 | 3300005535 | Bacteria | 4767 |
| 102 | Ga0070684_100028507 | 3300005535 | Bacteria | 4724 |
| 103 | Ga0070697_100000004 | 3300005536 | Bacteria | 284078 |
| 104 | Ga0070697_100013956 | 3300005536 | Bacteria | 6309 |
| 105 | Ga0070697_100015274 | 3300005536 | Bacteria | 6027 |
| 106 | Ga0070697_100221329 | 3300005536 | Bacteria | 1613 |
| 107 | Ga0070696_100140480 | 3300005546 | Bacteria | 1765 |
| 108 | Ga0070665_100009447 | 3300005548 | Bacteria | 9868 |
| 109 | Ga0070665_100177174 | 3300005548 | Bacteria | 2133 |
| 110 | Ga0070665_100400326 | 3300005548 | Bacteria | 1381 |
| 111 | Ga0070665_100528921 | 3300005548 | Bacteria | 1191 |
| 112 | Ga0070704_100003527 | 3300005549 | Bacteria | 8991 |
| 113 | Ga0068855_100003228 | 3300005563 | Bacteria | 19958 |
| 114 | Ga0068855_100074762 | 3300005563 | Bacteria | 3935 |
| 115 | Ga0070664_100178493 | 3300005564 | Bacteria | 1886 |
| 116 | Ga0068857_100003813 | 3300005577 | Bacteria | 12689 |
| 117 | Ga0068857_100189294 | 3300005577 | Bacteria | 1874 |
| 118 | Ga0068857_100205778 | 3300005577 | Bacteria | 1795 |
| 119 | Ga0068857_100237652 | 3300005577 | Bacteria | 1667 |
| 120 | Ga0068854_100004870 | 3300005578 | Bacteria | 8469 |
| 121 | Ga0068856_100044294 | 3300005614 | Bacteria | 4379 |
| 122 | Ga0068856_100050407 | 3300005614 | Bacteria | 4104 |
| 123 | Ga0068856_100053183 | 3300005614 | Bacteria | 3993 |
| 124 | Ga0068856_100293476 | 3300005614 | Bacteria | 1643 |
| 125 | Ga0070702_100106183 | 3300005615 | Bacteria | 1732 |
| 126 | Ga0068852_100013251 | 3300005616 | Bacteria | 6304 |
| 127 | Ga0068852_100032189 | 3300005616 | Bacteria | 4339 |
| 128 | Ga0068859_100026922 | 3300005617 | Bacteria | 5768 |
| 129 | Ga0068864_100371197 | 3300005618 | Bacteria | 1354 |
| 130 | Ga0068866_10086795 | 3300005718 | Bacteria | 1694 |
| 131 | Ga0068863_100069219 | 3300005841 | Bacteria | 3337 |
| 132 | Ga0068863_100164044 | 3300005841 | Bacteria | 2130 |
| 133 | Ga0068858_100014268 | 3300005842 | Bacteria | 7491 |
| 134 | Ga0068860_100091443 | 3300005843 | Bacteria | 2899 |
| 135 | Ga0081455_10000011 | 3300005937 | Bacteria | 203132 |
| 136 | Ga0081455_10001379 | 3300005937 | Bacteria | 30031 |
| 137 | Ga0081455_10002490 | 3300005937 | Bacteria | 21865 |
| 138 | Ga0081455_10010065 | 3300005937 | Bacteria | 9653 |
| 139 | Ga0081538_10000096 | 3300005981 | Bacteria | 85350 |
| 140 | Ga0081538_10000683 | 3300005981 | Bacteria | 37259 |
| 141 | Ga0081538_10003211 | 3300005981 | Bacteria | 15539 |
| 142 | Ga0081538_10015613 | 3300005981 | Bacteria | 5868 |
| 143 | Ga0081538_10045506 | 3300005981 | Bacteria | 2719 |
| 144 | Ga0081540_1001167 | 3300005983 | Bacteria | 23071 |
| 145 | Ga0081540_1035454 | 3300005983 | Bacteria | 2675 |
| 146 | Ga0081539_10000031 | 3300005985 | Bacteria | 313232 |
| 147 | Ga0081539_10000125 | 3300005985 | Bacteria | 180646 |
| 148 | Ga0081539_10000880 | 3300005985 | Bacteria | 57394 |
| 149 | Ga0081539_10001247 | 3300005985 | Bacteria | 45247 |
| 150 | Ga0081539_10005361 | 3300005985 | Bacteria | 13136 |
| 151 | Ga0081539_10019294 | 3300005985 | Bacteria | 4675 |
| 152 | Ga0081539_10043244 | 3300005985 | Bacteria | 2614 |
| 153 | Ga0081539_10055623 | 3300005985 | Bacteria | 2200 |
| 154 | Ga0070717_10007065 | 3300006028 | Bacteria | 8317 |
| 155 | Ga0070717_10008992 | 3300006028 | Bacteria | 7492 |
| 156 | Ga0070717_10022617 | 3300006028 | Bacteria | 4970 |
| 157 | Ga0070717_10054698 | 3300006028 | Bacteria | 3292 |
| 158 | Ga0070717_10064309 | 3300006028 | Bacteria | 3047 |
| 159 | Ga0070717_10406454 | 3300006028 | Bacteria | 1224 |
| 160 | Ga0075365_10041752 | 3300006038 | Bacteria | 2998 |
| 161 | Ga0070715_10003954 | 3300006163 | Bacteria | 4797 |
| 162 | Ga0070716_100000595 | 3300006173 | Bacteria | 15242 |
| 163 | Ga0070716_100001061 | 3300006173 | Bacteria | 12045 |
| 164 | Ga0070716_100001465 | 3300006173 | Bacteria | 10523 |
| 165 | Ga0070712_100001269 | 3300006175 | Bacteria | 15240 |
| 166 | Ga0070712_100003884 | 3300006175 | Bacteria | 9203 |
| 167 | Ga0070712_100066882 | 3300006175 | Bacteria | 2556 |
| 168 | Ga0070712_100260480 | 3300006175 | Bacteria | 1389 |
| 169 | Ga0097621_100447613 | 3300006237 | Bacteria | 1163 |
| 170 | Ga0068871_100058876 | 3300006358 | Bacteria | 3129 |
| 171 | Ga0068871_100208787 | 3300006358 | Bacteria | 1688 |
| 172 | Ga0075428_100001352 | 3300006844 | Bacteria | 26013 |
| 173 | Ga0075428_100050775 | 3300006844 | Bacteria | 4548 |
| 174 | Ga0075428_100081251 | 3300006844 | Bacteria | 3537 |
| 175 | Ga0075428_100228842 | 3300006844 | Bacteria | 2006 |
| 176 | Ga0075428_100421086 | 3300006844 | Bacteria | 1431 |
| 177 | Ga0075430_100000841 | 3300006846 | Bacteria | 24051 |
| 178 | Ga0075430_100001655 | 3300006846 | Bacteria | 18191 |
| 179 | Ga0075430_100041988 | 3300006846 | Bacteria | 3868 |
| 180 | Ga0075430_100195235 | 3300006846 | Bacteria | 1682 |
| 181 | Ga0075431_100001081 | 3300006847 | Bacteria | 24380 |
| 182 | Ga0075431_100001242 | 3300006847 | Bacteria | 23127 |
| 183 | Ga0075431_100001775 | 3300006847 | Bacteria | 20331 |
| 184 | Ga0075431_100141635 | 3300006847 | Bacteria | 2479 |
| 185 | Ga0075431_100324049 | 3300006847 | Bacteria | 1553 |
| 186 | Ga0075433_10027137 | 3300006852 | Bacteria | 4855 |
| 187 | Ga0075433_10045051 | 3300006852 | Bacteria | 3833 |
| 188 | Ga0075434_100077178 | 3300006871 | Bacteria | 3326 |
| 189 | Ga0075434_100084877 | 3300006871 | Bacteria | 3165 |
| 190 | Ga0075434_100291622 | 3300006871 | Bacteria | 1651 |
| 191 | Ga0075429_100000965 | 3300006880 | Bacteria | 22839 |
| 192 | Ga0075429_100003370 | 3300006880 | Bacteria | 13623 |
| 193 | Ga0075429_100024528 | 3300006880 | Bacteria | 5232 |
| 194 | Ga0075429_100231364 | 3300006880 | Bacteria | 1619 |
| 195 | Ga0068865_100060094 | 3300006881 | Bacteria | 2660 |
| 196 | Ga0068865_100297947 | 3300006881 | Bacteria | 1290 |
| 197 | Ga0075436_100066555 | 3300006914 | Bacteria | 2490 |
| 198 | Ga0075436_100131142 | 3300006914 | Bacteria | 1758 |
| 199 | Ga0075436_100153198 | 3300006914 | Bacteria | 1623 |
| 200 | Ga0097620_100026922 | 3300006931 | Bacteria | 5768 |
| 201 | Ga0075435_100062794 | 3300007076 | Bacteria | 3015 |
| 202 | Ga0075435_100083185 | 3300007076 | Bacteria | 2631 |
| 203 | Ga0075435_100167264 | 3300007076 | Bacteria | 1854 |
| 204 | Ga0105240_10018527 | 3300009093 | Bacteria | 9345 |
| 205 | Ga0111539_10025324 | 3300009094 | Bacteria | 7273 |
| 206 | Ga0111539_10078454 | 3300009094 | Bacteria | 3885 |
| 207 | Ga0111539_10133624 | 3300009094 | Bacteria | 2905 |
| 208 | Ga0105245_10056611 | 3300009098 | Bacteria | 3525 |
| 209 | Ga0105247_10069278 | 3300009101 | Bacteria | 2201 |
| 210 | Ga0114129_10000058 | 3300009147 | Bacteria | 99035 |
| 211 | Ga0114129_10005485 | 3300009147 | Bacteria | 17929 |
| 212 | Ga0114129_10155995 | 3300009147 | Bacteria | 3122 |
| 213 | Ga0114129_10169762 | 3300009147 | Bacteria | 2975 |
| 214 | Ga0114129_10745257 | 3300009147 | Bacteria | 1254 |
| 215 | Ga0105241_10027630 | 3300009174 | Bacteria | 4226 |
| 216 | Ga0105241_10194552 | 3300009174 | Bacteria | 1690 |
| 217 | Ga0105242_10366346 | 3300009176 | Bacteria | 1335 |
| 218 | Ga0105248_10195572 | 3300009177 | Bacteria | 2278 |
| 219 | Ga0105248_10308662 | 3300009177 | Bacteria | 1781 |
| 220 | Ga0105237_10008954 | 3300009545 | Bacteria | 10776 |
| 221 | Ga0105237_10159166 | 3300009545 | Bacteria | 2256 |
| 222 | Ga0105238_10019534 | 3300009551 | Bacteria | 6900 |
| 223 | Ga0105238_10267385 | 3300009551 | Bacteria | 1690 |
| 224 | Ga0105238_10642741 | 3300009551 | Bacteria | 1070 |
| 225 | Ga0105249_10129478 | 3300009553 | Bacteria | 2407 |
| 226 | Ga0105239_10094560 | 3300010375 | Bacteria | 3301 |
| 227 | Ga0105239_10205977 | 3300010375 | Bacteria | 2204 |
| 228 | Ga0105246_10002872 | 3300011119 | Bacteria | 10424 |
| 229 | Ga0157371_10211198 | 3300013102 | Bacteria | 1393 |
| 230 | Ga0157369_10036202 | 3300013105 | Bacteria | 5409 |
| 231 | Ga0157369_10825311 | 3300013105 | Bacteria | 952 |
| 232 | Ga0157374_10212197 | 3300013296 | Bacteria | 1898 |
| 233 | Ga0163162_10066253 | 3300013306 | Bacteria | 3660 |
| 234 | Ga0163162_10194445 | 3300013306 | Bacteria | 2157 |
| 235 | Ga0163162_10214220 | 3300013306 | Bacteria | 2056 |
| 236 | Ga0157372_10001996 | 3300013307 | Bacteria | 22167 |
| 237 | Ga0157372_10164374 | 3300013307 | Bacteria | 2566 |
| 238 | Ga0157372_10322389 | 3300013307 | Bacteria | 1799 |
| 239 | Ga0157375_10005616 | 3300013308 | Bacteria | 10919 |
| 240 | Ga0157375_10053521 | 3300013308 | Bacteria | 3972 |
| 241 | Ga0157375_10136323 | 3300013308 | Bacteria | 2578 |
| 242 | Ga0157375_10406521 | 3300013308 | Bacteria | 1528 |
| 243 | Ga0163163_10071420 | 3300014325 | Bacteria | 3459 |
| 244 | Ga0182008_10182663 | 3300014497 | Bacteria | 1062 |
| 245 | Ga0157379_10046583 | 3300014968 | Bacteria | 3868 |
| 246 | Ga0157379_10097932 | 3300014968 | Bacteria | 2633 |
| 247 | Ga0157376_10483217 | 3300014969 | Bacteria | 1214 |
| 248 | Ga0206353_10382620 | 3300020082 | Bacteria | 1148 |
| 249 | Ga0206353_11255998 | 3300020082 | Bacteria | 2894 |
| 250 | Ga0206353_11258446 | 3300020082 | Bacteria | 7367 |
| 251 | Ga0213874_10091327 | 3300021377 | Bacteria | 1001 |
| 252 | Ga0213875_10000478 | 3300021388 | Bacteria | 34042 |
| 253 | Ga0213875_10009768 | 3300021388 | Bacteria | 4844 |
| 254 | Ga0213875_10048149 | 3300021388 | Bacteria | 2000 |
| 255 | Ga0213875_10099926 | 3300021388 | Bacteria | 1354 |
| 256 | Ga0207426_1000499 | 3300025302 | Bacteria | 58455 |
| 257 | Ga0207426_1007355 | 3300025302 | Bacteria | 4623 |
| 258 | Ga0207692_10004546 | 3300025898 | Bacteria | 5504 |
| 259 | Ga0207692_10023163 | 3300025898 | Bacteria | 2868 |
| 260 | Ga0207692_10075628 | 3300025898 | Bacteria | 1787 |
| 261 | Ga0207647_10030164 | 3300025904 | Bacteria | 3501 |
| 262 | Ga0207685_10001463 | 3300025905 | Bacteria | 4968 |
| 263 | Ga0207685_10004658 | 3300025905 | Bacteria | 3520 |
| 264 | Ga0207685_10072438 | 3300025905 | Bacteria | 1401 |
| 265 | Ga0207685_10103183 | 3300025905 | Bacteria | 1223 |
| 266 | Ga0207699_10001508 | 3300025906 | Bacteria | 11046 |
| 267 | Ga0207699_10001939 | 3300025906 | Bacteria | 9748 |
| 268 | Ga0207699_10011039 | 3300025906 | Bacteria | 4550 |
| 269 | Ga0207699_10018952 | 3300025906 | Bacteria | 3657 |
| 270 | Ga0207705_10189322 | 3300025909 | Bacteria | 1555 |
| 271 | Ga0207684_10000002 | 3300025910 | Bacteria | 1042751 |
| 272 | Ga0207684_10002291 | 3300025910 | Bacteria | 19467 |
| 273 | Ga0207684_10002641 | 3300025910 | Bacteria | 17935 |
| 274 | Ga0207684_10002850 | 3300025910 | Bacteria | 17173 |
| 275 | Ga0207684_10008669 | 3300025910 | Bacteria | 9026 |
| 276 | Ga0207684_10018622 | 3300025910 | Bacteria | 5945 |
| 277 | Ga0207684_10022633 | 3300025910 | Bacteria | 5364 |
| 278 | Ga0207684_10089133 | 3300025910 | Bacteria | 2628 |
| 279 | Ga0207684_10311106 | 3300025910 | Bacteria | 1358 |
| 280 | Ga0207684_10340073 | 3300025910 | Bacteria | 1292 |
| 281 | Ga0207707_10187999 | 3300025912 | Bacteria | 1802 |
| 282 | Ga0207695_10003301 | 3300025913 | Bacteria | 22902 |
| 283 | Ga0207671_10000530 | 3300025914 | Bacteria | 51452 |
| 284 | Ga0207693_10002126 | 3300025915 | Bacteria | 17279 |
| 285 | Ga0207693_10024034 | 3300025915 | Bacteria | 4838 |
| 286 | Ga0207693_10048025 | 3300025915 | Bacteria | 3353 |
| 287 | Ga0207693_10261780 | 3300025915 | Bacteria | 1356 |
| 288 | Ga0207693_10268076 | 3300025915 | Bacteria | 1338 |
| 289 | Ga0207663_10001522 | 3300025916 | Bacteria | 10839 |
| 290 | Ga0207663_10026213 | 3300025916 | Bacteria | 3380 |
| 291 | Ga0207663_10126979 | 3300025916 | Bacteria | 1756 |
| 292 | Ga0207663_10130246 | 3300025916 | Bacteria | 1737 |
| 293 | Ga0207660_10415032 | 3300025917 | Bacteria | 1085 |
| 294 | Ga0207657_10044330 | 3300025919 | Bacteria | 3910 |
| 295 | Ga0207657_10232922 | 3300025919 | Bacteria | 1472 |
| 296 | Ga0207652_10103736 | 3300025921 | Bacteria | 2514 |
| 297 | Ga0207652_10148697 | 3300025921 | Bacteria | 2097 |
| 298 | Ga0207646_10000127 | 3300025922 | Bacteria | 103693 |
| 299 | Ga0207646_10000636 | 3300025922 | Bacteria | 45698 |
| 300 | Ga0207646_10001890 | 3300025922 | Bacteria | 25222 |
| 301 | Ga0207646_10002282 | 3300025922 | Bacteria | 22805 |
| 302 | Ga0207646_10002637 | 3300025922 | Bacteria | 21065 |
| 303 | Ga0207646_10004843 | 3300025922 | Bacteria | 14422 |
| 304 | Ga0207646_10005535 | 3300025922 | Bacteria | 13275 |
| 305 | Ga0207646_10011947 | 3300025922 | Bacteria | 8374 |
| 306 | Ga0207646_10023563 | 3300025922 | Bacteria | 5652 |
| 307 | Ga0207646_10044142 | 3300025922 | Bacteria | 4001 |
| 308 | Ga0207646_10065517 | 3300025922 | Bacteria | 3244 |
| 309 | Ga0207646_10133234 | 3300025922 | Bacteria | 2237 |
| 310 | Ga0207646_10139688 | 3300025922 | Bacteria | 2181 |
| 311 | Ga0207646_10166926 | 3300025922 | Bacteria | 1987 |
| 312 | Ga0207646_10466250 | 3300025922 | Bacteria | 1139 |
| 313 | Ga0207694_10009232 | 3300025924 | Bacteria | 7442 |
| 314 | Ga0207694_10401490 | 3300025924 | Bacteria | 1140 |
| 315 | Ga0207659_10297901 | 3300025926 | Bacteria | 1324 |
| 316 | Ga0207687_10018827 | 3300025927 | Bacteria | 4565 |
| 317 | Ga0207700_10000518 | 3300025928 | Bacteria | 22664 |
| 318 | Ga0207700_10003056 | 3300025928 | Bacteria | 9654 |
| 319 | Ga0207700_10005407 | 3300025928 | Bacteria | 7635 |
| 320 | Ga0207700_10014702 | 3300025928 | Bacteria | 5138 |
| 321 | Ga0207700_10016541 | 3300025928 | Bacteria | 4903 |
| 322 | Ga0207700_10027370 | 3300025928 | Bacteria | 3991 |
| 323 | Ga0207700_10050721 | 3300025928 | Bacteria | 3093 |
| 324 | Ga0207700_10084221 | 3300025928 | Bacteria | 2492 |
| 325 | Ga0207664_10001398 | 3300025929 | Bacteria | 15864 |
| 326 | Ga0207664_10001442 | 3300025929 | Bacteria | 15635 |
| 327 | Ga0207664_10004201 | 3300025929 | Bacteria | 9734 |
| 328 | Ga0207664_10005044 | 3300025929 | Bacteria | 8986 |
| 329 | Ga0207664_10005696 | 3300025929 | Bacteria | 8515 |
| 330 | Ga0207664_10026984 | 3300025929 | Bacteria | 4348 |
| 331 | Ga0207664_10040219 | 3300025929 | Bacteria | 3634 |
| 332 | Ga0207664_10061820 | 3300025929 | Bacteria | 2989 |
| 333 | Ga0207664_10064871 | 3300025929 | Bacteria | 2922 |
| 334 | Ga0207664_10137800 | 3300025929 | Bacteria | 2061 |
| 335 | Ga0207664_10181544 | 3300025929 | Bacteria | 1807 |
| 336 | Ga0207664_10518450 | 3300025929 | Bacteria | 1068 |
| 337 | Ga0207644_10004903 | 3300025931 | Bacteria | 8721 |
| 338 | Ga0207686_10243978 | 3300025934 | Bacteria | 1309 |
| 339 | Ga0207665_10000328 | 3300025939 | Bacteria | 32913 |
| 340 | Ga0207665_10003721 | 3300025939 | Bacteria | 10187 |
| 341 | Ga0207665_10009995 | 3300025939 | Bacteria | 6230 |
| 342 | Ga0207665_10013943 | 3300025939 | Bacteria | 5287 |
| 343 | Ga0207665_10082244 | 3300025939 | Bacteria | 2219 |
| 344 | Ga0207665_10096508 | 3300025939 | Bacteria | 2056 |
| 345 | Ga0207691_10439271 | 3300025940 | Bacteria | 1111 |
| 346 | Ga0207661_10002423 | 3300025944 | Bacteria | 12856 |
| 347 | Ga0207661_10018617 | 3300025944 | Bacteria | 5162 |
| 348 | Ga0207661_10050929 | 3300025944 | Bacteria | 3302 |
| 349 | Ga0207679_10117532 | 3300025945 | Bacteria | 2110 |
| 350 | Ga0207679_10431708 | 3300025945 | Bacteria | 1165 |
| 351 | Ga0207667_10021913 | 3300025949 | Bacteria | 7072 |
| 352 | Ga0207667_10106607 | 3300025949 | Bacteria | 2890 |
| 353 | Ga0207712_10137887 | 3300025961 | Bacteria | 1868 |
| 354 | Ga0207668_10112720 | 3300025972 | Bacteria | 2044 |
| 355 | Ga0207640_10024260 | 3300025981 | Bacteria | 3657 |
| 356 | Ga0207677_10560809 | 3300026023 | Bacteria | 997 |
| 357 | Ga0207678_10000168 | 3300026067 | Bacteria | 55114 |
| 358 | Ga0207678_10006715 | 3300026067 | Bacteria | 10206 |
| 359 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 360 | Ga0207702_10027777 | 3300026078 | Bacteria | 4701 |
| 361 | Ga0207702_10031245 | 3300026078 | Bacteria | 4438 |
| 362 | Ga0207702_10079375 | 3300026078 | Bacteria | 2844 |
| 363 | Ga0207702_10207185 | 3300026078 | Bacteria | 1821 |
| 364 | Ga0207641_10043512 | 3300026088 | Bacteria | 3772 |
| 365 | Ga0207676_10359496 | 3300026095 | Bacteria | 1349 |
| 366 | Ga0207674_10015760 | 3300026116 | Bacteria | 8291 |
| 367 | Ga0207674_10229391 | 3300026116 | Bacteria | 1805 |
| 368 | Ga0207683_10072497 | 3300026121 | Bacteria | 3046 |
| 369 | Ga0207683_10174424 | 3300026121 | Bacteria | 1948 |
| 370 | Ga0207683_10283032 | 3300026121 | Bacteria | 1515 |
| 371 | Ga0207683_10371623 | 3300026121 | Bacteria | 1314 |
| 372 | Ga0207698_10074845 | 3300026142 | Bacteria | 2703 |
| 373 | Ga0207698_10411798 | 3300026142 | Bacteria | 1295 |
| 374 | Ga0268266_10005053 | 3300028379 | Bacteria | 12451 |
| 375 | Ga0268266_10163626 | 3300028379 | Bacteria | 2014 |
| 376 | Ga0268266_10428405 | 3300028379 | Bacteria | 1255 |
| 377 | Ga0268264_10007538 | 3300028381 | Bacteria | 9078 |
| 378 | Ga0268264_10117203 | 3300028381 | Bacteria | 2342 |
| 379 | Ga0265326_10002290 | 3300028558 | Bacteria | 6474 |
| 380 | Ga0265319_1001647 | 3300028563 | Bacteria | 12952 |
| 381 | Ga0265334_10031727 | 3300028573 | Bacteria | 2110 |
| 382 | Ga0265334_10053025 | 3300028573 | Bacteria | 1550 |
| 383 | Ga0265318_10000251 | 3300028577 | Bacteria | 46650 |
| 384 | Ga0265323_10085974 | 3300028653 | Bacteria | 1057 |
| 385 | Ga0265322_10001581 | 3300028654 | Bacteria | 7308 |
| 386 | Ga0265336_10050538 | 3300028666 | Bacteria | 1257 |
| 387 | Ga0307517_10003710 | 3300028786 | Bacteria | 23732 |
| 388 | Ga0307517_10149923 | 3300028786 | Bacteria | 1604 |
| 389 | Ga0307515_10055673 | 3300028794 | Bacteria | 5772 |
| 390 | Ga0307515_10058294 | 3300028794 | Bacteria | 5564 |
| 391 | Ga0265338_10003462 | 3300028800 | Bacteria | 22216 |
| 392 | Ga0265338_10022191 | 3300028800 | Bacteria | 6583 |
| 393 | Ga0307511_10105972 | 3300030521 | Bacteria | 1817 |
| 394 | Ga0307512_10002471 | 3300030522 | Bacteria | 23281 |
| 395 | Ga0307512_10029546 | 3300030522 | Bacteria | 4785 |
| 396 | Ga0316176_1098424 | 3300030732 | Bacteria | 2352 |
| 397 | Ga0265330_10000873 | 3300031235 | Bacteria | 18828 |
| 398 | Ga0265328_10016149 | 3300031239 | Bacteria | 2909 |
| 399 | Ga0265320_10020167 | 3300031240 | Bacteria | 3622 |
| 400 | Ga0265325_10000549 | 3300031241 | Bacteria | 27215 |
| 401 | Ga0265329_10007314 | 3300031242 | Bacteria | 4282 |
| 402 | Ga0265339_10001224 | 3300031249 | Bacteria | 19295 |
| 403 | Ga0265339_10048399 | 3300031249 | Bacteria | 2331 |
| 404 | Ga0265331_10002901 | 3300031250 | Bacteria | 11329 |
| 405 | Ga0265327_10007522 | 3300031251 | Bacteria | 8388 |
| 406 | Ga0265316_10059650 | 3300031344 | Bacteria | 2966 |
| 407 | Ga0307513_10004399 | 3300031456 | Bacteria | 18811 |
| 408 | Ga0307509_10163490 | 3300031507 | Bacteria | 2119 |
| 409 | Ga0307408_100192736 | 3300031548 | Bacteria | 1643 |
| 410 | Ga0265313_10001573 | 3300031595 | Bacteria | 21174 |
| 411 | Ga0307508_10016728 | 3300031616 | Bacteria | 6672 |
| 412 | Ga0307508_10025972 | 3300031616 | Bacteria | 5310 |
| 413 | Ga0265314_10003084 | 3300031711 | Bacteria | 16422 |
| 414 | Ga0265314_10223998 | 3300031711 | Bacteria | 1095 |
| 415 | Ga0265342_10050564 | 3300031712 | Bacteria | 2482 |
| 416 | Ga0307516_10039706 | 3300031730 | Bacteria | 4690 |
| 417 | Ga0307405_10005187 | 3300031731 | Bacteria | 6253 |
| 418 | Ga0307405_10145531 | 3300031731 | Bacteria | 1659 |
| 419 | Ga0307405_10503374 | 3300031731 | Bacteria | 971 |
| 420 | Ga0307413_10060041 | 3300031824 | Bacteria | 2339 |
| 421 | Ga0307413_10190450 | 3300031824 | Bacteria | 1472 |
| 422 | Ga0307413_10271870 | 3300031824 | Bacteria | 1269 |
| 423 | Ga0307518_10000753 | 3300031838 | Bacteria | 24372 |
| 424 | Ga0307410_10009253 | 3300031852 | Bacteria | 5515 |
| 425 | Ga0307410_10182015 | 3300031852 | Bacteria | 1591 |
| 426 | Ga0307410_10488949 | 3300031852 | Bacteria | 1011 |
| 427 | Ga0307406_10040475 | 3300031901 | Bacteria | 2898 |
| 428 | Ga0307406_10062946 | 3300031901 | Bacteria | 2401 |
| 429 | Ga0307406_10066450 | 3300031901 | Bacteria | 2347 |
| 430 | Ga0307406_10188219 | 3300031901 | Bacteria | 1509 |
| 431 | Ga0307407_10016313 | 3300031903 | Bacteria | 3696 |
| 432 | Ga0307407_10051293 | 3300031903 | Bacteria | 2364 |
| 433 | Ga0307407_10251655 | 3300031903 | Bacteria | 1211 |
| 434 | Ga0307407_10256360 | 3300031903 | Bacteria | 1201 |
| 435 | Ga0307412_10031488 | 3300031911 | Bacteria | 3351 |
| 436 | Ga0307412_10172566 | 3300031911 | Bacteria | 1618 |
| 437 | Ga0307409_100000071 | 3300031995 | Bacteria | 36779 |
| 438 | Ga0307409_100024549 | 3300031995 | Bacteria | 4207 |
| 439 | Ga0307409_100057751 | 3300031995 | Bacteria | 3009 |
| 440 | Ga0307409_100089250 | 3300031995 | Bacteria | 2519 |
| 441 | Ga0307409_100102196 | 3300031995 | Bacteria | 2381 |
| 442 | Ga0307409_100131220 | 3300031995 | Bacteria | 2141 |
| 443 | Ga0307409_100163008 | 3300031995 | Bacteria | 1952 |
| 444 | Ga0307409_100414433 | 3300031995 | Bacteria | 1290 |
| 445 | Ga0307409_100449796 | 3300031995 | Bacteria | 1243 |
| 446 | Ga0307409_100462483 | 3300031995 | Bacteria | 1227 |
| 447 | Ga0307416_100001030 | 3300032002 | Bacteria | 14792 |
| 448 | Ga0307416_100004996 | 3300032002 | Bacteria | 8089 |
| 449 | Ga0307416_100048502 | 3300032002 | Bacteria | 3370 |
| 450 | Ga0307416_100369102 | 3300032002 | Bacteria | 1460 |
| 451 | Ga0307416_100378104 | 3300032002 | Bacteria | 1445 |
| 452 | Ga0307416_100463641 | 3300032002 | Bacteria | 1323 |
| 453 | Ga0307416_100505111 | 3300032002 | Bacteria | 1274 |
| 454 | Ga0307414_10008167 | 3300032004 | Bacteria | 5918 |
| 455 | Ga0307414_10012761 | 3300032004 | Bacteria | 4983 |
| 456 | Ga0307414_10039837 | 3300032004 | Bacteria | 3169 |
| 457 | Ga0307414_10201324 | 3300032004 | Bacteria | 1620 |
| 458 | Ga0307414_10276068 | 3300032004 | Bacteria | 1410 |
| 459 | Ga0307414_10561185 | 3300032004 | Bacteria | 1019 |
| 460 | Ga0307411_10222463 | 3300032005 | Bacteria | 1465 |
| 461 | Ga0307411_10291205 | 3300032005 | Bacteria | 1305 |
| 462 | Ga0307415_100000029 | 3300032126 | Bacteria | 60960 |
| 463 | Ga0307415_100003722 | 3300032126 | Bacteria | 7805 |
| 464 | Ga0307415_100052011 | 3300032126 | Bacteria | 2783 |
| 465 | Ga0307415_100234480 | 3300032126 | Bacteria | 1480 |
| 466 | Ga0307507_10035050 | 3300033179 | Bacteria | 5166 |
| 467 | Ga0307507_10041429 | 3300033179 | Bacteria | 4607 |
| 468 | Ga0307507_10050953 | 3300033179 | Bacteria | 3989 |
| 469 | Ga0307507_10060094 | 3300033179 | Bacteria | 3552 |
| 470 | Ga0307507_10141064 | 3300033179 | Bacteria | 1847 |
| 471 | Ga0307510_10109379 | 3300033180 | Bacteria | 2513 |
| 472 | Ga0307510_10308021 | 3300033180 | Bacteria | 1044 |
| 473 | Ga0373959_0009704 | 3300034820 | Bacteria | 1668 |
| 474 | Ga0373938_0007787 | 3300034957 | Bacteria | 1895 |
| 475 | Ga0373926_0000519 | 3300035083 | Bacteria | 10262 |
| 476 | Ga0373926_0096018 | 3300035083 | Bacteria | 1106 |
| 477 | Ga0373934_0000021 | 3300035086 | Bacteria | 53680 |
| 478 | Ga0373934_0024594 | 3300035086 | Bacteria | 2329 |
| 479 | Ga0373934_0098490 | 3300035086 | Bacteria | 1181 |
| 480 | Ga0373944_0068460 | 3300035089 | Bacteria | 1152 |
| 481 | Ga0373923_0004679 | 3300035111 | Bacteria | 4563 |
| 482 | Ga0373923_0010612 | 3300035111 | Bacteria | 3357 |
| 483 | Ga0373936_0004294 | 3300035113 | Bacteria | 5385 |
| 484 | Ga0373953_0000328 | 3300035117 | Bacteria | 12808 |
| 485 | Ga0373953_0015221 | 3300035117 | Bacteria | 2782 |
| 486 | Ga0373953_0053827 | 3300035117 | Bacteria | 1632 |
| 487 | Ga0373954_0000423 | 3300035118 | Bacteria | 15767 |
| 488 | Ga0373954_0065264 | 3300035118 | Bacteria | 1722 |
| 489 | Ga0373956_0000073 | 3300035119 | Bacteria | 32947 |
| 490 | Ga0373956_0040603 | 3300035119 | Bacteria | 2064 |
| 491 | Ga0373957_0001129 | 3300035120 | Bacteria | 7067 |
| 492 | Ga0373957_0002490 | 3300035120 | Bacteria | 5273 |
| 493 | Ga0373957_0033523 | 3300035120 | Bacteria | 1897 |
| 494 | Ga0373960_0010343 | 3300035121 | Bacteria | 2277 |
| 495 | Ga0373946_0030361 | 3300035171 | Bacteria | 2157 |
| 496 | Ga0373946_0088180 | 3300035171 | Bacteria | 1370 |
| 497 | Ga0373946_0106513 | 3300035171 | Bacteria | 1263 |
| 498 | Ga0373955_0000125 | 3300035172 | Bacteria | 30520 |
| 499 | Ga0373955_0018959 | 3300035172 | Bacteria | 3431 |
| 500 | Ga0373955_0053354 | 3300035172 | Bacteria | 2207 |
| 501 | Ga0373955_0060314 | 3300035172 | Bacteria | 2092 |
| 502 | Ga0373955_0110222 | 3300035172 | Bacteria | 1591 |
| 503 | Ga0373955_0136826 | 3300035172 | Bacteria | 1433 |
| 504 | Ga0373961_0040398 | 3300035241 | Bacteria | 1344 |
| 505 | Ga0373924_0000419 | 3300035410 | Bacteria | 12985 |
| 506 | Ga0373924_0009943 | 3300035410 | Bacteria | 3499 |
| 507 | Ga0373924_0092327 | 3300035410 | Bacteria | 1296 |
| 508 | Ga0373924_0113884 | 3300035410 | Bacteria | 1170 |
| 509 | Ga0373931_0143690 | 3300035691 | Bacteria | 1385 |
| 510 | Ga0373935_0013995 | 3300035692 | Bacteria | 4844 |
| 511 | Ga0373935_0123081 | 3300035692 | Bacteria | 1735 |
| 512 | Ga0373933_0001491 | 3300035724 | Bacteria | 13704 |
| 513 | Ga0373933_0016762 | 3300035724 | Bacteria | 4103 |
| 514 | Ga0373933_0034210 | 3300035724 | Bacteria | 2960 |
| 515 | Ga0373933_0045281 | 3300035724 | Bacteria | 2608 |
| 516 | Ga0373947_0000012 | 3300035725 | Bacteria | 155188 |
| 517 | Ga0373947_0016297 | 3300035725 | Bacteria | 4272 |
| 518 | Ga0373947_0291208 | 3300035725 | Bacteria | 1087 |
| 519 | Ga0373937_0000169 | 3300036401 | Bacteria | 63595 |
| 520 | Ga0373937_0007973 | 3300036401 | Bacteria | 9182 |
| 521 | Ga0373937_0021311 | 3300036401 | Bacteria | 5816 |
| 522 | Ga0373937_0033154 | 3300036401 | Bacteria | 4688 |
| 523 | Ga0373937_0263563 | 3300036401 | Bacteria | 1625 |
| 524 | Ga0373925_0146670 | 3300037068 | Bacteria | 1850 |
| 525 | Ga0395899_0364632 | 3300037312 | Bacteria | 963 |
| 526 | Ga0395900_0028475 | 3300037418 | Bacteria | 5723 |
| 527 | Ga0395900_0179248 | 3300037418 | Bacteria | 2154 |
| 528 | Ga0395900_0394700 | 3300037418 | Bacteria | 1349 |
| 529 | Ga0395898_0141809 | 3300037466 | Bacteria | 2300 |
| 530 | Ga0395898_0170849 | 3300037466 | Bacteria | 2078 |
| 531 | Ga0436364_0383821 | 3300037853 | Bacteria | 1564 |
| 532 | Ga0436364_0771738 | 3300037853 | Bacteria | 63638 |
| 533 | Ga0436364_0776813 | 3300037853 | Bacteria | 1126 |
| 534 | Ga0436364_1115153 | 3300037853 | Bacteria | 2069 |
| 535 | Ga0395901_0094169 | 3300038443 | Bacteria | 3137 |
| 536 | Ga0395901_0114765 | 3300038443 | Bacteria | 2829 |
| 537 | Ga0395901_0355088 | 3300038443 | Bacteria | 1512 |
| 538 | Ga0395901_0549672 | 3300038443 | Bacteria | 1170 |
| 539 | Ga0436363_0330691 | 3300039450 | Bacteria | 1863 |
| 540 | Ga0436363_1688649 | 3300039450 | Bacteria | 1522 |
| 541 | Ga0439439_0015490 | 3300041406 | Bacteria | 1863 |
| 542 | Ga0439466_0027522 | 3300041411 | Bacteria | 1969 |
| 543 | Ga0451853_0418742 | 3300041512 | Bacteria | 8558 |
| 544 | Ga0439433_0003783 | 3300041999 | Bacteria | 3253 |
| 545 | Ga0439449_0000547 | 3300042007 | Bacteria | 14102 |
| 546 | Ga0439449_0026449 | 3300042007 | Bacteria | 2166 |
| 547 | Ga0439455_0015758 | 3300042012 | Bacteria | 1741 |
| 548 | Ga0439463_012907 | 3300042016 | Bacteria | 2054 |
| 549 | Ga0450894_000030 | 3300042131 | Bacteria | 20068 |
| 550 | Ga0450896_002861 | 3300042133 | Bacteria | 2257 |
| 551 | Ga0450908_018391 | 3300042184 | Bacteria | 1236 |
| 552 | Ga0439440_0019313 | 3300042993 | Bacteria | 1519 |
| 553 | Ga0466969_0001393 | 3300044656 | Bacteria | 13038 |
| 554 | Ga0466969_0001519 | 3300044656 | Bacteria | 12499 |
| 555 | Ga0466969_0011231 | 3300044656 | Bacteria | 4740 |
| 556 | Ga0466969_0027492 | 3300044656 | Bacteria | 2913 |
| 557 | Ga0466969_0034637 | 3300044656 | Bacteria | 2558 |
| 558 | Ga0466972_0004598 | 3300044658 | Bacteria | 6918 |
| 559 | Ga0466972_0018756 | 3300044658 | Bacteria | 3457 |
| 560 | Ga0466972_0042721 | 3300044658 | Bacteria | 2202 |
| 561 | Ga0466965_0000947 | 3300044683 | Bacteria | 11168 |
| 562 | Ga0466965_0002500 | 3300044683 | Bacteria | 7823 |
| 563 | Ga0466965_0133587 | 3300044683 | Bacteria | 1288 |
| 564 | Ga0466966_0002213 | 3300044684 | Bacteria | 12648 |
| 565 | Ga0466966_0039397 | 3300044684 | Bacteria | 3043 |
| 566 | Ga0466966_0040037 | 3300044684 | Bacteria | 3016 |
| 567 | Ga0466961_0014213 | 3300044693 | Bacteria | 5109 |
| 568 | Ga0466961_0075824 | 3300044693 | Bacteria | 2131 |
| 569 | Ga0466961_0079663 | 3300044693 | Bacteria | 2074 |
| 570 | Ga0466961_0237177 | 3300044693 | Bacteria | 1122 |
| 571 | Ga0466963_0022444 | 3300044694 | Bacteria | 3997 |
| 572 | Ga0466963_0063650 | 3300044694 | Bacteria | 2469 |
| 573 | Ga0466963_0095896 | 3300044694 | Bacteria | 2025 |
| 574 | Ga0466963_0140822 | 3300044694 | Bacteria | 1671 |
| 575 | Ga0466963_0165563 | 3300044694 | Bacteria | 1540 |
| 576 | Ga0466964_0038411 | 3300044706 | Bacteria | 1925 |
| 577 | Ga0466964_0115185 | 3300044706 | Bacteria | 1204 |
| 578 | Ga0466971_0000368 | 3300044719 | Bacteria | 17381 |
| 579 | Ga0466971_0009808 | 3300044719 | Bacteria | 4180 |
| 580 | Ga0466968_0012689 | 3300044735 | Bacteria | 3305 |
| 581 | Ga0466968_0086609 | 3300044735 | Bacteria | 1383 |
| 582 | Ga0466970_0004353 | 3300044765 | Bacteria | 6974 |
| 583 | Ga0466970_0077750 | 3300044765 | Bacteria | 1789 |
| 584 | Ga0466970_0180022 | 3300044765 | Bacteria | 1173 |
| 585 | Ga0466957_0033625 | 3300044842 | Bacteria | 3076 |
| 586 | Ga0466957_0038565 | 3300044842 | Bacteria | 2879 |
| 587 | Ga0466957_0213611 | 3300044842 | Bacteria | 1271 |
| 588 | Ga0466960_0000646 | 3300044901 | Bacteria | 12081 |
| 589 | Ga0466960_0014072 | 3300044901 | Bacteria | 3414 |
| 590 | Ga0466960_0107141 | 3300044901 | Bacteria | 1447 |
| 591 | Ga0466960_0158726 | 3300044901 | Bacteria | 1213 |
| 592 | Ga0466959_0001945 | 3300045049 | Bacteria | 13009 |
| 593 | Ga0466959_0007600 | 3300045049 | Bacteria | 7615 |
| 594 | Ga0466959_0041292 | 3300045049 | Bacteria | 3405 |
| 595 | Ga0466959_0049520 | 3300045049 | Bacteria | 3087 |
| 596 | Ga0451576_0046870 | 3300045051 | Bacteria | 4549 |
| 597 | Ga0466958_0008607 | 3300045836 | Bacteria | 5664 |
| 598 | Ga0466958_0048578 | 3300045836 | Bacteria | 2565 |
| 599 | Ga0466958_0065679 | 3300045836 | Bacteria | 2214 |
| 600 | Ga0466967_0000767 | 3300045976 | Bacteria | 16624 |
| 601 | Ga0466967_0007908 | 3300045976 | Bacteria | 7731 |
| 602 | Ga0466967_0078227 | 3300045976 | Bacteria | 2979 |
| 603 | Ga0466967_0079181 | 3300045976 | Bacteria | 2962 |
| 604 | Ga0466967_0090629 | 3300045976 | Bacteria | 2778 |
| 605 | Ga0466967_0106994 | 3300045976 | Bacteria | 2565 |
| 606 | Ga0466967_0161671 | 3300045976 | Bacteria | 2102 |
| 607 | Ga0466967_0214119 | 3300045976 | Bacteria | 1828 |
| 608 | Ga0466967_0346449 | 3300045976 | Bacteria | 1437 |
| 609 | Ga0466967_0348110 | 3300045976 | Bacteria | 1434 |
| 610 | Ga0466967_0403108 | 3300045976 | Bacteria | 1331 |
| 611 | Ga0466967_0479042 | 3300045976 | Bacteria | 1219 |
| 612 | Ga0466967_0549385 | 3300045976 | Bacteria | 1137 |
| 613 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 614 | Ga0495592_0004032 | 3300046454 | Bacteria | 10669 |
| 615 | Ga0495592_0013978 | 3300046454 | Bacteria | 6097 |
| 616 | Ga0495592_0111702 | 3300046454 | Bacteria | 1933 |
| 617 | Ga0495592_0162615 | 3300046454 | Bacteria | 1534 |
| 618 | Ga0495603_0041124 | 3300046455 | Bacteria | 2765 |
| 619 | Ga0495603_0164913 | 3300046455 | Bacteria | 1284 |
| 620 | Ga0495590_0028614 | 3300046457 | Bacteria | 1954 |
| 621 | Ga0495629_0013328 | 3300046459 | Bacteria | 5931 |
| 622 | Ga0495629_0042855 | 3300046459 | Bacteria | 3179 |
| 623 | Ga0495641_0005969 | 3300046461 | Bacteria | 8026 |
| 624 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 625 | Ga0495651_0005798 | 3300046462 | Bacteria | 9426 |
| 626 | Ga0495651_0022065 | 3300046462 | Bacteria | 4950 |
| 627 | Ga0495651_0028953 | 3300046462 | Bacteria | 4319 |
| 628 | Ga0495651_0032487 | 3300046462 | Bacteria | 4070 |
| 629 | Ga0495651_0038132 | 3300046462 | Bacteria | 3742 |
| 630 | Ga0495651_0146117 | 3300046462 | Bacteria | 1709 |
| 631 | Ga0495653_0003317 | 3300046463 | Bacteria | 12925 |
| 632 | Ga0495653_0031568 | 3300046463 | Bacteria | 4210 |
| 633 | Ga0495653_0031576 | 3300046463 | Bacteria | 4209 |
| 634 | Ga0495653_0085186 | 3300046463 | Bacteria | 2325 |
| 635 | Ga0495650_0021622 | 3300046471 | Bacteria | 3103 |
| 636 | Ga0495580_0011800 | 3300046472 | Bacteria | 6745 |
| 637 | Ga0495662_0002341 | 3300046476 | Bacteria | 9547 |
| 638 | Ga0495662_0008311 | 3300046476 | Bacteria | 5105 |
| 639 | Ga0495662_0045589 | 3300046476 | Bacteria | 2116 |
| 640 | Ga0495662_0100866 | 3300046476 | Bacteria | 1412 |
| 641 | Ga0495664_0001695 | 3300046477 | Bacteria | 11711 |
| 642 | Ga0495664_0002877 | 3300046477 | Bacteria | 9276 |
| 643 | Ga0495664_0014217 | 3300046477 | Bacteria | 4509 |
| 644 | Ga0495664_0047702 | 3300046477 | Bacteria | 2542 |
| 645 | Ga0495594_0042224 | 3300046499 | Bacteria | 2497 |
| 646 | Ga0495607_0153336 | 3300046501 | Bacteria | 1177 |
| 647 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 648 | Ga0495608_0003305 | 3300046511 | Bacteria | 11527 |
| 649 | Ga0495608_0013648 | 3300046511 | Bacteria | 5636 |
| 650 | Ga0495608_0026966 | 3300046511 | Bacteria | 3912 |
| 651 | Ga0495608_0027784 | 3300046511 | Bacteria | 3847 |
| 652 | Ga0495618_0025440 | 3300046514 | Bacteria | 3673 |
| 653 | Ga0495618_0029916 | 3300046514 | Bacteria | 3400 |
| 654 | Ga0495618_0066094 | 3300046514 | Bacteria | 2298 |
| 655 | Ga0495618_0155516 | 3300046514 | Bacteria | 1459 |
| 656 | Ga0495628_0001347 | 3300046516 | Bacteria | 22500 |
| 657 | Ga0495628_0008742 | 3300046516 | Bacteria | 8669 |
| 658 | Ga0495628_0070586 | 3300046516 | Bacteria | 2723 |
| 659 | Ga0495628_0144248 | 3300046516 | Bacteria | 1816 |
| 660 | Ga0495628_0402929 | 3300046516 | Bacteria | 999 |
| 661 | Ga0495630_0015629 | 3300046517 | Bacteria | 5546 |
| 662 | Ga0495630_0022964 | 3300046517 | Bacteria | 4608 |
| 663 | Ga0495630_0034683 | 3300046517 | Bacteria | 3768 |
| 664 | Ga0495630_0093672 | 3300046517 | Bacteria | 2270 |
| 665 | Ga0495632_0053454 | 3300046519 | Bacteria | 1983 |
| 666 | Ga0495643_0001950 | 3300046522 | Bacteria | 17355 |
| 667 | Ga0495666_0006058 | 3300046526 | Bacteria | 6090 |
| 668 | Ga0495666_0084350 | 3300046526 | Bacteria | 1501 |
| 669 | Ga0495652_0000119 | 3300046529 | Bacteria | 85582 |
| 670 | Ga0495652_0012613 | 3300046529 | Bacteria | 7617 |
| 671 | Ga0495652_0022390 | 3300046529 | Bacteria | 5605 |
| 672 | Ga0495652_0127208 | 3300046529 | Bacteria | 2022 |
| 673 | Ga0495665_0000841 | 3300046531 | Bacteria | 16056 |
| 674 | Ga0495665_0001405 | 3300046531 | Bacteria | 12895 |
| 675 | Ga0495665_0071471 | 3300046531 | Bacteria | 1827 |
| 676 | Ga0495640_0005739 | 3300046533 | Bacteria | 9865 |
| 677 | Ga0495640_0007423 | 3300046533 | Bacteria | 8621 |
| 678 | Ga0495640_0016595 | 3300046533 | Bacteria | 5506 |
| 679 | Ga0495640_0023486 | 3300046533 | Bacteria | 4490 |
| 680 | Ga0495640_0073012 | 3300046533 | Bacteria | 2297 |
| 681 | Ga0495640_0229997 | 3300046533 | Bacteria | 1166 |
| 682 | Ga0495586_0003139 | 3300046535 | Bacteria | 8891 |
| 683 | Ga0495586_0059581 | 3300046535 | Bacteria | 2074 |
| 684 | Ga0495587_0000374 | 3300046536 | Bacteria | 31849 |
| 685 | Ga0495587_0007080 | 3300046536 | Bacteria | 7274 |
| 686 | Ga0495645_0004499 | 3300046543 | Bacteria | 9510 |
| 687 | Ga0495645_0005026 | 3300046543 | Bacteria | 9062 |
| 688 | Ga0495645_0043653 | 3300046543 | Bacteria | 3270 |
| 689 | Ga0495645_0067098 | 3300046543 | Bacteria | 2590 |
| 690 | Ga0495645_0164977 | 3300046543 | Bacteria | 1528 |
| 691 | Ga0495645_0216205 | 3300046543 | Bacteria | 1291 |
| 692 | Ga0495667_0000114 | 3300046559 | Bacteria | 58520 |
| 693 | Ga0495667_0012288 | 3300046559 | Bacteria | 5803 |
| 694 | Ga0495667_0013427 | 3300046559 | Bacteria | 5546 |
| 695 | Ga0495667_0016983 | 3300046559 | Bacteria | 4914 |
| 696 | Ga0495667_0024286 | 3300046559 | Bacteria | 4082 |
| 697 | Ga0495667_0123047 | 3300046559 | Bacteria | 1674 |
| 698 | Ga0495656_0038922 | 3300046615 | Bacteria | 1972 |
| 699 | Ga0495668_0000632 | 3300046616 | Bacteria | 42377 |
| 700 | Ga0495634_0013542 | 3300046642 | Bacteria | 5890 |
| 701 | Ga0495634_0018221 | 3300046642 | Bacteria | 5001 |
| 702 | Ga0495634_0020934 | 3300046642 | Bacteria | 4632 |
| 703 | Ga0495625_0000797 | 3300046660 | Bacteria | 43641 |
| 704 | Ga0495635_0169439 | 3300046663 | Bacteria | 1485 |
| 705 | Ga0495661_0167380 | 3300046665 | Bacteria | 1175 |
| 706 | Ga0495588_0091949 | 3300046674 | Bacteria | 1590 |
| 707 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 708 | Ga0495657_0008842 | 3300046675 | Bacteria | 7668 |
| 709 | Ga0495657_0009938 | 3300046675 | Bacteria | 7180 |
| 710 | Ga0495657_0010350 | 3300046675 | Bacteria | 7021 |
| 711 | Ga0495657_0014048 | 3300046675 | Bacteria | 5882 |
| 712 | Ga0495657_0114000 | 3300046675 | Bacteria | 1709 |
| 713 | Ga0495657_0179996 | 3300046675 | Bacteria | 1298 |
| 714 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 715 | Ga0495599_0003479 | 3300046678 | Bacteria | 9214 |
| 716 | Ga0495599_0008444 | 3300046678 | Bacteria | 6260 |
| 717 | Ga0495599_0146158 | 3300046678 | Bacteria | 1465 |
| 718 | Ga0495623_0000522 | 3300046679 | Bacteria | 25418 |
| 719 | Ga0495623_0037650 | 3300046679 | Bacteria | 3094 |
| 720 | Ga0495623_0084230 | 3300046679 | Bacteria | 1962 |
| 721 | Ga0495623_0109597 | 3300046679 | Bacteria | 1674 |
| 722 | Ga0495646_0029012 | 3300046680 | Bacteria | 3461 |
| 723 | Ga0495646_0098230 | 3300046680 | Bacteria | 1682 |
| 724 | Ga0495646_0134089 | 3300046680 | Bacteria | 1391 |
| 725 | Ga0495658_0009574 | 3300046683 | Bacteria | 4832 |
| 726 | Ga0495613_0004179 | 3300046689 | Bacteria | 10809 |
| 727 | Ga0495613_0019996 | 3300046689 | Bacteria | 4989 |
| 728 | Ga0495624_0060790 | 3300046690 | Bacteria | 2368 |
| 729 | Ga0495624_0075676 | 3300046690 | Bacteria | 2090 |
| 730 | Ga0495624_0177746 | 3300046690 | Bacteria | 1298 |
| 731 | Ga0495670_0013201 | 3300046691 | Bacteria | 4063 |
| 732 | Ga0495589_0011288 | 3300046794 | Bacteria | 4637 |
| 733 | Ga0495600_0012627 | 3300046809 | Bacteria | 5287 |
| 734 | Ga0495600_0014145 | 3300046809 | Bacteria | 5026 |
| 735 | Ga0495600_0035048 | 3300046809 | Bacteria | 3259 |
| 736 | Ga0495660_0015609 | 3300046810 | Bacteria | 4388 |
| 737 | Ga0495581_0003301 | 3300047315 | Bacteria | 9269 |
| 738 | Ga0495581_0007284 | 3300047315 | Bacteria | 6400 |
| 739 | Ga0495581_0024807 | 3300047315 | Bacteria | 3475 |
| 740 | Ga0495604_0000121 | 3300047317 | Bacteria | 65991 |
| 741 | Ga0495604_0002938 | 3300047317 | Bacteria | 13655 |
| 742 | Ga0495604_0003376 | 3300047317 | Bacteria | 12733 |
| 743 | Ga0495604_0003492 | 3300047317 | Bacteria | 12528 |
| 744 | Ga0495604_0023093 | 3300047317 | Bacteria | 4963 |
| 745 | Ga0495604_0038784 | 3300047317 | Bacteria | 3748 |
| 746 | Ga0495604_0087252 | 3300047317 | Bacteria | 2324 |
| 747 | Ga0495604_0232316 | 3300047317 | Bacteria | 1264 |
| 748 | Ga0495674_0006966 | 3300047319 | Bacteria | 10815 |
| 749 | Ga0495674_0041694 | 3300047319 | Bacteria | 4098 |
| 750 | Ga0495674_0062397 | 3300047319 | Bacteria | 3245 |
| 751 | Ga0495674_0094211 | 3300047319 | Bacteria | 2554 |
| 752 | Ga0495676_0013435 | 3300047321 | Bacteria | 7357 |
| 753 | Ga0495676_0057269 | 3300047321 | Bacteria | 3076 |
| 754 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 755 | Ga0495680_0007021 | 3300047322 | Bacteria | 10384 |
| 756 | Ga0495680_0034597 | 3300047322 | Bacteria | 4077 |
| 757 | Ga0495680_0091405 | 3300047322 | Bacteria | 2281 |
| 758 | Ga0495680_0136922 | 3300047322 | Bacteria | 1795 |
| 759 | Ga0495683_0029464 | 3300047323 | Bacteria | 2805 |
| 760 | Ga0495675_0000346 | 3300047444 | Bacteria | 32587 |
| 761 | Ga0495675_0003295 | 3300047444 | Bacteria | 9708 |
| 762 | Ga0495675_0003780 | 3300047444 | Bacteria | 9153 |
| 763 | Ga0495675_0012881 | 3300047444 | Bacteria | 5270 |
| 764 | Ga0495675_0017543 | 3300047444 | Bacteria | 4537 |
| 765 | Ga0495675_0024610 | 3300047444 | Bacteria | 3839 |
| 766 | Ga0495675_0114393 | 3300047444 | Bacteria | 1683 |
| 767 | Ga0495685_000223 | 3300047447 | Bacteria | 19334 |
| 768 | Ga0495681_0000654 | 3300047470 | Bacteria | 26355 |
| 769 | Ga0495684_0015097 | 3300047471 | Bacteria | 5948 |
| 770 | Ga0495684_0020685 | 3300047471 | Bacteria | 5070 |
| 771 | Ga0495684_0032859 | 3300047471 | Bacteria | 3985 |
| 772 | Ga0495684_0033418 | 3300047471 | Bacteria | 3944 |
| 773 | Ga0495684_0121422 | 3300047471 | Bacteria | 1967 |
| 774 | Ga0495684_0156602 | 3300047471 | Bacteria | 1701 |
| 775 | Ga0495684_0209143 | 3300047471 | Bacteria | 1435 |
| 776 | Ga0495684_0350267 | 3300047471 | Bacteria | 1048 |
| 777 | Ga0495593_0004457 | 3300047673 | Bacteria | 8322 |
| 778 | Ga0495593_0025558 | 3300047673 | Bacteria | 3268 |
| 779 | Ga0495593_0056538 | 3300047673 | Bacteria | 2062 |
| 780 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 781 | Ga0495602_0008130 | 3300048088 | Bacteria | 10954 |
| 782 | Ga0495602_0022114 | 3300048088 | Bacteria | 6232 |
| 783 | Ga0495602_0049974 | 3300048088 | Bacteria | 3740 |
| 784 | Ga0495602_0090966 | 3300048088 | Bacteria | 2532 |
| 785 | Ga0495626_0000581 | 3300048091 | Bacteria | 36264 |
| 786 | Ga0496100_0126154 | 3300048903 | Bacteria | 1796 |
| 787 | Ga0496100_0341163 | 3300048903 | Bacteria | 1130 |
| 788 | Ga0496101_0110785 | 3300048904 | Bacteria | 2066 |
| 789 | Ga0496102_0022743 | 3300048905 | Bacteria | 5557 |
| 790 | Ga0496102_0091395 | 3300048905 | Bacteria | 2817 |
| 791 | Ga0496102_0357441 | 3300048905 | Bacteria | 1375 |
| 792 | Ga0496102_0505222 | 3300048905 | Bacteria | 1131 |
| 793 | Ga0496102_0548913 | 3300048905 | Bacteria | 1078 |
| 794 | Ga0496103_0111620 | 3300048906 | Bacteria | 1737 |
| 795 | Ga0496104_0000600 | 3300048907 | Bacteria | 30850 |
| 796 | Ga0496104_0050173 | 3300048907 | Bacteria | 3937 |
| 797 | Ga0496104_0188724 | 3300048907 | Bacteria | 1972 |
| 798 | Ga0496105_0011198 | 3300048908 | Bacteria | 7076 |
| 799 | Ga0496105_0075457 | 3300048908 | Bacteria | 2784 |
| 800 | Ga0496105_0091725 | 3300048908 | Bacteria | 2508 |
| 801 | Ga0496105_0098448 | 3300048908 | Bacteria | 2415 |
| 802 | Ga0496106_0149256 | 3300048909 | Bacteria | 1843 |
| 803 | Ga0496106_0200629 | 3300048909 | Bacteria | 1587 |
| 804 | Ga0496106_0343267 | 3300048909 | Bacteria | 1199 |
| 805 | Ga0496107_0070168 | 3300048910 | Bacteria | 2544 |
| 806 | Ga0496107_0237196 | 3300048910 | Bacteria | 1357 |
| 807 | Ga0496107_0305996 | 3300048910 | Bacteria | 1183 |
| 808 | Ga0496108_0050723 | 3300048911 | Bacteria | 3474 |
| 809 | Ga0496108_0071004 | 3300048911 | Bacteria | 2938 |
| 810 | Ga0496108_0076762 | 3300048911 | Bacteria | 2824 |
| 811 | Ga0496108_0252088 | 3300048911 | Bacteria | 1535 |
| 812 | Ga0496108_0316972 | 3300048911 | Bacteria | 1359 |
| 813 | Ga0496109_0010422 | 3300048912 | Bacteria | 7939 |
| 814 | Ga0496109_0018991 | 3300048912 | Bacteria | 6054 |
| 815 | Ga0496109_0131677 | 3300048912 | Bacteria | 2334 |
| 816 | Ga0496109_0245531 | 3300048912 | Bacteria | 1685 |
| 817 | Ga0496110_0029877 | 3300048913 | Bacteria | 4696 |
| 818 | Ga0496110_0260791 | 3300048913 | Bacteria | 1577 |
| 819 | Ga0496111_0041212 | 3300048914 | Bacteria | 3313 |
| 820 | Ga0496111_0075282 | 3300048914 | Bacteria | 2459 |
| 821 | Ga0496111_0207339 | 3300048914 | Bacteria | 1456 |
| 822 | Ga0496112_0015213 | 3300048915 | Bacteria | 7171 |
| 823 | Ga0496112_0024759 | 3300048915 | Bacteria | 5755 |
| 824 | Ga0496113_0013081 | 3300048916 | Bacteria | 5604 |
| 825 | Ga0496113_0058609 | 3300048916 | Bacteria | 2898 |
| 826 | Ga0496113_0071667 | 3300048916 | Bacteria | 2636 |
| 827 | Ga0496113_0211415 | 3300048916 | Bacteria | 1544 |
| 828 | Ga0496113_0283687 | 3300048916 | Bacteria | 1324 |
| 829 | Ga0496114_0084678 | 3300048917 | Bacteria | 2685 |
| 830 | Ga0496115_0061249 | 3300048918 | Bacteria | 3034 |
| 831 | Ga0501306_016613 | 3300049127 | Bacteria | 991 |
| 832 | Ga0501031_0007875 | 3300049568 | Bacteria | 6934 |
| 833 | Ga0501031_0051483 | 3300049568 | Bacteria | 2682 |
| 834 | Ga0501031_0094205 | 3300049568 | Bacteria | 1954 |
| 835 | Ga0501032_0011354 | 3300049569 | Bacteria | 6398 |
| 836 | Ga0501034_0001939 | 3300049571 | Bacteria | 26203 |
| 837 | Ga0501034_0018672 | 3300049571 | Bacteria | 7107 |
| 838 | Ga0501034_0030498 | 3300049571 | Bacteria | 5482 |
| 839 | Ga0501036_0014365 | 3300049572 | Bacteria | 6593 |
| 840 | Ga0501036_0091441 | 3300049572 | Bacteria | 2570 |
| 841 | Ga0501036_0139400 | 3300049572 | Bacteria | 2047 |
| 842 | Ga0501037_0069864 | 3300049573 | Bacteria | 2556 |
| 843 | Ga0501037_0153098 | 3300049573 | Bacteria | 1647 |
| 844 | Ga0501037_0166246 | 3300049573 | Bacteria | 1571 |
| 845 | Ga0501037_0314737 | 3300049573 | Bacteria | 1085 |
| 846 | Ga0501038_0007410 | 3300049574 | Bacteria | 10120 |
| 847 | Ga0501039_0069388 | 3300049575 | Bacteria | 2737 |
| 848 | Ga0501039_0071197 | 3300049575 | Bacteria | 2702 |
| 849 | Ga0501039_0127215 | 3300049575 | Bacteria | 1999 |
| 850 | Ga0501039_0151585 | 3300049575 | Bacteria | 1821 |
| 851 | Ga0501040_0002194 | 3300049576 | Bacteria | 12583 |
| 852 | Ga0501040_0012124 | 3300049576 | Bacteria | 5644 |
| 853 | Ga0501041_0011862 | 3300049577 | Bacteria | 5159 |
| 854 | Ga0501041_0198609 | 3300049577 | Bacteria | 1257 |
| 855 | Ga0501042_0006044 | 3300049578 | Bacteria | 7840 |
| 856 | Ga0501042_0011625 | 3300049578 | Bacteria | 5947 |
| 857 | Ga0501042_0045520 | 3300049578 | Bacteria | 3127 |
| 858 | Ga0501042_0182028 | 3300049578 | Bacteria | 1516 |
| 859 | Ga0501043_0001474 | 3300049579 | Bacteria | 20563 |
| 860 | Ga0501043_0015282 | 3300049579 | Bacteria | 6013 |
| 861 | Ga0501046_0044949 | 3300049580 | Bacteria | 3511 |
| 862 | Ga0501047_0000023 | 3300049581 | Bacteria | 240478 |
| 863 | Ga0501047_0001834 | 3300049581 | Bacteria | 20518 |
| 864 | Ga0501047_0079764 | 3300049581 | Bacteria | 3147 |
| 865 | Ga0501048_0002840 | 3300049582 | Bacteria | 13223 |
| 866 | Ga0501048_0107090 | 3300049582 | Bacteria | 1973 |
| 867 | Ga0501048_0176683 | 3300049582 | Bacteria | 1513 |
| 868 | Ga0501069_0199898 | 3300049585 | Bacteria | 1158 |
| 869 | Ga0501071_0073222 | 3300049587 | Bacteria | 2498 |
| 870 | Ga0501071_0092974 | 3300049587 | Bacteria | 2217 |
| 871 | Ga0501071_0110459 | 3300049587 | Bacteria | 2032 |
| 872 | Ga0501072_0043733 | 3300049588 | Bacteria | 3521 |
| 873 | Ga0501074_0007659 | 3300049590 | Bacteria | 7818 |
| 874 | Ga0501074_0041280 | 3300049590 | Bacteria | 3341 |
| 875 | Ga0501074_0101347 | 3300049590 | Bacteria | 2061 |
| 876 | Ga0501075_0219358 | 3300049591 | Bacteria | 1451 |
| 877 | Ga0501075_0555235 | 3300049591 | Bacteria | 876 |
| 878 | Ga0501076_0045545 | 3300049592 | Bacteria | 3463 |
| 879 | Ga0501076_0130345 | 3300049592 | Bacteria | 2039 |
| 880 | Ga0501076_0416498 | 3300049592 | Bacteria | 1105 |
| 881 | Ga0501077_0017748 | 3300049593 | Bacteria | 4496 |
| 882 | Ga0501079_0010899 | 3300049741 | Bacteria | 6924 |
| 883 | Ga0501079_0041476 | 3300049741 | Bacteria | 3553 |
| 884 | Ga0501079_0042074 | 3300049741 | Bacteria | 3528 |
| 885 | Ga0501079_0267014 | 3300049741 | Bacteria | 1338 |
| 886 | Ga0501081_0037174 | 3300049743 | Bacteria | 3322 |
| 887 | Ga0501081_0091440 | 3300049743 | Bacteria | 2140 |
| 888 | Ga0501081_0250121 | 3300049743 | Bacteria | 1294 |
| 889 | Ga0501035_0226776 | 3300049822 | Bacteria | 1593 |
| 890 | Ga0501035_0233074 | 3300049822 | Bacteria | 1568 |
| 891 | Ga0501035_0374713 | 3300049822 | Bacteria | 1188 |
| 892 | Ga0501044_0181917 | 3300049823 | Bacteria | 2068 |
| 893 | Ga0501044_0378228 | 3300049823 | Bacteria | 1331 |
| 894 | Ga0501045_0022982 | 3300049824 | Bacteria | 4468 |
| 895 | Ga0501045_0030175 | 3300049824 | Bacteria | 3923 |
| 896 | Ga0501045_0039769 | 3300049824 | Bacteria | 3422 |
| 897 | Ga0501045_0138439 | 3300049824 | Bacteria | 1810 |
| 898 | Ga0501045_0155953 | 3300049824 | Bacteria | 1699 |
| 899 | Ga0501045_0518563 | 3300049824 | Bacteria | 885 |
| 900 | nmdc:mga00v17_62994_c1 | 3300050491 | Bacteria | 2283 |
| 901 | nmdc:mga0yw44_74322_c1 | 3300050492 | Bacteria | 2117 |
| 902 | nmdc:mga05p37_123417_c1 | 3300050507 | Bacteria | 3181 |
| 903 | nmdc:mga05p37_1328_c1 | 3300050507 | Bacteria | 28757 |
| 904 | nmdc:mga05p37_4688_c1 | 3300050507 | Bacteria | 15972 |
| 905 | nmdc:mga05p37_7379_c1 | 3300050507 | Bacteria | 12968 |
| 906 | nmdc:mga05p37_845639_c1 | 3300050507 | Bacteria | 995 |
| 907 | nmdc:mga09592_122501_c1 | 3300050508 | Bacteria | 2234 |
| 908 | nmdc:mga09592_30_c2 | 3300050508 | Bacteria | 42688 |
| 909 | nmdc:mga09592_583_c1 | 3300050508 | Bacteria | 27626 |
| 910 | nmdc:mga09592_8037_c1 | 3300050508 | Bacteria | 8579 |
| 911 | nmdc:mga0qj67_183351_c1 | 3300050509 | Bacteria | 1700 |
| 912 | nmdc:mga0qj67_1_c2 | 3300050509 | Bacteria | 129768 |
| 913 | nmdc:mga0qj67_223_c1 | 3300050509 | Bacteria | 38690 |
| 914 | nmdc:mga0qj67_49588_c1 | 3300050509 | Bacteria | 3318 |
| 915 | nmdc:mga06r32_142077_c1 | 3300050510 | Bacteria | 2377 |
| 916 | nmdc:mga06r32_1579_c1 | 3300050510 | Bacteria | 20534 |
| 917 | nmdc:mga06r32_263_c5 | 3300050510 | Bacteria | 13218 |
| 918 | nmdc:mga06r32_30416_c1 | 3300050510 | Bacteria | 5066 |
| 919 | nmdc:mga06r32_34_c2 | 3300050510 | Bacteria | 56571 |
| 920 | nmdc:mga06r32_402783_c1 | 3300050510 | Bacteria | 1350 |
| 921 | nmdc:mga06r32_5723_c1 | 3300050510 | Bacteria | 11194 |
| 922 | nmdc:mga08y16_931422_c1 | 3300050511 | Bacteria | 853 |
| 923 | nmdc:mga0n895_155986_c1 | 3300050512 | Bacteria | 2313 |
| 924 | nmdc:mga08x19_148050_c1 | 3300050514 | Bacteria | 1589 |
| 925 | nmdc:mga08x19_277246_c1 | 3300050514 | Bacteria | 1161 |
| 926 | nmdc:mga08x19_46012_c1 | 3300050514 | Bacteria | 2790 |
| 927 | nmdc:mga0a205_175159_c1 | 3300050515 | Bacteria | 2041 |
| 928 | nmdc:mga0a205_67448_c1 | 3300050515 | Bacteria | 3457 |
| 929 | nmdc:mga0a205_76505_c1 | 3300050515 | Bacteria | 3234 |
| 930 | Ga0495601_0001268 | 3300053077 | Bacteria | 13834 |
| 931 | Ga0495601_0014999 | 3300053077 | Bacteria | 4680 |
| 932 | Ga0495601_0027000 | 3300053077 | Bacteria | 3548 |
| 933 | Ga0495601_0072017 | 3300053077 | Bacteria | 2207 |
| 934 | Ga0495601_0156035 | 3300053077 | Bacteria | 1490 |
| 935 | Ga0495612_0011735 | 3300053078 | Bacteria | 3531 |
| 936 | Ga0495612_0018995 | 3300053078 | Bacteria | 2751 |
| 937 | Ga0495655_0053454 | 3300053083 | Bacteria | 1077 |
| 938 | Ga0495655_0062623 | 3300053083 | Bacteria | 1019 |
| 939 | Ga0495595_0003474 | 3300053084 | Bacteria | 6257 |
| 940 | Ga0495595_0012738 | 3300053084 | Bacteria | 3542 |
| 941 | Ga0495595_0023439 | 3300053084 | Bacteria | 2717 |
| 942 | Ga0495619_0010437 | 3300053085 | Bacteria | 5845 |
| 943 | Ga0495619_0050201 | 3300053085 | Bacteria | 2753 |
| 944 | Ga0495619_0058001 | 3300053085 | Bacteria | 2569 |
| 945 | Ga0500578_0012829 | 3300053086 | Bacteria | 5407 |
| 946 | Ga0500644_0009800 | 3300053088 | Bacteria | 2574 |
| 947 | Ga0500646_0019284 | 3300053090 | Bacteria | 1804 |
| 948 | Ga0500654_046647 | 3300053099 | Bacteria | 2387 |
| 949 | Ga0500569_008053 | 3300053109 | Bacteria | 2395 |
| 950 | Ga0500614_015709 | 3300053123 | Bacteria | 1690 |
| 951 | Ga0500621_032779 | 3300053126 | Bacteria | 2071 |
| 952 | Ga0500652_003585 | 3300053131 | Bacteria | 4712 |
| 953 | Ga0500658_0016919 | 3300053134 | Bacteria | 2719 |
| 954 | Ga0500559_0007533 | 3300053136 | Bacteria | 4816 |
| 955 | Ga0500561_0002620 | 3300053137 | Bacteria | 3046 |
| 956 | Ga0500573_0016388 | 3300053140 | Bacteria | 4207 |
| 957 | Ga0500577_0116361 | 3300053142 | Bacteria | 1108 |
| 958 | Ga0500600_0012729 | 3300053149 | Bacteria | 5107 |
| 959 | Ga0500603_034744 | 3300053150 | Bacteria | 1319 |
| 960 | Ga0500616_0103025 | 3300053153 | Bacteria | 1391 |
| 961 | Ga0500633_0000265 | 3300053160 | Bacteria | 7634 |
| 962 | Ga0500634_0004205 | 3300053161 | Bacteria | 6606 |
| 963 | Ga0500656_003629 | 3300053732 | Bacteria | 1453 |
| 964 | Ga0500587_000082 | 3300053739 | Bacteria | 8076 |
| 965 | Ga0501084_0011699 | 3300054114 | Bacteria | 7264 |
| 966 | Ga0501084_0081969 | 3300054114 | Bacteria | 2706 |
| 967 | Ga0501084_0085914 | 3300054114 | Bacteria | 2641 |
| 968 | Ga0501082_0030856 | 3300060353 | Bacteria | 4620 |
| 969 | Ga0466962_0000748 | 3300061719 | Bacteria | 14566 |
| 970 | Ga0466962_0023613 | 3300061719 | Bacteria | 2955 |
| 971 | Ga0466962_0032289 | 3300061719 | Bacteria | 2506 |
| 972 | Ga0466962_0150991 | 3300061719 | Bacteria | 1127 |
| 973 | Ga0530510_0008024 | 3300061734 | Bacteria | 7364 |
| 974 | Ga0530510_0128825 | 3300061734 | Bacteria | 1861 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0291208 | Ga0373947_0291208_342_1076 | 238 |
| 2 | 3300005435 | Ga0070714_100037854 | Ga0070714_1000378542 | 251 |
| 3 | 3300025939 | Ga0207665_10013943 | Ga0207665_100139434 | 251 |
| 4 | 3300046516 | Ga0495628_0402929 | Ga0495628_0402929_46_822 | 256 |
| 5 | 3300049591 | Ga0501075_0555235 | Ga0501075_0555235_86_856 | 256 |
| 6 | 3300044694 | Ga0466963_0140822 | Ga0466963_0140822_822_1613 | 257 |
| 7 | 3300050511 | nmdc:mga08y16_931422_c1 | nmdc:mga08y16_931422_c1_67_843 | 257 |
| 8 | 3300049824 | Ga0501045_0518563 | Ga0501045_0518563_23_823 | 264 |
| 9 | 3300035113 | Ga0373936_0004294 | Ga0373936_0004294_220_1101 | 270 |
| 10 | 3300035117 | Ga0373953_0015221 | Ga0373953_0015221_983_1864 | 270 |
| 11 | 3300035118 | Ga0373954_0065264 | Ga0373954_0065264_481_1362 | 270 |
| 12 | 3300035119 | Ga0373956_0040603 | Ga0373956_0040603_695_1576 | 270 |
| 13 | 3300035120 | Ga0373957_0002490 | Ga0373957_0002490_1066_1947 | 270 |
| 14 | 3300035172 | Ga0373955_0053354 | Ga0373955_0053354_966_1847 | 270 |
| 15 | 3300035410 | Ga0373924_0009943 | Ga0373924_0009943_1628_2509 | 270 |
| 16 | 3300035692 | Ga0373935_0013995 | Ga0373935_0013995_983_1864 | 270 |
| 17 | 3300035724 | Ga0373933_0045281 | Ga0373933_0045281_489_1370 | 270 |
| 18 | 3300035725 | Ga0373947_0016297 | Ga0373947_0016297_543_1424 | 270 |
| 19 | 3300036401 | Ga0373937_0033154 | Ga0373937_0033154_3327_4208 | 270 |
| 20 | 3300046454 | Ga0495592_0013978 | Ga0495592_0013978_1545_2426 | 270 |
| 21 | 3300046461 | Ga0495641_0005969 | Ga0495641_0005969_192_1073 | 270 |
| 22 | 3300046462 | Ga0495651_0146117 | Ga0495651_0146117_489_1370 | 270 |
| 23 | 3300046463 | Ga0495653_0085186 | Ga0495653_0085186_341_1222 | 270 |
| 24 | 3300046476 | Ga0495662_0008311 | Ga0495662_0008311_804_1685 | 270 |
| 25 | 3300046477 | Ga0495664_0001695 | Ga0495664_0001695_8629_9510 | 270 |
| 26 | 3300046511 | Ga0495608_0026966 | Ga0495608_0026966_2543_3424 | 270 |
| 27 | 3300046516 | Ga0495628_0070586 | Ga0495628_0070586_1104_1985 | 270 |
| 28 | 3300046517 | Ga0495630_0093672 | Ga0495630_0093672_1245_2126 | 270 |
| 29 | 3300046529 | Ga0495652_0012613 | Ga0495652_0012613_4979_5860 | 270 |
| 30 | 3300046531 | Ga0495665_0000841 | Ga0495665_0000841_2681_3562 | 270 |
| 31 | 3300046533 | Ga0495640_0007423 | Ga0495640_0007423_4760_5641 | 270 |
| 32 | 3300046535 | Ga0495586_0059581 | Ga0495586_0059581_379_1260 | 270 |
| 33 | 3300046536 | Ga0495587_0007080 | Ga0495587_0007080_1544_2425 | 270 |
| 34 | 3300046543 | Ga0495645_0043653 | Ga0495645_0043653_1414_2295 | 270 |
| 35 | 3300046642 | Ga0495634_0020934 | Ga0495634_0020934_2644_3525 | 270 |
| 36 | 3300046675 | Ga0495657_0008842 | Ga0495657_0008842_1811_2692 | 270 |
| 37 | 3300046678 | Ga0495599_0008444 | Ga0495599_0008444_66_947 | 270 |
| 38 | 3300046683 | Ga0495658_0009574 | Ga0495658_0009574_2045_2926 | 270 |
| 39 | 3300046690 | Ga0495624_0075676 | Ga0495624_0075676_722_1603 | 270 |
| 40 | 3300047315 | Ga0495581_0003301 | Ga0495581_0003301_6962_7843 | 270 |
| 41 | 3300047317 | Ga0495604_0087252 | Ga0495604_0087252_1104_1985 | 270 |
| 42 | 3300047319 | Ga0495674_0062397 | Ga0495674_0062397_1245_2126 | 270 |
| 43 | 3300047322 | Ga0495680_0091405 | Ga0495680_0091405_482_1363 | 270 |
| 44 | 3300047444 | Ga0495675_0003295 | Ga0495675_0003295_4248_5129 | 270 |
| 45 | 3300047471 | Ga0495684_0209143 | Ga0495684_0209143_66_947 | 270 |
| 46 | 3300047673 | Ga0495593_0004457 | Ga0495593_0004457_6924_7805 | 270 |
| 47 | 3300053085 | Ga0495619_0010437 | Ga0495619_0010437_589_1470 | 270 |
| 48 | 3300046615 | Ga0495656_0038922 | Ga0495656_0038922_405_1277 | 271 |
| 49 | 3300005435 | Ga0070714_100007770 | Ga0070714_1000077701 | 272 |
| 50 | 3300005436 | Ga0070713_100155893 | Ga0070713_1001558933 | 272 |
| 51 | 3300009094 | Ga0111539_10078454 | Ga0111539_100784543 | 272 |
| 52 | 3300025928 | Ga0207700_10005407 | Ga0207700_100054075 | 272 |
| 53 | 3300025929 | Ga0207664_10040219 | Ga0207664_100402193 | 272 |
| 54 | 3300035117 | Ga0373953_0053827 | Ga0373953_0053827_331_1365 | 272 |
| 55 | 3300035172 | Ga0373955_0018959 | Ga0373955_0018959_2099_3133 | 272 |
| 56 | 3300035724 | Ga0373933_0034210 | Ga0373933_0034210_1225_2259 | 272 |
| 57 | 3300036401 | Ga0373937_0007973 | Ga0373937_0007973_4330_5364 | 272 |
| 58 | 3300046463 | Ga0495653_0031568 | Ga0495653_0031568_2644_3678 | 272 |
| 59 | 3300046559 | Ga0495667_0013427 | Ga0495667_0013427_4432_5466 | 272 |
| 60 | 3300047317 | Ga0495604_0038784 | Ga0495604_0038784_887_1768 | 272 |
| 61 | 3300047471 | Ga0495684_0156602 | Ga0495684_0156602_171_1205 | 272 |
| 62 | 3300050514 | nmdc:mga08x19_148050_c1 | nmdc:mga08x19_148050_c1_626_1507 | 272 |
| 63 | 3300005355 | Ga0070671_100003560 | Ga0070671_1000035609 | 273 |
| 64 | 3300005841 | Ga0068863_100164044 | Ga0068863_1001640442 | 273 |
| 65 | 3300025931 | Ga0207644_10004903 | Ga0207644_100049036 | 273 |
| 66 | 3300026088 | Ga0207641_10043512 | Ga0207641_100435123 | 273 |
| 67 | 3300028381 | Ga0268264_10007538 | Ga0268264_100075386 | 273 |
| 68 | 3300005467 | Ga0070706_100144438 | Ga0070706_1001444382 | 274 |
| 69 | 3300005536 | Ga0070697_100000004 | Ga0070697_100000004276 | 274 |
| 70 | 3300005548 | Ga0070665_100009447 | Ga0070665_1000094472 | 274 |
| 71 | 3300028379 | Ga0268266_10005053 | Ga0268266_1000505310 | 274 |
| 72 | 3300044658 | Ga0466972_0004598 | Ga0466972_0004598_3804_4685 | 274 |
| 73 | 3300044683 | Ga0466965_0000947 | Ga0466965_0000947_5865_6746 | 274 |
| 74 | 3300044693 | Ga0466961_0237177 | Ga0466961_0237177_156_1040 | 274 |
| 75 | 3300044765 | Ga0466970_0004353 | Ga0466970_0004353_1297_2178 | 274 |
| 76 | 3300044842 | Ga0466957_0038565 | Ga0466957_0038565_650_1531 | 274 |
| 77 | 3300044901 | Ga0466960_0014072 | Ga0466960_0014072_578_1459 | 274 |
| 78 | 3300006844 | Ga0075428_100001352 | Ga0075428_10000135212 | 276 |
| 79 | 3300006846 | Ga0075430_100000841 | Ga0075430_10000084111 | 276 |
| 80 | 3300006847 | Ga0075431_100001081 | Ga0075431_10000108113 | 276 |
| 81 | 3300006880 | Ga0075429_100000965 | Ga0075429_10000096512 | 276 |
| 82 | 3300009147 | Ga0114129_10000058 | Ga0114129_1000005823 | 276 |
| 83 | 3300050507 | nmdc:mga05p37_1328_c1 | nmdc:mga05p37_1328_c1_12265_13131 | 276 |
| 84 | 3300050508 | nmdc:mga09592_30_c2 | nmdc:mga09592_30_c2_32134_33000 | 276 |
| 85 | 3300050509 | nmdc:mga0qj67_1_c2 | nmdc:mga0qj67_1_c2_32283_33149 | 276 |
| 86 | 3300050510 | nmdc:mga06r32_34_c2 | nmdc:mga06r32_34_c2_32283_33149 | 276 |
| 87 | iso_pu_bacteria | 2899370129 | 2899373272 | 276 |
| 88 | 3300021388 | Ga0213875_10000478 | Ga0213875_1000047826 | 277 |
| 89 | 3300037853 | Ga0436364_0383821 | Ga0436364_0383821_236_1150 | 277 |
| 90 | 3300037853 | Ga0436364_0771738 | Ga0436364_0771738_28672_29550 | 277 |
| 91 | iso_pu_bacteria | 2791354901 | 2791911583 | 277 |
| 92 | iso_pu_bacteria | 2887478801 | 2887483427 | 277 |
| 93 | iso_pu_bacteria | 2895427314 | 2895438051 | 277 |
| 94 | 3300005985 | Ga0081539_10000031 | Ga0081539_1000003147 | 278 |
| 95 | 3300049575 | Ga0501039_0151585 | Ga0501039_0151585_906_1742 | 278 |
| 96 | 3300049577 | Ga0501041_0198609 | Ga0501041_0198609_67_903 | 278 |
| 97 | 3300049578 | Ga0501042_0045520 | Ga0501042_0045520_1940_2776 | 278 |
| 98 | 3300049587 | Ga0501071_0092974 | Ga0501071_0092974_109_945 | 278 |
| 99 | 3300049741 | Ga0501079_0042074 | Ga0501079_0042074_1219_2055 | 278 |
| 100 | 3300049743 | Ga0501081_0250121 | Ga0501081_0250121_340_1176 | 278 |
| 101 | 3300050510 | nmdc:mga06r32_263_c5 | nmdc:mga06r32_263_c5_6117_7046 | 278 |
| 102 | 3300054114 | Ga0501084_0081969 | Ga0501084_0081969_328_1164 | 278 |
| 103 | iso_pu_bacteria | 2738543034 | 2739363871 | 278 |
| 104 | iso_pu_bacteria | 2904770941 | 2904771926 | 278 |
| 105 | iso_pu_bacteria | 2974315732 | 2974317222 | 278 |
| 106 | iso_pu_bacteria | 2984523437 | 2984525428 | 278 |
| 107 | 3300026095 | Ga0207676_10359496 | Ga0207676_103594962 | 279 |
| 108 | 3300053088 | Ga0500644_0009800 | Ga0500644_0009800_222_1064 | 279 |
| 109 | 3300053142 | Ga0500577_0116361 | Ga0500577_0116361_46_888 | 279 |
| 110 | iso_pu_bacteria | 2551306166 | 2552112696 | 279 |
| 111 | iso_pu_bacteria | 3002998708 | 3002999734 | 279 |
| 112 | 3300005435 | Ga0070714_100000261 | Ga0070714_10000026132 | 280 |
| 113 | 3300005471 | Ga0070698_100002617 | Ga0070698_1000026174 | 280 |
| 114 | 3300025929 | Ga0207664_10001442 | Ga0207664_100014426 | 280 |
| 115 | 3300033179 | Ga0307507_10035050 | Ga0307507_100350502 | 280 |
| 116 | 3300049568 | Ga0501031_0051483 | Ga0501031_0051483_1792_2634 | 280 |
| 117 | 3300049571 | Ga0501034_0001939 | Ga0501034_0001939_2469_3350 | 280 |
| 118 | 3300049572 | Ga0501036_0091441 | Ga0501036_0091441_263_1144 | 280 |
| 119 | 3300049572 | Ga0501036_0139400 | Ga0501036_0139400_585_1427 | 280 |
| 120 | 3300049573 | Ga0501037_0069864 | Ga0501037_0069864_93_974 | 280 |
| 121 | 3300049574 | Ga0501038_0007410 | Ga0501038_0007410_6156_7037 | 280 |
| 122 | 3300049575 | Ga0501039_0069388 | Ga0501039_0069388_665_1507 | 280 |
| 123 | 3300049576 | Ga0501040_0012124 | Ga0501040_0012124_417_1259 | 280 |
| 124 | 3300049577 | Ga0501041_0011862 | Ga0501041_0011862_2090_2932 | 280 |
| 125 | 3300049578 | Ga0501042_0006044 | Ga0501042_0006044_5246_6127 | 280 |
| 126 | 3300049579 | Ga0501043_0001474 | Ga0501043_0001474_5079_5960 | 280 |
| 127 | 3300049581 | Ga0501047_0001834 | Ga0501047_0001834_4138_5019 | 280 |
| 128 | 3300049582 | Ga0501048_0002840 | Ga0501048_0002840_5836_6717 | 280 |
| 129 | 3300049582 | Ga0501048_0107090 | Ga0501048_0107090_484_1326 | 280 |
| 130 | 3300049587 | Ga0501071_0073222 | Ga0501071_0073222_500_1342 | 280 |
| 131 | 3300049588 | Ga0501072_0043733 | Ga0501072_0043733_1844_2686 | 280 |
| 132 | 3300049590 | Ga0501074_0007659 | Ga0501074_0007659_4685_5566 | 280 |
| 133 | 3300049590 | Ga0501074_0101347 | Ga0501074_0101347_512_1354 | 280 |
| 134 | 3300049592 | Ga0501076_0045545 | Ga0501076_0045545_531_1373 | 280 |
| 135 | 3300049593 | Ga0501077_0017748 | Ga0501077_0017748_2914_3756 | 280 |
| 136 | 3300049741 | Ga0501079_0041476 | Ga0501079_0041476_2125_2967 | 280 |
| 137 | 3300049822 | Ga0501035_0374713 | Ga0501035_0374713_233_1075 | 280 |
| 138 | 3300049824 | Ga0501045_0039769 | Ga0501045_0039769_2117_2959 | 280 |
| 139 | 3300054114 | Ga0501084_0011699 | Ga0501084_0011699_4741_5583 | 280 |
| 140 | 3300060353 | Ga0501082_0030856 | Ga0501082_0030856_1596_2438 | 280 |
| 141 | 3300061734 | Ga0530510_0008024 | Ga0530510_0008024_1305_2147 | 280 |
| 142 | iso_pu_bacteria | 2585427649 | 2586059268 | 280 |
| 143 | iso_pu_bacteria | 2622736626 | 2623589900 | 280 |
| 144 | iso_pu_bacteria | 2795385470 | 2795783127 | 280 |
| 145 | iso_pu_bacteria | 2808606522 | 2809591972 | 280 |
| 146 | iso_pu_bacteria | 2863067949 | 2863068703 | 280 |
| 147 | iso_pu_bacteria | 2866612099 | 2866616824 | 280 |
| 148 | iso_pu_bacteria | 2915768154 | 2915773990 | 280 |
| 149 | iso_pu_bacteria | 2997451912 | 2997459333 | 280 |
| 150 | iso_pu_bacteria | 8003314358 | 8003321503 | 280 |
| 151 | iso_pu_bacteria | 8047710418 | 8047718728 | 280 |
| 152 | iso_pu_bacteria | 8055066027 | 8055067287 | 280 |
| 153 | iso_pu_bacteria | 8055172936 | 8055179450 | 280 |
| 154 | iso_pu_bacteria | 8056207758 | 8056212896 | 280 |
| 155 | 3300005329 | Ga0070683_100205342 | Ga0070683_1002053422 | 281 |
| 156 | 3300005354 | Ga0070675_100325709 | Ga0070675_1003257091 | 281 |
| 157 | 3300005459 | Ga0068867_100165209 | Ga0068867_1001652092 | 281 |
| 158 | 3300005468 | Ga0070707_100016035 | Ga0070707_1000160355 | 281 |
| 159 | 3300005471 | Ga0070698_100050377 | Ga0070698_1000503775 | 281 |
| 160 | 3300005518 | Ga0070699_100076977 | Ga0070699_1000769772 | 281 |
| 161 | 3300005536 | Ga0070697_100221329 | Ga0070697_1002213291 | 281 |
| 162 | 3300005548 | Ga0070665_100400326 | Ga0070665_1004003262 | 281 |
| 163 | 3300005564 | Ga0070664_100178493 | Ga0070664_1001784933 | 281 |
| 164 | 3300005615 | Ga0070702_100106183 | Ga0070702_1001061832 | 281 |
| 165 | 3300005985 | Ga0081539_10000125 | Ga0081539_10000125132 | 281 |
| 166 | 3300006880 | Ga0075429_100231364 | Ga0075429_1002313642 | 281 |
| 167 | 3300006881 | Ga0068865_100297947 | Ga0068865_1002979472 | 281 |
| 168 | 3300007076 | Ga0075435_100167264 | Ga0075435_1001672642 | 281 |
| 169 | 3300025898 | Ga0207692_10004546 | Ga0207692_100045467 | 281 |
| 170 | 3300025922 | Ga0207646_10000127 | Ga0207646_1000012774 | 281 |
| 171 | 3300025926 | Ga0207659_10297901 | Ga0207659_102979012 | 281 |
| 172 | 3300025928 | Ga0207700_10050721 | Ga0207700_100507212 | 281 |
| 173 | 3300025945 | Ga0207679_10117532 | Ga0207679_101175323 | 281 |
| 174 | 3300025972 | Ga0207668_10112720 | Ga0207668_101127202 | 281 |
| 175 | 3300028794 | Ga0307515_10055673 | Ga0307515_100556734 | 281 |
| 176 | 3300030522 | Ga0307512_10029546 | Ga0307512_100295462 | 281 |
| 177 | 3300030732 | Ga0316176_1098424 | Ga0316176_10984243 | 281 |
| 178 | 3300031995 | Ga0307409_100462483 | Ga0307409_1004624832 | 281 |
| 179 | 3300042012 | Ga0439455_0015758 | Ga0439455_0015758_636_1493 | 281 |
| 180 | 3300044658 | Ga0466972_0042721 | Ga0466972_0042721_1053_1913 | 281 |
| 181 | 3300044683 | Ga0466965_0002500 | Ga0466965_0002500_3988_4848 | 281 |
| 182 | 3300044735 | Ga0466968_0012689 | Ga0466968_0012689_1638_2498 | 281 |
| 183 | 3300044901 | Ga0466960_0000646 | Ga0466960_0000646_1457_2317 | 281 |
| 184 | 3300046616 | Ga0495668_0000632 | Ga0495668_0000632_4674_5525 | 281 |
| 185 | 3300046660 | Ga0495625_0000797 | Ga0495625_0000797_38111_38962 | 281 |
| 186 | 3300047323 | Ga0495683_0029464 | Ga0495683_0029464_1850_2701 | 281 |
| 187 | 3300048091 | Ga0495626_0000581 | Ga0495626_0000581_4693_5544 | 281 |
| 188 | 3300050508 | nmdc:mga09592_122501_c1 | nmdc:mga09592_122501_c1_1187_2053 | 281 |
| 189 | iso_pu_bacteria | 2802429296 | 2804848734 | 281 |
| 190 | iso_pu_bacteria | 8025413630 | 8025417980 | 281 |
| 191 | iso_pu_bacteria | 8056447290 | 8056447295 | 281 |
| 192 | iso_pu_bacteria | 8056667051 | 8056667145 | 281 |
| 193 | 3300005455 | Ga0070663_100004631 | Ga0070663_1000046316 | 282 |
| 194 | 3300005617 | Ga0068859_100026922 | Ga0068859_1000269223 | 282 |
| 195 | 3300006844 | Ga0075428_100228842 | Ga0075428_1002288422 | 282 |
| 196 | 3300006847 | Ga0075431_100324049 | Ga0075431_1003240491 | 282 |
| 197 | 3300006931 | Ga0097620_100026922 | Ga0097620_1000269223 | 282 |
| 198 | 3300009147 | Ga0114129_10169762 | Ga0114129_101697621 | 282 |
| 199 | 3300026067 | Ga0207678_10000168 | Ga0207678_100001686 | 282 |
| 200 | 3300031824 | Ga0307413_10271870 | Ga0307413_102718702 | 282 |
| 201 | 3300044706 | Ga0466964_0115185 | Ga0466964_0115185_310_1170 | 282 |
| 202 | 3300044719 | Ga0466971_0009808 | Ga0466971_0009808_2596_3465 | 282 |
| 203 | 3300045976 | Ga0466967_0078227 | Ga0466967_0078227_1525_2373 | 282 |
| 204 | 3300045976 | Ga0466967_0090629 | Ga0466967_0090629_1781_2641 | 282 |
| 205 | 3300049581 | Ga0501047_0079764 | Ga0501047_0079764_866_1738 | 282 |
| 206 | 3300050491 | nmdc:mga00v17_62994_c1 | nmdc:mga00v17_62994_c1_1156_2022 | 282 |
| 207 | 3300050507 | nmdc:mga05p37_123417_c1 | nmdc:mga05p37_123417_c1_506_1369 | 282 |
| 208 | 3300050510 | nmdc:mga06r32_402783_c1 | nmdc:mga06r32_402783_c1_84_941 | 282 |
| 209 | iso_pu_bacteria | 2751185734 | 2753073625 | 282 |
| 210 | iso_pu_bacteria | 2862178590 | 2862182465 | 282 |
| 211 | iso_pu_bacteria | 2862382967 | 2862386444 | 282 |
| 212 | iso_pu_bacteria | 2863404153 | 2863409505 | 282 |
| 213 | iso_pu_bacteria | 2867475112 | 2867479776 | 282 |
| 214 | iso_pu_bacteria | 2870721527 | 2870725570 | 282 |
| 215 | iso_pu_bacteria | 2870782633 | 2870789073 | 282 |
| 216 | iso_pu_bacteria | 2912723979 | 2912729388 | 282 |
| 217 | iso_pu_bacteria | 2912757875 | 2912763748 | 282 |
| 218 | iso_pu_bacteria | 2917736166 | 2917738750 | 282 |
| 219 | iso_pu_bacteria | 2935390628 | 2935391243 | 282 |
| 220 | iso_pu_bacteria | 2954002825 | 2954010175 | 282 |
| 221 | iso_pu_bacteria | 2954711539 | 2954713471 | 282 |
| 222 | iso_pu_bacteria | 2954749733 | 2954757255 | 282 |
| 223 | iso_pu_bacteria | 2990059506 | 2990067849 | 282 |
| 224 | iso_pu_bacteria | 2990088156 | 2990089669 | 282 |
| 225 | iso_pu_bacteria | 3006486233 | 3006487579 | 282 |
| 226 | iso_pu_bacteria | 8008558824 | 8008563777 | 282 |
| 227 | iso_pu_bacteria | 8008574985 | 8008576392 | 282 |
| 228 | iso_pu_bacteria | 8023623736 | 8023624116 | 282 |
| 229 | iso_pu_bacteria | 8054160619 | 8054163033 | 282 |
| 230 | 3300005468 | Ga0070707_100091365 | Ga0070707_1000913653 | 283 |
| 231 | 3300005577 | Ga0068857_100189294 | Ga0068857_1001892942 | 283 |
| 232 | 3300005614 | Ga0068856_100293476 | Ga0068856_1002934762 | 283 |
| 233 | 3300006846 | Ga0075430_100001655 | Ga0075430_10000165512 | 283 |
| 234 | 3300025905 | Ga0207685_10103183 | Ga0207685_101031832 | 283 |
| 235 | 3300028558 | Ga0265326_10002290 | Ga0265326_100022904 | 283 |
| 236 | 3300028563 | Ga0265319_1001647 | Ga0265319_10016478 | 283 |
| 237 | 3300028573 | Ga0265334_10031727 | Ga0265334_100317272 | 283 |
| 238 | 3300028573 | Ga0265334_10053025 | Ga0265334_100530252 | 283 |
| 239 | 3300028577 | Ga0265318_10000251 | Ga0265318_1000025139 | 283 |
| 240 | 3300028653 | Ga0265323_10085974 | Ga0265323_100859742 | 283 |
| 241 | 3300028654 | Ga0265322_10001581 | Ga0265322_100015814 | 283 |
| 242 | 3300028666 | Ga0265336_10050538 | Ga0265336_100505382 | 283 |
| 243 | 3300028800 | Ga0265338_10003462 | Ga0265338_1000346219 | 283 |
| 244 | 3300028800 | Ga0265338_10022191 | Ga0265338_100221914 | 283 |
| 245 | 3300031235 | Ga0265330_10000873 | Ga0265330_100008733 | 283 |
| 246 | 3300031239 | Ga0265328_10016149 | Ga0265328_100161493 | 283 |
| 247 | 3300031240 | Ga0265320_10020167 | Ga0265320_100201673 | 283 |
| 248 | 3300031241 | Ga0265325_10000549 | Ga0265325_1000054915 | 283 |
| 249 | 3300031242 | Ga0265329_10007314 | Ga0265329_100073142 | 283 |
| 250 | 3300031249 | Ga0265339_10001224 | Ga0265339_100012243 | 283 |
| 251 | 3300031249 | Ga0265339_10048399 | Ga0265339_100483992 | 283 |
| 252 | 3300031250 | Ga0265331_10002901 | Ga0265331_100029012 | 283 |
| 253 | 3300031251 | Ga0265327_10007522 | Ga0265327_100075222 | 283 |
| 254 | 3300031344 | Ga0265316_10059650 | Ga0265316_100596502 | 283 |
| 255 | 3300031595 | Ga0265313_10001573 | Ga0265313_1000157312 | 283 |
| 256 | 3300031711 | Ga0265314_10003084 | Ga0265314_100030843 | 283 |
| 257 | 3300031711 | Ga0265314_10223998 | Ga0265314_102239982 | 283 |
| 258 | 3300031712 | Ga0265342_10050564 | Ga0265342_100505643 | 283 |
| 259 | 3300031731 | Ga0307405_10005187 | Ga0307405_100051875 | 283 |
| 260 | 3300031824 | Ga0307413_10060041 | Ga0307413_100600412 | 283 |
| 261 | 3300031852 | Ga0307410_10488949 | Ga0307410_104889491 | 283 |
| 262 | 3300031901 | Ga0307406_10062946 | Ga0307406_100629463 | 283 |
| 263 | 3300031901 | Ga0307406_10188219 | Ga0307406_101882192 | 283 |
| 264 | 3300031903 | Ga0307407_10016313 | Ga0307407_100163133 | 283 |
| 265 | 3300031911 | Ga0307412_10031488 | Ga0307412_100314883 | 283 |
| 266 | 3300031995 | Ga0307409_100000071 | Ga0307409_1000000713 | 283 |
| 267 | 3300031995 | Ga0307409_100024549 | Ga0307409_1000245494 | 283 |
| 268 | 3300032002 | Ga0307416_100001030 | Ga0307416_1000010304 | 283 |
| 269 | 3300032002 | Ga0307416_100505111 | Ga0307416_1005051112 | 283 |
| 270 | 3300032005 | Ga0307411_10222463 | Ga0307411_102224632 | 283 |
| 271 | 3300032005 | Ga0307411_10291205 | Ga0307411_102912052 | 283 |
| 272 | 3300032126 | Ga0307415_100000029 | Ga0307415_10000002919 | 283 |
| 273 | 3300033179 | Ga0307507_10041429 | Ga0307507_100414295 | 283 |
| 274 | 3300033179 | Ga0307507_10060094 | Ga0307507_100600942 | 283 |
| 275 | 3300035172 | Ga0373955_0110222 | Ga0373955_0110222_433_1290 | 283 |
| 276 | 3300038443 | Ga0395901_0114765 | Ga0395901_0114765_912_1775 | 283 |
| 277 | 3300044693 | Ga0466961_0079663 | Ga0466961_0079663_214_1071 | 283 |
| 278 | 3300044694 | Ga0466963_0022444 | Ga0466963_0022444_2221_3078 | 283 |
| 279 | 3300044694 | Ga0466963_0165563 | Ga0466963_0165563_479_1342 | 283 |
| 280 | 3300044842 | Ga0466957_0033625 | Ga0466957_0033625_1831_2688 | 283 |
| 281 | 3300045836 | Ga0466958_0048578 | Ga0466958_0048578_1422_2279 | 283 |
| 282 | 3300045976 | Ga0466967_0007908 | Ga0466967_0007908_4006_4869 | 283 |
| 283 | 3300045976 | Ga0466967_0161671 | Ga0466967_0161671_1100_1963 | 283 |
| 284 | 3300045976 | Ga0466967_0403108 | Ga0466967_0403108_393_1247 | 283 |
| 285 | 3300046511 | Ga0495608_0013648 | Ga0495608_0013648_1253_2110 | 283 |
| 286 | 3300046533 | Ga0495640_0229997 | Ga0495640_0229997_79_948 | 283 |
| 287 | 3300046559 | Ga0495667_0016983 | Ga0495667_0016983_2739_3596 | 283 |
| 288 | 3300046663 | Ga0495635_0169439 | Ga0495635_0169439_196_1053 | 283 |
| 289 | 3300046675 | Ga0495657_0179996 | Ga0495657_0179996_289_1146 | 283 |
| 290 | 3300047317 | Ga0495604_0232316 | Ga0495604_0232316_273_1142 | 283 |
| 291 | 3300047322 | Ga0495680_0034597 | Ga0495680_0034597_491_1348 | 283 |
| 292 | 3300047471 | Ga0495684_0032859 | Ga0495684_0032859_1961_2818 | 283 |
| 293 | 3300047471 | Ga0495684_0350267 | Ga0495684_0350267_32_889 | 283 |
| 294 | 3300048905 | Ga0496102_0548913 | Ga0496102_0548913_162_1025 | 283 |
| 295 | 3300048909 | Ga0496106_0200629 | Ga0496106_0200629_248_1111 | 283 |
| 296 | 3300048910 | Ga0496107_0070168 | Ga0496107_0070168_1574_2437 | 283 |
| 297 | 3300048914 | Ga0496111_0041212 | Ga0496111_0041212_361_1224 | 283 |
| 298 | 3300048916 | Ga0496113_0283687 | Ga0496113_0283687_267_1130 | 283 |
| 299 | 3300049587 | Ga0501071_0110459 | Ga0501071_0110459_736_1599 | 283 |
| 300 | 3300049592 | Ga0501076_0416498 | Ga0501076_0416498_85_948 | 283 |
| 301 | 3300049741 | Ga0501079_0267014 | Ga0501079_0267014_459_1322 | 283 |
| 302 | 3300049824 | Ga0501045_0030175 | Ga0501045_0030175_2046_2909 | 283 |
| 303 | 3300050509 | nmdc:mga0qj67_183351_c1 | nmdc:mga0qj67_183351_c1_76_936 | 283 |
| 304 | 3300050509 | nmdc:mga0qj67_223_c1 | nmdc:mga0qj67_223_c1_12529_13422 | 283 |
| 305 | 3300053085 | Ga0495619_0058001 | Ga0495619_0058001_1431_2288 | 283 |
| 306 | 3300061719 | Ga0466962_0023613 | Ga0466962_0023613_1317_2174 | 283 |
| 307 | iso_pu_bacteria | 2643221601 | 2644019577 | 283 |
| 308 | iso_pu_bacteria | 2643221631 | 2644180536 | 283 |
| 309 | iso_pu_bacteria | 2816332119 | 2816427621 | 283 |
| 310 | iso_pu_bacteria | 8053945823 | 8053946589 | 283 |
| 311 | 3300003354 | JGI25160J50197_1030646 | JGI25160J50197_10306462 | 284 |
| 312 | 3300005327 | Ga0070658_10018471 | Ga0070658_100184714 | 284 |
| 313 | 3300005329 | Ga0070683_100000230 | Ga0070683_1000002306 | 284 |
| 314 | 3300005337 | Ga0070682_100041825 | Ga0070682_1000418253 | 284 |
| 315 | 3300005339 | Ga0070660_100076325 | Ga0070660_1000763253 | 284 |
| 316 | 3300005345 | Ga0070692_10060720 | Ga0070692_100607202 | 284 |
| 317 | 3300005347 | Ga0070668_100006848 | Ga0070668_1000068485 | 284 |
| 318 | 3300005347 | Ga0070668_100189248 | Ga0070668_1001892482 | 284 |
| 319 | 3300005366 | Ga0070659_100543496 | Ga0070659_1005434961 | 284 |
| 320 | 3300005445 | Ga0070708_100055695 | Ga0070708_1000556952 | 284 |
| 321 | 3300005445 | Ga0070708_100119080 | Ga0070708_1001190803 | 284 |
| 322 | 3300005455 | Ga0070663_100000835 | Ga0070663_1000008353 | 284 |
| 323 | 3300005518 | Ga0070699_100014146 | Ga0070699_1000141463 | 284 |
| 324 | 3300005535 | Ga0070684_100027942 | Ga0070684_1000279424 | 284 |
| 325 | 3300005548 | Ga0070665_100177174 | Ga0070665_1001771743 | 284 |
| 326 | 3300005563 | Ga0068855_100003228 | Ga0068855_10000322816 | 284 |
| 327 | 3300005563 | Ga0068855_100074762 | Ga0068855_1000747625 | 284 |
| 328 | 3300005577 | Ga0068857_100003813 | Ga0068857_1000038135 | 284 |
| 329 | 3300005577 | Ga0068857_100205778 | Ga0068857_1002057782 | 284 |
| 330 | 3300005578 | Ga0068854_100004870 | Ga0068854_1000048703 | 284 |
| 331 | 3300005614 | Ga0068856_100050407 | Ga0068856_1000504072 | 284 |
| 332 | 3300005614 | Ga0068856_100053183 | Ga0068856_1000531832 | 284 |
| 333 | 3300005616 | Ga0068852_100013251 | Ga0068852_1000132516 | 284 |
| 334 | 3300005616 | Ga0068852_100032189 | Ga0068852_1000321895 | 284 |
| 335 | 3300005718 | Ga0068866_10086795 | Ga0068866_100867952 | 284 |
| 336 | 3300005842 | Ga0068858_100014268 | Ga0068858_1000142685 | 284 |
| 337 | 3300005843 | Ga0068860_100091443 | Ga0068860_1000914434 | 284 |
| 338 | 3300005937 | Ga0081455_10000011 | Ga0081455_10000011155 | 284 |
| 339 | 3300005983 | Ga0081540_1035454 | Ga0081540_10354544 | 284 |
| 340 | 3300006358 | Ga0068871_100058876 | Ga0068871_1000588762 | 284 |
| 341 | 3300006846 | Ga0075430_100195235 | Ga0075430_1001952352 | 284 |
| 342 | 3300006847 | Ga0075431_100141635 | Ga0075431_1001416353 | 284 |
| 343 | 3300006881 | Ga0068865_100060094 | Ga0068865_1000600942 | 284 |
| 344 | 3300006914 | Ga0075436_100066555 | Ga0075436_1000665553 | 284 |
| 345 | 3300009093 | Ga0105240_10018527 | Ga0105240_100185275 | 284 |
| 346 | 3300009098 | Ga0105245_10056611 | Ga0105245_100566113 | 284 |
| 347 | 3300009174 | Ga0105241_10027630 | Ga0105241_100276304 | 284 |
| 348 | 3300009176 | Ga0105242_10366346 | Ga0105242_103663462 | 284 |
| 349 | 3300009545 | Ga0105237_10008954 | Ga0105237_100089547 | 284 |
| 350 | 3300009551 | Ga0105238_10019534 | Ga0105238_100195344 | 284 |
| 351 | 3300009551 | Ga0105238_10267385 | Ga0105238_102673852 | 284 |
| 352 | 3300010375 | Ga0105239_10094560 | Ga0105239_100945602 | 284 |
| 353 | 3300010375 | Ga0105239_10205977 | Ga0105239_102059772 | 284 |
| 354 | 3300011119 | Ga0105246_10002872 | Ga0105246_1000287210 | 284 |
| 355 | 3300013105 | Ga0157369_10036202 | Ga0157369_100362021 | 284 |
| 356 | 3300013306 | Ga0163162_10066253 | Ga0163162_100662533 | 284 |
| 357 | 3300013307 | Ga0157372_10001996 | Ga0157372_1000199617 | 284 |
| 358 | 3300013308 | Ga0157375_10053521 | Ga0157375_100535212 | 284 |
| 359 | 3300014968 | Ga0157379_10046583 | Ga0157379_100465835 | 284 |
| 360 | 3300020082 | Ga0206353_10382620 | Ga0206353_103826201 | 284 |
| 361 | 3300021388 | Ga0213875_10048149 | Ga0213875_100481492 | 284 |
| 362 | 3300025302 | Ga0207426_1000499 | Ga0207426_100049923 | 284 |
| 363 | 3300025302 | Ga0207426_1007355 | Ga0207426_10073552 | 284 |
| 364 | 3300025904 | Ga0207647_10030164 | Ga0207647_100301642 | 284 |
| 365 | 3300025913 | Ga0207695_10003301 | Ga0207695_1000330116 | 284 |
| 366 | 3300025914 | Ga0207671_10000530 | Ga0207671_1000053045 | 284 |
| 367 | 3300025919 | Ga0207657_10044330 | Ga0207657_100443305 | 284 |
| 368 | 3300025922 | Ga0207646_10002637 | Ga0207646_1000263715 | 284 |
| 369 | 3300025922 | Ga0207646_10004843 | Ga0207646_100048435 | 284 |
| 370 | 3300025924 | Ga0207694_10009232 | Ga0207694_100092325 | 284 |
| 371 | 3300025927 | Ga0207687_10018827 | Ga0207687_100188273 | 284 |
| 372 | 3300025929 | Ga0207664_10518450 | Ga0207664_105184501 | 284 |
| 373 | 3300025934 | Ga0207686_10243978 | Ga0207686_102439782 | 284 |
| 374 | 3300025944 | Ga0207661_10002423 | Ga0207661_100024237 | 284 |
| 375 | 3300025949 | Ga0207667_10021913 | Ga0207667_100219132 | 284 |
| 376 | 3300025949 | Ga0207667_10106607 | Ga0207667_101066073 | 284 |
| 377 | 3300025981 | Ga0207640_10024260 | Ga0207640_100242605 | 284 |
| 378 | 3300026067 | Ga0207678_10006715 | Ga0207678_100067158 | 284 |
| 379 | 3300026078 | Ga0207702_10027777 | Ga0207702_100277774 | 284 |
| 380 | 3300026078 | Ga0207702_10079375 | Ga0207702_100793752 | 284 |
| 381 | 3300026116 | Ga0207674_10015760 | Ga0207674_100157605 | 284 |
| 382 | 3300026116 | Ga0207674_10229391 | Ga0207674_102293912 | 284 |
| 383 | 3300026121 | Ga0207683_10072497 | Ga0207683_100724973 | 284 |
| 384 | 3300026121 | Ga0207683_10371623 | Ga0207683_103716231 | 284 |
| 385 | 3300026142 | Ga0207698_10074845 | Ga0207698_100748453 | 284 |
| 386 | 3300028379 | Ga0268266_10163626 | Ga0268266_101636262 | 284 |
| 387 | 3300028786 | Ga0307517_10149923 | Ga0307517_101499232 | 284 |
| 388 | 3300028794 | Ga0307515_10058294 | Ga0307515_100582943 | 284 |
| 389 | 3300031731 | Ga0307405_10145531 | Ga0307405_101455312 | 284 |
| 390 | 3300031731 | Ga0307405_10503374 | Ga0307405_105033741 | 284 |
| 391 | 3300031824 | Ga0307413_10190450 | Ga0307413_101904502 | 284 |
| 392 | 3300031838 | Ga0307518_10000753 | Ga0307518_1000075325 | 284 |
| 393 | 3300031911 | Ga0307412_10172566 | Ga0307412_101725662 | 284 |
| 394 | 3300031995 | Ga0307409_100102196 | Ga0307409_1001021963 | 284 |
| 395 | 3300031995 | Ga0307409_100163008 | Ga0307409_1001630082 | 284 |
| 396 | 3300032002 | Ga0307416_100004996 | Ga0307416_1000049964 | 284 |
| 397 | 3300032004 | Ga0307414_10201324 | Ga0307414_102013242 | 284 |
| 398 | 3300032126 | Ga0307415_100003722 | Ga0307415_1000037224 | 284 |
| 399 | 3300032126 | Ga0307415_100234480 | Ga0307415_1002344802 | 284 |
| 400 | 3300033179 | Ga0307507_10050953 | Ga0307507_100509534 | 284 |
| 401 | 3300033179 | Ga0307507_10141064 | Ga0307507_101410643 | 284 |
| 402 | 3300033180 | Ga0307510_10109379 | Ga0307510_101093793 | 284 |
| 403 | 3300037853 | Ga0436364_1115153 | Ga0436364_1115153_307_1182 | 284 |
| 404 | 3300038443 | Ga0395901_0549672 | Ga0395901_0549672_256_1113 | 284 |
| 405 | 3300044656 | Ga0466969_0001519 | Ga0466969_0001519_6064_6933 | 284 |
| 406 | 3300044656 | Ga0466969_0011231 | Ga0466969_0011231_3075_3947 | 284 |
| 407 | 3300044658 | Ga0466972_0018756 | Ga0466972_0018756_567_1436 | 284 |
| 408 | 3300044684 | Ga0466966_0039397 | Ga0466966_0039397_2148_3017 | 284 |
| 409 | 3300044693 | Ga0466961_0014213 | Ga0466961_0014213_1232_2101 | 284 |
| 410 | 3300044693 | Ga0466961_0075824 | Ga0466961_0075824_1077_1949 | 284 |
| 411 | 3300044719 | Ga0466971_0000368 | Ga0466971_0000368_3905_4774 | 284 |
| 412 | 3300044735 | Ga0466968_0086609 | Ga0466968_0086609_222_1091 | 284 |
| 413 | 3300044765 | Ga0466970_0077750 | Ga0466970_0077750_11_883 | 284 |
| 414 | 3300044765 | Ga0466970_0180022 | Ga0466970_0180022_137_1006 | 284 |
| 415 | 3300045049 | Ga0466959_0001945 | Ga0466959_0001945_10935_11804 | 284 |
| 416 | 3300045051 | Ga0451576_0046870 | Ga0451576_0046870_2005_2865 | 284 |
| 417 | 3300045836 | Ga0466958_0008607 | Ga0466958_0008607_1114_1983 | 284 |
| 418 | 3300046462 | Ga0495651_0005798 | Ga0495651_0005798_5184_6053 | 284 |
| 419 | 3300046516 | Ga0495628_0008742 | Ga0495628_0008742_3290_4159 | 284 |
| 420 | 3300048905 | Ga0496102_0091395 | Ga0496102_0091395_1053_1913 | 284 |
| 421 | 3300048906 | Ga0496103_0111620 | Ga0496103_0111620_852_1712 | 284 |
| 422 | 3300048909 | Ga0496106_0343267 | Ga0496106_0343267_219_1079 | 284 |
| 423 | 3300048910 | Ga0496107_0305996 | Ga0496107_0305996_273_1133 | 284 |
| 424 | 3300048912 | Ga0496109_0245531 | Ga0496109_0245531_213_1073 | 284 |
| 425 | 3300048913 | Ga0496110_0260791 | Ga0496110_0260791_646_1506 | 284 |
| 426 | 3300048914 | Ga0496111_0075282 | Ga0496111_0075282_403_1263 | 284 |
| 427 | 3300049824 | Ga0501045_0155953 | Ga0501045_0155953_648_1508 | 284 |
| 428 | 3300050509 | nmdc:mga0qj67_49588_c1 | nmdc:mga0qj67_49588_c1_1743_2609 | 284 |
| 429 | 3300050510 | nmdc:mga06r32_142077_c1 | nmdc:mga06r32_142077_c1_869_1741 | 284 |
| 430 | 3300050514 | nmdc:mga08x19_46012_c1 | nmdc:mga08x19_46012_c1_718_1578 | 284 |
| 431 | 3300053077 | Ga0495601_0001268 | Ga0495601_0001268_9109_9978 | 284 |
| 432 | 3300053077 | Ga0495601_0027000 | Ga0495601_0027000_734_1606 | 284 |
| 433 | 3300053078 | Ga0495612_0018995 | Ga0495612_0018995_1695_2564 | 284 |
| 434 | 3300061719 | Ga0466962_0000748 | Ga0466962_0000748_7772_8641 | 284 |
| 435 | iso_pu_bacteria | 2558860112 | 2558913113 | 284 |
| 436 | iso_pu_bacteria | 2816332139 | 2816510689 | 284 |
| 437 | iso_pu_bacteria | 2818991472 | 2819739210 | 284 |
| 438 | iso_pu_bacteria | 2866612099 | 2866617782 | 284 |
| 439 | iso_pu_bacteria | 2899359706 | 2899364092 | 284 |
| 440 | iso_pu_bacteria | 2995463766 | 2995470976 | 284 |
| 441 | 3300005445 | Ga0070708_100000014 | Ga0070708_10000001461 | 285 |
| 442 | 3300005467 | Ga0070706_100000059 | Ga0070706_10000005941 | 285 |
| 443 | 3300005467 | Ga0070706_100043893 | Ga0070706_1000438933 | 285 |
| 444 | 3300005468 | Ga0070707_100000024 | Ga0070707_10000002437 | 285 |
| 445 | 3300005518 | Ga0070699_100000046 | Ga0070699_10000004641 | 285 |
| 446 | 3300005518 | Ga0070699_100255795 | Ga0070699_1002557951 | 285 |
| 447 | 3300005549 | Ga0070704_100003527 | Ga0070704_1000035272 | 285 |
| 448 | 3300005937 | Ga0081455_10010065 | Ga0081455_100100657 | 285 |
| 449 | 3300005981 | Ga0081538_10000096 | Ga0081538_1000009624 | 285 |
| 450 | 3300005981 | Ga0081538_10000683 | Ga0081538_1000068329 | 285 |
| 451 | 3300005981 | Ga0081538_10045506 | Ga0081538_100455063 | 285 |
| 452 | 3300006028 | Ga0070717_10406454 | Ga0070717_104064542 | 285 |
| 453 | 3300032002 | Ga0307416_100463641 | Ga0307416_1004636412 | 285 |
| 454 | 3300042016 | Ga0439463_012907 | Ga0439463_012907_38_895 | 285 |
| 455 | 3300042993 | Ga0439440_0019313 | Ga0439440_0019313_205_1074 | 285 |
| 456 | 3300046454 | Ga0495592_0162615 | Ga0495592_0162615_544_1440 | 285 |
| 457 | 3300046559 | Ga0495667_0024286 | Ga0495667_0024286_929_1825 | 285 |
| 458 | 3300046642 | Ga0495634_0013542 | Ga0495634_0013542_1742_2638 | 285 |
| 459 | 3300046675 | Ga0495657_0010350 | Ga0495657_0010350_3230_4126 | 285 |
| 460 | 3300049573 | Ga0501037_0166246 | Ga0501037_0166246_401_1270 | 285 |
| 461 | 3300049575 | Ga0501039_0071197 | Ga0501039_0071197_351_1220 | 285 |
| 462 | 3300049576 | Ga0501040_0002194 | Ga0501040_0002194_1150_2019 | 285 |
| 463 | 3300049582 | Ga0501048_0176683 | Ga0501048_0176683_399_1268 | 285 |
| 464 | 3300049590 | Ga0501074_0041280 | Ga0501074_0041280_1355_2224 | 285 |
| 465 | 3300049592 | Ga0501076_0130345 | Ga0501076_0130345_195_1064 | 285 |
| 466 | 3300049741 | Ga0501079_0010899 | Ga0501079_0010899_3447_4316 | 285 |
| 467 | 3300049743 | Ga0501081_0091440 | Ga0501081_0091440_691_1560 | 285 |
| 468 | 3300049824 | Ga0501045_0022982 | Ga0501045_0022982_3504_4373 | 285 |
| 469 | 3300054114 | Ga0501084_0085914 | Ga0501084_0085914_1172_2041 | 285 |
| 470 | 3300061734 | Ga0530510_0128825 | Ga0530510_0128825_388_1257 | 285 |
| 471 | 3300005329 | Ga0070683_100540639 | Ga0070683_1005406391 | 286 |
| 472 | 3300005434 | Ga0070709_10017375 | Ga0070709_100173753 | 286 |
| 473 | 3300005435 | Ga0070714_100001336 | Ga0070714_1000013366 | 286 |
| 474 | 3300005435 | Ga0070714_100159013 | Ga0070714_1001590132 | 286 |
| 475 | 3300005436 | Ga0070713_100035365 | Ga0070713_1000353653 | 286 |
| 476 | 3300005436 | Ga0070713_100073654 | Ga0070713_1000736542 | 286 |
| 477 | 3300005436 | Ga0070713_100310710 | Ga0070713_1003107102 | 286 |
| 478 | 3300005437 | Ga0070710_10000854 | Ga0070710_1000085413 | 286 |
| 479 | 3300005439 | Ga0070711_100020933 | Ga0070711_1000209332 | 286 |
| 480 | 3300005467 | Ga0070706_100007618 | Ga0070706_1000076182 | 286 |
| 481 | 3300005467 | Ga0070706_100013918 | Ga0070706_1000139183 | 286 |
| 482 | 3300005468 | Ga0070707_100039269 | Ga0070707_1000392693 | 286 |
| 483 | 3300005471 | Ga0070698_100040946 | Ga0070698_1000409462 | 286 |
| 484 | 3300005471 | Ga0070698_100140713 | Ga0070698_1001407131 | 286 |
| 485 | 3300005536 | Ga0070697_100013956 | Ga0070697_1000139564 | 286 |
| 486 | 3300005983 | Ga0081540_1001167 | Ga0081540_100116723 | 286 |
| 487 | 3300006028 | Ga0070717_10022617 | Ga0070717_100226173 | 286 |
| 488 | 3300006028 | Ga0070717_10054698 | Ga0070717_100546984 | 286 |
| 489 | 3300006028 | Ga0070717_10064309 | Ga0070717_100643092 | 286 |
| 490 | 3300006038 | Ga0075365_10041752 | Ga0075365_100417523 | 286 |
| 491 | 3300006173 | Ga0070716_100001061 | Ga0070716_1000010614 | 286 |
| 492 | 3300006175 | Ga0070712_100003884 | Ga0070712_1000038847 | 286 |
| 493 | 3300006844 | Ga0075428_100081251 | Ga0075428_1000812512 | 286 |
| 494 | 3300006852 | Ga0075433_10027137 | Ga0075433_100271372 | 286 |
| 495 | 3300006852 | Ga0075433_10045051 | Ga0075433_100450512 | 286 |
| 496 | 3300006871 | Ga0075434_100077178 | Ga0075434_1000771783 | 286 |
| 497 | 3300007076 | Ga0075435_100083185 | Ga0075435_1000831852 | 286 |
| 498 | 3300009147 | Ga0114129_10005485 | Ga0114129_1000548512 | 286 |
| 499 | 3300009177 | Ga0105248_10195572 | Ga0105248_101955722 | 286 |
| 500 | 3300013296 | Ga0157374_10212197 | Ga0157374_102121972 | 286 |
| 501 | 3300013306 | Ga0163162_10214220 | Ga0163162_102142202 | 286 |
| 502 | 3300013308 | Ga0157375_10005616 | Ga0157375_100056162 | 286 |
| 503 | 3300014325 | Ga0163163_10071420 | Ga0163163_100714203 | 286 |
| 504 | 3300021388 | Ga0213875_10009768 | Ga0213875_100097685 | 286 |
| 505 | 3300025898 | Ga0207692_10023163 | Ga0207692_100231632 | 286 |
| 506 | 3300025906 | Ga0207699_10001508 | Ga0207699_100015082 | 286 |
| 507 | 3300025910 | Ga0207684_10002850 | Ga0207684_1000285016 | 286 |
| 508 | 3300025915 | Ga0207693_10048025 | Ga0207693_100480252 | 286 |
| 509 | 3300025928 | Ga0207700_10014702 | Ga0207700_100147022 | 286 |
| 510 | 3300025929 | Ga0207664_10005044 | Ga0207664_100050445 | 286 |
| 511 | 3300025929 | Ga0207664_10005696 | Ga0207664_100056962 | 286 |
| 512 | 3300025939 | Ga0207665_10003721 | Ga0207665_100037212 | 286 |
| 513 | 3300025940 | Ga0207691_10439271 | Ga0207691_104392711 | 286 |
| 514 | 3300025944 | Ga0207661_10050929 | Ga0207661_100509291 | 286 |
| 515 | 3300025945 | Ga0207679_10431708 | Ga0207679_104317081 | 286 |
| 516 | 3300026142 | Ga0207698_10411798 | Ga0207698_104117982 | 286 |
| 517 | 3300028379 | Ga0268266_10428405 | Ga0268266_104284052 | 286 |
| 518 | 3300028786 | Ga0307517_10003710 | Ga0307517_100037104 | 286 |
| 519 | 3300030521 | Ga0307511_10105972 | Ga0307511_101059721 | 286 |
| 520 | 3300030522 | Ga0307512_10002471 | Ga0307512_100024716 | 286 |
| 521 | 3300031507 | Ga0307509_10163490 | Ga0307509_101634903 | 286 |
| 522 | 3300031616 | Ga0307508_10016728 | Ga0307508_100167283 | 286 |
| 523 | 3300031616 | Ga0307508_10025972 | Ga0307508_100259723 | 286 |
| 524 | 3300031730 | Ga0307516_10039706 | Ga0307516_100397064 | 286 |
| 525 | 3300033180 | Ga0307510_10308021 | Ga0307510_103080211 | 286 |
| 526 | 3300035083 | Ga0373926_0096018 | Ga0373926_0096018_68_949 | 286 |
| 527 | 3300035086 | Ga0373934_0000021 | Ga0373934_0000021_5348_6229 | 286 |
| 528 | 3300035111 | Ga0373923_0004679 | Ga0373923_0004679_1134_2015 | 286 |
| 529 | 3300035117 | Ga0373953_0000328 | Ga0373953_0000328_368_1249 | 286 |
| 530 | 3300035118 | Ga0373954_0000423 | Ga0373954_0000423_14506_15387 | 286 |
| 531 | 3300035119 | Ga0373956_0000073 | Ga0373956_0000073_5213_6094 | 286 |
| 532 | 3300035120 | Ga0373957_0001129 | Ga0373957_0001129_5369_6250 | 286 |
| 533 | 3300035172 | Ga0373955_0000125 | Ga0373955_0000125_21170_22051 | 286 |
| 534 | 3300035410 | Ga0373924_0000419 | Ga0373924_0000419_6773_7654 | 286 |
| 535 | 3300035410 | Ga0373924_0092327 | Ga0373924_0092327_186_1067 | 286 |
| 536 | 3300035724 | Ga0373933_0001491 | Ga0373933_0001491_7448_8329 | 286 |
| 537 | 3300036401 | Ga0373937_0000169 | Ga0373937_0000169_57339_58220 | 286 |
| 538 | 3300036401 | Ga0373937_0263563 | Ga0373937_0263563_399_1280 | 286 |
| 539 | 3300041406 | Ga0439439_0015490 | Ga0439439_0015490_634_1524 | 286 |
| 540 | 3300041411 | Ga0439466_0027522 | Ga0439466_0027522_594_1484 | 286 |
| 541 | 3300041512 | Ga0451853_0418742 | Ga0451853_0418742_5173_6060 | 286 |
| 542 | 3300041999 | Ga0439433_0003783 | Ga0439433_0003783_1180_2154 | 286 |
| 543 | 3300042007 | Ga0439449_0000547 | Ga0439449_0000547_9658_10548 | 286 |
| 544 | 3300042007 | Ga0439449_0026449 | Ga0439449_0026449_600_1472 | 286 |
| 545 | 3300042131 | Ga0450894_000030 | Ga0450894_000030_3314_4204 | 286 |
| 546 | 3300042133 | Ga0450896_002861 | Ga0450896_002861_842_1732 | 286 |
| 547 | 3300042184 | Ga0450908_018391 | Ga0450908_018391_261_1151 | 286 |
| 548 | 3300045976 | Ga0466967_0106994 | Ga0466967_0106994_1651_2520 | 286 |
| 549 | 3300045976 | Ga0466967_0346449 | Ga0466967_0346449_535_1425 | 286 |
| 550 | 3300046454 | Ga0495592_0000070 | Ga0495592_0000070_5376_6257 | 286 |
| 551 | 3300046455 | Ga0495603_0164913 | Ga0495603_0164913_201_1088 | 286 |
| 552 | 3300046457 | Ga0495590_0028614 | Ga0495590_0028614_639_1526 | 286 |
| 553 | 3300046459 | Ga0495629_0013328 | Ga0495629_0013328_1388_2275 | 286 |
| 554 | 3300046462 | Ga0495651_0000042 | Ga0495651_0000042_86999_87880 | 286 |
| 555 | 3300046462 | Ga0495651_0038132 | Ga0495651_0038132_2700_3596 | 286 |
| 556 | 3300046463 | Ga0495653_0031576 | Ga0495653_0031576_1074_1955 | 286 |
| 557 | 3300046499 | Ga0495594_0042224 | Ga0495594_0042224_755_1642 | 286 |
| 558 | 3300046501 | Ga0495607_0153336 | Ga0495607_0153336_257_1144 | 286 |
| 559 | 3300046511 | Ga0495608_0000054 | Ga0495608_0000054_86999_87880 | 286 |
| 560 | 3300046514 | Ga0495618_0029916 | Ga0495618_0029916_922_1818 | 286 |
| 561 | 3300046516 | Ga0495628_0001347 | Ga0495628_0001347_5351_6232 | 286 |
| 562 | 3300046516 | Ga0495628_0144248 | Ga0495628_0144248_667_1548 | 286 |
| 563 | 3300046519 | Ga0495632_0053454 | Ga0495632_0053454_868_1755 | 286 |
| 564 | 3300046522 | Ga0495643_0001950 | Ga0495643_0001950_13824_14711 | 286 |
| 565 | 3300046526 | Ga0495666_0084350 | Ga0495666_0084350_475_1371 | 286 |
| 566 | 3300046529 | Ga0495652_0000119 | Ga0495652_0000119_5361_6242 | 286 |
| 567 | 3300046529 | Ga0495652_0127208 | Ga0495652_0127208_364_1260 | 286 |
| 568 | 3300046533 | Ga0495640_0023486 | Ga0495640_0023486_1403_2299 | 286 |
| 569 | 3300046536 | Ga0495587_0000374 | Ga0495587_0000374_27043_27924 | 286 |
| 570 | 3300046543 | Ga0495645_0164977 | Ga0495645_0164977_377_1258 | 286 |
| 571 | 3300046559 | Ga0495667_0000114 | Ga0495667_0000114_5376_6257 | 286 |
| 572 | 3300046665 | Ga0495661_0167380 | Ga0495661_0167380_182_1069 | 286 |
| 573 | 3300046675 | Ga0495657_0000067 | Ga0495657_0000067_86999_87880 | 286 |
| 574 | 3300046675 | Ga0495657_0114000 | Ga0495657_0114000_596_1630 | 286 |
| 575 | 3300046678 | Ga0495599_0000042 | Ga0495599_0000042_7033_7914 | 286 |
| 576 | 3300046679 | Ga0495623_0000522 | Ga0495623_0000522_5314_6195 | 286 |
| 577 | 3300046679 | Ga0495623_0084230 | Ga0495623_0084230_975_1856 | 286 |
| 578 | 3300046680 | Ga0495646_0029012 | Ga0495646_0029012_1110_1991 | 286 |
| 579 | 3300046691 | Ga0495670_0013201 | Ga0495670_0013201_300_1187 | 286 |
| 580 | 3300046794 | Ga0495589_0011288 | Ga0495589_0011288_1126_2013 | 286 |
| 581 | 3300046809 | Ga0495600_0014145 | Ga0495600_0014145_1636_2517 | 286 |
| 582 | 3300046809 | Ga0495600_0035048 | Ga0495600_0035048_1389_2285 | 286 |
| 583 | 3300046810 | Ga0495660_0015609 | Ga0495660_0015609_3156_4043 | 286 |
| 584 | 3300047317 | Ga0495604_0000121 | Ga0495604_0000121_5376_6257 | 286 |
| 585 | 3300047321 | Ga0495676_0013435 | Ga0495676_0013435_2213_3109 | 286 |
| 586 | 3300047322 | Ga0495680_0000054 | Ga0495680_0000054_86988_87869 | 286 |
| 587 | 3300047444 | Ga0495675_0000346 | Ga0495675_0000346_5366_6247 | 286 |
| 588 | 3300047444 | Ga0495675_0114393 | Ga0495675_0114393_608_1540 | 286 |
| 589 | 3300047447 | Ga0495685_000223 | Ga0495685_000223_7662_8549 | 286 |
| 590 | 3300047470 | Ga0495681_0000654 | Ga0495681_0000654_18078_18965 | 286 |
| 591 | 3300048088 | Ga0495602_0000083 | Ga0495602_0000083_86999_87880 | 286 |
| 592 | 3300048088 | Ga0495602_0008130 | Ga0495602_0008130_9468_10349 | 286 |
| 593 | 3300048903 | Ga0496100_0341163 | Ga0496100_0341163_14_889 | 286 |
| 594 | 3300048904 | Ga0496101_0110785 | Ga0496101_0110785_1155_2030 | 286 |
| 595 | 3300048908 | Ga0496105_0098448 | Ga0496105_0098448_1338_2213 | 286 |
| 596 | 3300048911 | Ga0496108_0050723 | Ga0496108_0050723_698_1573 | 286 |
| 597 | 3300048911 | Ga0496108_0071004 | Ga0496108_0071004_1893_2783 | 286 |
| 598 | 3300048912 | Ga0496109_0010422 | Ga0496109_0010422_3789_4679 | 286 |
| 599 | 3300048912 | Ga0496109_0131677 | Ga0496109_0131677_552_1427 | 286 |
| 600 | 3300048914 | Ga0496111_0207339 | Ga0496111_0207339_341_1216 | 286 |
| 601 | 3300048915 | Ga0496112_0015213 | Ga0496112_0015213_3050_3925 | 286 |
| 602 | 3300048916 | Ga0496113_0211415 | Ga0496113_0211415_360_1235 | 286 |
| 603 | 3300049127 | Ga0501306_016613 | Ga0501306_016613_21_911 | 286 |
| 604 | 3300049568 | Ga0501031_0007875 | Ga0501031_0007875_4107_4994 | 286 |
| 605 | 3300049569 | Ga0501032_0011354 | Ga0501032_0011354_173_1069 | 286 |
| 606 | 3300049571 | Ga0501034_0030498 | Ga0501034_0030498_4551_5447 | 286 |
| 607 | 3300049573 | Ga0501037_0314737 | Ga0501037_0314737_155_1045 | 286 |
| 608 | 3300049578 | Ga0501042_0182028 | Ga0501042_0182028_388_1278 | 286 |
| 609 | 3300049579 | Ga0501043_0015282 | Ga0501043_0015282_2736_3632 | 286 |
| 610 | 3300049580 | Ga0501046_0044949 | Ga0501046_0044949_597_1463 | 286 |
| 611 | 3300049581 | Ga0501047_0000023 | Ga0501047_0000023_37507_38397 | 286 |
| 612 | 3300049591 | Ga0501075_0219358 | Ga0501075_0219358_230_1096 | 286 |
| 613 | 3300049743 | Ga0501081_0037174 | Ga0501081_0037174_366_1232 | 286 |
| 614 | 3300049822 | Ga0501035_0226776 | Ga0501035_0226776_292_1188 | 286 |
| 615 | 3300049823 | Ga0501044_0181917 | Ga0501044_0181917_406_1302 | 286 |
| 616 | 3300049823 | Ga0501044_0378228 | Ga0501044_0378228_168_1064 | 286 |
| 617 | 3300050492 | nmdc:mga0yw44_74322_c1 | nmdc:mga0yw44_74322_c1_402_1340 | 286 |
| 618 | 3300050507 | nmdc:mga05p37_845639_c1 | nmdc:mga05p37_845639_c1_32_913 | 286 |
| 619 | 3300050515 | nmdc:mga0a205_175159_c1 | nmdc:mga0a205_175159_c1_409_1290 | 286 |
| 620 | 3300050515 | nmdc:mga0a205_67448_c1 | nmdc:mga0a205_67448_c1_1661_2542 | 286 |
| 621 | 3300053083 | Ga0495655_0053454 | Ga0495655_0053454_37_924 | 286 |
| 622 | 3300053083 | Ga0495655_0062623 | Ga0495655_0062623_109_999 | 286 |
| 623 | 3300053084 | Ga0495595_0003474 | Ga0495595_0003474_1554_2435 | 286 |
| 624 | 3300053086 | Ga0500578_0012829 | Ga0500578_0012829_624_1511 | 286 |
| 625 | 3300053090 | Ga0500646_0019284 | Ga0500646_0019284_609_1496 | 286 |
| 626 | 3300053099 | Ga0500654_046647 | Ga0500654_046647_348_1235 | 286 |
| 627 | 3300053109 | Ga0500569_008053 | Ga0500569_008053_461_1348 | 286 |
| 628 | 3300053123 | Ga0500614_015709 | Ga0500614_015709_346_1299 | 286 |
| 629 | 3300053126 | Ga0500621_032779 | Ga0500621_032779_367_1254 | 286 |
| 630 | 3300053131 | Ga0500652_003585 | Ga0500652_003585_2635_3522 | 286 |
| 631 | 3300053134 | Ga0500658_0016919 | Ga0500658_0016919_902_1789 | 286 |
| 632 | 3300053136 | Ga0500559_0007533 | Ga0500559_0007533_1038_1916 | 286 |
| 633 | 3300053137 | Ga0500561_0002620 | Ga0500561_0002620_1037_1924 | 286 |
| 634 | 3300053149 | Ga0500600_0012729 | Ga0500600_0012729_752_1639 | 286 |
| 635 | 3300053150 | Ga0500603_034744 | Ga0500603_034744_60_947 | 286 |
| 636 | 3300053153 | Ga0500616_0103025 | Ga0500616_0103025_303_1190 | 286 |
| 637 | 3300053160 | Ga0500633_0000265 | Ga0500633_0000265_2521_3408 | 286 |
| 638 | 3300053161 | Ga0500634_0004205 | Ga0500634_0004205_1391_2278 | 286 |
| 639 | 3300053732 | Ga0500656_003629 | Ga0500656_003629_214_1101 | 286 |
| 640 | 3300053739 | Ga0500587_000082 | Ga0500587_000082_1433_2320 | 286 |
| 641 | 3300061719 | Ga0466962_0150991 | Ga0466962_0150991_41_931 | 286 |
| 642 | 3300005329 | Ga0070683_100059451 | Ga0070683_1000594512 | 287 |
| 643 | 3300005336 | Ga0070680_100105043 | Ga0070680_1001050432 | 287 |
| 644 | 3300005366 | Ga0070659_100207599 | Ga0070659_1002075992 | 287 |
| 645 | 3300005435 | Ga0070714_100002123 | Ga0070714_1000021232 | 287 |
| 646 | 3300005435 | Ga0070714_100057038 | Ga0070714_1000570382 | 287 |
| 647 | 3300005436 | Ga0070713_100042584 | Ga0070713_1000425842 | 287 |
| 648 | 3300005468 | Ga0070707_100019327 | Ga0070707_1000193275 | 287 |
| 649 | 3300005468 | Ga0070707_100186085 | Ga0070707_1001860853 | 287 |
| 650 | 3300006175 | Ga0070712_100066882 | Ga0070712_1000668823 | 287 |
| 651 | 3300006914 | Ga0075436_100131142 | Ga0075436_1001311422 | 287 |
| 652 | 3300009553 | Ga0105249_10129478 | Ga0105249_101294782 | 287 |
| 653 | 3300013307 | Ga0157372_10164374 | Ga0157372_101643743 | 287 |
| 654 | 3300013307 | Ga0157372_10322389 | Ga0157372_103223892 | 287 |
| 655 | 3300014497 | Ga0182008_10182663 | Ga0182008_101826632 | 287 |
| 656 | 3300025915 | Ga0207693_10268076 | Ga0207693_102680762 | 287 |
| 657 | 3300025916 | Ga0207663_10126979 | Ga0207663_101269792 | 287 |
| 658 | 3300025917 | Ga0207660_10415032 | Ga0207660_104150322 | 287 |
| 659 | 3300025922 | Ga0207646_10166926 | Ga0207646_101669262 | 287 |
| 660 | 3300025924 | Ga0207694_10401490 | Ga0207694_104014902 | 287 |
| 661 | 3300025929 | Ga0207664_10061820 | Ga0207664_100618203 | 287 |
| 662 | 3300025929 | Ga0207664_10181544 | Ga0207664_101815441 | 287 |
| 663 | 3300025944 | Ga0207661_10018617 | Ga0207661_100186175 | 287 |
| 664 | 3300025961 | Ga0207712_10137887 | Ga0207712_101378872 | 287 |
| 665 | 3300046690 | Ga0495624_0177746 | Ga0495624_0177746_29_919 | 287 |
| 666 | 3300047317 | Ga0495604_0003376 | Ga0495604_0003376_7239_8126 | 287 |
| 667 | 3300047322 | Ga0495680_0136922 | Ga0495680_0136922_99_968 | 287 |
| 668 | 3300047444 | Ga0495675_0012881 | Ga0495675_0012881_3276_4163 | 287 |
| 669 | 3300048905 | Ga0496102_0505222 | Ga0496102_0505222_234_1121 | 287 |
| 670 | 3300049578 | Ga0501042_0011625 | Ga0501042_0011625_914_1963 | 287 |
| 671 | 3300050514 | nmdc:mga08x19_277246_c1 | nmdc:mga08x19_277246_c1_49_1014 | 287 |
| 672 | 3300053140 | Ga0500573_0016388 | Ga0500573_0016388_1239_2171 | 287 |
| 673 | 3300003203 | JGI25406J46586_10020814 | JGI25406J46586_100208143 | 288 |
| 674 | 3300003320 | rootH2_10056866 | rootH2_100568662 | 288 |
| 675 | 3300005327 | Ga0070658_10202332 | Ga0070658_102023323 | 288 |
| 676 | 3300005336 | Ga0070680_100175649 | Ga0070680_1001756493 | 288 |
| 677 | 3300005337 | Ga0070682_100328889 | Ga0070682_1003288891 | 288 |
| 678 | 3300005364 | Ga0070673_100598870 | Ga0070673_1005988701 | 288 |
| 679 | 3300005434 | Ga0070709_10003354 | Ga0070709_100033547 | 288 |
| 680 | 3300005434 | Ga0070709_10021354 | Ga0070709_100213542 | 288 |
| 681 | 3300005435 | Ga0070714_100000770 | Ga0070714_10000077014 | 288 |
| 682 | 3300005435 | Ga0070714_100375791 | Ga0070714_1003757911 | 288 |
| 683 | 3300005436 | Ga0070713_100016908 | Ga0070713_1000169083 | 288 |
| 684 | 3300005436 | Ga0070713_100064896 | Ga0070713_1000648961 | 288 |
| 685 | 3300005437 | Ga0070710_10000697 | Ga0070710_1000069711 | 288 |
| 686 | 3300005437 | Ga0070710_10048538 | Ga0070710_100485382 | 288 |
| 687 | 3300005437 | Ga0070710_10064924 | Ga0070710_100649243 | 288 |
| 688 | 3300005439 | Ga0070711_100001444 | Ga0070711_1000014446 | 288 |
| 689 | 3300005439 | Ga0070711_100194104 | Ga0070711_1001941041 | 288 |
| 690 | 3300005440 | Ga0070705_100433242 | Ga0070705_1004332421 | 288 |
| 691 | 3300005441 | Ga0070700_100000003 | Ga0070700_100000003108 | 288 |
| 692 | 3300005445 | Ga0070708_100001201 | Ga0070708_1000012014 | 288 |
| 693 | 3300005445 | Ga0070708_100002929 | Ga0070708_1000029299 | 288 |
| 694 | 3300005445 | Ga0070708_100030895 | Ga0070708_1000308952 | 288 |
| 695 | 3300005445 | Ga0070708_100379330 | Ga0070708_1003793301 | 288 |
| 696 | 3300005458 | Ga0070681_10262212 | Ga0070681_102622122 | 288 |
| 697 | 3300005467 | Ga0070706_100000148 | Ga0070706_10000014843 | 288 |
| 698 | 3300005467 | Ga0070706_100013102 | Ga0070706_1000131025 | 288 |
| 699 | 3300005467 | Ga0070706_100025028 | Ga0070706_1000250283 | 288 |
| 700 | 3300005467 | Ga0070706_100026320 | Ga0070706_1000263203 | 288 |
| 701 | 3300005467 | Ga0070706_100170641 | Ga0070706_1001706412 | 288 |
| 702 | 3300005468 | Ga0070707_100001495 | Ga0070707_1000014955 | 288 |
| 703 | 3300005468 | Ga0070707_100002640 | Ga0070707_10000264011 | 288 |
| 704 | 3300005468 | Ga0070707_100013326 | Ga0070707_1000133264 | 288 |
| 705 | 3300005468 | Ga0070707_100050139 | Ga0070707_1000501396 | 288 |
| 706 | 3300005468 | Ga0070707_100375267 | Ga0070707_1003752672 | 288 |
| 707 | 3300005471 | Ga0070698_100002583 | Ga0070698_10000258312 | 288 |
| 708 | 3300005471 | Ga0070698_100003288 | Ga0070698_10000328815 | 288 |
| 709 | 3300005471 | Ga0070698_100005217 | Ga0070698_1000052173 | 288 |
| 710 | 3300005471 | Ga0070698_100006326 | Ga0070698_1000063262 | 288 |
| 711 | 3300005471 | Ga0070698_100030982 | Ga0070698_1000309827 | 288 |
| 712 | 3300005471 | Ga0070698_100114094 | Ga0070698_1001140942 | 288 |
| 713 | 3300005471 | Ga0070698_100120737 | Ga0070698_1001207372 | 288 |
| 714 | 3300005471 | Ga0070698_100141343 | Ga0070698_1001413431 | 288 |
| 715 | 3300005518 | Ga0070699_100000108 | Ga0070699_10000010846 | 288 |
| 716 | 3300005518 | Ga0070699_100411407 | Ga0070699_1004114071 | 288 |
| 717 | 3300005535 | Ga0070684_100028507 | Ga0070684_1000285074 | 288 |
| 718 | 3300005536 | Ga0070697_100015274 | Ga0070697_1000152744 | 288 |
| 719 | 3300005546 | Ga0070696_100140480 | Ga0070696_1001404801 | 288 |
| 720 | 3300005548 | Ga0070665_100528921 | Ga0070665_1005289211 | 288 |
| 721 | 3300005577 | Ga0068857_100237652 | Ga0068857_1002376522 | 288 |
| 722 | 3300005614 | Ga0068856_100044294 | Ga0068856_1000442942 | 288 |
| 723 | 3300005618 | Ga0068864_100371197 | Ga0068864_1003711972 | 288 |
| 724 | 3300005841 | Ga0068863_100069219 | Ga0068863_1000692193 | 288 |
| 725 | 3300005937 | Ga0081455_10001379 | Ga0081455_100013794 | 288 |
| 726 | 3300005937 | Ga0081455_10002490 | Ga0081455_1000249015 | 288 |
| 727 | 3300005981 | Ga0081538_10003211 | Ga0081538_1000321114 | 288 |
| 728 | 3300005981 | Ga0081538_10015613 | Ga0081538_100156133 | 288 |
| 729 | 3300005985 | Ga0081539_10000880 | Ga0081539_1000088049 | 288 |
| 730 | 3300005985 | Ga0081539_10001247 | Ga0081539_1000124719 | 288 |
| 731 | 3300005985 | Ga0081539_10005361 | Ga0081539_1000536111 | 288 |
| 732 | 3300005985 | Ga0081539_10019294 | Ga0081539_100192942 | 288 |
| 733 | 3300005985 | Ga0081539_10043244 | Ga0081539_100432442 | 288 |
| 734 | 3300005985 | Ga0081539_10055623 | Ga0081539_100556232 | 288 |
| 735 | 3300006028 | Ga0070717_10007065 | Ga0070717_100070652 | 288 |
| 736 | 3300006028 | Ga0070717_10008992 | Ga0070717_100089924 | 288 |
| 737 | 3300006163 | Ga0070715_10003954 | Ga0070715_100039544 | 288 |
| 738 | 3300006173 | Ga0070716_100000595 | Ga0070716_1000005958 | 288 |
| 739 | 3300006173 | Ga0070716_100001465 | Ga0070716_1000014652 | 288 |
| 740 | 3300006175 | Ga0070712_100001269 | Ga0070712_1000012696 | 288 |
| 741 | 3300006175 | Ga0070712_100260480 | Ga0070712_1002604802 | 288 |
| 742 | 3300006237 | Ga0097621_100447613 | Ga0097621_1004476131 | 288 |
| 743 | 3300006358 | Ga0068871_100208787 | Ga0068871_1002087872 | 288 |
| 744 | 3300006844 | Ga0075428_100050775 | Ga0075428_1000507754 | 288 |
| 745 | 3300006844 | Ga0075428_100421086 | Ga0075428_1004210862 | 288 |
| 746 | 3300006846 | Ga0075430_100041988 | Ga0075430_1000419881 | 288 |
| 747 | 3300006847 | Ga0075431_100001242 | Ga0075431_10000124214 | 288 |
| 748 | 3300006847 | Ga0075431_100001775 | Ga0075431_1000017759 | 288 |
| 749 | 3300006871 | Ga0075434_100084877 | Ga0075434_1000848773 | 288 |
| 750 | 3300006871 | Ga0075434_100291622 | Ga0075434_1002916222 | 288 |
| 751 | 3300006880 | Ga0075429_100003370 | Ga0075429_10000337011 | 288 |
| 752 | 3300006880 | Ga0075429_100024528 | Ga0075429_1000245283 | 288 |
| 753 | 3300006914 | Ga0075436_100153198 | Ga0075436_1001531982 | 288 |
| 754 | 3300007076 | Ga0075435_100062794 | Ga0075435_1000627943 | 288 |
| 755 | 3300009094 | Ga0111539_10025324 | Ga0111539_100253242 | 288 |
| 756 | 3300009094 | Ga0111539_10133624 | Ga0111539_101336243 | 288 |
| 757 | 3300009101 | Ga0105247_10069278 | Ga0105247_100692782 | 288 |
| 758 | 3300009147 | Ga0114129_10155995 | Ga0114129_101559952 | 288 |
| 759 | 3300009147 | Ga0114129_10745257 | Ga0114129_107452572 | 288 |
| 760 | 3300009174 | Ga0105241_10194552 | Ga0105241_101945522 | 288 |
| 761 | 3300009177 | Ga0105248_10308662 | Ga0105248_103086622 | 288 |
| 762 | 3300009545 | Ga0105237_10159166 | Ga0105237_101591662 | 288 |
| 763 | 3300009551 | Ga0105238_10642741 | Ga0105238_106427412 | 288 |
| 764 | 3300013102 | Ga0157371_10211198 | Ga0157371_102111982 | 288 |
| 765 | 3300013105 | Ga0157369_10825311 | Ga0157369_108253111 | 288 |
| 766 | 3300013306 | Ga0163162_10194445 | Ga0163162_101944453 | 288 |
| 767 | 3300013308 | Ga0157375_10136323 | Ga0157375_101363232 | 288 |
| 768 | 3300013308 | Ga0157375_10406521 | Ga0157375_104065212 | 288 |
| 769 | 3300014968 | Ga0157379_10097932 | Ga0157379_100979323 | 288 |
| 770 | 3300014969 | Ga0157376_10483217 | Ga0157376_104832171 | 288 |
| 771 | 3300020082 | Ga0206353_11255998 | Ga0206353_112559981 | 288 |
| 772 | 3300020082 | Ga0206353_11258446 | Ga0206353_112584466 | 288 |
| 773 | 3300021377 | Ga0213874_10091327 | Ga0213874_100913271 | 288 |
| 774 | 3300021388 | Ga0213875_10099926 | Ga0213875_100999261 | 288 |
| 775 | 3300025898 | Ga0207692_10075628 | Ga0207692_100756282 | 288 |
| 776 | 3300025905 | Ga0207685_10001463 | Ga0207685_100014634 | 288 |
| 777 | 3300025905 | Ga0207685_10004658 | Ga0207685_100046583 | 288 |
| 778 | 3300025905 | Ga0207685_10072438 | Ga0207685_100724382 | 288 |
| 779 | 3300025906 | Ga0207699_10001939 | Ga0207699_100019393 | 288 |
| 780 | 3300025906 | Ga0207699_10011039 | Ga0207699_100110395 | 288 |
| 781 | 3300025906 | Ga0207699_10018952 | Ga0207699_100189523 | 288 |
| 782 | 3300025909 | Ga0207705_10189322 | Ga0207705_101893222 | 288 |
| 783 | 3300025910 | Ga0207684_10000002 | Ga0207684_10000002735 | 288 |
| 784 | 3300025910 | Ga0207684_10002291 | Ga0207684_100022917 | 288 |
| 785 | 3300025910 | Ga0207684_10002641 | Ga0207684_1000264113 | 288 |
| 786 | 3300025910 | Ga0207684_10008669 | Ga0207684_100086697 | 288 |
| 787 | 3300025910 | Ga0207684_10018622 | Ga0207684_100186223 | 288 |
| 788 | 3300025910 | Ga0207684_10022633 | Ga0207684_100226333 | 288 |
| 789 | 3300025910 | Ga0207684_10089133 | Ga0207684_100891333 | 288 |
| 790 | 3300025910 | Ga0207684_10311106 | Ga0207684_103111062 | 288 |
| 791 | 3300025910 | Ga0207684_10340073 | Ga0207684_103400732 | 288 |
| 792 | 3300025912 | Ga0207707_10187999 | Ga0207707_101879992 | 288 |
| 793 | 3300025915 | Ga0207693_10002126 | Ga0207693_1000212614 | 288 |
| 794 | 3300025915 | Ga0207693_10024034 | Ga0207693_100240342 | 288 |
| 795 | 3300025915 | Ga0207693_10261780 | Ga0207693_102617802 | 288 |
| 796 | 3300025916 | Ga0207663_10001522 | Ga0207663_100015226 | 288 |
| 797 | 3300025916 | Ga0207663_10026213 | Ga0207663_100262131 | 288 |
| 798 | 3300025916 | Ga0207663_10130246 | Ga0207663_101302461 | 288 |
| 799 | 3300025919 | Ga0207657_10232922 | Ga0207657_102329222 | 288 |
| 800 | 3300025921 | Ga0207652_10103736 | Ga0207652_101037363 | 288 |
| 801 | 3300025921 | Ga0207652_10148697 | Ga0207652_101486972 | 288 |
| 802 | 3300025922 | Ga0207646_10000636 | Ga0207646_1000063630 | 288 |
| 803 | 3300025922 | Ga0207646_10001890 | Ga0207646_100018905 | 288 |
| 804 | 3300025922 | Ga0207646_10002282 | Ga0207646_1000228217 | 288 |
| 805 | 3300025922 | Ga0207646_10005535 | Ga0207646_100055355 | 288 |
| 806 | 3300025922 | Ga0207646_10011947 | Ga0207646_100119475 | 288 |
| 807 | 3300025922 | Ga0207646_10023563 | Ga0207646_100235636 | 288 |
| 808 | 3300025922 | Ga0207646_10044142 | Ga0207646_100441425 | 288 |
| 809 | 3300025922 | Ga0207646_10065517 | Ga0207646_100655173 | 288 |
| 810 | 3300025922 | Ga0207646_10133234 | Ga0207646_101332342 | 288 |
| 811 | 3300025922 | Ga0207646_10139688 | Ga0207646_101396882 | 288 |
| 812 | 3300025922 | Ga0207646_10466250 | Ga0207646_104662502 | 288 |
| 813 | 3300025928 | Ga0207700_10000518 | Ga0207700_1000051814 | 288 |
| 814 | 3300025928 | Ga0207700_10003056 | Ga0207700_100030563 | 288 |
| 815 | 3300025928 | Ga0207700_10016541 | Ga0207700_100165413 | 288 |
| 816 | 3300025928 | Ga0207700_10027370 | Ga0207700_100273703 | 288 |
| 817 | 3300025928 | Ga0207700_10084221 | Ga0207700_100842211 | 288 |
| 818 | 3300025929 | Ga0207664_10001398 | Ga0207664_100013988 | 288 |
| 819 | 3300025929 | Ga0207664_10004201 | Ga0207664_100042017 | 288 |
| 820 | 3300025929 | Ga0207664_10026984 | Ga0207664_100269845 | 288 |
| 821 | 3300025929 | Ga0207664_10064871 | Ga0207664_100648713 | 288 |
| 822 | 3300025929 | Ga0207664_10137800 | Ga0207664_101378002 | 288 |
| 823 | 3300025939 | Ga0207665_10000328 | Ga0207665_1000032821 | 288 |
| 824 | 3300025939 | Ga0207665_10009995 | Ga0207665_100099954 | 288 |
| 825 | 3300025939 | Ga0207665_10082244 | Ga0207665_100822443 | 288 |
| 826 | 3300025939 | Ga0207665_10096508 | Ga0207665_100965083 | 288 |
| 827 | 3300026023 | Ga0207677_10560809 | Ga0207677_105608091 | 288 |
| 828 | 3300026075 | Ga0207708_10000002 | Ga0207708_10000002247 | 288 |
| 829 | 3300026078 | Ga0207702_10031245 | Ga0207702_100312452 | 288 |
| 830 | 3300026078 | Ga0207702_10207185 | Ga0207702_102071852 | 288 |
| 831 | 3300026121 | Ga0207683_10174424 | Ga0207683_101744242 | 288 |
| 832 | 3300026121 | Ga0207683_10283032 | Ga0207683_102830322 | 288 |
| 833 | 3300028381 | Ga0268264_10117203 | Ga0268264_101172032 | 288 |
| 834 | 3300031456 | Ga0307513_10004399 | Ga0307513_100043992 | 288 |
| 835 | 3300031548 | Ga0307408_100192736 | Ga0307408_1001927362 | 288 |
| 836 | 3300031852 | Ga0307410_10009253 | Ga0307410_100092535 | 288 |
| 837 | 3300031852 | Ga0307410_10182015 | Ga0307410_101820151 | 288 |
| 838 | 3300031901 | Ga0307406_10040475 | Ga0307406_100404752 | 288 |
| 839 | 3300031901 | Ga0307406_10066450 | Ga0307406_100664502 | 288 |
| 840 | 3300031903 | Ga0307407_10051293 | Ga0307407_100512931 | 288 |
| 841 | 3300031903 | Ga0307407_10251655 | Ga0307407_102516551 | 288 |
| 842 | 3300031903 | Ga0307407_10256360 | Ga0307407_102563602 | 288 |
| 843 | 3300031995 | Ga0307409_100057751 | Ga0307409_1000577513 | 288 |
| 844 | 3300031995 | Ga0307409_100089250 | Ga0307409_1000892501 | 288 |
| 845 | 3300031995 | Ga0307409_100131220 | Ga0307409_1001312202 | 288 |
| 846 | 3300031995 | Ga0307409_100414433 | Ga0307409_1004144331 | 288 |
| 847 | 3300031995 | Ga0307409_100449796 | Ga0307409_1004497961 | 288 |
| 848 | 3300032002 | Ga0307416_100048502 | Ga0307416_1000485022 | 288 |
| 849 | 3300032002 | Ga0307416_100369102 | Ga0307416_1003691022 | 288 |
| 850 | 3300032002 | Ga0307416_100378104 | Ga0307416_1003781042 | 288 |
| 851 | 3300032004 | Ga0307414_10008167 | Ga0307414_100081672 | 288 |
| 852 | 3300032004 | Ga0307414_10012761 | Ga0307414_100127613 | 288 |
| 853 | 3300032004 | Ga0307414_10039837 | Ga0307414_100398372 | 288 |
| 854 | 3300032004 | Ga0307414_10276068 | Ga0307414_102760681 | 288 |
| 855 | 3300032004 | Ga0307414_10561185 | Ga0307414_105611851 | 288 |
| 856 | 3300032126 | Ga0307415_100052011 | Ga0307415_1000520113 | 288 |
| 857 | 3300034820 | Ga0373959_0009704 | Ga0373959_0009704_50_916 | 288 |
| 858 | 3300034957 | Ga0373938_0007787 | Ga0373938_0007787_476_1342 | 288 |
| 859 | 3300035083 | Ga0373926_0000519 | Ga0373926_0000519_1102_2010 | 288 |
| 860 | 3300035086 | Ga0373934_0024594 | Ga0373934_0024594_445_1311 | 288 |
| 861 | 3300035086 | Ga0373934_0098490 | Ga0373934_0098490_234_1103 | 288 |
| 862 | 3300035089 | Ga0373944_0068460 | Ga0373944_0068460_242_1108 | 288 |
| 863 | 3300035111 | Ga0373923_0010612 | Ga0373923_0010612_1784_2650 | 288 |
| 864 | 3300035120 | Ga0373957_0033523 | Ga0373957_0033523_692_1558 | 288 |
| 865 | 3300035121 | Ga0373960_0010343 | Ga0373960_0010343_446_1312 | 288 |
| 866 | 3300035171 | Ga0373946_0030361 | Ga0373946_0030361_1003_1911 | 288 |
| 867 | 3300035171 | Ga0373946_0088180 | Ga0373946_0088180_136_1005 | 288 |
| 868 | 3300035171 | Ga0373946_0106513 | Ga0373946_0106513_268_1134 | 288 |
| 869 | 3300035172 | Ga0373955_0060314 | Ga0373955_0060314_107_976 | 288 |
| 870 | 3300035172 | Ga0373955_0136826 | Ga0373955_0136826_198_1064 | 288 |
| 871 | 3300035241 | Ga0373961_0040398 | Ga0373961_0040398_442_1308 | 288 |
| 872 | 3300035410 | Ga0373924_0113884 | Ga0373924_0113884_31_900 | 288 |
| 873 | 3300035691 | Ga0373931_0143690 | Ga0373931_0143690_69_935 | 288 |
| 874 | 3300035692 | Ga0373935_0123081 | Ga0373935_0123081_751_1617 | 288 |
| 875 | 3300035724 | Ga0373933_0016762 | Ga0373933_0016762_214_1080 | 288 |
| 876 | 3300035725 | Ga0373947_0000012 | Ga0373947_0000012_70441_71349 | 288 |
| 877 | 3300036401 | Ga0373937_0021311 | Ga0373937_0021311_2905_3771 | 288 |
| 878 | 3300037068 | Ga0373925_0146670 | Ga0373925_0146670_946_1812 | 288 |
| 879 | 3300037312 | Ga0395899_0364632 | Ga0395899_0364632_22_906 | 288 |
| 880 | 3300037418 | Ga0395900_0028475 | Ga0395900_0028475_2563_3519 | 288 |
| 881 | 3300037418 | Ga0395900_0179248 | Ga0395900_0179248_778_1662 | 288 |
| 882 | 3300037418 | Ga0395900_0394700 | Ga0395900_0394700_45_917 | 288 |
| 883 | 3300037466 | Ga0395898_0141809 | Ga0395898_0141809_386_1270 | 288 |
| 884 | 3300037466 | Ga0395898_0170849 | Ga0395898_0170849_638_1510 | 288 |
| 885 | 3300037853 | Ga0436364_0776813 | Ga0436364_0776813_90_956 | 288 |
| 886 | 3300038443 | Ga0395901_0094169 | Ga0395901_0094169_1731_2603 | 288 |
| 887 | 3300038443 | Ga0395901_0355088 | Ga0395901_0355088_332_1204 | 288 |
| 888 | 3300039450 | Ga0436363_0330691 | Ga0436363_0330691_450_1316 | 288 |
| 889 | 3300039450 | Ga0436363_1688649 | Ga0436363_1688649_618_1484 | 288 |
| 890 | 3300044656 | Ga0466969_0001393 | Ga0466969_0001393_7389_8294 | 288 |
| 891 | 3300044656 | Ga0466969_0027492 | Ga0466969_0027492_955_1839 | 288 |
| 892 | 3300044656 | Ga0466969_0034637 | Ga0466969_0034637_18_923 | 288 |
| 893 | 3300044683 | Ga0466965_0133587 | Ga0466965_0133587_219_1091 | 288 |
| 894 | 3300044684 | Ga0466966_0002213 | Ga0466966_0002213_4716_5621 | 288 |
| 895 | 3300044684 | Ga0466966_0040037 | Ga0466966_0040037_494_1378 | 288 |
| 896 | 3300044694 | Ga0466963_0063650 | Ga0466963_0063650_1429_2313 | 288 |
| 897 | 3300044694 | Ga0466963_0095896 | Ga0466963_0095896_244_1128 | 288 |
| 898 | 3300044706 | Ga0466964_0038411 | Ga0466964_0038411_477_1361 | 288 |
| 899 | 3300044842 | Ga0466957_0213611 | Ga0466957_0213611_258_1142 | 288 |
| 900 | 3300044901 | Ga0466960_0107141 | Ga0466960_0107141_19_891 | 288 |
| 901 | 3300044901 | Ga0466960_0158726 | Ga0466960_0158726_263_1147 | 288 |
| 902 | 3300045049 | Ga0466959_0007600 | Ga0466959_0007600_5165_6070 | 288 |
| 903 | 3300045049 | Ga0466959_0041292 | Ga0466959_0041292_843_1727 | 288 |
| 904 | 3300045049 | Ga0466959_0049520 | Ga0466959_0049520_368_1252 | 288 |
| 905 | 3300045836 | Ga0466958_0065679 | Ga0466958_0065679_720_1604 | 288 |
| 906 | 3300045976 | Ga0466967_0000767 | Ga0466967_0000767_7268_8164 | 288 |
| 907 | 3300045976 | Ga0466967_0079181 | Ga0466967_0079181_30_914 | 288 |
| 908 | 3300045976 | Ga0466967_0214119 | Ga0466967_0214119_740_1624 | 288 |
| 909 | 3300045976 | Ga0466967_0348110 | Ga0466967_0348110_257_1165 | 288 |
| 910 | 3300045976 | Ga0466967_0479042 | Ga0466967_0479042_172_1038 | 288 |
| 911 | 3300045976 | Ga0466967_0549385 | Ga0466967_0549385_104_988 | 288 |
| 912 | 3300046454 | Ga0495592_0004032 | Ga0495592_0004032_3401_4309 | 288 |
| 913 | 3300046454 | Ga0495592_0111702 | Ga0495592_0111702_234_1103 | 288 |
| 914 | 3300046455 | Ga0495603_0041124 | Ga0495603_0041124_1520_2386 | 288 |
| 915 | 3300046459 | Ga0495629_0042855 | Ga0495629_0042855_1183_2052 | 288 |
| 916 | 3300046462 | Ga0495651_0022065 | Ga0495651_0022065_1533_2402 | 288 |
| 917 | 3300046462 | Ga0495651_0028953 | Ga0495651_0028953_2536_3444 | 288 |
| 918 | 3300046462 | Ga0495651_0032487 | Ga0495651_0032487_94_960 | 288 |
| 919 | 3300046463 | Ga0495653_0003317 | Ga0495653_0003317_6414_7322 | 288 |
| 920 | 3300046471 | Ga0495650_0021622 | Ga0495650_0021622_1923_2792 | 288 |
| 921 | 3300046472 | Ga0495580_0011800 | Ga0495580_0011800_3243_4151 | 288 |
| 922 | 3300046476 | Ga0495662_0002341 | Ga0495662_0002341_6486_7394 | 288 |
| 923 | 3300046476 | Ga0495662_0045589 | Ga0495662_0045589_1231_2097 | 288 |
| 924 | 3300046476 | Ga0495662_0100866 | Ga0495662_0100866_168_1037 | 288 |
| 925 | 3300046477 | Ga0495664_0002877 | Ga0495664_0002877_3150_4016 | 288 |
| 926 | 3300046477 | Ga0495664_0014217 | Ga0495664_0014217_1330_2199 | 288 |
| 927 | 3300046477 | Ga0495664_0047702 | Ga0495664_0047702_398_1264 | 288 |
| 928 | 3300046511 | Ga0495608_0003305 | Ga0495608_0003305_3221_4129 | 288 |
| 929 | 3300046511 | Ga0495608_0027784 | Ga0495608_0027784_2046_2912 | 288 |
| 930 | 3300046514 | Ga0495618_0025440 | Ga0495618_0025440_364_1233 | 288 |
| 931 | 3300046514 | Ga0495618_0066094 | Ga0495618_0066094_236_1102 | 288 |
| 932 | 3300046514 | Ga0495618_0155516 | Ga0495618_0155516_270_1178 | 288 |
| 933 | 3300046517 | Ga0495630_0015629 | Ga0495630_0015629_1400_2266 | 288 |
| 934 | 3300046517 | Ga0495630_0022964 | Ga0495630_0022964_2490_3398 | 288 |
| 935 | 3300046517 | Ga0495630_0034683 | Ga0495630_0034683_452_1321 | 288 |
| 936 | 3300046526 | Ga0495666_0006058 | Ga0495666_0006058_1501_2409 | 288 |
| 937 | 3300046529 | Ga0495652_0022390 | Ga0495652_0022390_262_1170 | 288 |
| 938 | 3300046531 | Ga0495665_0001405 | Ga0495665_0001405_6410_7318 | 288 |
| 939 | 3300046531 | Ga0495665_0071471 | Ga0495665_0071471_717_1586 | 288 |
| 940 | 3300046533 | Ga0495640_0005739 | Ga0495640_0005739_2362_3270 | 288 |
| 941 | 3300046533 | Ga0495640_0016595 | Ga0495640_0016595_1956_2822 | 288 |
| 942 | 3300046533 | Ga0495640_0073012 | Ga0495640_0073012_1220_2086 | 288 |
| 943 | 3300046535 | Ga0495586_0003139 | Ga0495586_0003139_7179_8087 | 288 |
| 944 | 3300046543 | Ga0495645_0004499 | Ga0495645_0004499_206_1111 | 288 |
| 945 | 3300046543 | Ga0495645_0005026 | Ga0495645_0005026_1004_1912 | 288 |
| 946 | 3300046543 | Ga0495645_0067098 | Ga0495645_0067098_304_1173 | 288 |
| 947 | 3300046543 | Ga0495645_0216205 | Ga0495645_0216205_165_1031 | 288 |
| 948 | 3300046559 | Ga0495667_0012288 | Ga0495667_0012288_166_1032 | 288 |
| 949 | 3300046559 | Ga0495667_0123047 | Ga0495667_0123047_262_1170 | 288 |
| 950 | 3300046642 | Ga0495634_0018221 | Ga0495634_0018221_3826_4692 | 288 |
| 951 | 3300046674 | Ga0495588_0091949 | Ga0495588_0091949_389_1258 | 288 |
| 952 | 3300046675 | Ga0495657_0009938 | Ga0495657_0009938_465_1331 | 288 |
| 953 | 3300046675 | Ga0495657_0014048 | Ga0495657_0014048_4683_5591 | 288 |
| 954 | 3300046678 | Ga0495599_0003479 | Ga0495599_0003479_756_1625 | 288 |
| 955 | 3300046678 | Ga0495599_0146158 | Ga0495599_0146158_121_987 | 288 |
| 956 | 3300046679 | Ga0495623_0037650 | Ga0495623_0037650_1353_2219 | 288 |
| 957 | 3300046679 | Ga0495623_0109597 | Ga0495623_0109597_262_1170 | 288 |
| 958 | 3300046680 | Ga0495646_0098230 | Ga0495646_0098230_341_1207 | 288 |
| 959 | 3300046680 | Ga0495646_0134089 | Ga0495646_0134089_301_1167 | 288 |
| 960 | 3300046689 | Ga0495613_0004179 | Ga0495613_0004179_4026_4934 | 288 |
| 961 | 3300046689 | Ga0495613_0019996 | Ga0495613_0019996_2788_3654 | 288 |
| 962 | 3300046690 | Ga0495624_0060790 | Ga0495624_0060790_495_1364 | 288 |
| 963 | 3300046809 | Ga0495600_0012627 | Ga0495600_0012627_2868_3737 | 288 |
| 964 | 3300047315 | Ga0495581_0007284 | Ga0495581_0007284_539_1447 | 288 |
| 965 | 3300047315 | Ga0495581_0024807 | Ga0495581_0024807_748_1617 | 288 |
| 966 | 3300047317 | Ga0495604_0002938 | Ga0495604_0002938_7038_7946 | 288 |
| 967 | 3300047317 | Ga0495604_0003492 | Ga0495604_0003492_7552_8418 | 288 |
| 968 | 3300047317 | Ga0495604_0023093 | Ga0495604_0023093_3361_4230 | 288 |
| 969 | 3300047319 | Ga0495674_0006966 | Ga0495674_0006966_7600_8466 | 288 |
| 970 | 3300047319 | Ga0495674_0041694 | Ga0495674_0041694_1980_2888 | 288 |
| 971 | 3300047319 | Ga0495674_0094211 | Ga0495674_0094211_833_1702 | 288 |
| 972 | 3300047321 | Ga0495676_0057269 | Ga0495676_0057269_1010_1876 | 288 |
| 973 | 3300047322 | Ga0495680_0007021 | Ga0495680_0007021_201_1067 | 288 |
| 974 | 3300047444 | Ga0495675_0003780 | Ga0495675_0003780_2536_3444 | 288 |
| 975 | 3300047444 | Ga0495675_0017543 | Ga0495675_0017543_2903_3769 | 288 |
| 976 | 3300047444 | Ga0495675_0024610 | Ga0495675_0024610_638_1543 | 288 |
| 977 | 3300047471 | Ga0495684_0015097 | Ga0495684_0015097_2536_3444 | 288 |
| 978 | 3300047471 | Ga0495684_0020685 | Ga0495684_0020685_1334_2203 | 288 |
| 979 | 3300047471 | Ga0495684_0033418 | Ga0495684_0033418_1002_1868 | 288 |
| 980 | 3300047471 | Ga0495684_0121422 | Ga0495684_0121422_166_1032 | 288 |
| 981 | 3300047673 | Ga0495593_0025558 | Ga0495593_0025558_2126_2992 | 288 |
| 982 | 3300047673 | Ga0495593_0056538 | Ga0495593_0056538_151_1059 | 288 |
| 983 | 3300048088 | Ga0495602_0022114 | Ga0495602_0022114_2013_2882 | 288 |
| 984 | 3300048088 | Ga0495602_0049974 | Ga0495602_0049974_807_1715 | 288 |
| 985 | 3300048088 | Ga0495602_0090966 | Ga0495602_0090966_1650_2516 | 288 |
| 986 | 3300048903 | Ga0496100_0126154 | Ga0496100_0126154_897_1763 | 288 |
| 987 | 3300048905 | Ga0496102_0022743 | Ga0496102_0022743_3550_4416 | 288 |
| 988 | 3300048905 | Ga0496102_0357441 | Ga0496102_0357441_56_925 | 288 |
| 989 | 3300048907 | Ga0496104_0000600 | Ga0496104_0000600_6268_7134 | 288 |
| 990 | 3300048907 | Ga0496104_0050173 | Ga0496104_0050173_27_893 | 288 |
| 991 | 3300048907 | Ga0496104_0188724 | Ga0496104_0188724_1003_1872 | 288 |
| 992 | 3300048908 | Ga0496105_0011198 | Ga0496105_0011198_3544_4410 | 288 |
| 993 | 3300048908 | Ga0496105_0075457 | Ga0496105_0075457_1553_2422 | 288 |
| 994 | 3300048908 | Ga0496105_0091725 | Ga0496105_0091725_491_1357 | 288 |
| 995 | 3300048909 | Ga0496106_0149256 | Ga0496106_0149256_132_998 | 288 |
| 996 | 3300048910 | Ga0496107_0237196 | Ga0496107_0237196_319_1185 | 288 |
| 997 | 3300048911 | Ga0496108_0076762 | Ga0496108_0076762_847_1713 | 288 |
| 998 | 3300048911 | Ga0496108_0252088 | Ga0496108_0252088_64_933 | 288 |
| 999 | 3300048911 | Ga0496108_0316972 | Ga0496108_0316972_132_998 | 288 |
| 1000 | 3300048912 | Ga0496109_0018991 | Ga0496109_0018991_1761_2627 | 288 |
| 1001 | 3300048913 | Ga0496110_0029877 | Ga0496110_0029877_1494_2363 | 288 |
| 1002 | 3300048915 | Ga0496112_0024759 | Ga0496112_0024759_3639_4505 | 288 |
| 1003 | 3300048916 | Ga0496113_0013081 | Ga0496113_0013081_692_1558 | 288 |
| 1004 | 3300048916 | Ga0496113_0058609 | Ga0496113_0058609_329_1195 | 288 |
| 1005 | 3300048916 | Ga0496113_0071667 | Ga0496113_0071667_904_1773 | 288 |
| 1006 | 3300048917 | Ga0496114_0084678 | Ga0496114_0084678_1139_2005 | 288 |
| 1007 | 3300048918 | Ga0496115_0061249 | Ga0496115_0061249_1418_2284 | 288 |
| 1008 | 3300049568 | Ga0501031_0094205 | Ga0501031_0094205_248_1141 | 288 |
| 1009 | 3300049571 | Ga0501034_0018672 | Ga0501034_0018672_5260_6153 | 288 |
| 1010 | 3300049572 | Ga0501036_0014365 | Ga0501036_0014365_3785_4678 | 288 |
| 1011 | 3300049573 | Ga0501037_0153098 | Ga0501037_0153098_346_1239 | 288 |
| 1012 | 3300049575 | Ga0501039_0127215 | Ga0501039_0127215_45_920 | 288 |
| 1013 | 3300049585 | Ga0501069_0199898 | Ga0501069_0199898_51_938 | 288 |
| 1014 | 3300049822 | Ga0501035_0233074 | Ga0501035_0233074_656_1549 | 288 |
| 1015 | 3300049824 | Ga0501045_0138439 | Ga0501045_0138439_347_1240 | 288 |
| 1016 | 3300050507 | nmdc:mga05p37_4688_c1 | nmdc:mga05p37_4688_c1_14267_15136 | 288 |
| 1017 | 3300050507 | nmdc:mga05p37_7379_c1 | nmdc:mga05p37_7379_c1_965_1843 | 288 |
| 1018 | 3300050508 | nmdc:mga09592_583_c1 | nmdc:mga09592_583_c1_2063_2932 | 288 |
| 1019 | 3300050508 | nmdc:mga09592_8037_c1 | nmdc:mga09592_8037_c1_4402_5280 | 288 |
| 1020 | 3300050510 | nmdc:mga06r32_1579_c1 | nmdc:mga06r32_1579_c1_15690_16559 | 288 |
| 1021 | 3300050510 | nmdc:mga06r32_30416_c1 | nmdc:mga06r32_30416_c1_3743_4621 | 288 |
| 1022 | 3300050510 | nmdc:mga06r32_5723_c1 | nmdc:mga06r32_5723_c1_8201_9070 | 288 |
| 1023 | 3300050512 | nmdc:mga0n895_155986_c1 | nmdc:mga0n895_155986_c1_886_1755 | 288 |
| 1024 | 3300050515 | nmdc:mga0a205_76505_c1 | nmdc:mga0a205_76505_c1_720_1586 | 288 |
| 1025 | 3300053077 | Ga0495601_0014999 | Ga0495601_0014999_740_1606 | 288 |
| 1026 | 3300053077 | Ga0495601_0072017 | Ga0495601_0072017_958_1827 | 288 |
| 1027 | 3300053077 | Ga0495601_0156035 | Ga0495601_0156035_282_1148 | 288 |
| 1028 | 3300053078 | Ga0495612_0011735 | Ga0495612_0011735_2501_3367 | 288 |
| 1029 | 3300053084 | Ga0495595_0012738 | Ga0495595_0012738_1328_2197 | 288 |
| 1030 | 3300053084 | Ga0495595_0023439 | Ga0495595_0023439_1327_2193 | 288 |
| 1031 | 3300053085 | Ga0495619_0050201 | Ga0495619_0050201_1682_2590 | 288 |
| 1032 | 3300061719 | Ga0466962_0032289 | Ga0466962_0032289_95_979 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zoh-assembly1.cif.gz_B-2 | crystal structure of glyceraldehyde oxidoreductase | 0.8981 | 1 | 281 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.8918 | 1 | 285 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.8891 | 1 | 285 |
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.8886 | 1 | 284 |
| 1jrp-assembly2.cif.gz_G | crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus | 0.8859 | 3 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9611 | 54 | 165 | 3.30.465.10 |
| 4zohB02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.956 | 54 | 165 | 3.30.465.10 |
| af_Q46800_56_173_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9524 | 53 | 165 | 3.30.465.10 |
| 4zohB02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9477 | 54 | 165 | 3.30.465.10 |
| 1jroG04 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9452 | 54 | 165 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535DE55-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.972 | 34 | 287 |
GO:0016491
GO:0071949 |
| AF-A0A066YPD3-F1-model_v4 | Carbon-monoxide dehydrogenase | 0.9718 | 1 | 122 |
GO:0016491
GO:0071949 |
| AF-A0A1C4T952-F1-model_v4 | deleted | 0.9659 | 1 | 258 |
|
| AF-A0A7V9E9V3-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9616 | 135 | 287 |
|
| AF-A0A7W7LZ93-F1-model_v4 | CO/xanthine dehydrogenase Mo-binding subunit | 0.9615 | 1 | 122 |
GO:0005506
GO:0016491 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar