F488593

General Info

Members Datasets Scaffolds Average Seq Length
1030 427 1003 337

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100322628|Ga0075431_1003226282
Length 353
Sequence VTDPTSERAAGLEVVRYRPQPSEFAWTFGGVRPVRSVRPGTVLEVWTEDAFGGRVKGPDDLVSRVIEFPFVNPQTGPFFIEGAEPGDTLAVHFVSITPSRDVAASSTIPFFGALTATGPIHTASLQDPLEERVWMYEVDRAGWTVTFTASRGEFSVALPMDPMHGTVGVAPGSFEARSSLVPDAHGGNMDTPEMRAGTTCYLGVNVEGALFSLGDGHCRQGEGESCGVAVEAAMDTVVIVDLLKGVATPWPRLETDDYVMSTGSARPLEDAFRISQVDLVSWVASQFGLETLDAYQLVTQAVEAPVANVCDPNYTFISKLRKRWLPRVDPYGGVHARLREMAAAYQAEEGSRD

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
4 2643221647 Streptomyces sp. Root369 Isolate Unclassified
5 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
6 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
7 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
8 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
9 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
10 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
11 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
12 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
13 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
14 2862574272 Streptomyces sp. AcE210 Isolate Nodule
15 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
16 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
17 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
18 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
19 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
20 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
21 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
22 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
23 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
24 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
240 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
241 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
242 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
243 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
244 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
245 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
406 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
407 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
408 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
409 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
410 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
411 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
415 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
416 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
417 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
420 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
421 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
426 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
427 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0.87
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0.1
Rhizoplane 4.27
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10031578 3300003203 Bacteria 1979
2 rootH1_10101709 3300003316 Bacteria 1490
3 JGI25407J50210_10035106 3300003373 Bacteria 1293
4 Ga0070658_10006893 3300005327 Bacteria 9180
5 Ga0070683_100001796 3300005329 Bacteria 16715
6 Ga0070683_100037024 3300005329 Bacteria 4465
7 Ga0070683_100077938 3300005329 Bacteria 3100
8 Ga0070683_100173457 3300005329 Bacteria 2047
9 Ga0070683_100236990 3300005329 Bacteria 1735
10 Ga0070680_100108855 3300005336 Bacteria 2305
11 Ga0070682_100002746 3300005337 Bacteria 9750
12 Ga0070682_100044017 3300005337 Bacteria 2762
13 Ga0070682_100193492 3300005337 Bacteria 1429
14 Ga0068868_100020069 3300005338 Bacteria 5016
15 Ga0070660_100084688 3300005339 Bacteria 2492
16 Ga0070660_100173781 3300005339 Bacteria 1741
17 Ga0070660_100195402 3300005339 Bacteria 1640
18 Ga0070691_10041579 3300005341 Bacteria 2173
19 Ga0070691_10125745 3300005341 Bacteria 1295
20 Ga0070661_100149372 3300005344 Bacteria 1765
21 Ga0070692_10095894 3300005345 Bacteria 1619
22 Ga0070675_100105217 3300005354 Bacteria 2381
23 Ga0070659_100012412 3300005366 Bacteria 6318
24 Ga0070659_100035946 3300005366 Bacteria 3860
25 Ga0070709_10000860 3300005434 Bacteria 16969
26 Ga0070709_10006505 3300005434 Bacteria 6370
27 Ga0070709_10072398 3300005434 Bacteria 2228
28 Ga0070714_100000689 3300005435 Bacteria 23869
29 Ga0070714_100008563 3300005435 Bacteria 7998
30 Ga0070714_100032055 3300005435 Bacteria 4387
31 Ga0070714_100039832 3300005435 Bacteria 3958
32 Ga0070714_100053955 3300005435 Bacteria 3433
33 Ga0070714_100058409 3300005435 Bacteria 3304
34 Ga0070714_100060750 3300005435 Bacteria 3244
35 Ga0070714_100339940 3300005435 Bacteria 1408
36 Ga0070713_100005240 3300005436 Bacteria 8838
37 Ga0070713_100015430 3300005436 Bacteria 5711
38 Ga0070713_100016652 3300005436 Bacteria 5531
39 Ga0070713_100034356 3300005436 Bacteria 4072
40 Ga0070713_100040573 3300005436 Bacteria 3785
41 Ga0070713_100056444 3300005436 Bacteria 3267
42 Ga0070713_100102646 3300005436 Bacteria 2480
43 Ga0070713_100119803 3300005436 Bacteria 2306
44 Ga0070710_10001129 3300005437 Bacteria 12635
45 Ga0070710_10005384 3300005437 Bacteria 6073
46 Ga0070710_10066854 3300005437 Bacteria 2061
47 Ga0070711_100001373 3300005439 Bacteria 13307
48 Ga0070711_100113632 3300005439 Bacteria 1991
49 Ga0070705_100174382 3300005440 Bacteria 1450
50 Ga0070700_100161241 3300005441 Bacteria 1544
51 Ga0070708_100000572 3300005445 Bacteria 27610
52 Ga0070708_100004428 3300005445 Bacteria 11035
53 Ga0070708_100164741 3300005445 Bacteria 2067
54 Ga0070708_100430744 3300005445 Bacteria 1244
55 Ga0070663_100041840 3300005455 Bacteria 3217
56 Ga0070685_10182773 3300005466 Bacteria 1351
57 Ga0070706_100005350 3300005467 Bacteria 12234
58 Ga0070706_100009709 3300005467 Bacteria 8945
59 Ga0070706_100016121 3300005467 Bacteria 6900
60 Ga0070706_100020458 3300005467 Bacteria 6100
61 Ga0070706_100021910 3300005467 Bacteria 5884
62 Ga0070707_100003304 3300005468 Bacteria 15226
63 Ga0070707_100003555 3300005468 Bacteria 14713
64 Ga0070707_100004577 3300005468 Bacteria 12950
65 Ga0070707_100007078 3300005468 Bacteria 10401
66 Ga0070707_100062407 3300005468 Bacteria 3575
67 Ga0070707_100119997 3300005468 Bacteria 2553
68 Ga0070707_100127635 3300005468 Bacteria 2471
69 Ga0070698_100000677 3300005471 Bacteria 36359
70 Ga0070698_100000986 3300005471 Bacteria 31324
71 Ga0070698_100006573 3300005471 Bacteria 12610
72 Ga0070698_100009522 3300005471 Bacteria 10403
73 Ga0070698_100010816 3300005471 Bacteria 9712
74 Ga0070698_100061266 3300005471 Bacteria 3796
75 Ga0070698_100085106 3300005471 Bacteria 3150
76 Ga0070698_100182287 3300005471 Bacteria 2038
77 Ga0070699_100153687 3300005518 Bacteria 2036
78 Ga0070699_100349094 3300005518 Bacteria 1332
79 Ga0070699_100365505 3300005518 Bacteria 1301
80 Ga0070679_100068481 3300005530 Bacteria 3540
81 Ga0070679_100189982 3300005530 Bacteria 2023
82 Ga0070679_100205666 3300005530 Bacteria 1933
83 Ga0070684_100000608 3300005535 Bacteria 24723
84 Ga0070684_100002313 3300005535 Bacteria 14044
85 Ga0070684_100020130 3300005535 Bacteria 5535
86 Ga0070684_100038507 3300005535 Bacteria 4107
87 Ga0070684_100045374 3300005535 Bacteria 3806
88 Ga0070697_100030792 3300005536 Bacteria 4312
89 Ga0070697_100056089 3300005536 Bacteria 3204
90 Ga0068853_100062864 3300005539 Bacteria 3214
91 Ga0068853_100117379 3300005539 Bacteria 2370
92 Ga0070686_100252333 3300005544 Bacteria 1289
93 Ga0070696_100243923 3300005546 Bacteria 1356
94 Ga0070693_100059186 3300005547 Bacteria 2220
95 Ga0070665_100000582 3300005548 Bacteria 50895
96 Ga0070665_100081229 3300005548 Bacteria 3247
97 Ga0070665_100212801 3300005548 Bacteria 1934
98 Ga0068855_100093327 3300005563 Bacteria 3470
99 Ga0068855_100205944 3300005563 Bacteria 2213
100 Ga0070664_100040523 3300005564 Bacteria 3927
101 Ga0070664_100294746 3300005564 Bacteria 1465
102 Ga0068857_100008605 3300005577 Bacteria 8830
103 Ga0068857_100020356 3300005577 Bacteria 5835
104 Ga0068857_100191074 3300005577 Bacteria 1865
105 Ga0068857_100193134 3300005577 Bacteria 1854
106 Ga0068856_100065834 3300005614 Bacteria 3581
107 Ga0068856_100068931 3300005614 Bacteria 3497
108 Ga0068856_100102493 3300005614 Bacteria 2856
109 Ga0070702_100169701 3300005615 Bacteria 1418
110 Ga0068852_100030636 3300005616 Bacteria 4432
111 Ga0068852_100072771 3300005616 Bacteria 3022
112 Ga0068859_100038330 3300005617 Bacteria 4809
113 Ga0068859_100359984 3300005617 Bacteria 1550
114 Ga0068863_100088483 3300005841 Bacteria 2935
115 Ga0068863_100208021 3300005841 Bacteria 1884
116 Ga0068858_100020418 3300005842 Bacteria 6194
117 Ga0068858_100237970 3300005842 Bacteria 1727
118 Ga0081455_10112013 3300005937 Bacteria 2167
119 Ga0081538_10002686 3300005981 Bacteria 17125
120 Ga0081538_10002769 3300005981 Bacteria 16806
121 Ga0081538_10008960 3300005981 Bacteria 8408
122 Ga0081540_1000362 3300005983 Bacteria 45713
123 Ga0081540_1005003 3300005983 Bacteria 9962
124 Ga0081540_1020904 3300005983 Bacteria 3919
125 Ga0081539_10000039 3300005985 Bacteria 295914
126 Ga0081539_10004894 3300005985 Bacteria 14288
127 Ga0081539_10006034 3300005985 Bacteria 11869
128 Ga0081539_10053769 3300005985 Bacteria 2252
129 Ga0070717_10035078 3300006028 Bacteria 4058
130 Ga0070717_10052905 3300006028 Bacteria 3346
131 Ga0070717_10056812 3300006028 Bacteria 3235
132 Ga0070717_10074523 3300006028 Bacteria 2837
133 Ga0070717_10079373 3300006028 Bacteria 2752
134 Ga0070717_10084720 3300006028 Bacteria 2666
135 Ga0070717_10091955 3300006028 Bacteria 2563
136 Ga0070717_10146186 3300006028 Bacteria 2042
137 Ga0070717_10271008 3300006028 Bacteria 1504
138 Ga0075432_10001729 3300006058 Bacteria 7183
139 Ga0070715_10004785 3300006163 Bacteria 4478
140 Ga0070716_100002145 3300006173 Bacteria 9066
141 Ga0070716_100010128 3300006173 Bacteria 4720
142 Ga0070716_100035985 3300006173 Bacteria 2726
143 Ga0070716_100094031 3300006173 Bacteria 1821
144 Ga0070716_100156320 3300006173 Bacteria 1473
145 Ga0070712_100028908 3300006175 Bacteria 3712
146 Ga0070712_100035014 3300006175 Bacteria 3406
147 Ga0075367_10000378 3300006178 Bacteria 16096
148 Ga0068871_100245715 3300006358 Bacteria 1557
149 Ga0068871_100446539 3300006358 Bacteria 1158
150 Ga0075428_100078984 3300006844 Bacteria 3591
151 Ga0075430_100006129 3300006846 Bacteria 10131
152 Ga0075431_100177162 3300006847 Bacteria 2189
153 Ga0075431_100322628 3300006847 Bacteria 1557
154 Ga0075433_10052354 3300006852 Bacteria 3557
155 Ga0075433_10179093 3300006852 Bacteria 1886
156 Ga0075434_100016613 3300006871 Bacteria 7078
157 Ga0075434_100129791 3300006871 Bacteria 2539
158 Ga0075434_100138927 3300006871 Bacteria 2449
159 Ga0075429_100070862 3300006880 Bacteria 3035
160 Ga0068865_100023351 3300006881 Bacteria 4048
161 Ga0068865_100052087 3300006881 Bacteria 2836
162 Ga0075436_100031854 3300006914 Bacteria 3633
163 Ga0097620_100038330 3300006931 Bacteria 4809
164 Ga0097620_100359963 3300006931 Bacteria 1550
165 Ga0075435_100021794 3300007076 Bacteria 4935
166 Ga0075435_100248277 3300007076 Bacteria 1515
167 Ga0099794_10034778 3300007265 Bacteria 2376
168 Ga0099795_10046895 3300007788 Bacteria 1559
169 Ga0105240_10130379 3300009093 Bacteria 3017
170 Ga0105240_10424807 3300009093 Bacteria 1492
171 Ga0111539_10038804 3300009094 Bacteria 5744
172 Ga0111539_10055365 3300009094 Bacteria 4715
173 Ga0105245_10006123 3300009098 Bacteria 10580
174 Ga0105245_10013974 3300009098 Bacteria 6992
175 Ga0105245_10032946 3300009098 Bacteria 4589
176 Ga0114129_10010765 3300009147 Bacteria 13035
177 Ga0114129_10046417 3300009147 Bacteria 6105
178 Ga0114129_10069176 3300009147 Bacteria 4921
179 Ga0114129_10867256 3300009147 Bacteria 1146
180 Ga0105241_10052977 3300009174 Bacteria 3101
181 Ga0105248_10179331 3300009177 Bacteria 2387
182 Ga0105237_10030620 3300009545 Bacteria 5464
183 Ga0105237_10371231 3300009545 Bacteria 1435
184 Ga0105238_10078537 3300009551 Bacteria 3290
185 Ga0105249_10002630 3300009553 Bacteria 15550
186 Ga0105249_10011140 3300009553 Bacteria 7899
187 Ga0105249_10043204 3300009553 Bacteria 4100
188 Ga0105239_10002393 3300010375 Bacteria 23914
189 Ga0105239_10002486 3300010375 Bacteria 23478
190 Ga0105239_10051480 3300010375 Bacteria 4514
191 Ga0105246_10000375 3300011119 Bacteria 23857
192 Ga0105246_10001529 3300011119 Bacteria 13708
193 Ga0105246_10080398 3300011119 Bacteria 2320
194 Ga0105246_10228961 3300011119 Bacteria 1462
195 Ga0157373_10192458 3300013100 Bacteria 1437
196 Ga0157370_10093073 3300013104 Bacteria 2829
197 Ga0157369_10004516 3300013105 Bacteria 16375
198 Ga0157369_10030857 3300013105 Bacteria 5908
199 Ga0157369_10051301 3300013105 Bacteria 4464
200 Ga0157369_10057279 3300013105 Bacteria 4205
201 Ga0157369_10095454 3300013105 Bacteria 3173
202 Ga0157374_10264870 3300013296 Bacteria 1694
203 Ga0157374_10529327 3300013296 Bacteria 1185
204 Ga0163162_10012538 3300013306 Bacteria 8280
205 Ga0163162_10075259 3300013306 Bacteria 3437
206 Ga0163162_10133191 3300013306 Bacteria 2595
207 Ga0157372_10006919 3300013307 Bacteria 12068
208 Ga0157372_10014256 3300013307 Bacteria 8497
209 Ga0157372_10059793 3300013307 Bacteria 4263
210 Ga0157375_10009992 3300013308 Bacteria 8342
211 Ga0157375_10010284 3300013308 Bacteria 8231
212 Ga0157375_10077426 3300013308 Bacteria 3355
213 Ga0163163_10063038 3300014325 Bacteria 3675
214 Ga0182008_10003575 3300014497 Bacteria 9317
215 Ga0157379_10036296 3300014968 Bacteria 4395
216 Ga0157379_10073580 3300014968 Bacteria 3059
217 Ga0182007_10003274 3300015262 Bacteria 7696
218 Ga0183367_1003 3300015688 Bacteria 814276
219 Ga0163161_10053784 3300017792 Bacteria 2920
220 Ga0206356_10634487 3300020070 Bacteria 1162
221 Ga0206356_11862379 3300020070 Bacteria 3395
222 Ga0206352_10692001 3300020078 Bacteria 2997
223 Ga0206354_11398097 3300020081 Bacteria 2794
224 Ga0206353_11223522 3300020082 Bacteria 1722
225 Ga0206353_11401531 3300020082 Bacteria 4725
226 Ga0213874_10010623 3300021377 Bacteria 2310
227 Ga0213876_10032554 3300021384 Bacteria 2750
228 Ga0213875_10000733 3300021388 Bacteria 25011
229 Ga0213875_10001317 3300021388 Bacteria 16413
230 Ga0213875_10072346 3300021388 Bacteria 1609
231 Ga0224712_10010694 3300022467 Bacteria 2817
232 Ga0224712_10027516 3300022467 Bacteria 2023
233 Ga0224712_10050471 3300022467 Bacteria 1616
234 Ga0209758_1010847 3300025297 Bacteria 5381
235 Ga0207692_10008396 3300025898 Bacteria 4272
236 Ga0207692_10015692 3300025898 Bacteria 3340
237 Ga0207688_10019493 3300025901 Bacteria 3698
238 Ga0207688_10071225 3300025901 Bacteria 1973
239 Ga0207647_10003769 3300025904 Bacteria 11334
240 Ga0207647_10040416 3300025904 Bacteria 2937
241 Ga0207685_10002713 3300025905 Bacteria 4121
242 Ga0207685_10042902 3300025905 Bacteria 1701
243 Ga0207699_10004435 3300025906 Bacteria 6710
244 Ga0207699_10007040 3300025906 Bacteria 5480
245 Ga0207699_10008456 3300025906 Bacteria 5081
246 Ga0207699_10012336 3300025906 Bacteria 4345
247 Ga0207699_10085070 3300025906 Bacteria 1971
248 Ga0207705_10028490 3300025909 Bacteria 3982
249 Ga0207705_10028636 3300025909 Bacteria 3971
250 Ga0207705_10050015 3300025909 Bacteria 3008
251 Ga0207684_10000987 3300025910 Bacteria 31919
252 Ga0207684_10001173 3300025910 Bacteria 29296
253 Ga0207684_10004337 3300025910 Bacteria 13414
254 Ga0207684_10008945 3300025910 Bacteria 8880
255 Ga0207684_10049953 3300025910 Bacteria 3548
256 Ga0207684_10054486 3300025910 Bacteria 3393
257 Ga0207684_10108883 3300025910 Bacteria 2371
258 Ga0207684_10236430 3300025910 Bacteria 1576
259 Ga0207654_10031288 3300025911 Bacteria 2930
260 Ga0207707_10073527 3300025912 Bacteria 2981
261 Ga0207707_10214544 3300025912 Bacteria 1676
262 Ga0207695_10025447 3300025913 Bacteria 6625
263 Ga0207671_10000197 3300025914 Bacteria 93773
264 Ga0207693_10047191 3300025915 Bacteria 3385
265 Ga0207693_10235904 3300025915 Bacteria 1436
266 Ga0207663_10001110 3300025916 Bacteria 12377
267 Ga0207663_10045424 3300025916 Bacteria 2702
268 Ga0207663_10120871 3300025916 Bacteria 1793
269 Ga0207660_10076651 3300025917 Bacteria 2445
270 Ga0207662_10058702 3300025918 Bacteria 2304
271 Ga0207657_10051552 3300025919 Bacteria 3577
272 Ga0207657_10057965 3300025919 Bacteria 3335
273 Ga0207657_10285260 3300025919 Bacteria 1310
274 Ga0207649_10099387 3300025920 Bacteria 1922
275 Ga0207652_10203944 3300025921 Bacteria 1780
276 Ga0207646_10000049 3300025922 Bacteria 171680
277 Ga0207646_10007857 3300025922 Bacteria 10778
278 Ga0207646_10018496 3300025922 Bacteria 6497
279 Ga0207646_10051512 3300025922 Bacteria 3683
280 Ga0207646_10057527 3300025922 Bacteria 3474
281 Ga0207646_10129186 3300025922 Bacteria 2273
282 Ga0207646_10135456 3300025922 Bacteria 2217
283 Ga0207646_10146084 3300025922 Bacteria 2131
284 Ga0207694_10060725 3300025924 Bacteria 2942
285 Ga0207687_10043182 3300025927 Bacteria 3105
286 Ga0207700_10003695 3300025928 Bacteria 8926
287 Ga0207700_10003979 3300025928 Bacteria 8650
288 Ga0207700_10006305 3300025928 Bacteria 7155
289 Ga0207700_10008111 3300025928 Bacteria 6483
290 Ga0207700_10068205 3300025928 Bacteria 2725
291 Ga0207700_10129802 3300025928 Bacteria 2056
292 Ga0207700_10215218 3300025928 Bacteria 1626
293 Ga0207664_10005230 3300025929 Bacteria 8852
294 Ga0207664_10005718 3300025929 Bacteria 8501
295 Ga0207664_10012080 3300025929 Bacteria 6167
296 Ga0207664_10024351 3300025929 Bacteria 4549
297 Ga0207664_10057241 3300025929 Bacteria 3098
298 Ga0207664_10342894 3300025929 Bacteria 1321
299 Ga0207690_10013592 3300025932 Bacteria 4894
300 Ga0207690_10090061 3300025932 Bacteria 2165
301 Ga0207706_10004215 3300025933 Bacteria 13541
302 Ga0207669_10032987 3300025937 Bacteria 2916
303 Ga0207704_10029079 3300025938 Bacteria 3075
304 Ga0207704_10033132 3300025938 Bacteria 2934
305 Ga0207665_10004164 3300025939 Bacteria 9626
306 Ga0207665_10020054 3300025939 Bacteria 4391
307 Ga0207665_10061603 3300025939 Bacteria 2544
308 Ga0207661_10001526 3300025944 Bacteria 15727
309 Ga0207661_10013022 3300025944 Bacteria 6069
310 Ga0207661_10077242 3300025944 Bacteria 2738
311 Ga0207661_10148458 3300025944 Bacteria 2025
312 Ga0207679_10024923 3300025945 Bacteria 4107
313 Ga0207679_10175210 3300025945 Bacteria 1770
314 Ga0207667_10109524 3300025949 Bacteria 2848
315 Ga0207667_10216285 3300025949 Bacteria 1963
316 Ga0207712_10065078 3300025961 Bacteria 2601
317 Ga0207712_10078665 3300025961 Bacteria 2394
318 Ga0207668_10116748 3300025972 Bacteria 2013
319 Ga0207640_10021202 3300025981 Bacteria 3869
320 Ga0207658_10102280 3300025986 Bacteria 2247
321 Ga0207677_10309929 3300026023 Bacteria 1307
322 Ga0207703_10048104 3300026035 Bacteria 3440
323 Ga0207703_10102134 3300026035 Bacteria 2433
324 Ga0207703_10320547 3300026035 Bacteria 1419
325 Ga0207639_10349244 3300026041 Bacteria 1321
326 Ga0207678_10022818 3300026067 Bacteria 5481
327 Ga0207678_10273427 3300026067 Bacteria 1449
328 Ga0207708_10188986 3300026075 Bacteria 1639
329 Ga0207702_10028124 3300026078 Bacteria 4671
330 Ga0207702_10076975 3300026078 Bacteria 2884
331 Ga0207702_10087925 3300026078 Bacteria 2714
332 Ga0207702_10145929 3300026078 Bacteria 2147
333 Ga0207676_10193894 3300026095 Bacteria 1790
334 Ga0207676_10541905 3300026095 Bacteria 1111
335 Ga0207674_10007103 3300026116 Bacteria 13086
336 Ga0207674_10024704 3300026116 Bacteria 6415
337 Ga0207674_10028804 3300026116 Bacteria 5855
338 Ga0207674_10047529 3300026116 Bacteria 4398
339 Ga0207675_100002050 3300026118 Bacteria 20092
340 Ga0207683_10067823 3300026121 Bacteria 3148
341 Ga0207698_10044778 3300026142 Bacteria 3329
342 Ga0207428_10022977 3300027907 Bacteria 5252
343 Ga0268266_10003627 3300028379 Bacteria 15268
344 Ga0268266_10148383 3300028379 Bacteria 2111
345 Ga0268265_10168578 3300028380 Bacteria 1869
346 Ga0268264_10029455 3300028381 Bacteria 4496
347 Ga0268264_10274692 3300028381 Bacteria 1576
348 Ga0307517_10001103 3300028786 Bacteria 45619
349 Ga0307517_10001543 3300028786 Bacteria 38377
350 Ga0307515_10002955 3300028794 Bacteria 36045
351 Ga0265338_10006470 3300028800 Bacteria 14924
352 Ga0265338_10007640 3300028800 Bacteria 13342
353 Ga0265338_10007919 3300028800 Bacteria 13017
354 Ga0307511_10000334 3300030521 Bacteria 50044
355 Ga0307511_10080861 3300030521 Bacteria 2286
356 Ga0307511_10116044 3300030521 Bacteria 1679
357 Ga0307512_10001670 3300030522 Bacteria 30513
358 Ga0307512_10053638 3300030522 Bacteria 3204
359 Ga0307513_10001865 3300031456 Bacteria 29946
360 Ga0307513_10134545 3300031456 Bacteria 2410
361 Ga0307509_10024865 3300031507 Bacteria 6700
362 Ga0307509_10030629 3300031507 Bacteria 5948
363 Ga0307408_100015369 3300031548 Bacteria 5095
364 Ga0307408_100250961 3300031548 Bacteria 1459
365 Ga0307508_10002111 3300031616 Bacteria 21339
366 Ga0307508_10002445 3300031616 Bacteria 19572
367 Ga0307508_10010556 3300031616 Bacteria 8451
368 Ga0307514_10140248 3300031649 Bacteria 1645
369 Ga0307516_10028396 3300031730 Bacteria 5661
370 Ga0307405_10048727 3300031731 Bacteria 2614
371 Ga0307405_10054300 3300031731 Bacteria 2500
372 Ga0307405_10055207 3300031731 Bacteria 2485
373 Ga0307405_10082874 3300031731 Bacteria 2101
374 Ga0307405_10113982 3300031731 Bacteria 1836
375 Ga0307413_10020376 3300031824 Bacteria 3525
376 Ga0307518_10020369 3300031838 Bacteria 4766
377 Ga0307518_10067094 3300031838 Bacteria 2602
378 Ga0307410_10009806 3300031852 Bacteria 5392
379 Ga0307410_10031309 3300031852 Bacteria 3412
380 Ga0307410_10196612 3300031852 Bacteria 1537
381 Ga0307406_10029112 3300031901 Bacteria 3342
382 Ga0307406_10115818 3300031901 Bacteria 1853
383 Ga0307407_10003597 3300031903 Bacteria 6407
384 Ga0307407_10018666 3300031903 Bacteria 3513
385 Ga0307409_100001240 3300031995 Bacteria 12299
386 Ga0307416_100000885 3300032002 Bacteria 15784
387 Ga0307416_100005485 3300032002 Bacteria 7794
388 Ga0307416_100025764 3300032002 Bacteria 4319
389 Ga0307416_100155120 3300032002 Bacteria 2107
390 Ga0307416_100259631 3300032002 Bacteria 1697
391 Ga0307416_100546994 3300032002 Bacteria 1230
392 Ga0307414_10033856 3300032004 Bacteria 3381
393 Ga0307414_10049041 3300032004 Bacteria 2917
394 Ga0307414_10069025 3300032004 Bacteria 2539
395 Ga0307414_10200278 3300032004 Bacteria 1623
396 Ga0307411_10080483 3300032005 Bacteria 2240
397 Ga0307411_10097769 3300032005 Bacteria 2067
398 Ga0307415_100008431 3300032126 Bacteria 5710
399 Ga0307415_100009901 3300032126 Bacteria 5373
400 Ga0307415_100036653 3300032126 Bacteria 3215
401 Ga0307415_100043355 3300032126 Bacteria 3001
402 Ga0307415_100063572 3300032126 Bacteria 2565
403 Ga0307507_10031417 3300033179 Bacteria 5576
404 Ga0307507_10104011 3300033179 Bacteria 2359
405 Ga0307507_10179135 3300033179 Bacteria 1519
406 Ga0307510_10015027 3300033180 Bacteria 9155
407 Ga0316214_1001164 3300033545 Bacteria 2971
408 Ga0373948_0045592 3300034817 Bacteria 930
409 Ga0373926_0000303 3300035083 Bacteria 12183
410 Ga0373926_0102196 3300035083 Bacteria 1072
411 Ga0373934_0000901 3300035086 Bacteria 10732
412 Ga0373934_0048431 3300035086 Bacteria 1682
413 Ga0373940_0040899 3300035088 Bacteria 1274
414 Ga0373944_0023619 3300035089 Bacteria 1795
415 Ga0373949_0035623 3300035090 Bacteria 1204
416 Ga0373923_0001192 3300035111 Bacteria 7269
417 Ga0373923_0006452 3300035111 Bacteria 4057
418 Ga0373936_0000261 3300035113 Bacteria 17307
419 Ga0373936_0003311 3300035113 Bacteria 6043
420 Ga0373939_0003903 3300035114 Bacteria 3508
421 Ga0373941_0013082 3300035115 Bacteria 2186
422 Ga0373945_0001094 3300035116 Bacteria 8161
423 Ga0373953_0000513 3300035117 Bacteria 10765
424 Ga0373953_0011058 3300035117 Bacteria 3155
425 Ga0373953_0068048 3300035117 Bacteria 1465
426 Ga0373954_0003115 3300035118 Bacteria 7001
427 Ga0373954_0012807 3300035118 Bacteria 3734
428 Ga0373954_0017144 3300035118 Bacteria 3249
429 Ga0373954_0036240 3300035118 Bacteria 2289
430 Ga0373956_0009927 3300035119 Bacteria 3882
431 Ga0373956_0018086 3300035119 Bacteria 2980
432 Ga0373957_0000657 3300035120 Bacteria 8889
433 Ga0373957_0000760 3300035120 Bacteria 8375
434 Ga0373957_0007245 3300035120 Bacteria 3544
435 Ga0373957_0010835 3300035120 Bacteria 3025
436 Ga0373957_0012232 3300035120 Bacteria 2885
437 Ga0373957_0065310 3300035120 Bacteria 1416
438 Ga0373960_0058072 3300035121 Bacteria 1166
439 Ga0373943_0039356 3300035170 Bacteria 2277
440 Ga0373943_0111130 3300035170 Bacteria 1445
441 Ga0373946_0003584 3300035171 Bacteria 5508
442 Ga0373946_0009123 3300035171 Bacteria 3651
443 Ga0373946_0033982 3300035171 Bacteria 2056
444 Ga0373946_0134219 3300035171 Bacteria 1141
445 Ga0373955_0000006 3300035172 Bacteria 101050
446 Ga0373955_0002081 3300035172 Bacteria 8629
447 Ga0373955_0029188 3300035172 Bacteria 2866
448 Ga0373955_0063906 3300035172 Bacteria 2038
449 Ga0373955_0068852 3300035172 Bacteria 1973
450 Ga0373942_0000318 3300035207 Bacteria 13094
451 Ga0373924_0000743 3300035410 Bacteria 10150
452 Ga0373924_0001349 3300035410 Bacteria 7914
453 Ga0373924_0003886 3300035410 Bacteria 5177
454 Ga0373924_0058859 3300035410 Bacteria 1604
455 Ga0373935_0010564 3300035692 Bacteria 5539
456 Ga0373935_0012709 3300035692 Bacteria 5068
457 Ga0373935_0213332 3300035692 Bacteria 1338
458 Ga0373927_0023290 3300035695 Bacteria 4056
459 Ga0373927_0195461 3300035695 Bacteria 1327
460 Ga0373933_0012156 3300035724 Bacteria 4755
461 Ga0373933_0077306 3300035724 Bacteria 2034
462 Ga0373933_0093070 3300035724 Bacteria 1862
463 Ga0373933_0094971 3300035724 Bacteria 1844
464 Ga0373933_0240472 3300035724 Bacteria 1164
465 Ga0373947_0000002 3300035725 Bacteria 383924
466 Ga0373947_0005570 3300035725 Bacteria 7338
467 Ga0373937_0000039 3300036401 Bacteria 109668
468 Ga0373937_0019920 3300036401 Bacteria 6009
469 Ga0373937_0051116 3300036401 Bacteria 3788
470 Ga0373937_0170479 3300036401 Bacteria 2042
471 Ga0373937_0213368 3300036401 Bacteria 1816
472 Ga0373925_0000129 3300037068 Bacteria 80897
473 Ga0373925_0000789 3300037068 Bacteria 29187
474 Ga0373925_0004572 3300037068 Bacteria 10456
475 Ga0373925_0014080 3300037068 Bacteria 5788
476 Ga0373925_0037019 3300037068 Bacteria 3600
477 Ga0373925_0074646 3300037068 Bacteria 2568
478 Ga0373925_0237633 3300037068 Bacteria 1458
479 Ga0395899_0134922 3300037312 Bacteria 1760
480 Ga0395900_0001460 3300037418 Bacteria 28192
481 Ga0395900_0017541 3300037418 Bacteria 7305
482 Ga0395900_0021811 3300037418 Bacteria 6548
483 Ga0395900_0042006 3300037418 Bacteria 4711
484 Ga0395900_0047250 3300037418 Bacteria 4432
485 Ga0395898_0012712 3300037466 Bacteria 8694
486 Ga0395898_0034736 3300037466 Bacteria 5019
487 Ga0395898_0204919 3300037466 Bacteria 1882
488 Ga0395905_0002907 3300037471 Bacteria 18691
489 Ga0395905_0015416 3300037471 Bacteria 7265
490 Ga0436364_0185875 3300037853 Bacteria 1399
491 Ga0436364_0403534 3300037853 Bacteria 17431
492 Ga0436364_0770879 3300037853 Bacteria 5466
493 Ga0436364_1220868 3300037853 Bacteria 4901
494 Ga0436364_1535764 3300037853 Bacteria 8445
495 Ga0395901_0005424 3300038443 Bacteria 12904
496 Ga0395901_0015291 3300038443 Bacteria 7808
497 Ga0395901_0019313 3300038443 Bacteria 6967
498 Ga0395901_0092863 3300038443 Bacteria 3159
499 Ga0395901_0113364 3300038443 Bacteria 2847
500 Ga0436363_1185395 3300039450 Bacteria 1702
501 Ga0436363_1403459 3300039450 Bacteria 2927
502 Ga0436362_0651943 3300039453 Bacteria 1187
503 Ga0439443_025121 3300042003 Bacteria 959
504 Ga0439448_0004998 3300042005 Bacteria 3769
505 Ga0439450_000186 3300042008 Bacteria 7237
506 Ga0439450_012499 3300042008 Bacteria 1686
507 Ga0439450_036932 3300042008 Bacteria 1120
508 Ga0439451_009603 3300042009 Bacteria 1957
509 Ga0439454_003425 3300042011 Bacteria 1763
510 Ga0439455_0004764 3300042012 Bacteria 2708
511 Ga0439455_0007280 3300042012 Bacteria 2335
512 Ga0439463_002090 3300042016 Bacteria 5167
513 Ga0439463_006978 3300042016 Bacteria 2787
514 Ga0439463_013041 3300042016 Bacteria 2044
515 Ga0450913_002786 3300042117 Bacteria 1102
516 Ga0450888_001316 3300042126 Bacteria 2377
517 Ga0450903_000015 3300042138 Bacteria 34074
518 Ga0450904_002193 3300042139 Bacteria 2389
519 Ga0439464_0005595 3300042439 Bacteria 3254
520 Ga0439464_0007007 3300042439 Bacteria 2945
521 Ga0439440_0000237 3300042993 Bacteria 8821
522 Ga0466969_0000938 3300044656 Bacteria 15726
523 Ga0466969_0073055 3300044656 Bacteria 1646
524 Ga0466972_0060027 3300044658 Bacteria 1825
525 Ga0466966_0010118 3300044684 Bacteria 6257
526 Ga0466966_0035826 3300044684 Bacteria 3205
527 Ga0466966_0115377 3300044684 Bacteria 1653
528 Ga0466961_0036247 3300044693 Bacteria 3166
529 Ga0466961_0052102 3300044693 Bacteria 2612
530 Ga0466961_0108162 3300044693 Bacteria 1750
531 Ga0466963_0033483 3300044694 Bacteria 3337
532 Ga0466963_0051587 3300044694 Bacteria 2727
533 Ga0466963_0087142 3300044694 Bacteria 2123
534 Ga0466963_0218562 3300044694 Bacteria 1334
535 Ga0466964_0097103 3300044706 Bacteria 1292
536 Ga0466971_0002879 3300044719 Bacteria 7300
537 Ga0466971_0086463 3300044719 Bacteria 1433
538 Ga0466970_0117570 3300044765 Bacteria 1454
539 Ga0466957_0045184 3300044842 Bacteria 2671
540 Ga0466959_0020690 3300045049 Bacteria 4848
541 Ga0466959_0186226 3300045049 Bacteria 1450
542 Ga0466958_0054078 3300045836 Bacteria 2434
543 Ga0466958_0072099 3300045836 Bacteria 2115
544 Ga0466967_0016992 3300045976 Bacteria 5757
545 Ga0466967_0019461 3300045976 Bacteria 5458
546 Ga0466967_0025071 3300045976 Bacteria 4912
547 Ga0466967_0026680 3300045976 Bacteria 4789
548 Ga0466967_0037445 3300045976 Bacteria 4151
549 Ga0466967_0112800 3300045976 Bacteria 2500
550 Ga0466967_0146068 3300045976 Bacteria 2206
551 Ga0466967_0198712 3300045976 Bacteria 1898
552 Ga0466967_0247896 3300045976 Bacteria 1700
553 Ga0466967_0316256 3300045976 Bacteria 1505
554 Ga0495592_0000567 3300046454 Bacteria 26216
555 Ga0495592_0005211 3300046454 Bacteria 9587
556 Ga0495592_0020327 3300046454 Bacteria 5050
557 Ga0495592_0060608 3300046454 Bacteria 2783
558 Ga0495592_0142098 3300046454 Bacteria 1668
559 Ga0495603_0000412 3300046455 Bacteria 23683
560 Ga0495603_0002412 3300046455 Bacteria 10989
561 Ga0495603_0004797 3300046455 Bacteria 8080
562 Ga0495603_0006225 3300046455 Bacteria 7135
563 Ga0495603_0007066 3300046455 Bacteria 6734
564 Ga0495603_0038207 3300046455 Bacteria 2879
565 Ga0495603_0070862 3300046455 Bacteria 2049
566 Ga0495629_0000886 3300046459 Bacteria 24144
567 Ga0495629_0003035 3300046459 Bacteria 12762
568 Ga0495629_0004317 3300046459 Bacteria 10661
569 Ga0495629_0004730 3300046459 Bacteria 10202
570 Ga0495629_0008814 3300046459 Bacteria 7417
571 Ga0495629_0012006 3300046459 Bacteria 6279
572 Ga0495629_0017721 3300046459 Bacteria 5104
573 Ga0495629_0018334 3300046459 Bacteria 5010
574 Ga0495638_0083603 3300046460 Bacteria 1933
575 Ga0495638_0133406 3300046460 Bacteria 1457
576 Ga0495641_0004729 3300046461 Bacteria 9485
577 Ga0495641_0006497 3300046461 Bacteria 7563
578 Ga0495641_0008040 3300046461 Bacteria 6492
579 Ga0495641_0039190 3300046461 Bacteria 2211
580 Ga0495651_0000013 3300046462 Bacteria 137933
581 Ga0495651_0002609 3300046462 Bacteria 13943
582 Ga0495651_0004896 3300046462 Bacteria 10240
583 Ga0495651_0005277 3300046462 Bacteria 9850
584 Ga0495651_0006641 3300046462 Bacteria 8840
585 Ga0495651_0015508 3300046462 Bacteria 5894
586 Ga0495651_0053799 3300046462 Bacteria 3097
587 Ga0495651_0062785 3300046462 Bacteria 2841
588 Ga0495653_0005478 3300046463 Bacteria 10337
589 Ga0495653_0006741 3300046463 Bacteria 9428
590 Ga0495653_0038056 3300046463 Bacteria 3776
591 Ga0495653_0113118 3300046463 Bacteria 1947
592 Ga0495653_0197191 3300046463 Bacteria 1369
593 Ga0495580_0006999 3300046472 Bacteria 9091
594 Ga0495582_0002025 3300046473 Bacteria 11355
595 Ga0495582_0005524 3300046473 Bacteria 7039
596 Ga0495582_0016720 3300046473 Bacteria 4017
597 Ga0495582_0022952 3300046473 Bacteria 3412
598 Ga0495582_0161015 3300046473 Bacteria 1276
599 Ga0495605_0016046 3300046474 Bacteria 4062
600 Ga0495605_0039514 3300046474 Bacteria 2363
601 Ga0495639_0006511 3300046475 Bacteria 5024
602 Ga0495639_0135211 3300046475 Bacteria 1182
603 Ga0495662_0000687 3300046476 Bacteria 15995
604 Ga0495662_0002464 3300046476 Bacteria 9314
605 Ga0495662_0003024 3300046476 Bacteria 8483
606 Ga0495662_0003887 3300046476 Bacteria 7533
607 Ga0495662_0006157 3300046476 Bacteria 5998
608 Ga0495662_0015599 3300046476 Bacteria 3687
609 Ga0495662_0073391 3300046476 Bacteria 1659
610 Ga0495585_0173773 3300046492 Bacteria 1111
611 Ga0495594_0002999 3300046499 Bacteria 8742
612 Ga0495594_0005157 3300046499 Bacteria 6721
613 Ga0495594_0008585 3300046499 Bacteria 5266
614 Ga0495607_0063014 3300046501 Bacteria 2099
615 Ga0495607_0078925 3300046501 Bacteria 1815
616 Ga0495583_0011636 3300046506 Bacteria 5040
617 Ga0495583_0085468 3300046506 Bacteria 1365
618 Ga0495606_0012472 3300046507 Bacteria 6810
619 Ga0495608_0000114 3300046511 Bacteria 57810
620 Ga0495608_0002000 3300046511 Bacteria 14603
621 Ga0495608_0067426 3300046511 Bacteria 2340
622 Ga0495616_0010477 3300046513 Bacteria 5364
623 Ga0495618_0004694 3300046514 Bacteria 8357
624 Ga0495618_0010288 3300046514 Bacteria 5659
625 Ga0495618_0046177 3300046514 Bacteria 2749
626 Ga0495618_0197356 3300046514 Bacteria 1274
627 Ga0495620_0002993 3300046515 Bacteria 9723
628 Ga0495620_0014051 3300046515 Bacteria 4082
629 Ga0495628_0039946 3300046516 Bacteria 3751
630 Ga0495628_0044087 3300046516 Bacteria 3550
631 Ga0495628_0046875 3300046516 Bacteria 3431
632 Ga0495628_0064055 3300046516 Bacteria 2879
633 Ga0495628_0081187 3300046516 Bacteria 2518
634 Ga0495628_0143740 3300046516 Bacteria 1819
635 Ga0495630_0016315 3300046517 Bacteria 5426
636 Ga0495630_0100368 3300046517 Bacteria 2190
637 Ga0495630_0122947 3300046517 Bacteria 1969
638 Ga0495630_0169388 3300046517 Bacteria 1664
639 Ga0495643_0001800 3300046522 Bacteria 18343
640 Ga0495643_0006360 3300046522 Bacteria 7800
641 Ga0495648_0033986 3300046524 Bacteria 3325
642 Ga0495648_0146539 3300046524 Bacteria 1236
643 Ga0495663_0038475 3300046525 Bacteria 1446
644 Ga0495666_0002910 3300046526 Bacteria 8578
645 Ga0495642_0055077 3300046528 Bacteria 1641
646 Ga0495652_0000145 3300046529 Bacteria 80170
647 Ga0495652_0001696 3300046529 Bacteria 23783
648 Ga0495652_0002970 3300046529 Bacteria 17061
649 Ga0495652_0022281 3300046529 Bacteria 5622
650 Ga0495652_0123221 3300046529 Bacteria 2063
651 Ga0495654_0035163 3300046530 Bacteria 2525
652 Ga0495665_0009058 3300046531 Bacteria 5397
653 Ga0495640_0012649 3300046533 Bacteria 6442
654 Ga0495640_0017468 3300046533 Bacteria 5347
655 Ga0495640_0027608 3300046533 Bacteria 4092
656 Ga0495640_0031606 3300046533 Bacteria 3776
657 Ga0495586_0005351 3300046535 Bacteria 6866
658 Ga0495586_0090821 3300046535 Bacteria 1687
659 Ga0495587_0000063 3300046536 Bacteria 91300
660 Ga0495587_0003797 3300046536 Bacteria 10023
661 Ga0495587_0022426 3300046536 Bacteria 3888
662 Ga0495587_0059215 3300046536 Bacteria 2248
663 Ga0495587_0094069 3300046536 Bacteria 1730
664 Ga0495587_0126579 3300046536 Bacteria 1461
665 Ga0495609_0011318 3300046538 Bacteria 4251
666 Ga0495597_0027365 3300046542 Bacteria 2614
667 Ga0495645_0005532 3300046543 Bacteria 8686
668 Ga0495645_0034718 3300046543 Bacteria 3677
669 Ga0495622_0138073 3300046557 Bacteria 1108
670 Ga0495633_0027478 3300046558 Bacteria 2782
671 Ga0495667_0000049 3300046559 Bacteria 115812
672 Ga0495667_0001442 3300046559 Bacteria 15667
673 Ga0495667_0004790 3300046559 Bacteria 9148
674 Ga0495667_0008790 3300046559 Bacteria 6866
675 Ga0495667_0024556 3300046559 Bacteria 4059
676 Ga0495667_0105715 3300046559 Bacteria 1819
677 Ga0495656_0000626 3300046615 Bacteria 11297
678 Ga0495668_0008327 3300046616 Bacteria 6493
679 Ga0495668_0017593 3300046616 Bacteria 4142
680 Ga0495634_0004604 3300046642 Bacteria 10772
681 Ga0495634_0004827 3300046642 Bacteria 10464
682 Ga0495634_0014110 3300046642 Bacteria 5768
683 Ga0495634_0054403 3300046642 Bacteria 2679
684 Ga0495634_0063506 3300046642 Bacteria 2450
685 Ga0495634_0067673 3300046642 Bacteria 2362
686 Ga0495634_0085216 3300046642 Bacteria 2059
687 Ga0495625_0009696 3300046660 Bacteria 8020
688 Ga0495635_0008752 3300046663 Bacteria 7068
689 Ga0495635_0017835 3300046663 Bacteria 4958
690 Ga0495635_0029051 3300046663 Bacteria 3843
691 Ga0495635_0057653 3300046663 Bacteria 2672
692 Ga0495635_0113599 3300046663 Bacteria 1849
693 Ga0495661_0058379 3300046665 Bacteria 2300
694 Ga0495588_0001052 3300046674 Bacteria 11984
695 Ga0495588_0009383 3300046674 Bacteria 4520
696 Ga0495588_0019330 3300046674 Bacteria 3336
697 Ga0495588_0083071 3300046674 Bacteria 1673
698 Ga0495657_0000513 3300046675 Bacteria 36152
699 Ga0495657_0003849 3300046675 Bacteria 12103
700 Ga0495657_0006358 3300046675 Bacteria 9248
701 Ga0495657_0010243 3300046675 Bacteria 7056
702 Ga0495657_0011590 3300046675 Bacteria 6587
703 Ga0495657_0015439 3300046675 Bacteria 5589
704 Ga0495657_0029912 3300046675 Bacteria 3817
705 Ga0495657_0050964 3300046675 Bacteria 2781
706 Ga0495657_0111713 3300046675 Bacteria 1730
707 Ga0495599_0000077 3300046678 Bacteria 68751
708 Ga0495599_0001711 3300046678 Bacteria 12692
709 Ga0495599_0008164 3300046678 Bacteria 6358
710 Ga0495623_0016860 3300046679 Bacteria 4718
711 Ga0495623_0043723 3300046679 Bacteria 2849
712 Ga0495646_0004530 3300046680 Bacteria 8748
713 Ga0495646_0083147 3300046680 Bacteria 1861
714 Ga0495647_0003643 3300046681 Bacteria 4946
715 Ga0495658_0011983 3300046683 Bacteria 4378
716 Ga0495658_0015551 3300046683 Bacteria 3904
717 Ga0495658_0016589 3300046683 Bacteria 3791
718 Ga0495658_0024478 3300046683 Bacteria 3216
719 Ga0495658_0051655 3300046683 Bacteria 2329
720 Ga0495613_0002958 3300046689 Bacteria 12716
721 Ga0495613_0004216 3300046689 Bacteria 10766
722 Ga0495613_0004610 3300046689 Bacteria 10347
723 Ga0495613_0014800 3300046689 Bacteria 5789
724 Ga0495613_0047411 3300046689 Bacteria 3174
725 Ga0495613_0053228 3300046689 Bacteria 2979
726 Ga0495613_0075107 3300046689 Bacteria 2460
727 Ga0495613_0081336 3300046689 Bacteria 2353
728 Ga0495624_0014953 3300046690 Bacteria 5256
729 Ga0495624_0042611 3300046690 Bacteria 2900
730 Ga0495624_0084447 3300046690 Bacteria 1962
731 Ga0495624_0126745 3300046690 Bacteria 1566
732 Ga0495624_0169922 3300046690 Bacteria 1330
733 Ga0495670_0010579 3300046691 Bacteria 4534
734 Ga0495670_0026031 3300046691 Bacteria 2896
735 Ga0495671_0049061 3300046692 Bacteria 2105
736 Ga0495649_0027030 3300046694 Bacteria 3185
737 Ga0495649_0102475 3300046694 Bacteria 1520
738 Ga0495589_0003791 3300046794 Bacteria 8133
739 Ga0495589_0008907 3300046794 Bacteria 5222
740 Ga0495589_0077824 3300046794 Bacteria 1615
741 Ga0495589_0091719 3300046794 Bacteria 1475
742 Ga0495600_0000124 3300046809 Bacteria 43037
743 Ga0495600_0004312 3300046809 Bacteria 8509
744 Ga0495600_0006029 3300046809 Bacteria 7337
745 Ga0495600_0026387 3300046809 Bacteria 3749
746 Ga0495600_0033821 3300046809 Bacteria 3318
747 Ga0495600_0042804 3300046809 Bacteria 2953
748 Ga0495600_0070644 3300046809 Bacteria 2281
749 Ga0495600_0094695 3300046809 Bacteria 1947
750 Ga0495600_0121418 3300046809 Bacteria 1699
751 Ga0495660_0053103 3300046810 Bacteria 2201
752 Ga0495581_0013815 3300047315 Bacteria 4679
753 Ga0495581_0026066 3300047315 Bacteria 3390
754 Ga0495581_0057624 3300047315 Bacteria 2242
755 Ga0495581_0058630 3300047315 Bacteria 2224
756 Ga0495604_0000032 3300047317 Bacteria 137882
757 Ga0495604_0000635 3300047317 Bacteria 30134
758 Ga0495604_0005069 3300047317 Bacteria 10426
759 Ga0495604_0021140 3300047317 Bacteria 5193
760 Ga0495604_0021660 3300047317 Bacteria 5131
761 Ga0495604_0040941 3300047317 Bacteria 3635
762 Ga0495604_0124068 3300047317 Bacteria 1865
763 Ga0495604_0124827 3300047317 Bacteria 1858
764 Ga0495636_0026436 3300047318 Bacteria 2361
765 Ga0495636_0029658 3300047318 Bacteria 2234
766 Ga0495674_0007591 3300047319 Bacteria 10363
767 Ga0495674_0008937 3300047319 Bacteria 9524
768 Ga0495674_0031385 3300047319 Bacteria 4826
769 Ga0495674_0037970 3300047319 Bacteria 4326
770 Ga0495674_0177865 3300047319 Bacteria 1773
771 Ga0495674_0182603 3300047319 Bacteria 1746
772 Ga0495672_0071716 3300047320 Bacteria 1959
773 Ga0495676_0002926 3300047321 Bacteria 15426
774 Ga0495676_0003257 3300047321 Bacteria 14666
775 Ga0495676_0005841 3300047321 Bacteria 11298
776 Ga0495676_0016062 3300047321 Bacteria 6651
777 Ga0495676_0032758 3300047321 Bacteria 4383
778 Ga0495676_0065186 3300047321 Bacteria 2828
779 Ga0495680_0000058 3300047322 Bacteria 91920
780 Ga0495680_0025736 3300047322 Bacteria 4865
781 Ga0495680_0032888 3300047322 Bacteria 4204
782 Ga0495680_0045293 3300047322 Bacteria 3473
783 Ga0495680_0066907 3300047322 Bacteria 2748
784 Ga0495683_0084340 3300047323 Bacteria 1546
785 Ga0495687_007958 3300047443 Bacteria 6154
786 Ga0495675_0000679 3300047444 Bacteria 21395
787 Ga0495675_0003848 3300047444 Bacteria 9090
788 Ga0495675_0018011 3300047444 Bacteria 4478
789 Ga0495675_0034143 3300047444 Bacteria 3246
790 Ga0495675_0096493 3300047444 Bacteria 1853
791 Ga0495685_000446 3300047447 Bacteria 12986
792 Ga0495685_020320 3300047447 Bacteria 2282
793 Ga0495685_025216 3300047447 Bacteria 2046
794 Ga0495685_040160 3300047447 Bacteria 1600
795 Ga0495685_044066 3300047447 Bacteria 1522
796 Ga0495681_0002353 3300047470 Bacteria 13576
797 Ga0495681_0002430 3300047470 Bacteria 13307
798 Ga0495681_0043645 3300047470 Bacteria 2160
799 Ga0495684_0010142 3300047471 Bacteria 7285
800 Ga0495684_0014339 3300047471 Bacteria 6099
801 Ga0495684_0037283 3300047471 Bacteria 3728
802 Ga0495684_0040812 3300047471 Bacteria 3557
803 Ga0495684_0106139 3300047471 Bacteria 2122
804 Ga0495686_0039322 3300047472 Bacteria 3022
805 Ga0495593_0001065 3300047673 Bacteria 16022
806 Ga0495593_0002190 3300047673 Bacteria 11688
807 Ga0495593_0009073 3300047673 Bacteria 5770
808 Ga0495602_0000092 3300048088 Bacteria 85286
809 Ga0495602_0014113 3300048088 Bacteria 8124
810 Ga0495602_0022032 3300048088 Bacteria 6248
811 Ga0495602_0043234 3300048088 Bacteria 4099
812 Ga0495614_0001443 3300048089 Bacteria 10271
813 Ga0495614_0002481 3300048089 Bacteria 8208
814 Ga0495614_0002629 3300048089 Bacteria 7982
815 Ga0495614_0045180 3300048089 Bacteria 1889
816 Ga0495614_0098504 3300048089 Bacteria 1276
817 Ga0496100_0092905 3300048903 Bacteria 2063
818 Ga0496101_0154968 3300048904 Bacteria 1754
819 Ga0496102_0003034 3300048905 Bacteria 14221
820 Ga0496102_0021775 3300048905 Bacteria 5672
821 Ga0496102_0042867 3300048905 Bacteria 4102
822 Ga0496102_0064997 3300048905 Bacteria 3343
823 Ga0496102_0072382 3300048905 Bacteria 3167
824 Ga0496102_0204762 3300048905 Bacteria 1860
825 Ga0496102_0324159 3300048905 Bacteria 1451
826 Ga0496103_0074772 3300048906 Bacteria 2124
827 Ga0496104_0000244 3300048907 Bacteria 48036
828 Ga0496104_0134978 3300048907 Bacteria 2370
829 Ga0496105_0001370 3300048908 Bacteria 17152
830 Ga0496105_0034393 3300048908 Bacteria 4167
831 Ga0496107_0010045 3300048910 Bacteria 6565
832 Ga0496107_0030908 3300048910 Bacteria 3819
833 Ga0496107_0031927 3300048910 Bacteria 3761
834 Ga0496108_0008554 3300048911 Bacteria 8300
835 Ga0496108_0010090 3300048911 Bacteria 7664
836 Ga0496108_0166033 3300048911 Bacteria 1909
837 Ga0496109_0013798 3300048912 Bacteria 7021
838 Ga0496109_0019583 3300048912 Bacteria 5970
839 Ga0496109_0023085 3300048912 Bacteria 5518
840 Ga0496109_0048147 3300048912 Bacteria 3878
841 Ga0496109_0059631 3300048912 Bacteria 3486
842 Ga0496110_0014679 3300048913 Bacteria 6511
843 Ga0496110_0030416 3300048913 Bacteria 4655
844 Ga0496110_0041963 3300048913 Bacteria 3993
845 Ga0496111_0006908 3300048914 Bacteria 7406
846 Ga0496111_0040657 3300048914 Bacteria 3335
847 Ga0496111_0086378 3300048914 Bacteria 2295
848 Ga0496111_0102376 3300048914 Bacteria 2105
849 Ga0496112_0001754 3300048915 Bacteria 17007
850 Ga0496112_0316828 3300048915 Bacteria 1504
851 Ga0496113_0024868 3300048916 Bacteria 4263
852 Ga0496113_0049159 3300048916 Bacteria 3140
853 Ga0496113_0050330 3300048916 Bacteria 3106
854 Ga0496113_0256454 3300048916 Bacteria 1397
855 Ga0496114_0172821 3300048917 Bacteria 1884
856 Ga0496115_0042719 3300048918 Bacteria 3613
857 Ga0496115_0046890 3300048918 Bacteria 3456
858 Ga0496115_0112732 3300048918 Bacteria 2234
859 Ga0496115_0116202 3300048918 Bacteria 2200
860 Ga0496115_0116233 3300048918 Bacteria 2200
861 Ga0496121_0114469 3300048924 Bacteria 2050
862 Ga0496126_0187819 3300048929 Bacteria 1752
863 Ga0496126_0211467 3300048929 Bacteria 1633
864 Ga0495678_048034 3300049459 Bacteria 1667
865 Ga0501031_0001656 3300049568 Bacteria 13987
866 Ga0501031_0015250 3300049568 Bacteria 4989
867 Ga0501031_0102009 3300049568 Bacteria 1872
868 Ga0501032_0105058 3300049569 Bacteria 1871
869 Ga0501033_0002616 3300049570 Bacteria 15157
870 Ga0501033_0017648 3300049570 Bacteria 5390
871 Ga0501034_0029918 3300049571 Bacteria 5536
872 Ga0501034_0197263 3300049571 Bacteria 1972
873 Ga0501036_0000024 3300049572 Bacteria 110026
874 Ga0501036_0028132 3300049572 Bacteria 4752
875 Ga0501037_0015902 3300049573 Bacteria 5541
876 Ga0501037_0017673 3300049573 Bacteria 5249
877 Ga0501038_0008017 3300049574 Bacteria 9731
878 Ga0501038_0010473 3300049574 Bacteria 8481
879 Ga0501038_0012747 3300049574 Bacteria 7679
880 Ga0501039_0001591 3300049575 Bacteria 16711
881 Ga0501039_0012453 3300049575 Bacteria 6493
882 Ga0501040_0000144 3300049576 Bacteria 38633
883 Ga0501040_0016439 3300049576 Bacteria 4898
884 Ga0501041_0000359 3300049577 Bacteria 22602
885 Ga0501041_0025301 3300049577 Bacteria 3567
886 Ga0501042_0000388 3300049578 Bacteria 22349
887 Ga0501042_0003232 3300049578 Bacteria 10187
888 Ga0501042_0012100 3300049578 Bacteria 5838
889 Ga0501043_0004254 3300049579 Bacteria 11656
890 Ga0501043_0042936 3300049579 Bacteria 3554
891 Ga0501043_0049855 3300049579 Bacteria 3292
892 Ga0501046_0000495 3300049580 Bacteria 39248
893 Ga0501047_0049314 3300049581 Bacteria 4066
894 Ga0501048_0000192 3300049582 Bacteria 39421
895 Ga0501048_0021176 3300049582 Bacteria 4760
896 Ga0501067_0020366 3300049583 Bacteria 3670
897 Ga0501068_0001934 3300049584 Bacteria 11009
898 Ga0501068_0019718 3300049584 Bacteria 3920
899 Ga0501069_0055833 3300049585 Bacteria 2200
900 Ga0501070_0028315 3300049586 Bacteria 4698
901 Ga0501070_0036609 3300049586 Bacteria 4098
902 Ga0501070_0198983 3300049586 Bacteria 1646
903 Ga0501071_0003188 3300049587 Bacteria 10210
904 Ga0501071_0037072 3300049587 Bacteria 3480
905 Ga0501072_0000920 3300049588 Bacteria 21630
906 Ga0501072_0032965 3300049588 Bacteria 4057
907 Ga0501072_0048194 3300049588 Bacteria 3355
908 Ga0501073_0023674 3300049589 Bacteria 4407
909 Ga0501073_0113897 3300049589 Bacteria 1875
910 Ga0501074_0001328 3300049590 Bacteria 16420
911 Ga0501074_0004667 3300049590 Bacteria 9815
912 Ga0501074_0035653 3300049590 Bacteria 3604
913 Ga0501075_0000132 3300049591 Bacteria 37143
914 Ga0501076_0000281 3300049592 Bacteria 31694
915 Ga0501076_0023286 3300049592 Bacteria 4772
916 Ga0501077_0000332 3300049593 Bacteria 27953
917 Ga0501077_0003894 3300049593 Bacteria 8987
918 Ga0501079_0003439 3300049741 Bacteria 11629
919 Ga0501079_0015673 3300049741 Bacteria 5788
920 Ga0501079_0020586 3300049741 Bacteria 5043
921 Ga0501080_0019407 3300049742 Bacteria 6298
922 Ga0501080_0033312 3300049742 Bacteria 4808
923 Ga0501081_0010172 3300049743 Bacteria 6139
924 Ga0501081_0013408 3300049743 Bacteria 5389
925 Ga0501083_0004138 3300049744 Bacteria 10213
926 Ga0501035_0019738 3300049822 Bacteria 6192
927 Ga0501035_0082078 3300049822 Bacteria 2845
928 Ga0501035_0215949 3300049822 Bacteria 1639
929 Ga0501044_0054713 3300049823 Bacteria 4101
930 Ga0501044_0092412 3300049823 Bacteria 3051
931 Ga0501045_0000216 3300049824 Bacteria 33098
932 Ga0501045_0013278 3300049824 Bacteria 5814
933 nmdc:mga0yw44_213472_c1 3300050492 Bacteria 1277
934 nmdc:mga06z11_2103_c1 3300050494 Bacteria 7556
935 nmdc:mga05p37_110293_c1 3300050507 Bacteria 3385
936 nmdc:mga05p37_313554_c1 3300050507 Bacteria 1859
937 nmdc:mga05p37_353928_c1 3300050507 Bacteria 1728
938 nmdc:mga05p37_42108_c1 3300050507 Bacteria 5610
939 nmdc:mga05p37_4546_c1 3300050507 Bacteria 16215
940 nmdc:mga05p37_544681_c1 3300050507 Bacteria 1322
941 nmdc:mga09592_102592_c1 3300050508 Bacteria 2451
942 nmdc:mga0qj67_15701_c1 3300050509 Bacteria 5735
943 nmdc:mga0qj67_38148_c1 3300050509 Bacteria 3769
944 nmdc:mga06r32_118242_c1 3300050510 Bacteria 2612
945 nmdc:mga06r32_20455_c1 3300050510 Bacteria 6095
946 nmdc:mga08y16_129001_c1 3300050511 Bacteria 2630
947 nmdc:mga08y16_27457_c1 3300050511 Bacteria 6000
948 nmdc:mga0n895_103058_c1 3300050512 Bacteria 2865
949 nmdc:mga0n895_232198_c1 3300050512 Bacteria 1872
950 nmdc:mga0n895_334805_c1 3300050512 Bacteria 1534
951 nmdc:mga0rr50_190743_c1 3300050513 Bacteria 1679
952 nmdc:mga0rr50_19286_c1 3300050513 Bacteria 4600
953 nmdc:mga08x19_12598_c1 3300050514 Bacteria 3663
954 nmdc:mga0a205_10334_c1 3300050515 Bacteria 8579
955 nmdc:mga0a205_1709_c1 3300050515 Bacteria 18947
956 nmdc:mga0a205_5529_c1 3300050515 Bacteria 11384
957 nmdc:mga0a205_59766_c1 3300050515 Bacteria 2712
958 Ga0495601_0001343 3300053077 Bacteria 13513
959 Ga0495601_0005633 3300053077 Bacteria 7300
960 Ga0495601_0010347 3300053077 Bacteria 5549
961 Ga0495601_0034033 3300053077 Bacteria 3176
962 Ga0495601_0034403 3300053077 Bacteria 3161
963 Ga0495601_0076024 3300053077 Bacteria 2150
964 Ga0495601_0152149 3300053077 Bacteria 1510
965 Ga0495601_0155307 3300053077 Bacteria 1494
966 Ga0495612_0005116 3300053078 Bacteria 5422
967 Ga0495612_0005699 3300053078 Bacteria 5144
968 Ga0495612_0015201 3300053078 Bacteria 3086
969 Ga0495612_0030014 3300053078 Bacteria 2190
970 Ga0495595_0009801 3300053084 Bacteria 3971
971 Ga0495595_0021794 3300053084 Bacteria 2803
972 Ga0495595_0022058 3300053084 Bacteria 2791
973 Ga0495595_0071417 3300053084 Bacteria 1641
974 Ga0495619_0001479 3300053085 Bacteria 15483
975 Ga0495619_0010401 3300053085 Bacteria 5855
976 Ga0495619_0066283 3300053085 Bacteria 2409
977 Ga0495619_0105032 3300053085 Bacteria 1926
978 Ga0495619_0320213 3300053085 Bacteria 1073
979 Ga0500578_0007649 3300053086 Bacteria 7121
980 Ga0500644_0004472 3300053088 Bacteria 3500
981 Ga0500640_046359 3300053095 Bacteria 1905
982 Ga0500654_030751 3300053099 Bacteria 3234
983 Ga0500569_014808 3300053109 Bacteria 1939
984 Ga0500614_005706 3300053123 Bacteria 2612
985 Ga0500628_002620 3300053129 Bacteria 2964
986 Ga0500652_002244 3300053131 Bacteria 5809
987 Ga0500658_0008353 3300053134 Bacteria 3826
988 Ga0500561_0000448 3300053137 Bacteria 6689
989 Ga0500573_0036939 3300053140 Bacteria 2821
990 Ga0500579_021942 3300053143 Bacteria 4139
991 Ga0500600_0007019 3300053149 Bacteria 6755
992 Ga0500616_0014405 3300053153 Bacteria 4544
993 Ga0500634_0028656 3300053161 Bacteria 3032
994 Ga0500656_000457 3300053732 Bacteria 3005
995 Ga0500587_005173 3300053739 Bacteria 1764
996 Ga0501084_0001254 3300054114 Bacteria 19977
997 Ga0501084_0014854 3300054114 Bacteria 6457
998 Ga0501084_0016371 3300054114 Bacteria 6156
999 Ga0501082_0000366 3300060353 Bacteria 39900
1000 Ga0501082_0005003 3300060353 Bacteria 11568
1001 Ga0501082_0049464 3300060353 Bacteria 3625
1002 Ga0466962_0008057 3300061719 Bacteria 5051
1003 Ga0530510_0000013 3300061734 Bacteria 110065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034817 Ga0373948_0045592 Ga0373948_0045592_11_865 280
2 3300035121 Ga0373960_0058072 Ga0373960_0058072_260_1114 280
3 3300046514 Ga0495618_0197356 Ga0495618_0197356_25_879 280
4 3300035170 Ga0373943_0039356 Ga0373943_0039356_1382_2245 282
5 3300042003 Ga0439443_025121 Ga0439443_025121_58_912 284
6 3300047319 Ga0495674_0037970 Ga0495674_0037970_13_888 288
7 3300053078 Ga0495612_0015201 Ga0495612_0015201_2198_3073 288
8 3300042012 Ga0439455_0007280 Ga0439455_0007280_1241_2152 299
9 3300046810 Ga0495660_0053103 Ga0495660_0053103_10_918 301
10 3300035118 Ga0373954_0017144 Ga0373954_0017144_23_937 302
11 3300035117 Ga0373953_0011058 Ga0373953_0011058_2194_3132 309
12 3300045976 Ga0466967_0316256 Ga0466967_0316256_556_1488 309
13 3300046536 Ga0495587_0126579 Ga0495587_0126579_26_964 309
14 3300037312 Ga0395899_0134922 Ga0395899_0134922_34_972 311
15 3300046528 Ga0495642_0055077 Ga0495642_0055077_11_949 311
16 3300005985 Ga0081539_10053769 Ga0081539_100537692 314
17 3300005329 Ga0070683_100037024 Ga0070683_1000370244 319
18 3300005337 Ga0070682_100002746 Ga0070682_1000027467 319
19 3300005366 Ga0070659_100035946 Ga0070659_1000359463 319
20 3300005535 Ga0070684_100000608 Ga0070684_1000006086 319
21 3300005539 Ga0068853_100062864 Ga0068853_1000628643 319
22 3300009098 Ga0105245_10006123 Ga0105245_100061233 319
23 3300009177 Ga0105248_10179331 Ga0105248_101793312 319
24 3300009553 Ga0105249_10043204 Ga0105249_100432042 319
25 3300010375 Ga0105239_10002393 Ga0105239_1000239316 319
26 3300011119 Ga0105246_10001529 Ga0105246_100015299 319
27 3300013307 Ga0157372_10006919 Ga0157372_100069194 319
28 3300013308 Ga0157375_10009992 Ga0157375_100099923 319
29 3300014968 Ga0157379_10036296 Ga0157379_100362962 319
30 3300026095 Ga0207676_10541905 Ga0207676_105419051 319
31 3300045976 Ga0466967_0026680 Ga0466967_0026680_49_1020 319
32 3300048905 Ga0496102_0003034 Ga0496102_0003034_5789_6760 319
33 3300048910 Ga0496107_0031927 Ga0496107_0031927_1177_2148 319
34 3300048912 Ga0496109_0048147 Ga0496109_0048147_549_1520 319
35 3300048914 Ga0496111_0086378 Ga0496111_0086378_416_1387 319
36 3300048913 Ga0496110_0041963 Ga0496110_0041963_408_1382 320
37 3300038443 Ga0395901_0113364 Ga0395901_0113364_1864_2832 321
38 3300025944 Ga0207661_10077242 Ga0207661_100772422 325
39 3300006173 Ga0070716_100156320 Ga0070716_1001563202 326
40 3300003316 rootH1_10101709 rootH1_101017091 328
41 iso_pu_bacteria 2808606357 2808828189 328
42 iso_pu_bacteria 2808606366 2808877972 328
43 iso_pu_bacteria 2945916053 2945917807 328
44 3300005435 Ga0070714_100000689 Ga0070714_1000006895 329
45 3300005436 Ga0070713_100056444 Ga0070713_1000564442 329
46 3300005436 Ga0070713_100102646 Ga0070713_1001026462 329
47 3300005548 Ga0070665_100000582 Ga0070665_10000058221 329
48 3300006028 Ga0070717_10035078 Ga0070717_100350784 329
49 3300006175 Ga0070712_100035014 Ga0070712_1000350142 329
50 3300025915 Ga0207693_10047191 Ga0207693_100471912 329
51 3300025916 Ga0207663_10120871 Ga0207663_101208712 329
52 3300025928 Ga0207700_10008111 Ga0207700_100081112 329
53 3300025928 Ga0207700_10068205 Ga0207700_100682052 329
54 3300025929 Ga0207664_10057241 Ga0207664_100572412 329
55 3300028379 Ga0268266_10003627 Ga0268266_100036274 329
56 3300033545 Ga0316214_1001164 Ga0316214_10011642 329
57 3300048905 Ga0496102_0064997 Ga0496102_0064997_1713_2714 329
58 3300048929 Ga0496126_0187819 Ga0496126_0187819_597_1601 329
59 3300049571 Ga0501034_0029918 Ga0501034_0029918_3521_4540 329
60 3300049583 Ga0501067_0020366 Ga0501067_0020366_2515_3534 329
61 3300049584 Ga0501068_0001934 Ga0501068_0001934_6332_7351 329
62 3300049586 Ga0501070_0028315 Ga0501070_0028315_2515_3534 329
63 3300049587 Ga0501071_0037072 Ga0501071_0037072_1494_2513 329
64 3300049588 Ga0501072_0048194 Ga0501072_0048194_1388_2407 329
65 3300049589 Ga0501073_0023674 Ga0501073_0023674_1656_2675 329
66 3300049590 Ga0501074_0004667 Ga0501074_0004667_2387_3406 329
67 3300049741 Ga0501079_0003439 Ga0501079_0003439_6111_7130 329
68 3300049742 Ga0501080_0019407 Ga0501080_0019407_645_1664 329
69 3300049744 Ga0501083_0004138 Ga0501083_0004138_2465_3484 329
70 3300054114 Ga0501084_0014854 Ga0501084_0014854_136_1155 329
71 3300060353 Ga0501082_0005003 Ga0501082_0005003_3519_4538 329
72 iso_pu_bacteria 2835188231 2835188483 329
73 3300005329 Ga0070683_100173457 Ga0070683_1001734572 330
74 3300005336 Ga0070680_100108855 Ga0070680_1001088552 330
75 3300005337 Ga0070682_100193492 Ga0070682_1001934921 330
76 3300005339 Ga0070660_100195402 Ga0070660_1001954022 330
77 3300005341 Ga0070691_10125745 Ga0070691_101257451 330
78 3300005434 Ga0070709_10072398 Ga0070709_100723982 330
79 3300005436 Ga0070713_100040573 Ga0070713_1000405732 330
80 3300005439 Ga0070711_100113632 Ga0070711_1001136322 330
81 3300005455 Ga0070663_100041840 Ga0070663_1000418402 330
82 3300005471 Ga0070698_100085106 Ga0070698_1000851061 330
83 3300005518 Ga0070699_100153687 Ga0070699_1001536872 330
84 3300005530 Ga0070679_100189982 Ga0070679_1001899822 330
85 3300005535 Ga0070684_100020130 Ga0070684_1000201304 330
86 3300005577 Ga0068857_100191074 Ga0068857_1001910742 330
87 3300005985 Ga0081539_10000039 Ga0081539_10000039138 330
88 3300009093 Ga0105240_10424807 Ga0105240_104248071 330
89 3300013105 Ga0157369_10004516 Ga0157369_100045162 330
90 3300013105 Ga0157369_10051301 Ga0157369_100513013 330
91 3300020081 Ga0206354_11398097 Ga0206354_113980972 330
92 3300020082 Ga0206353_11223522 Ga0206353_112235221 330
93 3300022467 Ga0224712_10010694 Ga0224712_100106942 330
94 3300025909 Ga0207705_10050015 Ga0207705_100500152 330
95 3300025917 Ga0207660_10076651 Ga0207660_100766512 330
96 3300025919 Ga0207657_10051552 Ga0207657_100515522 330
97 3300025928 Ga0207700_10129802 Ga0207700_101298022 330
98 3300025937 Ga0207669_10032987 Ga0207669_100329872 330
99 3300026067 Ga0207678_10022818 Ga0207678_100228183 330
100 3300026116 Ga0207674_10047529 Ga0207674_100475292 330
101 3300028800 Ga0265338_10006470 Ga0265338_1000647016 330
102 3300028800 Ga0265338_10007919 Ga0265338_100079199 330
103 3300037068 Ga0373925_0000129 Ga0373925_0000129_35312_36328 330
104 3300045836 Ga0466958_0072099 Ga0466958_0072099_329_1339 330
105 3300045976 Ga0466967_0146068 Ga0466967_0146068_114_1124 330
106 3300046690 Ga0495624_0169922 Ga0495624_0169922_111_1106 330
107 3300048918 Ga0496115_0112732 Ga0496115_0112732_416_1456 330
108 3300048918 Ga0496115_0116233 Ga0496115_0116233_527_1543 330
109 3300048929 Ga0496126_0211467 Ga0496126_0211467_351_1370 330
110 3300053140 Ga0500573_0036939 Ga0500573_0036939_1454_2449 330
111 3300005345 Ga0070692_10095894 Ga0070692_100958942 331
112 3300025944 Ga0207661_10148458 Ga0207661_101484583 331
113 3300032004 Ga0307414_10200278 Ga0307414_102002782 331
114 3300037853 Ga0436364_0770879 Ga0436364_0770879_705_1718 331
115 3300005437 Ga0070710_10066854 Ga0070710_100668542 332
116 3300005467 Ga0070706_100020458 Ga0070706_1000204584 332
117 3300005518 Ga0070699_100349094 Ga0070699_1003490941 332
118 3300005577 Ga0068857_100020356 Ga0068857_1000203563 332
119 3300005614 Ga0068856_100065834 Ga0068856_1000658343 332
120 3300006173 Ga0070716_100094031 Ga0070716_1000940312 332
121 3300006881 Ga0068865_100052087 Ga0068865_1000520872 332
122 3300007076 Ga0075435_100248277 Ga0075435_1002482772 332
123 3300009545 Ga0105237_10371231 Ga0105237_103712312 332
124 3300020070 Ga0206356_10634487 Ga0206356_106344871 332
125 3300021377 Ga0213874_10010623 Ga0213874_100106232 332
126 3300021388 Ga0213875_10072346 Ga0213875_100723462 332
127 3300022467 Ga0224712_10050471 Ga0224712_100504712 332
128 3300025901 Ga0207688_10019493 Ga0207688_100194933 332
129 3300025906 Ga0207699_10012336 Ga0207699_100123362 332
130 3300025910 Ga0207684_10054486 Ga0207684_100544862 332
131 3300025915 Ga0207693_10235904 Ga0207693_102359042 332
132 3300025928 Ga0207700_10215218 Ga0207700_102152182 332
133 3300025938 Ga0207704_10029079 Ga0207704_100290792 332
134 3300025939 Ga0207665_10020054 Ga0207665_100200543 332
135 3300025944 Ga0207661_10013022 Ga0207661_100130223 332
136 3300025945 Ga0207679_10024923 Ga0207679_100249233 332
137 3300025949 Ga0207667_10109524 Ga0207667_101095242 332
138 3300025961 Ga0207712_10078665 Ga0207712_100786651 332
139 3300025986 Ga0207658_10102280 Ga0207658_101022802 332
140 3300026078 Ga0207702_10145929 Ga0207702_101459292 332
141 3300026116 Ga0207674_10028804 Ga0207674_100288044 332
142 3300028381 Ga0268264_10029455 Ga0268264_100294553 332
143 3300028786 Ga0307517_10001543 Ga0307517_1000154329 332
144 3300030521 Ga0307511_10080861 Ga0307511_100808612 332
145 3300031616 Ga0307508_10002445 Ga0307508_100024454 332
146 3300031649 Ga0307514_10140248 Ga0307514_101402482 332
147 3300031730 Ga0307516_10028396 Ga0307516_100283963 332
148 3300035086 Ga0373934_0000901 Ga0373934_0000901_7379_8392 332
149 3300035088 Ga0373940_0040899 Ga0373940_0040899_69_1082 332
150 3300035089 Ga0373944_0023619 Ga0373944_0023619_248_1261 332
151 3300035111 Ga0373923_0006452 Ga0373923_0006452_185_1198 332
152 3300035113 Ga0373936_0000261 Ga0373936_0000261_6663_7676 332
153 3300035116 Ga0373945_0001094 Ga0373945_0001094_6789_7802 332
154 3300035120 Ga0373957_0010835 Ga0373957_0010835_428_1441 332
155 3300035171 Ga0373946_0003584 Ga0373946_0003584_1966_2979 332
156 3300035172 Ga0373955_0063906 Ga0373955_0063906_617_1630 332
157 3300035410 Ga0373924_0000743 Ga0373924_0000743_7659_8672 332
158 3300035692 Ga0373935_0010564 Ga0373935_0010564_1439_2452 332
159 3300035692 Ga0373935_0213332 Ga0373935_0213332_321_1328 332
160 3300035695 Ga0373927_0023290 Ga0373927_0023290_646_1659 332
161 3300035724 Ga0373933_0012156 Ga0373933_0012156_1356_2369 332
162 3300035724 Ga0373933_0077306 Ga0373933_0077306_525_1538 332
163 3300035724 Ga0373933_0240472 Ga0373933_0240472_103_1116 332
164 3300035725 Ga0373947_0005570 Ga0373947_0005570_1559_2572 332
165 3300036401 Ga0373937_0051116 Ga0373937_0051116_1259_2272 332
166 3300037068 Ga0373925_0037019 Ga0373925_0037019_2531_3544 332
167 3300037418 Ga0395900_0001460 Ga0395900_0001460_14889_15905 332
168 3300037471 Ga0395905_0002907 Ga0395905_0002907_1008_2024 332
169 3300039450 Ga0436363_1185395 Ga0436363_1185395_347_1360 332
170 3300046454 Ga0495592_0142098 Ga0495592_0142098_629_1642 332
171 3300046455 Ga0495603_0007066 Ga0495603_0007066_3591_4604 332
172 3300046459 Ga0495629_0003035 Ga0495629_0003035_4185_5198 332
173 3300046460 Ga0495638_0083603 Ga0495638_0083603_462_1469 332
174 3300046461 Ga0495641_0006497 Ga0495641_0006497_2371_3384 332
175 3300046462 Ga0495651_0062785 Ga0495651_0062785_1720_2733 332
176 3300046473 Ga0495582_0022952 Ga0495582_0022952_13_1026 332
177 3300046476 Ga0495662_0000687 Ga0495662_0000687_10422_11435 332
178 3300046499 Ga0495594_0005157 Ga0495594_0005157_5417_6430 332
179 3300046511 Ga0495608_0067426 Ga0495608_0067426_308_1321 332
180 3300046514 Ga0495618_0010288 Ga0495618_0010288_1559_2572 332
181 3300046516 Ga0495628_0081187 Ga0495628_0081187_57_1070 332
182 3300046522 Ga0495643_0001800 Ga0495643_0001800_962_1969 332
183 3300046526 Ga0495666_0002910 Ga0495666_0002910_82_1095 332
184 3300046536 Ga0495587_0094069 Ga0495587_0094069_436_1449 332
185 3300046543 Ga0495645_0034718 Ga0495645_0034718_1148_2161 332
186 3300046558 Ga0495633_0027478 Ga0495633_0027478_426_1433 332
187 3300046559 Ga0495667_0008790 Ga0495667_0008790_1851_2864 332
188 3300046642 Ga0495634_0004604 Ga0495634_0004604_6672_7685 332
189 3300046663 Ga0495635_0017835 Ga0495635_0017835_3919_4932 332
190 3300046674 Ga0495588_0083071 Ga0495588_0083071_573_1586 332
191 3300046675 Ga0495657_0050964 Ga0495657_0050964_1201_2214 332
192 3300046680 Ga0495646_0004530 Ga0495646_0004530_947_1960 332
193 3300046681 Ga0495647_0003643 Ga0495647_0003643_2418_3431 332
194 3300046683 Ga0495658_0011983 Ga0495658_0011983_1175_2182 332
195 3300046683 Ga0495658_0024478 Ga0495658_0024478_728_1741 332
196 3300046689 Ga0495613_0002958 Ga0495613_0002958_7624_8637 332
197 3300046690 Ga0495624_0126745 Ga0495624_0126745_288_1301 332
198 3300046691 Ga0495670_0010579 Ga0495670_0010579_1198_2205 332
199 3300046692 Ga0495671_0049061 Ga0495671_0049061_450_1457 332
200 3300046809 Ga0495600_0026387 Ga0495600_0026387_136_1149 332
201 3300047321 Ga0495676_0032758 Ga0495676_0032758_604_1617 332
202 3300047323 Ga0495683_0084340 Ga0495683_0084340_85_1092 332
203 3300047447 Ga0495685_000446 Ga0495685_000446_11787_12794 332
204 3300047470 Ga0495681_0002353 Ga0495681_0002353_3194_4201 332
205 3300047471 Ga0495684_0037283 Ga0495684_0037283_2531_3544 332
206 3300047673 Ga0495593_0002190 Ga0495593_0002190_6818_7831 332
207 3300049568 Ga0501031_0102009 Ga0501031_0102009_19_1038 332
208 3300053077 Ga0495601_0005633 Ga0495601_0005633_3757_4770 332
209 3300053077 Ga0495601_0152149 Ga0495601_0152149_492_1499 332
210 3300053085 Ga0495619_0010401 Ga0495619_0010401_1293_2306 332
211 3300053086 Ga0500578_0007649 Ga0500578_0007649_4314_5321 332
212 3300053099 Ga0500654_030751 Ga0500654_030751_51_1058 332
213 3300053109 Ga0500569_014808 Ga0500569_014808_733_1740 332
214 3300053123 Ga0500614_005706 Ga0500614_005706_338_1345 332
215 3300053129 Ga0500628_002620 Ga0500628_002620_202_1209 332
216 3300053131 Ga0500652_002244 Ga0500652_002244_1518_2525 332
217 3300053134 Ga0500658_0008353 Ga0500658_0008353_200_1207 332
218 3300053137 Ga0500561_0000448 Ga0500561_0000448_2525_3532 332
219 3300053143 Ga0500579_021942 Ga0500579_021942_2003_3010 332
220 3300053149 Ga0500600_0007019 Ga0500600_0007019_321_1328 332
221 3300053153 Ga0500616_0014405 Ga0500616_0014405_1672_2679 332
222 3300053161 Ga0500634_0028656 Ga0500634_0028656_1705_2712 332
223 3300053732 Ga0500656_000457 Ga0500656_000457_691_1698 332
224 3300053739 Ga0500587_005173 Ga0500587_005173_341_1348 332
225 iso_pu_bacteria 2582581314 2585317345 332
226 iso_pu_bacteria 2616644814 2616693144 332
227 iso_pu_bacteria 2643221647 2644263513 332
228 iso_pu_bacteria 2808606375 2808918053 332
229 iso_pu_bacteria 2862281513 2862290056 332
230 iso_pu_bacteria 2877676314 2877683794 332
231 iso_pu_bacteria 2912723979 2912726530 332
232 iso_pu_bacteria 2954380949 2954389097 332
233 iso_pu_bacteria 2954691527 2954699843 332
234 iso_pu_bacteria 2954701450 2954702355 332
235 iso_pu_bacteria 3006493962 3006497048 332
236 iso_pu_bacteria 8008574985 8008581090 332
237 iso_pu_bacteria 8056829672 8056832647 332
238 3300005329 Ga0070683_100077938 Ga0070683_1000779381 333
239 3300005434 Ga0070709_10000860 Ga0070709_1000086012 333
240 3300005434 Ga0070709_10006505 Ga0070709_100065052 333
241 3300005435 Ga0070714_100008563 Ga0070714_1000085636 333
242 3300005435 Ga0070714_100039832 Ga0070714_1000398324 333
243 3300005435 Ga0070714_100058409 Ga0070714_1000584092 333
244 3300005435 Ga0070714_100339940 Ga0070714_1003399402 333
245 3300005436 Ga0070713_100005240 Ga0070713_1000052403 333
246 3300005436 Ga0070713_100015430 Ga0070713_1000154304 333
247 3300005436 Ga0070713_100034356 Ga0070713_1000343564 333
248 3300005437 Ga0070710_10001129 Ga0070710_100011293 333
249 3300005439 Ga0070711_100001373 Ga0070711_10000137313 333
250 3300005445 Ga0070708_100164741 Ga0070708_1001647412 333
251 3300005445 Ga0070708_100430744 Ga0070708_1004307441 333
252 3300005467 Ga0070706_100009709 Ga0070706_1000097095 333
253 3300005467 Ga0070706_100016121 Ga0070706_1000161217 333
254 3300005468 Ga0070707_100003304 Ga0070707_1000033042 333
255 3300005468 Ga0070707_100004577 Ga0070707_1000045775 333
256 3300005468 Ga0070707_100007078 Ga0070707_1000070786 333
257 3300005468 Ga0070707_100127635 Ga0070707_1001276352 333
258 3300005471 Ga0070698_100006573 Ga0070698_1000065732 333
259 3300005471 Ga0070698_100009522 Ga0070698_1000095224 333
260 3300005471 Ga0070698_100182287 Ga0070698_1001822872 333
261 3300005536 Ga0070697_100030792 Ga0070697_1000307923 333
262 3300006028 Ga0070717_10052905 Ga0070717_100529052 333
263 3300006028 Ga0070717_10056812 Ga0070717_100568122 333
264 3300006028 Ga0070717_10084720 Ga0070717_100847202 333
265 3300006028 Ga0070717_10146186 Ga0070717_101461862 333
266 3300006163 Ga0070715_10004785 Ga0070715_100047854 333
267 3300006173 Ga0070716_100002145 Ga0070716_1000021453 333
268 3300006173 Ga0070716_100010128 Ga0070716_1000101284 333
269 3300006175 Ga0070712_100028908 Ga0070712_1000289082 333
270 3300007265 Ga0099794_10034778 Ga0099794_100347782 333
271 3300007788 Ga0099795_10046895 Ga0099795_100468952 333
272 3300014325 Ga0163163_10063038 Ga0163163_100630383 333
273 3300020070 Ga0206356_11862379 Ga0206356_118623793 333
274 3300021388 Ga0213875_10000733 Ga0213875_1000073326 333
275 3300025898 Ga0207692_10008396 Ga0207692_100083962 333
276 3300025898 Ga0207692_10015692 Ga0207692_100156921 333
277 3300025905 Ga0207685_10002713 Ga0207685_100027133 333
278 3300025905 Ga0207685_10042902 Ga0207685_100429022 333
279 3300025906 Ga0207699_10004435 Ga0207699_100044352 333
280 3300025906 Ga0207699_10008456 Ga0207699_100084564 333
281 3300025910 Ga0207684_10001173 Ga0207684_100011736 333
282 3300025910 Ga0207684_10108883 Ga0207684_101088833 333
283 3300025910 Ga0207684_10236430 Ga0207684_102364302 333
284 3300025912 Ga0207707_10214544 Ga0207707_102145442 333
285 3300025916 Ga0207663_10001110 Ga0207663_100011105 333
286 3300025922 Ga0207646_10000049 Ga0207646_100000496 333
287 3300025922 Ga0207646_10007857 Ga0207646_100078576 333
288 3300025922 Ga0207646_10057527 Ga0207646_100575273 333
289 3300025922 Ga0207646_10129186 Ga0207646_101291862 333
290 3300025922 Ga0207646_10146084 Ga0207646_101460842 333
291 3300025928 Ga0207700_10003695 Ga0207700_100036957 333
292 3300025928 Ga0207700_10003979 Ga0207700_100039795 333
293 3300025928 Ga0207700_10006305 Ga0207700_100063052 333
294 3300025929 Ga0207664_10005230 Ga0207664_100052306 333
295 3300025929 Ga0207664_10012080 Ga0207664_100120804 333
296 3300025939 Ga0207665_10004164 Ga0207665_100041646 333
297 3300026116 Ga0207674_10024704 Ga0207674_100247047 333
298 3300032002 Ga0307416_100155120 Ga0307416_1001551202 333
299 3300032126 Ga0307415_100009901 Ga0307415_1000099012 333
300 3300035111 Ga0373923_0001192 Ga0373923_0001192_114_1127 333
301 3300035113 Ga0373936_0003311 Ga0373936_0003311_3450_4463 333
302 3300035120 Ga0373957_0000657 Ga0373957_0000657_5471_6484 333
303 3300035120 Ga0373957_0007245 Ga0373957_0007245_48_1061 333
304 3300035171 Ga0373946_0009123 Ga0373946_0009123_2334_3347 333
305 3300035172 Ga0373955_0002081 Ga0373955_0002081_5585_6598 333
306 3300035207 Ga0373942_0000318 Ga0373942_0000318_1630_2643 333
307 3300035410 Ga0373924_0003886 Ga0373924_0003886_2827_3840 333
308 3300037068 Ga0373925_0014080 Ga0373925_0014080_1929_2942 333
309 3300037853 Ga0436364_1220868 Ga0436364_1220868_1885_2928 333
310 3300037853 Ga0436364_1535764 Ga0436364_1535764_2804_3820 333
311 3300039450 Ga0436363_1403459 Ga0436363_1403459_1191_2210 333
312 3300044694 Ga0466963_0218562 Ga0466963_0218562_25_1038 333
313 3300044842 Ga0466957_0045184 Ga0466957_0045184_1498_2511 333
314 3300045049 Ga0466959_0186226 Ga0466959_0186226_36_1049 333
315 3300045976 Ga0466967_0016992 Ga0466967_0016992_3075_4088 333
316 3300045976 Ga0466967_0025071 Ga0466967_0025071_2299_3312 333
317 3300045976 Ga0466967_0198712 Ga0466967_0198712_591_1604 333
318 3300046459 Ga0495629_0004317 Ga0495629_0004317_6303_7316 333
319 3300046461 Ga0495641_0008040 Ga0495641_0008040_2506_3519 333
320 3300046461 Ga0495641_0039190 Ga0495641_0039190_839_1879 333
321 3300046462 Ga0495651_0053799 Ga0495651_0053799_1978_2991 333
322 3300046463 Ga0495653_0038056 Ga0495653_0038056_1838_2851 333
323 3300046473 Ga0495582_0002025 Ga0495582_0002025_2032_3045 333
324 3300046476 Ga0495662_0002464 Ga0495662_0002464_714_1727 333
325 3300046514 Ga0495618_0004694 Ga0495618_0004694_3234_4247 333
326 3300046516 Ga0495628_0143740 Ga0495628_0143740_107_1120 333
327 3300046531 Ga0495665_0009058 Ga0495665_0009058_2035_3048 333
328 3300046533 Ga0495640_0017468 Ga0495640_0017468_3323_4336 333
329 3300046535 Ga0495586_0005351 Ga0495586_0005351_4427_5440 333
330 3300046543 Ga0495645_0005532 Ga0495645_0005532_4428_5441 333
331 3300046559 Ga0495667_0105715 Ga0495667_0105715_107_1120 333
332 3300046642 Ga0495634_0004827 Ga0495634_0004827_4365_5378 333
333 3300046675 Ga0495657_0029912 Ga0495657_0029912_827_1840 333
334 3300046683 Ga0495658_0015551 Ga0495658_0015551_2248_3261 333
335 3300046689 Ga0495613_0004610 Ga0495613_0004610_4091_5104 333
336 3300046690 Ga0495624_0014953 Ga0495624_0014953_1988_3001 333
337 3300046809 Ga0495600_0033821 Ga0495600_0033821_468_1481 333
338 3300047315 Ga0495581_0013815 Ga0495581_0013815_3196_4209 333
339 3300047317 Ga0495604_0021660 Ga0495604_0021660_2153_3166 333
340 3300047322 Ga0495680_0045293 Ga0495680_0045293_1838_2851 333
341 3300047673 Ga0495593_0009073 Ga0495593_0009073_4237_5250 333
342 3300048089 Ga0495614_0045180 Ga0495614_0045180_389_1402 333
343 3300048905 Ga0496102_0042867 Ga0496102_0042867_2572_3585 333
344 3300048907 Ga0496104_0000244 Ga0496104_0000244_7813_8826 333
345 3300048908 Ga0496105_0001370 Ga0496105_0001370_14137_15150 333
346 3300048910 Ga0496107_0030908 Ga0496107_0030908_2709_3722 333
347 3300048911 Ga0496108_0008554 Ga0496108_0008554_2242_3255 333
348 3300048912 Ga0496109_0013798 Ga0496109_0013798_5612_6625 333
349 3300048915 Ga0496112_0001754 Ga0496112_0001754_9650_10663 333
350 3300048916 Ga0496113_0024868 Ga0496113_0024868_1632_2645 333
351 3300048918 Ga0496115_0046890 Ga0496115_0046890_814_1827 333
352 3300049578 Ga0501042_0012100 Ga0501042_0012100_4815_5828 333
353 3300049579 Ga0501043_0049855 Ga0501043_0049855_1885_2910 333
354 3300049585 Ga0501069_0055833 Ga0501069_0055833_656_1681 333
355 3300050513 nmdc:mga0rr50_190743_c1 nmdc:mga0rr50_190743_c1_442_1455 333
356 3300053077 Ga0495601_0034033 Ga0495601_0034033_1279_2292 333
357 3300053078 Ga0495612_0005699 Ga0495612_0005699_1757_2770 333
358 3300053084 Ga0495595_0021794 Ga0495595_0021794_894_1907 333
359 3300053085 Ga0495619_0001479 Ga0495619_0001479_13645_14658 333
360 iso_pu_bacteria 2616644941 2616904349 333
361 iso_pu_bacteria 2862178590 2862180702 333
362 iso_pu_bacteria 2862574272 2862574991 333
363 3300005435 Ga0070714_100032055 Ga0070714_1000320552 334
364 3300005435 Ga0070714_100060750 Ga0070714_1000607501 334
365 3300005436 Ga0070713_100119803 Ga0070713_1001198033 334
366 3300005437 Ga0070710_10005384 Ga0070710_100053842 334
367 3300005445 Ga0070708_100004428 Ga0070708_1000044281 334
368 3300005467 Ga0070706_100005350 Ga0070706_1000053508 334
369 3300005467 Ga0070706_100021910 Ga0070706_1000219102 334
370 3300005468 Ga0070707_100003555 Ga0070707_10000355513 334
371 3300005468 Ga0070707_100062407 Ga0070707_1000624072 334
372 3300005468 Ga0070707_100119997 Ga0070707_1001199971 334
373 3300005471 Ga0070698_100000677 Ga0070698_10000067722 334
374 3300005471 Ga0070698_100000986 Ga0070698_10000098626 334
375 3300005471 Ga0070698_100010816 Ga0070698_1000108166 334
376 3300005471 Ga0070698_100061266 Ga0070698_1000612662 334
377 3300005536 Ga0070697_100056089 Ga0070697_1000560892 334
378 3300005544 Ga0070686_100252333 Ga0070686_1002523331 334
379 3300005563 Ga0068855_100205944 Ga0068855_1002059442 334
380 3300005617 Ga0068859_100359984 Ga0068859_1003599842 334
381 3300005983 Ga0081540_1000362 Ga0081540_100036235 334
382 3300005983 Ga0081540_1005003 Ga0081540_10050037 334
383 3300005985 Ga0081539_10004894 Ga0081539_1000489414 334
384 3300006028 Ga0070717_10074523 Ga0070717_100745232 334
385 3300006028 Ga0070717_10079373 Ga0070717_100793732 334
386 3300006028 Ga0070717_10091955 Ga0070717_100919553 334
387 3300006178 Ga0075367_10000378 Ga0075367_1000037810 334
388 3300006358 Ga0068871_100245715 Ga0068871_1002457152 334
389 3300006844 Ga0075428_100078984 Ga0075428_1000789843 334
390 3300006847 Ga0075431_100177162 Ga0075431_1001771621 334
391 3300006852 Ga0075433_10052354 Ga0075433_100523542 334
392 3300006852 Ga0075433_10179093 Ga0075433_101790932 334
393 3300006871 Ga0075434_100016613 Ga0075434_1000166132 334
394 3300006880 Ga0075429_100070862 Ga0075429_1000708622 334
395 3300006914 Ga0075436_100031854 Ga0075436_1000318541 334
396 3300006931 Ga0097620_100359963 Ga0097620_1003599631 334
397 3300007076 Ga0075435_100021794 Ga0075435_1000217942 334
398 3300009094 Ga0111539_10038804 Ga0111539_100388044 334
399 3300009147 Ga0114129_10010765 Ga0114129_1001076511 334
400 3300009147 Ga0114129_10046417 Ga0114129_100464173 334
401 3300011119 Ga0105246_10080398 Ga0105246_100803982 334
402 3300013100 Ga0157373_10192458 Ga0157373_101924581 334
403 3300014497 Ga0182008_10003575 Ga0182008_100035756 334
404 3300015262 Ga0182007_10003274 Ga0182007_100032744 334
405 3300015688 Ga0183367_1003 Ga0183367_1003226 334
406 3300021388 Ga0213875_10001317 Ga0213875_1000131716 334
407 3300025297 Ga0209758_1010847 Ga0209758_10108474 334
408 3300025904 Ga0207647_10003769 Ga0207647_100037693 334
409 3300025906 Ga0207699_10007040 Ga0207699_100070404 334
410 3300025906 Ga0207699_10085070 Ga0207699_100850702 334
411 3300025910 Ga0207684_10000987 Ga0207684_1000098713 334
412 3300025910 Ga0207684_10004337 Ga0207684_100043372 334
413 3300025910 Ga0207684_10008945 Ga0207684_100089455 334
414 3300025910 Ga0207684_10049953 Ga0207684_100499532 334
415 3300025916 Ga0207663_10045424 Ga0207663_100454243 334
416 3300025922 Ga0207646_10018496 Ga0207646_100184962 334
417 3300025922 Ga0207646_10051512 Ga0207646_100515124 334
418 3300025922 Ga0207646_10135456 Ga0207646_101354562 334
419 3300025929 Ga0207664_10005718 Ga0207664_100057182 334
420 3300025929 Ga0207664_10342894 Ga0207664_103428942 334
421 3300025949 Ga0207667_10216285 Ga0207667_102162852 334
422 3300026078 Ga0207702_10028124 Ga0207702_100281242 334
423 3300028786 Ga0307517_10001103 Ga0307517_1000110338 334
424 3300028794 Ga0307515_10002955 Ga0307515_1000295532 334
425 3300028800 Ga0265338_10007640 Ga0265338_100076403 334
426 3300030521 Ga0307511_10000334 Ga0307511_100003347 334
427 3300030521 Ga0307511_10116044 Ga0307511_101160441 334
428 3300030522 Ga0307512_10001670 Ga0307512_1000167010 334
429 3300030522 Ga0307512_10053638 Ga0307512_100536383 334
430 3300031456 Ga0307513_10001865 Ga0307513_1000186518 334
431 3300031456 Ga0307513_10134545 Ga0307513_101345453 334
432 3300031507 Ga0307509_10024865 Ga0307509_100248654 334
433 3300031507 Ga0307509_10030629 Ga0307509_100306293 334
434 3300031616 Ga0307508_10002111 Ga0307508_100021113 334
435 3300031616 Ga0307508_10010556 Ga0307508_100105565 334
436 3300031838 Ga0307518_10020369 Ga0307518_100203692 334
437 3300031838 Ga0307518_10067094 Ga0307518_100670942 334
438 3300032002 Ga0307416_100259631 Ga0307416_1002596312 334
439 3300032126 Ga0307415_100063572 Ga0307415_1000635723 334
440 3300033179 Ga0307507_10031417 Ga0307507_100314174 334
441 3300033179 Ga0307507_10104011 Ga0307507_101040112 334
442 3300033179 Ga0307507_10179135 Ga0307507_101791352 334
443 3300033180 Ga0307510_10015027 Ga0307510_100150274 334
444 3300035083 Ga0373926_0000303 Ga0373926_0000303_9188_10204 334
445 3300035090 Ga0373949_0035623 Ga0373949_0035623_126_1142 334
446 3300035114 Ga0373939_0003903 Ga0373939_0003903_1830_2846 334
447 3300035115 Ga0373941_0013082 Ga0373941_0013082_107_1123 334
448 3300035117 Ga0373953_0000513 Ga0373953_0000513_928_1944 334
449 3300035117 Ga0373953_0068048 Ga0373953_0068048_21_1037 334
450 3300035118 Ga0373954_0012807 Ga0373954_0012807_2205_3221 334
451 3300035120 Ga0373957_0012232 Ga0373957_0012232_109_1125 334
452 3300035120 Ga0373957_0065310 Ga0373957_0065310_321_1337 334
453 3300035171 Ga0373946_0033982 Ga0373946_0033982_901_1917 334
454 3300035172 Ga0373955_0029188 Ga0373955_0029188_405_1421 334
455 3300035410 Ga0373924_0058859 Ga0373924_0058859_426_1442 334
456 3300035692 Ga0373935_0012709 Ga0373935_0012709_263_1279 334
457 3300035724 Ga0373933_0094971 Ga0373933_0094971_797_1813 334
458 3300035725 Ga0373947_0000002 Ga0373947_0000002_73423_74439 334
459 3300036401 Ga0373937_0019920 Ga0373937_0019920_1618_2634 334
460 3300036401 Ga0373937_0170479 Ga0373937_0170479_933_1949 334
461 3300036401 Ga0373937_0213368 Ga0373937_0213368_405_1421 334
462 3300037068 Ga0373925_0004572 Ga0373925_0004572_6037_7053 334
463 3300037068 Ga0373925_0074646 Ga0373925_0074646_185_1201 334
464 3300037068 Ga0373925_0237633 Ga0373925_0237633_54_1070 334
465 3300037418 Ga0395900_0017541 Ga0395900_0017541_1832_2842 334
466 3300037418 Ga0395900_0047250 Ga0395900_0047250_2348_3361 334
467 3300037466 Ga0395898_0012712 Ga0395898_0012712_7413_8426 334
468 3300037466 Ga0395898_0204919 Ga0395898_0204919_310_1320 334
469 3300037471 Ga0395905_0015416 Ga0395905_0015416_2455_3465 334
470 3300037853 Ga0436364_0185875 Ga0436364_0185875_92_1108 334
471 3300037853 Ga0436364_0403534 Ga0436364_0403534_1657_2676 334
472 3300038443 Ga0395901_0005424 Ga0395901_0005424_10516_11526 334
473 3300038443 Ga0395901_0015291 Ga0395901_0015291_3220_4230 334
474 3300042005 Ga0439448_0004998 Ga0439448_0004998_2502_3542 334
475 3300042012 Ga0439455_0004764 Ga0439455_0004764_596_1636 334
476 3300042138 Ga0450903_000015 Ga0450903_000015_12355_13395 334
477 3300044656 Ga0466969_0000938 Ga0466969_0000938_3757_4788 334
478 3300044658 Ga0466972_0060027 Ga0466972_0060027_722_1735 334
479 3300044684 Ga0466966_0010118 Ga0466966_0010118_1900_2931 334
480 3300044684 Ga0466966_0115377 Ga0466966_0115377_600_1631 334
481 3300044693 Ga0466961_0052102 Ga0466961_0052102_821_1852 334
482 3300044693 Ga0466961_0108162 Ga0466961_0108162_708_1739 334
483 3300044719 Ga0466971_0002879 Ga0466971_0002879_180_1211 334
484 3300044765 Ga0466970_0117570 Ga0466970_0117570_84_1100 334
485 3300045049 Ga0466959_0020690 Ga0466959_0020690_1724_2755 334
486 3300045836 Ga0466958_0054078 Ga0466958_0054078_734_1765 334
487 3300046454 Ga0495592_0000567 Ga0495592_0000567_20104_21120 334
488 3300046454 Ga0495592_0005211 Ga0495592_0005211_5353_6366 334
489 3300046454 Ga0495592_0060608 Ga0495592_0060608_159_1172 334
490 3300046455 Ga0495603_0002412 Ga0495603_0002412_9060_10073 334
491 3300046455 Ga0495603_0038207 Ga0495603_0038207_1504_2517 334
492 3300046459 Ga0495629_0008814 Ga0495629_0008814_78_1094 334
493 3300046459 Ga0495629_0012006 Ga0495629_0012006_336_1349 334
494 3300046459 Ga0495629_0017721 Ga0495629_0017721_2780_3793 334
495 3300046459 Ga0495629_0018334 Ga0495629_0018334_970_1983 334
496 3300046460 Ga0495638_0133406 Ga0495638_0133406_356_1369 334
497 3300046461 Ga0495641_0004729 Ga0495641_0004729_4182_5198 334
498 3300046462 Ga0495651_0002609 Ga0495651_0002609_1924_2940 334
499 3300046462 Ga0495651_0004896 Ga0495651_0004896_1505_2518 334
500 3300046463 Ga0495653_0113118 Ga0495653_0113118_30_1046 334
501 3300046463 Ga0495653_0197191 Ga0495653_0197191_29_1042 334
502 3300046472 Ga0495580_0006999 Ga0495580_0006999_6747_7763 334
503 3300046473 Ga0495582_0005524 Ga0495582_0005524_3029_4045 334
504 3300046473 Ga0495582_0016720 Ga0495582_0016720_109_1122 334
505 3300046473 Ga0495582_0161015 Ga0495582_0161015_209_1222 334
506 3300046474 Ga0495605_0016046 Ga0495605_0016046_1966_2979 334
507 3300046474 Ga0495605_0039514 Ga0495605_0039514_1114_2127 334
508 3300046475 Ga0495639_0006511 Ga0495639_0006511_2876_3892 334
509 3300046476 Ga0495662_0003024 Ga0495662_0003024_6366_7379 334
510 3300046476 Ga0495662_0003887 Ga0495662_0003887_2140_3153 334
511 3300046476 Ga0495662_0006157 Ga0495662_0006157_3576_4589 334
512 3300046476 Ga0495662_0015599 Ga0495662_0015599_332_1348 334
513 3300046476 Ga0495662_0073391 Ga0495662_0073391_459_1475 334
514 3300046499 Ga0495594_0008585 Ga0495594_0008585_1903_2916 334
515 3300046501 Ga0495607_0063014 Ga0495607_0063014_422_1435 334
516 3300046506 Ga0495583_0011636 Ga0495583_0011636_2950_3963 334
517 3300046506 Ga0495583_0085468 Ga0495583_0085468_337_1350 334
518 3300046507 Ga0495606_0012472 Ga0495606_0012472_862_1875 334
519 3300046513 Ga0495616_0010477 Ga0495616_0010477_2363_3376 334
520 3300046514 Ga0495618_0046177 Ga0495618_0046177_1153_2166 334
521 3300046515 Ga0495620_0002993 Ga0495620_0002993_5536_6549 334
522 3300046515 Ga0495620_0014051 Ga0495620_0014051_1149_2162 334
523 3300046516 Ga0495628_0039946 Ga0495628_0039946_807_1820 334
524 3300046516 Ga0495628_0044087 Ga0495628_0044087_2449_3462 334
525 3300046517 Ga0495630_0016315 Ga0495630_0016315_3649_4662 334
526 3300046517 Ga0495630_0100368 Ga0495630_0100368_453_1469 334
527 3300046517 Ga0495630_0122947 Ga0495630_0122947_454_1470 334
528 3300046517 Ga0495630_0169388 Ga0495630_0169388_489_1502 334
529 3300046522 Ga0495643_0006360 Ga0495643_0006360_548_1561 334
530 3300046524 Ga0495648_0033986 Ga0495648_0033986_1093_2106 334
531 3300046524 Ga0495648_0146539 Ga0495648_0146539_68_1081 334
532 3300046529 Ga0495652_0022281 Ga0495652_0022281_641_1654 334
533 3300046529 Ga0495652_0123221 Ga0495652_0123221_400_1416 334
534 3300046530 Ga0495654_0035163 Ga0495654_0035163_1458_2471 334
535 3300046533 Ga0495640_0012649 Ga0495640_0012649_3988_5001 334
536 3300046533 Ga0495640_0027608 Ga0495640_0027608_376_1389 334
537 3300046535 Ga0495586_0090821 Ga0495586_0090821_323_1336 334
538 3300046536 Ga0495587_0059215 Ga0495587_0059215_1104_2117 334
539 3300046538 Ga0495609_0011318 Ga0495609_0011318_1628_2641 334
540 3300046542 Ga0495597_0027365 Ga0495597_0027365_675_1688 334
541 3300046557 Ga0495622_0138073 Ga0495622_0138073_12_1025 334
542 3300046559 Ga0495667_0004790 Ga0495667_0004790_5048_6064 334
543 3300046559 Ga0495667_0024556 Ga0495667_0024556_1448_2464 334
544 3300046616 Ga0495668_0008327 Ga0495668_0008327_1474_2487 334
545 3300046616 Ga0495668_0017593 Ga0495668_0017593_1228_2241 334
546 3300046642 Ga0495634_0014110 Ga0495634_0014110_4098_5111 334
547 3300046642 Ga0495634_0054403 Ga0495634_0054403_443_1459 334
548 3300046642 Ga0495634_0063506 Ga0495634_0063506_1294_2307 334
549 3300046642 Ga0495634_0067673 Ga0495634_0067673_663_1679 334
550 3300046660 Ga0495625_0009696 Ga0495625_0009696_2256_3269 334
551 3300046663 Ga0495635_0008752 Ga0495635_0008752_2808_3824 334
552 3300046663 Ga0495635_0029051 Ga0495635_0029051_2617_3633 334
553 3300046663 Ga0495635_0057653 Ga0495635_0057653_1131_2147 334
554 3300046663 Ga0495635_0113599 Ga0495635_0113599_586_1602 334
555 3300046674 Ga0495588_0009383 Ga0495588_0009383_2124_3137 334
556 3300046674 Ga0495588_0019330 Ga0495588_0019330_1487_2500 334
557 3300046675 Ga0495657_0003849 Ga0495657_0003849_5549_6562 334
558 3300046675 Ga0495657_0010243 Ga0495657_0010243_2698_3714 334
559 3300046675 Ga0495657_0011590 Ga0495657_0011590_4127_5143 334
560 3300046675 Ga0495657_0015439 Ga0495657_0015439_4139_5152 334
561 3300046679 Ga0495623_0016860 Ga0495623_0016860_980_1996 334
562 3300046680 Ga0495646_0083147 Ga0495646_0083147_493_1509 334
563 3300046683 Ga0495658_0016589 Ga0495658_0016589_2234_3250 334
564 3300046683 Ga0495658_0051655 Ga0495658_0051655_25_1038 334
565 3300046689 Ga0495613_0014800 Ga0495613_0014800_2372_3385 334
566 3300046689 Ga0495613_0047411 Ga0495613_0047411_2076_3089 334
567 3300046689 Ga0495613_0075107 Ga0495613_0075107_1040_2053 334
568 3300046689 Ga0495613_0081336 Ga0495613_0081336_917_1930 334
569 3300046690 Ga0495624_0042611 Ga0495624_0042611_36_1049 334
570 3300046690 Ga0495624_0084447 Ga0495624_0084447_537_1550 334
571 3300046694 Ga0495649_0027030 Ga0495649_0027030_1312_2325 334
572 3300046694 Ga0495649_0102475 Ga0495649_0102475_220_1233 334
573 3300046794 Ga0495589_0008907 Ga0495589_0008907_1405_2418 334
574 3300046794 Ga0495589_0091719 Ga0495589_0091719_33_1046 334
575 3300046809 Ga0495600_0000124 Ga0495600_0000124_35667_36680 334
576 3300046809 Ga0495600_0006029 Ga0495600_0006029_3358_4374 334
577 3300046809 Ga0495600_0042804 Ga0495600_0042804_1376_2392 334
578 3300046809 Ga0495600_0094695 Ga0495600_0094695_435_1448 334
579 3300047315 Ga0495581_0026066 Ga0495581_0026066_968_1984 334
580 3300047315 Ga0495581_0058630 Ga0495581_0058630_1190_2197 334
581 3300047317 Ga0495604_0000635 Ga0495604_0000635_11084_12097 334
582 3300047317 Ga0495604_0021140 Ga0495604_0021140_253_1266 334
583 3300047317 Ga0495604_0040941 Ga0495604_0040941_471_1490 334
584 3300047317 Ga0495604_0124068 Ga0495604_0124068_757_1770 334
585 3300047318 Ga0495636_0026436 Ga0495636_0026436_969_1982 334
586 3300047318 Ga0495636_0029658 Ga0495636_0029658_1004_2017 334
587 3300047319 Ga0495674_0008937 Ga0495674_0008937_2348_3364 334
588 3300047319 Ga0495674_0031385 Ga0495674_0031385_988_2004 334
589 3300047319 Ga0495674_0177865 Ga0495674_0177865_600_1613 334
590 3300047319 Ga0495674_0182603 Ga0495674_0182603_431_1450 334
591 3300047320 Ga0495672_0071716 Ga0495672_0071716_797_1810 334
592 3300047321 Ga0495676_0002926 Ga0495676_0002926_9984_10997 334
593 3300047321 Ga0495676_0016062 Ga0495676_0016062_5326_6342 334
594 3300047321 Ga0495676_0065186 Ga0495676_0065186_1499_2512 334
595 3300047322 Ga0495680_0025736 Ga0495680_0025736_2532_3548 334
596 3300047322 Ga0495680_0066907 Ga0495680_0066907_324_1340 334
597 3300047443 Ga0495687_007958 Ga0495687_007958_889_1902 334
598 3300047444 Ga0495675_0018011 Ga0495675_0018011_2866_3882 334
599 3300047444 Ga0495675_0096493 Ga0495675_0096493_91_1104 334
600 3300047447 Ga0495685_025216 Ga0495685_025216_541_1554 334
601 3300047447 Ga0495685_040160 Ga0495685_040160_367_1380 334
602 3300047447 Ga0495685_044066 Ga0495685_044066_475_1488 334
603 3300047470 Ga0495681_0002430 Ga0495681_0002430_6872_7885 334
604 3300047470 Ga0495681_0043645 Ga0495681_0043645_894_1907 334
605 3300047471 Ga0495684_0014339 Ga0495684_0014339_763_1779 334
606 3300047471 Ga0495684_0040812 Ga0495684_0040812_285_1301 334
607 3300047471 Ga0495684_0106139 Ga0495684_0106139_1037_2053 334
608 3300047472 Ga0495686_0039322 Ga0495686_0039322_1721_2734 334
609 3300047673 Ga0495593_0001065 Ga0495593_0001065_13825_14838 334
610 3300048088 Ga0495602_0022032 Ga0495602_0022032_1901_2917 334
611 3300048088 Ga0495602_0043234 Ga0495602_0043234_2436_3449 334
612 3300048089 Ga0495614_0002481 Ga0495614_0002481_2543_3556 334
613 3300048089 Ga0495614_0002629 Ga0495614_0002629_5172_6188 334
614 3300048089 Ga0495614_0098504 Ga0495614_0098504_161_1174 334
615 3300048903 Ga0496100_0092905 Ga0496100_0092905_632_1648 334
616 3300048904 Ga0496101_0154968 Ga0496101_0154968_323_1339 334
617 3300048905 Ga0496102_0072382 Ga0496102_0072382_1327_2343 334
618 3300048907 Ga0496104_0134978 Ga0496104_0134978_800_1816 334
619 3300048910 Ga0496107_0010045 Ga0496107_0010045_1296_2312 334
620 3300048911 Ga0496108_0166033 Ga0496108_0166033_650_1663 334
621 3300048912 Ga0496109_0019583 Ga0496109_0019583_3194_4219 334
622 3300048912 Ga0496109_0023085 Ga0496109_0023085_4368_5384 334
623 3300048913 Ga0496110_0030416 Ga0496110_0030416_2182_3207 334
624 3300048914 Ga0496111_0102376 Ga0496111_0102376_287_1312 334
625 3300048918 Ga0496115_0116202 Ga0496115_0116202_389_1405 334
626 3300049459 Ga0495678_048034 Ga0495678_048034_63_1076 334
627 3300049570 Ga0501033_0002616 Ga0501033_0002616_87_1100 334
628 3300049571 Ga0501034_0197263 Ga0501034_0197263_804_1817 334
629 3300049574 Ga0501038_0008017 Ga0501038_0008017_188_1201 334
630 3300049579 Ga0501043_0042936 Ga0501043_0042936_921_1934 334
631 3300049581 Ga0501047_0049314 Ga0501047_0049314_1363_2376 334
632 3300049586 Ga0501070_0198983 Ga0501070_0198983_316_1329 334
633 3300049823 Ga0501044_0054713 Ga0501044_0054713_1269_2282 334
634 3300049823 Ga0501044_0092412 Ga0501044_0092412_639_1652 334
635 3300050492 nmdc:mga0yw44_213472_c1 nmdc:mga0yw44_213472_c1_203_1216 334
636 3300050494 nmdc:mga06z11_2103_c1 nmdc:mga06z11_2103_c1_1434_2447 334
637 3300050507 nmdc:mga05p37_313554_c1 nmdc:mga05p37_313554_c1_11_1027 334
638 3300050507 nmdc:mga05p37_42108_c1 nmdc:mga05p37_42108_c1_3660_4670 334
639 3300050509 nmdc:mga0qj67_15701_c1 nmdc:mga0qj67_15701_c1_1557_2582 334
640 3300050510 nmdc:mga06r32_118242_c1 nmdc:mga06r32_118242_c1_1374_2399 334
641 3300050511 nmdc:mga08y16_129001_c1 nmdc:mga08y16_129001_c1_878_1894 334
642 3300050512 nmdc:mga0n895_103058_c1 nmdc:mga0n895_103058_c1_404_1420 334
643 3300050512 nmdc:mga0n895_334805_c1 nmdc:mga0n895_334805_c1_288_1304 334
644 3300050513 nmdc:mga0rr50_19286_c1 nmdc:mga0rr50_19286_c1_3136_4152 334
645 3300050514 nmdc:mga08x19_12598_c1 nmdc:mga08x19_12598_c1_2526_3542 334
646 3300050515 nmdc:mga0a205_5529_c1 nmdc:mga0a205_5529_c1_4047_5063 334
647 3300050515 nmdc:mga0a205_59766_c1 nmdc:mga0a205_59766_c1_502_1518 334
648 3300053077 Ga0495601_0034403 Ga0495601_0034403_426_1442 334
649 3300053077 Ga0495601_0155307 Ga0495601_0155307_361_1377 334
650 3300053084 Ga0495595_0009801 Ga0495595_0009801_2867_3883 334
651 3300053088 Ga0500644_0004472 Ga0500644_0004472_167_1180 334
652 3300053095 Ga0500640_046359 Ga0500640_046359_774_1787 334
653 3300061719 Ga0466962_0008057 Ga0466962_0008057_2612_3643 334
654 iso_pu_bacteria 2786546132 2786667807 334
655 iso_pu_bacteria 2873151551 2873158096 334
656 iso_pu_bacteria 2954673503 2954673947 334
657 iso_pu_bacteria 2954682443 2954690044 334
658 3300005327 Ga0070658_10006893 Ga0070658_1000689310 335
659 3300005329 Ga0070683_100236990 Ga0070683_1002369902 335
660 3300005338 Ga0068868_100020069 Ga0068868_1000200696 335
661 3300005339 Ga0070660_100173781 Ga0070660_1001737811 335
662 3300005341 Ga0070691_10041579 Ga0070691_100415792 335
663 3300005344 Ga0070661_100149372 Ga0070661_1001493723 335
664 3300005440 Ga0070705_100174382 Ga0070705_1001743822 335
665 3300005441 Ga0070700_100161241 Ga0070700_1001612411 335
666 3300005530 Ga0070679_100068481 Ga0070679_1000684816 335
667 3300005535 Ga0070684_100038507 Ga0070684_1000385072 335
668 3300005535 Ga0070684_100045374 Ga0070684_1000453743 335
669 3300005546 Ga0070696_100243923 Ga0070696_1002439232 335
670 3300005548 Ga0070665_100081229 Ga0070665_1000812292 335
671 3300005548 Ga0070665_100212801 Ga0070665_1002128012 335
672 3300005563 Ga0068855_100093327 Ga0068855_1000933274 335
673 3300005564 Ga0070664_100294746 Ga0070664_1002947462 335
674 3300005577 Ga0068857_100193134 Ga0068857_1001931342 335
675 3300005614 Ga0068856_100068931 Ga0068856_1000689314 335
676 3300005616 Ga0068852_100072771 Ga0068852_1000727713 335
677 3300005617 Ga0068859_100038330 Ga0068859_1000383302 335
678 3300005841 Ga0068863_100208021 Ga0068863_1002080212 335
679 3300005842 Ga0068858_100020418 Ga0068858_1000204182 335
680 3300005842 Ga0068858_100237970 Ga0068858_1002379702 335
681 3300006028 Ga0070717_10271008 Ga0070717_102710082 335
682 3300006173 Ga0070716_100035985 Ga0070716_1000359853 335
683 3300006358 Ga0068871_100446539 Ga0068871_1004465391 335
684 3300006847 Ga0075431_100322628 Ga0075431_1003226282 335
685 3300006871 Ga0075434_100129791 Ga0075434_1001297913 335
686 3300006931 Ga0097620_100038330 Ga0097620_1000383302 335
687 3300009093 Ga0105240_10130379 Ga0105240_101303791 335
688 3300009098 Ga0105245_10032946 Ga0105245_100329465 335
689 3300009147 Ga0114129_10069176 Ga0114129_100691762 335
690 3300009147 Ga0114129_10867256 Ga0114129_108672562 335
691 3300009174 Ga0105241_10052977 Ga0105241_100529771 335
692 3300009545 Ga0105237_10030620 Ga0105237_100306202 335
693 3300009551 Ga0105238_10078537 Ga0105238_100785371 335
694 3300010375 Ga0105239_10051480 Ga0105239_100514801 335
695 3300011119 Ga0105246_10228961 Ga0105246_102289611 335
696 3300013105 Ga0157369_10057279 Ga0157369_100572795 335
697 3300013105 Ga0157369_10095454 Ga0157369_100954543 335
698 3300013296 Ga0157374_10264870 Ga0157374_102648701 335
699 3300013306 Ga0163162_10133191 Ga0163162_101331912 335
700 3300013307 Ga0157372_10059793 Ga0157372_100597933 335
701 3300013308 Ga0157375_10077426 Ga0157375_100774263 335
702 3300014968 Ga0157379_10073580 Ga0157379_100735802 335
703 3300020078 Ga0206352_10692001 Ga0206352_106920011 335
704 3300020082 Ga0206353_11401531 Ga0206353_114015312 335
705 3300022467 Ga0224712_10027516 Ga0224712_100275161 335
706 3300025904 Ga0207647_10040416 Ga0207647_100404161 335
707 3300025909 Ga0207705_10028490 Ga0207705_100284905 335
708 3300025911 Ga0207654_10031288 Ga0207654_100312881 335
709 3300025912 Ga0207707_10073527 Ga0207707_100735272 335
710 3300025913 Ga0207695_10025447 Ga0207695_100254473 335
711 3300025914 Ga0207671_10000197 Ga0207671_1000019760 335
712 3300025919 Ga0207657_10285260 Ga0207657_102852601 335
713 3300025920 Ga0207649_10099387 Ga0207649_100993871 335
714 3300025924 Ga0207694_10060725 Ga0207694_100607251 335
715 3300025932 Ga0207690_10090061 Ga0207690_100900612 335
716 3300025939 Ga0207665_10061603 Ga0207665_100616033 335
717 3300025981 Ga0207640_10021202 Ga0207640_100212023 335
718 3300026023 Ga0207677_10309929 Ga0207677_103099292 335
719 3300026035 Ga0207703_10102134 Ga0207703_101021342 335
720 3300026035 Ga0207703_10320547 Ga0207703_103205472 335
721 3300026041 Ga0207639_10349244 Ga0207639_103492442 335
722 3300026075 Ga0207708_10188986 Ga0207708_101889861 335
723 3300026078 Ga0207702_10076975 Ga0207702_100769753 335
724 3300026095 Ga0207676_10193894 Ga0207676_101938942 335
725 3300026121 Ga0207683_10067823 Ga0207683_100678232 335
726 3300028379 Ga0268266_10148383 Ga0268266_101483833 335
727 3300028381 Ga0268264_10274692 Ga0268264_102746921 335
728 3300031852 Ga0307410_10196612 Ga0307410_101966122 335
729 3300035083 Ga0373926_0102196 Ga0373926_0102196_28_1050 335
730 3300035086 Ga0373934_0048431 Ga0373934_0048431_579_1601 335
731 3300035118 Ga0373954_0036240 Ga0373954_0036240_465_1487 335
732 3300035119 Ga0373956_0018086 Ga0373956_0018086_884_1906 335
733 3300035170 Ga0373943_0111130 Ga0373943_0111130_229_1251 335
734 3300035171 Ga0373946_0134219 Ga0373946_0134219_29_1051 335
735 3300035172 Ga0373955_0068852 Ga0373955_0068852_123_1145 335
736 3300035695 Ga0373927_0195461 Ga0373927_0195461_277_1299 335
737 3300037418 Ga0395900_0042006 Ga0395900_0042006_2754_3782 335
738 3300044693 Ga0466961_0036247 Ga0466961_0036247_1685_2767 335
739 3300044694 Ga0466963_0033483 Ga0466963_0033483_963_1973 335
740 3300044694 Ga0466963_0087142 Ga0466963_0087142_534_1553 335
741 3300044706 Ga0466964_0097103 Ga0466964_0097103_51_1061 335
742 3300045976 Ga0466967_0247896 Ga0466967_0247896_425_1435 335
743 3300046455 Ga0495603_0000412 Ga0495603_0000412_8381_9397 335
744 3300046455 Ga0495603_0004797 Ga0495603_0004797_1344_2360 335
745 3300046455 Ga0495603_0006225 Ga0495603_0006225_5783_6814 335
746 3300046455 Ga0495603_0070862 Ga0495603_0070862_76_1095 335
747 3300046459 Ga0495629_0000886 Ga0495629_0000886_4139_5155 335
748 3300046459 Ga0495629_0004730 Ga0495629_0004730_6285_7301 335
749 3300046462 Ga0495651_0005277 Ga0495651_0005277_3455_4477 335
750 3300046462 Ga0495651_0015508 Ga0495651_0015508_629_1648 335
751 3300046475 Ga0495639_0135211 Ga0495639_0135211_138_1160 335
752 3300046492 Ga0495585_0173773 Ga0495585_0173773_38_1069 335
753 3300046499 Ga0495594_0002999 Ga0495594_0002999_7076_8092 335
754 3300046501 Ga0495607_0078925 Ga0495607_0078925_379_1410 335
755 3300046516 Ga0495628_0064055 Ga0495628_0064055_678_1697 335
756 3300046529 Ga0495652_0001696 Ga0495652_0001696_15467_16486 335
757 3300046536 Ga0495587_0022426 Ga0495587_0022426_2705_3727 335
758 3300046642 Ga0495634_0085216 Ga0495634_0085216_851_1873 335
759 3300046665 Ga0495661_0058379 Ga0495661_0058379_635_1666 335
760 3300046674 Ga0495588_0001052 Ga0495588_0001052_3117_4133 335
761 3300046675 Ga0495657_0111713 Ga0495657_0111713_211_1233 335
762 3300046678 Ga0495599_0001711 Ga0495599_0001711_5293_6315 335
763 3300046679 Ga0495623_0043723 Ga0495623_0043723_131_1153 335
764 3300046689 Ga0495613_0004216 Ga0495613_0004216_5740_6756 335
765 3300046794 Ga0495589_0003791 Ga0495589_0003791_476_1507 335
766 3300046794 Ga0495589_0077824 Ga0495589_0077824_76_1107 335
767 3300046809 Ga0495600_0070644 Ga0495600_0070644_342_1364 335
768 3300046809 Ga0495600_0121418 Ga0495600_0121418_152_1171 335
769 3300047315 Ga0495581_0057624 Ga0495581_0057624_1174_2196 335
770 3300047317 Ga0495604_0124827 Ga0495604_0124827_743_1762 335
771 3300047321 Ga0495676_0003257 Ga0495676_0003257_9599_10615 335
772 3300047321 Ga0495676_0005841 Ga0495676_0005841_6949_7965 335
773 3300047444 Ga0495675_0034143 Ga0495675_0034143_1677_2699 335
774 3300047447 Ga0495685_020320 Ga0495685_020320_524_1555 335
775 3300048089 Ga0495614_0001443 Ga0495614_0001443_3514_4530 335
776 3300048905 Ga0496102_0324159 Ga0496102_0324159_302_1324 335
777 3300048908 Ga0496105_0034393 Ga0496105_0034393_1363_2385 335
778 3300048914 Ga0496111_0040657 Ga0496111_0040657_385_1407 335
779 3300048915 Ga0496112_0316828 Ga0496112_0316828_466_1488 335
780 3300048916 Ga0496113_0049159 Ga0496113_0049159_1502_2524 335
781 3300048917 Ga0496114_0172821 Ga0496114_0172821_488_1510 335
782 3300048918 Ga0496115_0042719 Ga0496115_0042719_2019_3041 335
783 3300050507 nmdc:mga05p37_353928_c1 nmdc:mga05p37_353928_c1_483_1511 335
784 3300050507 nmdc:mga05p37_544681_c1 nmdc:mga05p37_544681_c1_280_1293 335
785 3300050512 nmdc:mga0n895_232198_c1 nmdc:mga0n895_232198_c1_698_1720 335
786 3300053077 Ga0495601_0076024 Ga0495601_0076024_912_1931 335
787 3300053078 Ga0495612_0030014 Ga0495612_0030014_850_1872 335
788 3300053085 Ga0495619_0066283 Ga0495619_0066283_711_1733 335
789 iso_pu_bacteria 2784746768 2785366749 335
790 3300005329 Ga0070683_100001796 Ga0070683_1000017962 336
791 3300005337 Ga0070682_100044017 Ga0070682_1000440172 336
792 3300005339 Ga0070660_100084688 Ga0070660_1000846883 336
793 3300005354 Ga0070675_100105217 Ga0070675_1001052172 336
794 3300005366 Ga0070659_100012412 Ga0070659_1000124123 336
795 3300005466 Ga0070685_10182773 Ga0070685_101827731 336
796 3300005530 Ga0070679_100205666 Ga0070679_1002056662 336
797 3300005535 Ga0070684_100002313 Ga0070684_1000023138 336
798 3300005539 Ga0068853_100117379 Ga0068853_1001173792 336
799 3300005547 Ga0070693_100059186 Ga0070693_1000591862 336
800 3300005564 Ga0070664_100040523 Ga0070664_1000405232 336
801 3300005577 Ga0068857_100008605 Ga0068857_1000086054 336
802 3300005614 Ga0068856_100102493 Ga0068856_1001024932 336
803 3300005615 Ga0070702_100169701 Ga0070702_1001697012 336
804 3300005616 Ga0068852_100030636 Ga0068852_1000306364 336
805 3300005841 Ga0068863_100088483 Ga0068863_1000884833 336
806 3300006881 Ga0068865_100023351 Ga0068865_1000233512 336
807 3300009098 Ga0105245_10013974 Ga0105245_100139746 336
808 3300009553 Ga0105249_10011140 Ga0105249_100111406 336
809 3300010375 Ga0105239_10002486 Ga0105239_1000248612 336
810 3300011119 Ga0105246_10000375 Ga0105246_1000037512 336
811 3300013104 Ga0157370_10093073 Ga0157370_100930733 336
812 3300013105 Ga0157369_10030857 Ga0157369_100308572 336
813 3300013296 Ga0157374_10529327 Ga0157374_105293271 336
814 3300013306 Ga0163162_10012538 Ga0163162_100125387 336
815 3300013307 Ga0157372_10014256 Ga0157372_100142563 336
816 3300013308 Ga0157375_10010284 Ga0157375_100102843 336
817 3300021384 Ga0213876_10032554 Ga0213876_100325542 336
818 3300025901 Ga0207688_10071225 Ga0207688_100712252 336
819 3300025909 Ga0207705_10028636 Ga0207705_100286362 336
820 3300025918 Ga0207662_10058702 Ga0207662_100587023 336
821 3300025919 Ga0207657_10057965 Ga0207657_100579653 336
822 3300025921 Ga0207652_10203944 Ga0207652_102039442 336
823 3300025927 Ga0207687_10043182 Ga0207687_100431822 336
824 3300025932 Ga0207690_10013592 Ga0207690_100135925 336
825 3300025938 Ga0207704_10033132 Ga0207704_100331323 336
826 3300025944 Ga0207661_10001526 Ga0207661_1000152612 336
827 3300025945 Ga0207679_10175210 Ga0207679_101752102 336
828 3300026035 Ga0207703_10048104 Ga0207703_100481042 336
829 3300026067 Ga0207678_10273427 Ga0207678_102734272 336
830 3300026078 Ga0207702_10087925 Ga0207702_100879252 336
831 3300026116 Ga0207674_10007103 Ga0207674_100071037 336
832 3300026142 Ga0207698_10044778 Ga0207698_100447782 336
833 3300035118 Ga0373954_0003115 Ga0373954_0003115_4549_5577 336
834 3300035119 Ga0373956_0009927 Ga0373956_0009927_2530_3558 336
835 3300035120 Ga0373957_0000760 Ga0373957_0000760_6939_7967 336
836 3300035172 Ga0373955_0000006 Ga0373955_0000006_79793_80821 336
837 3300035410 Ga0373924_0001349 Ga0373924_0001349_5389_6417 336
838 3300035724 Ga0373933_0093070 Ga0373933_0093070_169_1191 336
839 3300036401 Ga0373937_0000039 Ga0373937_0000039_5340_6368 336
840 3300037068 Ga0373925_0000789 Ga0373925_0000789_18609_19631 336
841 3300039453 Ga0436362_0651943 Ga0436362_0651943_121_1140 336
842 3300044656 Ga0466969_0073055 Ga0466969_0073055_141_1166 336
843 3300044684 Ga0466966_0035826 Ga0466966_0035826_480_1505 336
844 3300044694 Ga0466963_0051587 Ga0466963_0051587_748_1767 336
845 3300044719 Ga0466971_0086463 Ga0466971_0086463_297_1322 336
846 3300045976 Ga0466967_0019461 Ga0466967_0019461_2171_3193 336
847 3300045976 Ga0466967_0037445 Ga0466967_0037445_1991_3016 336
848 3300045976 Ga0466967_0112800 Ga0466967_0112800_303_1322 336
849 3300046454 Ga0495592_0020327 Ga0495592_0020327_2052_3074 336
850 3300046462 Ga0495651_0000013 Ga0495651_0000013_103301_104329 336
851 3300046462 Ga0495651_0006641 Ga0495651_0006641_711_1733 336
852 3300046463 Ga0495653_0005478 Ga0495653_0005478_3653_4675 336
853 3300046463 Ga0495653_0006741 Ga0495653_0006741_508_1536 336
854 3300046511 Ga0495608_0000114 Ga0495608_0000114_36679_37707 336
855 3300046511 Ga0495608_0002000 Ga0495608_0002000_12662_13684 336
856 3300046516 Ga0495628_0046875 Ga0495628_0046875_714_1736 336
857 3300046529 Ga0495652_0000145 Ga0495652_0000145_20096_21124 336
858 3300046529 Ga0495652_0002970 Ga0495652_0002970_8428_9450 336
859 3300046533 Ga0495640_0031606 Ga0495640_0031606_1885_2907 336
860 3300046536 Ga0495587_0000063 Ga0495587_0000063_70301_71329 336
861 3300046536 Ga0495587_0003797 Ga0495587_0003797_3557_4579 336
862 3300046559 Ga0495667_0000049 Ga0495667_0000049_20072_21100 336
863 3300046559 Ga0495667_0001442 Ga0495667_0001442_8011_9033 336
864 3300046675 Ga0495657_0000513 Ga0495657_0000513_14895_15923 336
865 3300046675 Ga0495657_0006358 Ga0495657_0006358_2682_3704 336
866 3300046678 Ga0495599_0000077 Ga0495599_0000077_55797_56825 336
867 3300046678 Ga0495599_0008164 Ga0495599_0008164_1871_2893 336
868 3300046689 Ga0495613_0053228 Ga0495613_0053228_1181_2209 336
869 3300046809 Ga0495600_0004312 Ga0495600_0004312_6161_7183 336
870 3300047317 Ga0495604_0000032 Ga0495604_0000032_103250_104278 336
871 3300047317 Ga0495604_0005069 Ga0495604_0005069_8009_9031 336
872 3300047319 Ga0495674_0007591 Ga0495674_0007591_3665_4687 336
873 3300047322 Ga0495680_0000058 Ga0495680_0000058_70663_71691 336
874 3300047322 Ga0495680_0032888 Ga0495680_0032888_2524_3546 336
875 3300047444 Ga0495675_0000679 Ga0495675_0000679_10116_11144 336
876 3300047444 Ga0495675_0003848 Ga0495675_0003848_5346_6368 336
877 3300047471 Ga0495684_0010142 Ga0495684_0010142_2094_3116 336
878 3300048088 Ga0495602_0000092 Ga0495602_0000092_33605_34633 336
879 3300048088 Ga0495602_0014113 Ga0495602_0014113_892_1914 336
880 3300048905 Ga0496102_0021775 Ga0496102_0021775_3951_4964 336
881 3300048906 Ga0496103_0074772 Ga0496103_0074772_1033_2046 336
882 3300048911 Ga0496108_0010090 Ga0496108_0010090_991_2004 336
883 3300048912 Ga0496109_0059631 Ga0496109_0059631_2057_3070 336
884 3300048913 Ga0496110_0014679 Ga0496110_0014679_650_1663 336
885 3300048914 Ga0496111_0006908 Ga0496111_0006908_1610_2623 336
886 3300048916 Ga0496113_0050330 Ga0496113_0050330_1062_2075 336
887 3300048916 Ga0496113_0256454 Ga0496113_0256454_300_1322 336
888 3300049822 Ga0501035_0215949 Ga0501035_0215949_472_1494 336
889 3300053077 Ga0495601_0001343 Ga0495601_0001343_798_1826 336
890 3300053077 Ga0495601_0010347 Ga0495601_0010347_3396_4442 336
891 3300053078 Ga0495612_0005116 Ga0495612_0005116_3122_4168 336
892 3300053084 Ga0495595_0022058 Ga0495595_0022058_1588_2616 336
893 3300053084 Ga0495595_0071417 Ga0495595_0071417_451_1473 336
894 3300053085 Ga0495619_0105032 Ga0495619_0105032_369_1415 336
895 3300053085 Ga0495619_0320213 Ga0495619_0320213_27_1049 336
896 iso_pu_bacteria 2811994882 2812372489 336
897 iso_pu_bacteria 2811994882 2812373356 336
898 3300003373 JGI25407J50210_10035106 JGI25407J50210_100351061 337
899 3300005435 Ga0070714_100053955 Ga0070714_1000539554 337
900 3300005436 Ga0070713_100016652 Ga0070713_1000166524 337
901 3300005445 Ga0070708_100000572 Ga0070708_1000005726 337
902 3300005518 Ga0070699_100365505 Ga0070699_1003655052 337
903 3300005937 Ga0081455_10112013 Ga0081455_101120132 337
904 3300005981 Ga0081538_10002686 Ga0081538_1000268611 337
905 3300005981 Ga0081538_10002769 Ga0081538_100027699 337
906 3300005981 Ga0081538_10008960 Ga0081538_100089605 337
907 3300006058 Ga0075432_10001729 Ga0075432_100017292 337
908 3300006846 Ga0075430_100006129 Ga0075430_1000061296 337
909 3300006871 Ga0075434_100138927 Ga0075434_1001389272 337
910 3300009094 Ga0111539_10055365 Ga0111539_100553653 337
911 3300009553 Ga0105249_10002630 Ga0105249_1000263010 337
912 3300013306 Ga0163162_10075259 Ga0163162_100752593 337
913 3300017792 Ga0163161_10053784 Ga0163161_100537842 337
914 3300025929 Ga0207664_10024351 Ga0207664_100243512 337
915 3300025933 Ga0207706_10004215 Ga0207706_100042153 337
916 3300025961 Ga0207712_10065078 Ga0207712_100650782 337
917 3300025972 Ga0207668_10116748 Ga0207668_101167482 337
918 3300026118 Ga0207675_100002050 Ga0207675_10000205015 337
919 3300027907 Ga0207428_10022977 Ga0207428_100229775 337
920 3300031548 Ga0307408_100250961 Ga0307408_1002509612 337
921 3300031731 Ga0307405_10048727 Ga0307405_100487272 337
922 3300031731 Ga0307405_10054300 Ga0307405_100543002 337
923 3300031731 Ga0307405_10055207 Ga0307405_100552073 337
924 3300031731 Ga0307405_10082874 Ga0307405_100828742 337
925 3300031824 Ga0307413_10020376 Ga0307413_100203763 337
926 3300031852 Ga0307410_10009806 Ga0307410_100098062 337
927 3300031901 Ga0307406_10115818 Ga0307406_101158182 337
928 3300031903 Ga0307407_10018666 Ga0307407_100186662 337
929 3300032002 Ga0307416_100005485 Ga0307416_1000054853 337
930 3300032002 Ga0307416_100025764 Ga0307416_1000257644 337
931 3300032004 Ga0307414_10033856 Ga0307414_100338562 337
932 3300032004 Ga0307414_10069025 Ga0307414_100690252 337
933 3300032005 Ga0307411_10097769 Ga0307411_100977692 337
934 3300032126 Ga0307415_100008431 Ga0307415_1000084312 337
935 3300037418 Ga0395900_0021811 Ga0395900_0021811_3885_4916 337
936 3300037466 Ga0395898_0034736 Ga0395898_0034736_2432_3463 337
937 3300038443 Ga0395901_0019313 Ga0395901_0019313_2386_3417 337
938 3300038443 Ga0395901_0092863 Ga0395901_0092863_1112_2125 337
939 3300042008 Ga0439450_000186 Ga0439450_000186_5678_6691 337
940 3300042008 Ga0439450_012499 Ga0439450_012499_182_1195 337
941 3300042008 Ga0439450_036932 Ga0439450_036932_86_1099 337
942 3300042009 Ga0439451_009603 Ga0439451_009603_723_1736 337
943 3300042011 Ga0439454_003425 Ga0439454_003425_240_1253 337
944 3300042016 Ga0439463_002090 Ga0439463_002090_133_1146 337
945 3300042016 Ga0439463_006978 Ga0439463_006978_37_1050 337
946 3300042016 Ga0439463_013041 Ga0439463_013041_357_1370 337
947 3300042117 Ga0450913_002786 Ga0450913_002786_57_1070 337
948 3300042126 Ga0450888_001316 Ga0450888_001316_928_1941 337
949 3300042139 Ga0450904_002193 Ga0450904_002193_145_1158 337
950 3300042439 Ga0439464_0005595 Ga0439464_0005595_150_1163 337
951 3300042439 Ga0439464_0007007 Ga0439464_0007007_1846_2859 337
952 3300042993 Ga0439440_0000237 Ga0439440_0000237_6336_7349 337
953 3300046525 Ga0495663_0038475 Ga0495663_0038475_284_1297 337
954 3300046615 Ga0495656_0000626 Ga0495656_0000626_749_1762 337
955 3300046691 Ga0495670_0026031 Ga0495670_0026031_1581_2594 337
956 3300048905 Ga0496102_0204762 Ga0496102_0204762_581_1612 337
957 3300048924 Ga0496121_0114469 Ga0496121_0114469_667_1698 337
958 3300049568 Ga0501031_0001656 Ga0501031_0001656_10193_11206 337
959 3300049569 Ga0501032_0105058 Ga0501032_0105058_498_1511 337
960 3300049572 Ga0501036_0000024 Ga0501036_0000024_78026_79039 337
961 3300049573 Ga0501037_0017673 Ga0501037_0017673_3697_4710 337
962 3300049574 Ga0501038_0012747 Ga0501038_0012747_3052_4065 337
963 3300049575 Ga0501039_0012453 Ga0501039_0012453_4736_5749 337
964 3300049576 Ga0501040_0000144 Ga0501040_0000144_24332_25345 337
965 3300049577 Ga0501041_0000359 Ga0501041_0000359_8001_9014 337
966 3300049578 Ga0501042_0000388 Ga0501042_0000388_5223_6236 337
967 3300049580 Ga0501046_0000495 Ga0501046_0000495_7359_8372 337
968 3300049582 Ga0501048_0000192 Ga0501048_0000192_30975_31988 337
969 3300049586 Ga0501070_0036609 Ga0501070_0036609_2814_3827 337
970 3300049587 Ga0501071_0003188 Ga0501071_0003188_5694_6707 337
971 3300049588 Ga0501072_0000920 Ga0501072_0000920_7015_8028 337
972 3300049589 Ga0501073_0113897 Ga0501073_0113897_844_1857 337
973 3300049590 Ga0501074_0035653 Ga0501074_0035653_401_1414 337
974 3300049591 Ga0501075_0000132 Ga0501075_0000132_5202_6215 337
975 3300049592 Ga0501076_0000281 Ga0501076_0000281_7334_8347 337
976 3300049593 Ga0501077_0000332 Ga0501077_0000332_9246_10259 337
977 3300049741 Ga0501079_0020586 Ga0501079_0020586_1861_2874 337
978 3300049742 Ga0501080_0033312 Ga0501080_0033312_1737_2750 337
979 3300049743 Ga0501081_0010172 Ga0501081_0010172_4759_5772 337
980 3300049822 Ga0501035_0019738 Ga0501035_0019738_4692_5705 337
981 3300049824 Ga0501045_0000216 Ga0501045_0000216_4758_5771 337
982 3300050507 nmdc:mga05p37_110293_c1 nmdc:mga05p37_110293_c1_2239_3252 337
983 3300050507 nmdc:mga05p37_4546_c1 nmdc:mga05p37_4546_c1_641_1654 337
984 3300050508 nmdc:mga09592_102592_c1 nmdc:mga09592_102592_c1_1257_2270 337
985 3300050509 nmdc:mga0qj67_38148_c1 nmdc:mga0qj67_38148_c1_1554_2567 337
986 3300050510 nmdc:mga06r32_20455_c1 nmdc:mga06r32_20455_c1_3942_4955 337
987 3300050511 nmdc:mga08y16_27457_c1 nmdc:mga08y16_27457_c1_4751_5764 337
988 3300050515 nmdc:mga0a205_10334_c1 nmdc:mga0a205_10334_c1_6110_7123 337
989 3300050515 nmdc:mga0a205_1709_c1 nmdc:mga0a205_1709_c1_2240_3253 337
990 3300054114 Ga0501084_0001254 Ga0501084_0001254_9867_10880 337
991 3300060353 Ga0501082_0000366 Ga0501082_0000366_13478_14491 337
992 3300061734 Ga0530510_0000013 Ga0530510_0000013_31043_32056 337
993 3300003203 JGI25406J46586_10031578 JGI25406J46586_100315782 338
994 3300005983 Ga0081540_1020904 Ga0081540_10209043 338
995 3300005985 Ga0081539_10006034 Ga0081539_100060347 338
996 3300028380 Ga0268265_10168578 Ga0268265_101685781 338
997 3300031548 Ga0307408_100015369 Ga0307408_1000153694 338
998 3300031731 Ga0307405_10113982 Ga0307405_101139822 338
999 3300031852 Ga0307410_10031309 Ga0307410_100313092 338
1000 3300031901 Ga0307406_10029112 Ga0307406_100291122 338
1001 3300031903 Ga0307407_10003597 Ga0307407_100035973 338
1002 3300031995 Ga0307409_100001240 Ga0307409_10000124010 338
1003 3300032002 Ga0307416_100000885 Ga0307416_10000088512 338
1004 3300032002 Ga0307416_100546994 Ga0307416_1005469942 338
1005 3300032004 Ga0307414_10049041 Ga0307414_100490412 338
1006 3300032005 Ga0307411_10080483 Ga0307411_100804833 338
1007 3300032126 Ga0307415_100036653 Ga0307415_1000366534 338
1008 3300032126 Ga0307415_100043355 Ga0307415_1000433552 338
1009 3300049568 Ga0501031_0015250 Ga0501031_0015250_1184_2200 338
1010 3300049570 Ga0501033_0017648 Ga0501033_0017648_1810_2826 338
1011 3300049572 Ga0501036_0028132 Ga0501036_0028132_1153_2169 338
1012 3300049573 Ga0501037_0015902 Ga0501037_0015902_4196_5212 338
1013 3300049574 Ga0501038_0010473 Ga0501038_0010473_2532_3548 338
1014 3300049575 Ga0501039_0001591 Ga0501039_0001591_1164_2180 338
1015 3300049576 Ga0501040_0016439 Ga0501040_0016439_1288_2304 338
1016 3300049577 Ga0501041_0025301 Ga0501041_0025301_1184_2200 338
1017 3300049578 Ga0501042_0003232 Ga0501042_0003232_7866_8882 338
1018 3300049579 Ga0501043_0004254 Ga0501043_0004254_2563_3579 338
1019 3300049582 Ga0501048_0021176 Ga0501048_0021176_2561_3577 338
1020 3300049584 Ga0501068_0019718 Ga0501068_0019718_90_1106 338
1021 3300049588 Ga0501072_0032965 Ga0501072_0032965_2532_3548 338
1022 3300049590 Ga0501074_0001328 Ga0501074_0001328_1956_2972 338
1023 3300049592 Ga0501076_0023286 Ga0501076_0023286_1178_2194 338
1024 3300049593 Ga0501077_0003894 Ga0501077_0003894_1468_2484 338
1025 3300049741 Ga0501079_0015673 Ga0501079_0015673_1550_2566 338
1026 3300049743 Ga0501081_0013408 Ga0501081_0013408_1151_2167 338
1027 3300049822 Ga0501035_0082078 Ga0501035_0082078_886_1902 338
1028 3300049824 Ga0501045_0013278 Ga0501045_0013278_2600_3616 338
1029 3300054114 Ga0501084_0016371 Ga0501084_0016371_3551_4567 338
1030 3300060353 Ga0501082_0049464 Ga0501082_0049464_1184_2200 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

173

317

0.9

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

25

174

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ubu-assembly1.cif.gz_D 2.75 angstrom resolution crystal structure of acetamidase from yersinia enterocolitica. 0.9304 2 314
2ii1-assembly2.cif.gz_B crystal structure of acetamidase (10172637) from bacillus halodurans at 1.95 a resolution 0.9264 4 311
2f4l-assembly2.cif.gz_C crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.925 1 313
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9248 1 313
3tkk-assembly2.cif.gz_D crystal structure analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis 0.9234 1 312
ID Description Score Start End Superfamily
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.935 5 230 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9047 5 230 2.60.120.580
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.9031 236 313 3.10.28.20
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8823 236 313 3.10.28.20
af_Q5AJF2_20_284_2.60.120.580 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.8181 9 229 2.60.120.580
ID Description Score Start End GO Terms
AF-A0A6I6SE48-F1-model_v4 Acetamidase 0.9808 2 332 GO:0016811
AF-A0A6I3X6V0-F1-model_v4 Acetamidase 0.9778 2 331 GO:0016811
AF-E6S7Q4-F1-model_v4 Acetamidase/Formamidase 0.9777 1 332 GO:0016811
AF-A0A1Q9SBM4-F1-model_v4 Acetamidase 0.9775 2 336 GO:0016811
AF-A0A1D7W201-F1-model_v4 Acetamidase 0.9773 1 332 GO:0016811

Feature Viewer

pLDDT pTM Quality
94.31 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map