F488588
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 500 | 898 | 349 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237166|2514046283 |
| Length | 397 |
| Sequence | MRGVFRLANWPNGQVSPSDRAAIMSFSPLRAAPLRGFCLLPMRFDLERPLQSATAHRVAVLLINLGTPDAPTPRAVRRYLAQFLSDPRVVEIPAFVWQIILRLFILPFRGVASAKKYASVWMPEGSPLRVHTQKQVEGLRHLLHLNDYTVIVDYAMRYGTPDIPAMLNQLKLAGAERILLMPMYPQYSSSTTATAFDDAFAALKRMRNQPEIRTVRQYADHPAYIAALAAQVNHYWHTHGRPDFAAGDKLVLSFHGVPKRTLDLGDPYHDQCQQTASLLMHALGLTSVECRVTFQSRFGKAEWLQPYTAPTLKELGAAGVHRADVFCPGFTADCLETIEEIGMEVRDEFVHAGGKVFHAIPCLNAAPAWIAALGEIVAQHLQGWPVQAVAPQSASVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 11 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 12 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 13 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 14 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 15 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 16 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 17 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 18 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 19 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 20 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 21 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 22 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 23 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 24 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 25 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 26 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 27 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 28 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 29 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 30 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 31 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 32 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 33 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 34 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 35 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 36 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 37 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 38 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 39 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 40 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 41 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 42 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 43 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 44 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 45 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 46 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 47 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 48 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 49 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 50 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 51 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 52 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 53 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 54 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 55 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 56 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 57 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 58 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 59 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 60 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 61 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 62 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 63 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 64 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 65 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 66 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 67 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 68 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 69 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 70 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 71 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 72 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 73 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 74 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 75 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 76 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 77 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 78 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 79 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 80 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 81 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 82 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 83 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 84 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 85 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 86 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 87 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 88 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 89 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 90 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 91 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 92 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 93 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 94 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 95 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 96 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 97 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 98 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 99 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 100 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 101 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 102 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 103 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 104 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 105 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 106 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 107 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 108 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 109 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 110 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 111 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 112 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 113 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 114 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 115 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 116 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 117 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 118 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 119 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 120 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 121 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 122 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 123 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 124 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 125 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 126 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 127 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 128 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 129 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 130 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 131 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 132 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 133 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 134 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 135 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 136 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 137 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 138 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 139 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 140 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 141 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 142 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 143 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 144 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 145 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 146 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 147 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 148 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 149 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 150 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 151 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 152 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 156 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 164 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 166 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 168 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 169 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 170 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 171 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 172 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 173 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 174 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 175 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 176 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 177 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 178 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 179 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 181 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 201 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 203 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 204 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 205 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 211 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 269 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 270 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 271 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 272 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 273 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 274 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 277 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 283 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 284 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 285 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 292 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 293 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 300 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 301 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 302 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 303 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 306 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 307 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 308 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 309 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 310 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 311 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 312 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 313 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 314 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 315 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 316 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 317 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 318 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 319 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 320 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 321 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 322 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 323 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 324 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 325 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 326 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 327 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 328 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 329 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 332 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 333 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 334 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 427 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 428 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 437 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 438 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 439 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 440 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 441 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 442 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 443 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 444 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 445 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 446 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 449 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 450 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 460 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 461 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 462 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 463 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 464 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 467 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 468 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 470 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 471 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 473 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 475 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 478 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 481 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 484 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 485 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 486 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 487 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 488 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 489 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 490 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 491 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 492 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 493 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 494 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 495 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 496 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 497 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 498 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 499 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 500 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.69 |
| Metatranscriptomes | 0.58 |
| Isolates | 12.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.16 |
| Nodule | 2.24 |
| Rhizoplane | 5.15 |
| Rhizosphere | 58.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003397 | 3300001979 | Bacteria | 7006 |
| 2 | JGI24740J21852_10007221 | 3300001979 | Bacteria | 4529 |
| 3 | JGI24739J22299_10002664 | 3300001989 | Bacteria | 6874 |
| 4 | JGI24739J22299_10005575 | 3300001989 | Bacteria | 4773 |
| 5 | JGI24739J22299_10035620 | 3300001989 | Bacteria | 1686 |
| 6 | JGI24737J22298_10023739 | 3300001990 | Bacteria | 1944 |
| 7 | JGI24735J21928_10002378 | 3300002067 | Bacteria | 6546 |
| 8 | JGI24735J21928_10049111 | 3300002067 | Bacteria | 1220 |
| 9 | JGI24738J21930_10001505 | 3300002075 | Bacteria | 6459 |
| 10 | JGI25155J39150_1000724 | 3300002704 | Bacteria | 5734 |
| 11 | JGI25156J39149_1000504 | 3300002705 | Bacteria | 22869 |
| 12 | JGI25156J39149_1000735 | 3300002705 | Bacteria | 17392 |
| 13 | JGI25156J39149_1002542 | 3300002705 | Bacteria | 6479 |
| 14 | JGI25152J39213_1000915 | 3300002773 | Bacteria | 14469 |
| 15 | JGI25152J39213_1001246 | 3300002773 | Bacteria | 11617 |
| 16 | JGI25150J39212_1000991 | 3300002774 | Bacteria | 8877 |
| 17 | JGI25150J39212_1002008 | 3300002774 | Bacteria | 5305 |
| 18 | JGI25159J45721_1001447 | 3300002987 | Bacteria | 9805 |
| 19 | JGI25151J46595_10002025 | 3300003187 | Bacteria | 12673 |
| 20 | JGI25151J46595_10002925 | 3300003187 | Bacteria | 9778 |
| 21 | JGI25151J46595_10003922 | 3300003187 | Bacteria | 8027 |
| 22 | JGI25151J46595_10008898 | 3300003187 | Bacteria | 4792 |
| 23 | JGI25165J46597_1001196 | 3300003214 | Bacteria | 15743 |
| 24 | JGI25153J46596_10001486 | 3300003215 | Bacteria | 13976 |
| 25 | JGI25153J46596_10004452 | 3300003215 | Bacteria | 7551 |
| 26 | rootL2_10002479 | 3300003322 | Bacteria | 16465 |
| 27 | rootL2_10084409 | 3300003322 | Bacteria | 1779 |
| 28 | JGI25160J50197_1000171 | 3300003354 | Bacteria | 55915 |
| 29 | JGI25160J50197_1001502 | 3300003354 | Bacteria | 11587 |
| 30 | JGI25160J50197_1006483 | 3300003354 | Bacteria | 4729 |
| 31 | JGI25161J50226_1001006 | 3300003374 | Bacteria | 9840 |
| 32 | JGI25161J50226_1002287 | 3300003374 | Bacteria | 5010 |
| 33 | Ga0006562J51391_1095652 | 3300003578 | Bacteria | 5267 |
| 34 | Ga0006562J51391_1095654 | 3300003578 | Bacteria | 2270 |
| 35 | Ga0055533_1000292 | 3300003756 | Bacteria | 25514 |
| 36 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 37 | Ga0055532_1002025 | 3300003758 | Bacteria | 4653 |
| 38 | Ga0055532_1002081 | 3300003758 | Bacteria | 4552 |
| 39 | Ga0055532_1002399 | 3300003758 | Bacteria | 3929 |
| 40 | Ga0055527_1000014 | 3300003760 | Bacteria | 289449 |
| 41 | Ga0055527_1001374 | 3300003760 | Bacteria | 5199 |
| 42 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 43 | Ga0055535_1000998 | 3300003761 | Bacteria | 18248 |
| 44 | Ga0055535_1002924 | 3300003761 | Bacteria | 5304 |
| 45 | Ga0055535_1002982 | 3300003761 | Bacteria | 5199 |
| 46 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 47 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 48 | Ga0055542_1001017 | 3300003762 | Bacteria | 17787 |
| 49 | Ga0055542_1002094 | 3300003762 | Bacteria | 7418 |
| 50 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 51 | Ga0055529_1001769 | 3300003763 | Bacteria | 5337 |
| 52 | Ga0055526_1000649 | 3300003771 | Bacteria | 26986 |
| 53 | Ga0055526_1002772 | 3300003771 | Bacteria | 11617 |
| 54 | Ga0055526_1004608 | 3300003771 | Bacteria | 8220 |
| 55 | Ga0055537_1000390 | 3300003773 | Bacteria | 29440 |
| 56 | Ga0055537_1001113 | 3300003773 | Bacteria | 11617 |
| 57 | Ga0055524_1001840 | 3300003775 | Bacteria | 11617 |
| 58 | Ga0055536_1001135 | 3300003781 | Bacteria | 16683 |
| 59 | Ga0055536_1001267 | 3300003781 | Bacteria | 15565 |
| 60 | Ga0055536_1002880 | 3300003781 | Bacteria | 9461 |
| 61 | Ga0055534_1000349 | 3300003784 | Bacteria | 29554 |
| 62 | Ga0055534_1001367 | 3300003784 | Bacteria | 9769 |
| 63 | Ga0055534_1006607 | 3300003784 | Bacteria | 2895 |
| 64 | Ga0055528_1000914 | 3300003790 | Bacteria | 19888 |
| 65 | Ga0055528_1002082 | 3300003790 | Bacteria | 11117 |
| 66 | Ga0055530_10001555 | 3300003791 | Bacteria | 16471 |
| 67 | Ga0055540_1000996 | 3300003792 | Bacteria | 18262 |
| 68 | Ga0055540_1003629 | 3300003792 | Bacteria | 7362 |
| 69 | Ga0055540_1003698 | 3300003792 | Bacteria | 7248 |
| 70 | Ga0055540_1004049 | 3300003792 | Bacteria | 6808 |
| 71 | Ga0055540_1008591 | 3300003792 | Bacteria | 3661 |
| 72 | Ga0055531_10001175 | 3300003794 | Bacteria | 20153 |
| 73 | Ga0055531_10004876 | 3300003794 | Bacteria | 7995 |
| 74 | Ga0055531_10021333 | 3300003794 | Bacteria | 2516 |
| 75 | Ga0058692_1002599 | 3300003856 | Bacteria | 5962 |
| 76 | Ga0055543_1002168 | 3300004625 | Bacteria | 6752 |
| 77 | Ga0055543_1002259 | 3300004625 | Bacteria | 6516 |
| 78 | Ga0065165_1001193 | 3300005262 | Bacteria | 30041 |
| 79 | Ga0065165_1003400 | 3300005262 | Bacteria | 11243 |
| 80 | Ga0065714_10008370 | 3300005288 | Bacteria | 2574 |
| 81 | Ga0065704_10072545 | 3300005289 | Bacteria | 8347 |
| 82 | Ga0070658_10002647 | 3300005327 | Bacteria | 14905 |
| 83 | Ga0070658_10014898 | 3300005327 | Bacteria | 6228 |
| 84 | Ga0070658_10265732 | 3300005327 | Bacteria | 1458 |
| 85 | Ga0070666_10057749 | 3300005335 | Bacteria | 2623 |
| 86 | Ga0068868_100081982 | 3300005338 | Bacteria | 2587 |
| 87 | Ga0070660_100000032 | 3300005339 | Bacteria | 85304 |
| 88 | Ga0070660_100002402 | 3300005339 | Bacteria | 12862 |
| 89 | Ga0070661_100237510 | 3300005344 | Bacteria | 1402 |
| 90 | Ga0070659_100000355 | 3300005366 | Bacteria | 34908 |
| 91 | Ga0070659_100304392 | 3300005366 | Bacteria | 1330 |
| 92 | Ga0070667_100050240 | 3300005367 | Bacteria | 3514 |
| 93 | Ga0070663_100009295 | 3300005455 | Bacteria | 6083 |
| 94 | Ga0070678_100084625 | 3300005456 | Bacteria | 2415 |
| 95 | Ga0070678_100109415 | 3300005456 | Bacteria | 2159 |
| 96 | Ga0070678_100142288 | 3300005456 | Bacteria | 1921 |
| 97 | Ga0070662_100017863 | 3300005457 | Bacteria | 4787 |
| 98 | Ga0070662_100267055 | 3300005457 | Bacteria | 1380 |
| 99 | Ga0068853_100020864 | 3300005539 | Bacteria | 5450 |
| 100 | Ga0068853_100081717 | 3300005539 | Bacteria | 2830 |
| 101 | Ga0070665_100385058 | 3300005548 | Bacteria | 1410 |
| 102 | Ga0068855_100009319 | 3300005563 | Bacteria | 11857 |
| 103 | Ga0068855_100022698 | 3300005563 | Bacteria | 7520 |
| 104 | Ga0068855_100424737 | 3300005563 | Bacteria | 1453 |
| 105 | Ga0070664_100029930 | 3300005564 | Bacteria | 4540 |
| 106 | Ga0068852_100003043 | 3300005616 | Bacteria | 11665 |
| 107 | Ga0068852_100136933 | 3300005616 | Bacteria | 2261 |
| 108 | Ga0068859_100253636 | 3300005617 | Bacteria | 1850 |
| 109 | Ga0068862_100153601 | 3300005844 | Bacteria | 2050 |
| 110 | Ga0075368_10007239 | 3300006042 | Bacteria | 3911 |
| 111 | Ga0075363_100020228 | 3300006048 | Bacteria | 3336 |
| 112 | Ga0075363_100033095 | 3300006048 | Bacteria | 2690 |
| 113 | Ga0075363_100182109 | 3300006048 | Bacteria | 1196 |
| 114 | Ga0075364_10008450 | 3300006051 | Bacteria | 6154 |
| 115 | Ga0075364_10133357 | 3300006051 | Bacteria | 1668 |
| 116 | Ga0075362_10007125 | 3300006177 | Bacteria | 4212 |
| 117 | Ga0075362_10030423 | 3300006177 | Bacteria | 2331 |
| 118 | Ga0075362_10031860 | 3300006177 | Bacteria | 2284 |
| 119 | Ga0075362_10033809 | 3300006177 | Bacteria | 2225 |
| 120 | Ga0075362_10078284 | 3300006177 | Bacteria | 1520 |
| 121 | Ga0075367_10023801 | 3300006178 | Bacteria | 3450 |
| 122 | Ga0075369_10048964 | 3300006186 | Bacteria | 1824 |
| 123 | Ga0075369_10069478 | 3300006186 | Bacteria | 1549 |
| 124 | Ga0075366_10003695 | 3300006195 | Bacteria | 8120 |
| 125 | Ga0075366_10006163 | 3300006195 | Bacteria | 6542 |
| 126 | Ga0075366_10087818 | 3300006195 | Bacteria | 1862 |
| 127 | Ga0075370_10001351 | 3300006353 | Bacteria | 10561 |
| 128 | Ga0075370_10001937 | 3300006353 | Bacteria | 9340 |
| 129 | Ga0075370_10031089 | 3300006353 | Bacteria | 2980 |
| 130 | Ga0075370_10040569 | 3300006353 | Bacteria | 2626 |
| 131 | Ga0075370_10128971 | 3300006353 | Bacteria | 1475 |
| 132 | Ga0068871_100223272 | 3300006358 | Bacteria | 1633 |
| 133 | Ga0097620_100253623 | 3300006931 | Bacteria | 1850 |
| 134 | Ga0099826_10030220 | 3300006948 | Bacteria | 3939 |
| 135 | Ga0105251_10000097 | 3300009011 | Bacteria | 85550 |
| 136 | Ga0105251_10004896 | 3300009011 | Bacteria | 8933 |
| 137 | Ga0105251_10076755 | 3300009011 | Bacteria | 1550 |
| 138 | Ga0105244_10001759 | 3300009036 | Bacteria | 17026 |
| 139 | Ga0105244_10050125 | 3300009036 | Bacteria | 2130 |
| 140 | Ga0105250_10006717 | 3300009092 | Bacteria | 4998 |
| 141 | Ga0105240_10000656 | 3300009093 | Bacteria | 63756 |
| 142 | Ga0105240_10008487 | 3300009093 | Bacteria | 14693 |
| 143 | Ga0105240_10045631 | 3300009093 | Bacteria | 5558 |
| 144 | Ga0105240_10081746 | 3300009093 | Bacteria | 3969 |
| 145 | Ga0105240_10089914 | 3300009093 | Bacteria | 3754 |
| 146 | Ga0105240_10345382 | 3300009093 | Bacteria | 1689 |
| 147 | Ga0105243_10002439 | 3300009148 | Bacteria | 15527 |
| 148 | Ga0105243_10004361 | 3300009148 | Bacteria | 11207 |
| 149 | Ga0105243_10347035 | 3300009148 | Bacteria | 1362 |
| 150 | Ga0105241_10129036 | 3300009174 | Bacteria | 2045 |
| 151 | Ga0105242_10127949 | 3300009176 | Bacteria | 2188 |
| 152 | Ga0105248_10036706 | 3300009177 | Bacteria | 5481 |
| 153 | Ga0105248_10177643 | 3300009177 | Bacteria | 2399 |
| 154 | Ga0105248_10179120 | 3300009177 | Bacteria | 2389 |
| 155 | Ga0105237_10013204 | 3300009545 | Bacteria | 8665 |
| 156 | Ga0105237_10057546 | 3300009545 | Bacteria | 3890 |
| 157 | Ga0105237_10063269 | 3300009545 | Bacteria | 3698 |
| 158 | Ga0105238_10037100 | 3300009551 | Bacteria | 4956 |
| 159 | Ga0105238_10070714 | 3300009551 | Bacteria | 3488 |
| 160 | Ga0105238_10244627 | 3300009551 | Bacteria | 1772 |
| 161 | Ga0105239_10007406 | 3300010375 | Bacteria | 12591 |
| 162 | Ga0105239_10036412 | 3300010375 | Bacteria | 5402 |
| 163 | Ga0105246_10061294 | 3300011119 | Bacteria | 2617 |
| 164 | Ga0105246_10352220 | 3300011119 | Bacteria | 1207 |
| 165 | Ga0157373_10003547 | 3300013100 | Bacteria | 11784 |
| 166 | Ga0157373_10053204 | 3300013100 | Bacteria | 2879 |
| 167 | Ga0157371_10027247 | 3300013102 | Bacteria | 4147 |
| 168 | Ga0157370_10000328 | 3300013104 | Bacteria | 59681 |
| 169 | Ga0157370_10001149 | 3300013104 | Bacteria | 32991 |
| 170 | Ga0157370_10055529 | 3300013104 | Bacteria | 3772 |
| 171 | Ga0157370_10186502 | 3300013104 | Bacteria | 1926 |
| 172 | Ga0157370_10193324 | 3300013104 | Bacteria | 1889 |
| 173 | Ga0157369_10000206 | 3300013105 | Bacteria | 81958 |
| 174 | Ga0157369_10000556 | 3300013105 | Bacteria | 49013 |
| 175 | Ga0157369_10000953 | 3300013105 | Bacteria | 36714 |
| 176 | Ga0157369_10387518 | 3300013105 | Bacteria | 1450 |
| 177 | Ga0157374_10000370 | 3300013296 | Bacteria | 41402 |
| 178 | Ga0163162_10010310 | 3300013306 | Bacteria | 9081 |
| 179 | Ga0163162_10047011 | 3300013306 | Bacteria | 4326 |
| 180 | Ga0157372_10003805 | 3300013307 | Bacteria | 16207 |
| 181 | Ga0157372_10019343 | 3300013307 | Bacteria | 7336 |
| 182 | Ga0182008_10001707 | 3300014497 | Bacteria | 14407 |
| 183 | Ga0182008_10029056 | 3300014497 | Bacteria | 2794 |
| 184 | Ga0157379_10120360 | 3300014968 | Bacteria | 2361 |
| 185 | Ga0182006_1000990 | 3300015261 | Bacteria | 18649 |
| 186 | Ga0182006_1030114 | 3300015261 | Bacteria | 2196 |
| 187 | Ga0182007_10000150 | 3300015262 | Bacteria | 47210 |
| 188 | Ga0182007_10000673 | 3300015262 | Bacteria | 19643 |
| 189 | Ga0182007_10005814 | 3300015262 | Bacteria | 5362 |
| 190 | Ga0182007_10016384 | 3300015262 | Bacteria | 2736 |
| 191 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 192 | Ga0183361_10012 | 3300016635 | Bacteria | 203395 |
| 193 | Ga0163161_10000743 | 3300017792 | Bacteria | 25623 |
| 194 | Ga0163161_10005081 | 3300017792 | Bacteria | 9158 |
| 195 | Ga0163161_10011455 | 3300017792 | Bacteria | 6153 |
| 196 | Ga0163161_10016751 | 3300017792 | Bacteria | 5122 |
| 197 | Ga0197907_10707312 | 3300020069 | Bacteria | 4514 |
| 198 | Ga0206354_11366513 | 3300020081 | Bacteria | 2607 |
| 199 | Ga0206353_11314560 | 3300020082 | Bacteria | 2421 |
| 200 | Ga0224712_10000022 | 3300022467 | Bacteria | 23225 |
| 201 | Ga0209436_103577 | 3300025208 | Bacteria | 4075 |
| 202 | Ga0209436_108792 | 3300025208 | Bacteria | 1976 |
| 203 | Ga0209566_100216 | 3300025225 | Bacteria | 57945 |
| 204 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 205 | Ga0209674_100092 | 3300025226 | Bacteria | 172272 |
| 206 | Ga0209674_101735 | 3300025226 | Bacteria | 5354 |
| 207 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 208 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 209 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 210 | Ga0209672_101148 | 3300025228 | Bacteria | 10893 |
| 211 | Ga0209672_101654 | 3300025228 | Bacteria | 7273 |
| 212 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 213 | Ga0209147_100112 | 3300025229 | Bacteria | 145046 |
| 214 | Ga0209147_100163 | 3300025229 | Bacteria | 90494 |
| 215 | Ga0209147_100686 | 3300025229 | Bacteria | 17369 |
| 216 | Ga0209147_102613 | 3300025229 | Bacteria | 4260 |
| 217 | Ga0209563_104011 | 3300025230 | Bacteria | 2900 |
| 218 | Ga0207427_103987 | 3300025231 | Bacteria | 2703 |
| 219 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 220 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 221 | Ga0209258_100109 | 3300025242 | Bacteria | 203881 |
| 222 | Ga0209258_100112 | 3300025242 | Bacteria | 192884 |
| 223 | Ga0207425_1000199 | 3300025245 | Bacteria | 48186 |
| 224 | Ga0207425_1000595 | 3300025245 | Bacteria | 21041 |
| 225 | Ga0207425_1002925 | 3300025245 | Bacteria | 5720 |
| 226 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 227 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 228 | Ga0209148_1000081 | 3300025254 | Bacteria | 273676 |
| 229 | Ga0209148_1000997 | 3300025254 | Bacteria | 18101 |
| 230 | Ga0209759_1000053 | 3300025256 | Bacteria | 212789 |
| 231 | Ga0209759_1000074 | 3300025256 | Bacteria | 177152 |
| 232 | Ga0209759_1000601 | 3300025256 | Bacteria | 34849 |
| 233 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 234 | Ga0209129_1000089 | 3300025258 | Bacteria | 177344 |
| 235 | Ga0209129_1001975 | 3300025258 | Bacteria | 10674 |
| 236 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 237 | Ga0209565_1000288 | 3300025263 | Bacteria | 49295 |
| 238 | Ga0209565_1000293 | 3300025263 | Bacteria | 48108 |
| 239 | Ga0209565_1001947 | 3300025263 | Bacteria | 8104 |
| 240 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 241 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 242 | Ga0209455_1014935 | 3300025272 | Bacteria | 1732 |
| 243 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 244 | Ga0209673_1000265 | 3300025273 | Bacteria | 98501 |
| 245 | Ga0209673_1000838 | 3300025273 | Bacteria | 40184 |
| 246 | Ga0209673_1001258 | 3300025273 | Bacteria | 26126 |
| 247 | Ga0209130_1000113 | 3300025284 | Bacteria | 130804 |
| 248 | Ga0209130_1001550 | 3300025284 | Bacteria | 14636 |
| 249 | Ga0209130_1004836 | 3300025284 | Bacteria | 4931 |
| 250 | Ga0209675_1000127 | 3300025291 | Bacteria | 104257 |
| 251 | Ga0209675_1000276 | 3300025291 | Bacteria | 49295 |
| 252 | Ga0209675_1000887 | 3300025291 | Bacteria | 19242 |
| 253 | Ga0209675_1002155 | 3300025291 | Bacteria | 10373 |
| 254 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 255 | Ga0209676_1001480 | 3300025292 | Bacteria | 21721 |
| 256 | Ga0209676_1003545 | 3300025292 | Bacteria | 9484 |
| 257 | Ga0209676_1004910 | 3300025292 | Bacteria | 7202 |
| 258 | Ga0209676_1009073 | 3300025292 | Bacteria | 4340 |
| 259 | Ga0209676_1017071 | 3300025292 | Bacteria | 2586 |
| 260 | Ga0209025_1000134 | 3300025294 | Bacteria | 194505 |
| 261 | Ga0209025_1000484 | 3300025294 | Bacteria | 76831 |
| 262 | Ga0209025_1001331 | 3300025294 | Bacteria | 33405 |
| 263 | Ga0209025_1002208 | 3300025294 | Bacteria | 21511 |
| 264 | Ga0209025_1009028 | 3300025294 | Bacteria | 7034 |
| 265 | Ga0209564_1000053 | 3300025295 | Bacteria | 351452 |
| 266 | Ga0209564_1000394 | 3300025295 | Bacteria | 78197 |
| 267 | Ga0209564_1000698 | 3300025295 | Bacteria | 49135 |
| 268 | Ga0209564_1006730 | 3300025295 | Bacteria | 6108 |
| 269 | Ga0209564_1027441 | 3300025295 | Bacteria | 1849 |
| 270 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 271 | Ga0209758_1000622 | 3300025297 | Bacteria | 54385 |
| 272 | Ga0209758_1014045 | 3300025297 | Bacteria | 4303 |
| 273 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 274 | Ga0209050_1001433 | 3300025298 | Bacteria | 25685 |
| 275 | Ga0209050_1011252 | 3300025298 | Bacteria | 4274 |
| 276 | Ga0209256_1000115 | 3300025299 | Bacteria | 173607 |
| 277 | Ga0209256_1000864 | 3300025299 | Bacteria | 37672 |
| 278 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 279 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 280 | Ga0207426_1000037 | 3300025302 | Bacteria | 442735 |
| 281 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 282 | Ga0209051_1000385 | 3300025303 | Bacteria | 62270 |
| 283 | Ga0209051_1000781 | 3300025303 | Bacteria | 33617 |
| 284 | Ga0209051_1001504 | 3300025303 | Bacteria | 19477 |
| 285 | Ga0209051_1002109 | 3300025303 | Bacteria | 14875 |
| 286 | Ga0209051_1002621 | 3300025303 | Bacteria | 12630 |
| 287 | Ga0209051_1019996 | 3300025303 | Bacteria | 2903 |
| 288 | Ga0209051_1053265 | 3300025303 | Bacteria | 1330 |
| 289 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 290 | Ga0209257_1001057 | 3300025304 | Bacteria | 36450 |
| 291 | Ga0209257_1003120 | 3300025304 | Bacteria | 14812 |
| 292 | Ga0209257_1005156 | 3300025304 | Bacteria | 9429 |
| 293 | Ga0207655_1013658 | 3300025728 | Bacteria | 4646 |
| 294 | Ga0207713_1000305 | 3300025735 | Bacteria | 56170 |
| 295 | Ga0207682_10034113 | 3300025893 | Bacteria | 2051 |
| 296 | Ga0207680_10008834 | 3300025903 | Bacteria | 4966 |
| 297 | Ga0207647_10000268 | 3300025904 | Bacteria | 42845 |
| 298 | Ga0207647_10004135 | 3300025904 | Bacteria | 10770 |
| 299 | Ga0207647_10008546 | 3300025904 | Bacteria | 7332 |
| 300 | Ga0207647_10019591 | 3300025904 | Bacteria | 4548 |
| 301 | Ga0207647_10027493 | 3300025904 | Bacteria | 3708 |
| 302 | Ga0207647_10043031 | 3300025904 | Bacteria | 2828 |
| 303 | Ga0207705_10000708 | 3300025909 | Bacteria | 27547 |
| 304 | Ga0207705_10134982 | 3300025909 | Bacteria | 1839 |
| 305 | Ga0207695_10005102 | 3300025913 | Bacteria | 17594 |
| 306 | Ga0207695_10018782 | 3300025913 | Bacteria | 7979 |
| 307 | Ga0207695_10099910 | 3300025913 | Bacteria | 2898 |
| 308 | Ga0207695_10188464 | 3300025913 | Bacteria | 1981 |
| 309 | Ga0207695_10373598 | 3300025913 | Bacteria | 1312 |
| 310 | Ga0207671_10026696 | 3300025914 | Bacteria | 4323 |
| 311 | Ga0207671_10059100 | 3300025914 | Bacteria | 2842 |
| 312 | Ga0207671_10103198 | 3300025914 | Bacteria | 2162 |
| 313 | Ga0207657_10000051 | 3300025919 | Bacteria | 109129 |
| 314 | Ga0207657_10000131 | 3300025919 | Bacteria | 75479 |
| 315 | Ga0207694_10019539 | 3300025924 | Bacteria | 5122 |
| 316 | Ga0207694_10065076 | 3300025924 | Bacteria | 2842 |
| 317 | Ga0207690_10000034 | 3300025932 | Bacteria | 149574 |
| 318 | Ga0207709_10001032 | 3300025935 | Bacteria | 20578 |
| 319 | Ga0207709_10001454 | 3300025935 | Bacteria | 16482 |
| 320 | Ga0207711_10026135 | 3300025941 | Bacteria | 4897 |
| 321 | Ga0207711_10031612 | 3300025941 | Bacteria | 4469 |
| 322 | Ga0207711_10228248 | 3300025941 | Bacteria | 1705 |
| 323 | Ga0207679_10015470 | 3300025945 | Bacteria | 5043 |
| 324 | Ga0207667_10003149 | 3300025949 | Bacteria | 20416 |
| 325 | Ga0207667_10009431 | 3300025949 | Bacteria | 11496 |
| 326 | Ga0207667_10113941 | 3300025949 | Bacteria | 2787 |
| 327 | Ga0207667_10202305 | 3300025949 | Bacteria | 2037 |
| 328 | Ga0207640_10215795 | 3300025981 | Bacteria | 1465 |
| 329 | Ga0207658_10047893 | 3300025986 | Bacteria | 3131 |
| 330 | Ga0207658_10057051 | 3300025986 | Bacteria | 2901 |
| 331 | Ga0207639_10007462 | 3300026041 | Bacteria | 7459 |
| 332 | Ga0207639_10065918 | 3300026041 | Bacteria | 2812 |
| 333 | Ga0207678_10002721 | 3300026067 | Bacteria | 16032 |
| 334 | Ga0207678_10037514 | 3300026067 | Bacteria | 4214 |
| 335 | Ga0207678_10262867 | 3300026067 | Bacteria | 1479 |
| 336 | Ga0207674_10198781 | 3300026116 | Bacteria | 1954 |
| 337 | Ga0207674_10369757 | 3300026116 | Bacteria | 1386 |
| 338 | Ga0207683_10014003 | 3300026121 | Bacteria | 6839 |
| 339 | Ga0207683_10056358 | 3300026121 | Bacteria | 3447 |
| 340 | Ga0207698_10010500 | 3300026142 | Bacteria | 5958 |
| 341 | Ga0207698_10111986 | 3300026142 | Bacteria | 2290 |
| 342 | Ga0209371_1000090 | 3300027312 | Bacteria | 173119 |
| 343 | Ga0209371_1001109 | 3300027312 | Bacteria | 19951 |
| 344 | Ga0209282_1000334 | 3300027666 | Bacteria | 23330 |
| 345 | Ga0207428_10351654 | 3300027907 | Bacteria | 1084 |
| 346 | Ga0268266_10240987 | 3300028379 | Bacteria | 1669 |
| 347 | Ga0268266_10335955 | 3300028379 | Bacteria | 1417 |
| 348 | Ga0268265_10118263 | 3300028380 | Bacteria | 2178 |
| 349 | Ga0268264_10171693 | 3300028381 | Bacteria | 1962 |
| 350 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 351 | Ga0307515_10024629 | 3300028794 | Bacteria | 10474 |
| 352 | Ga0265338_10000113 | 3300028800 | Bacteria | 150993 |
| 353 | Ga0268256_1000115 | 3300030500 | Bacteria | 116918 |
| 354 | Ga0268256_1000921 | 3300030500 | Bacteria | 20306 |
| 355 | Ga0307511_10000025 | 3300030521 | Bacteria | 112344 |
| 356 | Ga0316177_1029429 | 3300030731 | Bacteria | 3928 |
| 357 | Ga0316176_1080864 | 3300030732 | Bacteria | 2014 |
| 358 | Ga0314311_1124028 | 3300030733 | Bacteria | 3356 |
| 359 | Ga0316180_1012367 | 3300030736 | Bacteria | 2491 |
| 360 | Ga0316182_1325098 | 3300030745 | Bacteria | 2859 |
| 361 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 362 | Ga0265325_10000262 | 3300031241 | Bacteria | 37299 |
| 363 | Ga0265327_10000722 | 3300031251 | Bacteria | 51801 |
| 364 | Ga0265327_10015860 | 3300031251 | Bacteria | 4831 |
| 365 | Ga0265316_10000299 | 3300031344 | Bacteria | 55433 |
| 366 | Ga0265316_10089534 | 3300031344 | Bacteria | 2348 |
| 367 | Ga0307513_10116636 | 3300031456 | Bacteria | 2649 |
| 368 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 369 | Ga0307408_100002431 | 3300031548 | Bacteria | 13091 |
| 370 | Ga0307408_100024541 | 3300031548 | Bacteria | 4118 |
| 371 | Ga0307408_100114667 | 3300031548 | Bacteria | 2076 |
| 372 | Ga0307408_100157292 | 3300031548 | Bacteria | 1801 |
| 373 | Ga0307508_10059988 | 3300031616 | Bacteria | 3365 |
| 374 | Ga0307514_10005152 | 3300031649 | Bacteria | 11799 |
| 375 | Ga0307516_10003171 | 3300031730 | Bacteria | 21396 |
| 376 | Ga0307405_10002949 | 3300031731 | Bacteria | 7680 |
| 377 | Ga0307406_10001482 | 3300031901 | Bacteria | 12962 |
| 378 | Ga0307406_10033625 | 3300031901 | Bacteria | 3140 |
| 379 | Ga0307412_10000051 | 3300031911 | Bacteria | 150433 |
| 380 | Ga0307412_10061531 | 3300031911 | Bacteria | 2524 |
| 381 | Ga0307412_10194031 | 3300031911 | Bacteria | 1537 |
| 382 | Ga0307416_100023777 | 3300032002 | Bacteria | 4456 |
| 383 | Ga0307416_100462395 | 3300032002 | Bacteria | 1324 |
| 384 | Ga0307414_10071445 | 3300032004 | Bacteria | 2503 |
| 385 | Ga0307411_10020506 | 3300032005 | Bacteria | 3846 |
| 386 | Ga0307411_10118497 | 3300032005 | Bacteria | 1910 |
| 387 | Ga0307411_10207668 | 3300032005 | Bacteria | 1509 |
| 388 | Ga0316583_10029627 | 3300032133 | Bacteria | 1951 |
| 389 | Ga0307507_10088851 | 3300033179 | Bacteria | 2663 |
| 390 | Ga0395899_0000008 | 3300037312 | Bacteria | 567572 |
| 391 | Ga0395900_0000055 | 3300037418 | Bacteria | 219875 |
| 392 | Ga0395900_0002303 | 3300037418 | Bacteria | 21211 |
| 393 | Ga0395900_0007321 | 3300037418 | Bacteria | 11416 |
| 394 | Ga0395900_0028412 | 3300037418 | Bacteria | 5728 |
| 395 | Ga0395900_0134985 | 3300037418 | Bacteria | 2528 |
| 396 | Ga0395900_0138938 | 3300037418 | Bacteria | 2489 |
| 397 | Ga0395900_0250241 | 3300037418 | Bacteria | 1774 |
| 398 | Ga0395898_0000119 | 3300037466 | Bacteria | 209937 |
| 399 | Ga0395898_0001260 | 3300037466 | Bacteria | 37617 |
| 400 | Ga0395898_0032722 | 3300037466 | Bacteria | 5191 |
| 401 | Ga0395905_0000168 | 3300037471 | Bacteria | 107034 |
| 402 | Ga0395905_0075175 | 3300037471 | Bacteria | 3166 |
| 403 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 404 | Ga0395901_0010491 | 3300038443 | Bacteria | 9383 |
| 405 | Ga0395901_0019159 | 3300038443 | Bacteria | 6996 |
| 406 | Ga0395901_0170239 | 3300038443 | Bacteria | 2285 |
| 407 | Ga0395901_0194691 | 3300038443 | Bacteria | 2125 |
| 408 | Ga0436361_0131139 | 3300039447 | Bacteria | 6535 |
| 409 | Ga0439436_0000470 | 3300041404 | Bacteria | 10385 |
| 410 | Ga0439436_0002954 | 3300041404 | Bacteria | 5157 |
| 411 | Ga0439439_0002400 | 3300041406 | Bacteria | 3974 |
| 412 | Ga0439447_002633 | 3300041407 | Bacteria | 6511 |
| 413 | Ga0439447_012795 | 3300041407 | Bacteria | 2399 |
| 414 | Ga0439461_0018568 | 3300041410 | Bacteria | 1362 |
| 415 | Ga0439466_0003460 | 3300041411 | Bacteria | 6117 |
| 416 | Ga0439465_0000108 | 3300041413 | Bacteria | 19156 |
| 417 | Ga0439465_0007545 | 3300041413 | Bacteria | 3454 |
| 418 | Ga0451853_4091276 | 3300041512 | Bacteria | 1447 |
| 419 | Ga0439431_0004413 | 3300041997 | Bacteria | 3092 |
| 420 | Ga0439433_0000895 | 3300041999 | Bacteria | 5940 |
| 421 | Ga0439442_004394 | 3300042002 | Bacteria | 2799 |
| 422 | Ga0439445_0001046 | 3300042004 | Bacteria | 5909 |
| 423 | Ga0439445_0008898 | 3300042004 | Bacteria | 2358 |
| 424 | Ga0439448_0001330 | 3300042005 | Bacteria | 6326 |
| 425 | Ga0439432_003819 | 3300042006 | Bacteria | 5559 |
| 426 | Ga0439432_010034 | 3300042006 | Bacteria | 3293 |
| 427 | Ga0439449_0000245 | 3300042007 | Bacteria | 19553 |
| 428 | Ga0439449_0001647 | 3300042007 | Bacteria | 8764 |
| 429 | Ga0439449_0003981 | 3300042007 | Bacteria | 5711 |
| 430 | Ga0439449_0004140 | 3300042007 | Bacteria | 5609 |
| 431 | Ga0439452_000792 | 3300042010 | Bacteria | 14976 |
| 432 | Ga0439452_005772 | 3300042010 | Bacteria | 3955 |
| 433 | Ga0439457_001278 | 3300042014 | Bacteria | 7554 |
| 434 | Ga0439457_029009 | 3300042014 | Bacteria | 1226 |
| 435 | Ga0439462_0017172 | 3300042015 | Bacteria | 1874 |
| 436 | Ga0450894_003722 | 3300042131 | Bacteria | 1992 |
| 437 | Ga0450906_001265 | 3300042145 | Bacteria | 5568 |
| 438 | Ga0450907_010923 | 3300042146 | Bacteria | 1509 |
| 439 | Ga0439446_0010238 | 3300042156 | Bacteria | 2524 |
| 440 | Ga0450908_000841 | 3300042184 | Bacteria | 5923 |
| 441 | Ga0450909_003757 | 3300042185 | Bacteria | 2156 |
| 442 | Ga0439434_0001099 | 3300042435 | Bacteria | 7827 |
| 443 | Ga0439434_0006472 | 3300042435 | Bacteria | 3423 |
| 444 | Ga0451577_0003100 | 3300042876 | Bacteria | 18746 |
| 445 | Ga0451577_0025039 | 3300042876 | Bacteria | 5418 |
| 446 | Ga0451577_0072441 | 3300042876 | Bacteria | 3073 |
| 447 | Ga0451577_0078031 | 3300042876 | Bacteria | 2953 |
| 448 | Ga0451577_0091835 | 3300042876 | Bacteria | 2711 |
| 449 | Ga0466969_0002847 | 3300044656 | Bacteria | 9244 |
| 450 | Ga0466969_0004757 | 3300044656 | Bacteria | 7223 |
| 451 | Ga0466973_0009139 | 3300044659 | Bacteria | 9055 |
| 452 | Ga0453683_0156859 | 3300044673 | Bacteria | 1439 |
| 453 | Ga0466965_0001211 | 3300044683 | Bacteria | 10198 |
| 454 | Ga0466965_0001863 | 3300044683 | Bacteria | 8779 |
| 455 | Ga0466965_0032927 | 3300044683 | Bacteria | 2532 |
| 456 | Ga0466966_0000032 | 3300044684 | Bacteria | 102181 |
| 457 | Ga0466966_0002909 | 3300044684 | Bacteria | 11277 |
| 458 | Ga0466966_0016532 | 3300044684 | Bacteria | 4872 |
| 459 | Ga0466966_0063721 | 3300044684 | Bacteria | 2322 |
| 460 | Ga0466961_0004925 | 3300044693 | Bacteria | 8398 |
| 461 | Ga0466961_0116424 | 3300044693 | Bacteria | 1679 |
| 462 | Ga0466963_0001953 | 3300044694 | Bacteria | 11306 |
| 463 | Ga0466963_0015153 | 3300044694 | Bacteria | 4768 |
| 464 | Ga0466964_0002026 | 3300044706 | Bacteria | 7123 |
| 465 | Ga0466964_0039190 | 3300044706 | Bacteria | 1908 |
| 466 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 467 | Ga0453684_0000583 | 3300044712 | Bacteria | 135940 |
| 468 | Ga0453684_0004902 | 3300044712 | Bacteria | 27396 |
| 469 | Ga0453684_0005751 | 3300044712 | Bacteria | 24224 |
| 470 | Ga0453684_0008183 | 3300044712 | Bacteria | 18861 |
| 471 | Ga0453684_0116937 | 3300044712 | Bacteria | 3227 |
| 472 | Ga0453684_0524355 | 3300044712 | Bacteria | 1308 |
| 473 | Ga0466968_0005823 | 3300044735 | Bacteria | 4626 |
| 474 | Ga0466970_0026347 | 3300044765 | Bacteria | 3047 |
| 475 | Ga0466970_0091606 | 3300044765 | Bacteria | 1650 |
| 476 | Ga0466957_0015351 | 3300044842 | Bacteria | 4474 |
| 477 | Ga0466957_0047793 | 3300044842 | Bacteria | 2600 |
| 478 | Ga0466957_0097795 | 3300044842 | Bacteria | 1846 |
| 479 | Ga0466960_0010342 | 3300044901 | Bacteria | 3872 |
| 480 | Ga0466959_0010040 | 3300045049 | Bacteria | 6747 |
| 481 | Ga0466959_0014675 | 3300045049 | Bacteria | 5701 |
| 482 | Ga0466959_0222376 | 3300045049 | Bacteria | 1309 |
| 483 | Ga0451576_0000137 | 3300045051 | Bacteria | 185212 |
| 484 | Ga0451576_0000738 | 3300045051 | Bacteria | 65424 |
| 485 | Ga0451576_0001961 | 3300045051 | Bacteria | 32770 |
| 486 | Ga0451576_0012728 | 3300045051 | Bacteria | 9445 |
| 487 | Ga0451576_0052917 | 3300045051 | Bacteria | 4254 |
| 488 | Ga0451576_0145389 | 3300045051 | Bacteria | 2472 |
| 489 | Ga0466958_0001759 | 3300045836 | Bacteria | 10489 |
| 490 | Ga0466958_0005164 | 3300045836 | Bacteria | 6984 |
| 491 | Ga0466958_0009785 | 3300045836 | Bacteria | 5349 |
| 492 | Ga0466958_0021413 | 3300045836 | Bacteria | 3778 |
| 493 | Ga0466967_0343404 | 3300045976 | Bacteria | 1444 |
| 494 | Ga0495627_007509 | 3300046453 | Bacteria | 4167 |
| 495 | Ga0495592_0040557 | 3300046454 | Bacteria | 3494 |
| 496 | Ga0495592_0052099 | 3300046454 | Bacteria | 3039 |
| 497 | Ga0495592_0197290 | 3300046454 | Bacteria | 1360 |
| 498 | Ga0495603_0001297 | 3300046455 | Bacteria | 14577 |
| 499 | Ga0495603_0007952 | 3300046455 | Bacteria | 6400 |
| 500 | Ga0495603_0009400 | 3300046455 | Bacteria | 5907 |
| 501 | Ga0495590_0001947 | 3300046457 | Bacteria | 8729 |
| 502 | Ga0495590_0060794 | 3300046457 | Bacteria | 1323 |
| 503 | Ga0495591_006781 | 3300046458 | Bacteria | 4985 |
| 504 | Ga0495629_0000369 | 3300046459 | Bacteria | 38164 |
| 505 | Ga0495629_0004351 | 3300046459 | Bacteria | 10617 |
| 506 | Ga0495629_0005165 | 3300046459 | Bacteria | 9767 |
| 507 | Ga0495629_0014711 | 3300046459 | Bacteria | 5628 |
| 508 | Ga0495629_0041923 | 3300046459 | Bacteria | 3217 |
| 509 | Ga0495629_0049525 | 3300046459 | Bacteria | 2944 |
| 510 | Ga0495638_0028169 | 3300046460 | Bacteria | 3630 |
| 511 | Ga0495638_0074310 | 3300046460 | Bacteria | 2073 |
| 512 | Ga0495641_0003603 | 3300046461 | Bacteria | 11474 |
| 513 | Ga0495651_0009952 | 3300046462 | Bacteria | 7311 |
| 514 | Ga0495651_0023058 | 3300046462 | Bacteria | 4841 |
| 515 | Ga0495651_0196935 | 3300046462 | Bacteria | 1413 |
| 516 | Ga0495651_0218439 | 3300046462 | Bacteria | 1321 |
| 517 | Ga0495653_0006567 | 3300046463 | Bacteria | 9545 |
| 518 | Ga0495653_0018833 | 3300046463 | Bacteria | 5601 |
| 519 | Ga0495653_0023696 | 3300046463 | Bacteria | 4955 |
| 520 | Ga0495653_0037748 | 3300046463 | Bacteria | 3793 |
| 521 | Ga0495653_0092915 | 3300046463 | Bacteria | 2202 |
| 522 | Ga0495653_0175644 | 3300046463 | Bacteria | 1474 |
| 523 | Ga0495650_0004632 | 3300046471 | Bacteria | 9321 |
| 524 | Ga0495650_0014058 | 3300046471 | Bacteria | 4192 |
| 525 | Ga0495650_0017226 | 3300046471 | Bacteria | 3627 |
| 526 | Ga0495650_0019000 | 3300046471 | Bacteria | 3399 |
| 527 | Ga0495650_0027417 | 3300046471 | Bacteria | 2632 |
| 528 | Ga0495580_0002054 | 3300046472 | Bacteria | 17674 |
| 529 | Ga0495580_0005418 | 3300046472 | Bacteria | 10546 |
| 530 | Ga0495580_0023500 | 3300046472 | Bacteria | 4525 |
| 531 | Ga0495580_0070077 | 3300046472 | Bacteria | 2449 |
| 532 | Ga0495580_0113459 | 3300046472 | Bacteria | 1882 |
| 533 | Ga0495580_0149687 | 3300046472 | Bacteria | 1617 |
| 534 | Ga0495580_0159856 | 3300046472 | Bacteria | 1559 |
| 535 | Ga0495582_0002285 | 3300046473 | Bacteria | 10726 |
| 536 | Ga0495582_0052398 | 3300046473 | Bacteria | 2250 |
| 537 | Ga0495605_0002196 | 3300046474 | Bacteria | 12190 |
| 538 | Ga0495605_0004899 | 3300046474 | Bacteria | 7821 |
| 539 | Ga0495605_0010712 | 3300046474 | Bacteria | 5124 |
| 540 | Ga0495605_0016596 | 3300046474 | Bacteria | 3984 |
| 541 | Ga0495639_0009089 | 3300046475 | Bacteria | 4260 |
| 542 | Ga0495662_0024751 | 3300046476 | Bacteria | 2897 |
| 543 | Ga0495662_0077914 | 3300046476 | Bacteria | 1610 |
| 544 | Ga0495664_0001019 | 3300046477 | Bacteria | 14491 |
| 545 | Ga0495664_0015601 | 3300046477 | Bacteria | 4320 |
| 546 | Ga0495664_0083586 | 3300046477 | Bacteria | 1916 |
| 547 | Ga0495596_0005025 | 3300046500 | Bacteria | 6324 |
| 548 | Ga0495596_0039764 | 3300046500 | Bacteria | 1857 |
| 549 | Ga0495596_0073211 | 3300046500 | Bacteria | 1330 |
| 550 | Ga0495583_0003894 | 3300046506 | Bacteria | 11050 |
| 551 | Ga0495583_0006862 | 3300046506 | Bacteria | 7331 |
| 552 | Ga0495583_0013530 | 3300046506 | Bacteria | 4547 |
| 553 | Ga0495606_0012257 | 3300046507 | Bacteria | 6896 |
| 554 | Ga0495606_0039182 | 3300046507 | Bacteria | 3197 |
| 555 | Ga0495606_0072098 | 3300046507 | Bacteria | 2172 |
| 556 | Ga0495606_0083444 | 3300046507 | Bacteria | 1981 |
| 557 | Ga0495606_0099160 | 3300046507 | Bacteria | 1776 |
| 558 | Ga0495606_0138973 | 3300046507 | Bacteria | 1436 |
| 559 | Ga0495608_0007446 | 3300046511 | Bacteria | 7734 |
| 560 | Ga0495608_0042458 | 3300046511 | Bacteria | 3041 |
| 561 | Ga0495610_0019946 | 3300046512 | Bacteria | 3735 |
| 562 | Ga0495616_0002124 | 3300046513 | Bacteria | 13283 |
| 563 | Ga0495616_0073811 | 3300046513 | Bacteria | 1645 |
| 564 | Ga0495618_0001663 | 3300046514 | Bacteria | 14785 |
| 565 | Ga0495618_0011271 | 3300046514 | Bacteria | 5417 |
| 566 | Ga0495618_0014447 | 3300046514 | Bacteria | 4811 |
| 567 | Ga0495620_0011576 | 3300046515 | Bacteria | 4597 |
| 568 | Ga0495620_0036745 | 3300046515 | Bacteria | 2189 |
| 569 | Ga0495628_0002617 | 3300046516 | Bacteria | 16154 |
| 570 | Ga0495628_0027908 | 3300046516 | Bacteria | 4589 |
| 571 | Ga0495628_0033448 | 3300046516 | Bacteria | 4145 |
| 572 | Ga0495628_0037443 | 3300046516 | Bacteria | 3889 |
| 573 | Ga0495628_0049906 | 3300046516 | Bacteria | 3311 |
| 574 | Ga0495628_0174155 | 3300046516 | Bacteria | 1630 |
| 575 | Ga0495630_0020532 | 3300046517 | Bacteria | 4870 |
| 576 | Ga0495630_0044761 | 3300046517 | Bacteria | 3307 |
| 577 | Ga0495630_0235052 | 3300046517 | Bacteria | 1400 |
| 578 | Ga0495631_0001388 | 3300046518 | Bacteria | 14713 |
| 579 | Ga0495637_0007495 | 3300046520 | Bacteria | 5402 |
| 580 | Ga0495648_0012380 | 3300046524 | Bacteria | 6371 |
| 581 | Ga0495648_0021277 | 3300046524 | Bacteria | 4496 |
| 582 | Ga0495648_0022600 | 3300046524 | Bacteria | 4324 |
| 583 | Ga0495648_0044551 | 3300046524 | Bacteria | 2768 |
| 584 | Ga0495648_0142954 | 3300046524 | Bacteria | 1257 |
| 585 | Ga0495663_0002160 | 3300046525 | Bacteria | 5990 |
| 586 | Ga0495666_0004704 | 3300046526 | Bacteria | 6903 |
| 587 | Ga0495666_0005594 | 3300046526 | Bacteria | 6331 |
| 588 | Ga0495666_0006495 | 3300046526 | Bacteria | 5887 |
| 589 | Ga0495642_0006746 | 3300046528 | Bacteria | 4401 |
| 590 | Ga0495642_0021025 | 3300046528 | Bacteria | 2565 |
| 591 | Ga0495652_0029140 | 3300046529 | Bacteria | 4850 |
| 592 | Ga0495652_0033248 | 3300046529 | Bacteria | 4504 |
| 593 | Ga0495654_0018415 | 3300046530 | Bacteria | 3661 |
| 594 | Ga0495654_0028146 | 3300046530 | Bacteria | 2875 |
| 595 | Ga0495654_0081073 | 3300046530 | Bacteria | 1521 |
| 596 | Ga0495665_0005886 | 3300046531 | Bacteria | 6604 |
| 597 | Ga0495665_0021328 | 3300046531 | Bacteria | 3480 |
| 598 | Ga0495665_0025686 | 3300046531 | Bacteria | 3163 |
| 599 | Ga0495640_0002933 | 3300046533 | Bacteria | 13734 |
| 600 | Ga0495640_0005861 | 3300046533 | Bacteria | 9748 |
| 601 | Ga0495640_0026287 | 3300046533 | Bacteria | 4208 |
| 602 | Ga0495640_0113370 | 3300046533 | Bacteria | 1769 |
| 603 | Ga0495586_0000633 | 3300046535 | Bacteria | 20275 |
| 604 | Ga0495586_0031997 | 3300046535 | Bacteria | 2820 |
| 605 | Ga0495586_0092520 | 3300046535 | Bacteria | 1672 |
| 606 | Ga0495587_0018778 | 3300046536 | Bacteria | 4287 |
| 607 | Ga0495621_0009096 | 3300046539 | Bacteria | 3004 |
| 608 | Ga0495597_0002648 | 3300046542 | Bacteria | 11102 |
| 609 | Ga0495597_0016569 | 3300046542 | Bacteria | 3480 |
| 610 | Ga0495597_0044837 | 3300046542 | Bacteria | 1965 |
| 611 | Ga0495645_0003050 | 3300046543 | Bacteria | 11342 |
| 612 | Ga0495645_0011091 | 3300046543 | Bacteria | 6336 |
| 613 | Ga0495645_0045339 | 3300046543 | Bacteria | 3207 |
| 614 | Ga0495645_0122181 | 3300046543 | Bacteria | 1832 |
| 615 | Ga0495622_0004831 | 3300046557 | Bacteria | 6242 |
| 616 | Ga0495622_0016921 | 3300046557 | Bacteria | 3394 |
| 617 | Ga0495667_0017947 | 3300046559 | Bacteria | 4779 |
| 618 | Ga0495667_0022585 | 3300046559 | Bacteria | 4239 |
| 619 | Ga0495668_0011933 | 3300046616 | Bacteria | 5174 |
| 620 | Ga0495668_0041562 | 3300046616 | Bacteria | 2561 |
| 621 | Ga0495634_0009735 | 3300046642 | Bacteria | 7071 |
| 622 | Ga0495634_0011188 | 3300046642 | Bacteria | 6543 |
| 623 | Ga0495634_0022513 | 3300046642 | Bacteria | 4439 |
| 624 | Ga0495625_0000279 | 3300046660 | Bacteria | 79498 |
| 625 | Ga0495625_0147991 | 3300046660 | Bacteria | 1580 |
| 626 | Ga0495625_0155597 | 3300046660 | Bacteria | 1534 |
| 627 | Ga0495635_0013627 | 3300046663 | Bacteria | 5690 |
| 628 | Ga0495635_0034889 | 3300046663 | Bacteria | 3489 |
| 629 | Ga0495635_0040500 | 3300046663 | Bacteria | 3219 |
| 630 | Ga0495635_0102843 | 3300046663 | Bacteria | 1952 |
| 631 | Ga0495661_0005519 | 3300046665 | Bacteria | 8973 |
| 632 | Ga0495661_0010232 | 3300046665 | Bacteria | 6410 |
| 633 | Ga0495588_0008649 | 3300046674 | Bacteria | 4678 |
| 634 | Ga0495588_0025253 | 3300046674 | Bacteria | 2959 |
| 635 | Ga0495588_0035503 | 3300046674 | Bacteria | 2526 |
| 636 | Ga0495599_0015425 | 3300046678 | Bacteria | 4741 |
| 637 | Ga0495599_0023267 | 3300046678 | Bacteria | 3871 |
| 638 | Ga0495599_0032828 | 3300046678 | Bacteria | 3259 |
| 639 | Ga0495599_0048735 | 3300046678 | Bacteria | 2655 |
| 640 | Ga0495599_0131437 | 3300046678 | Bacteria | 1555 |
| 641 | Ga0495623_0007011 | 3300046679 | Bacteria | 7325 |
| 642 | Ga0495623_0010956 | 3300046679 | Bacteria | 5867 |
| 643 | Ga0495623_0021667 | 3300046679 | Bacteria | 4150 |
| 644 | Ga0495623_0135016 | 3300046679 | Bacteria | 1473 |
| 645 | Ga0495646_0001320 | 3300046680 | Bacteria | 14655 |
| 646 | Ga0495646_0011483 | 3300046680 | Bacteria | 5622 |
| 647 | Ga0495646_0021365 | 3300046680 | Bacteria | 4088 |
| 648 | Ga0495646_0023967 | 3300046680 | Bacteria | 3842 |
| 649 | Ga0495646_0034617 | 3300046680 | Bacteria | 3136 |
| 650 | Ga0495646_0053517 | 3300046680 | Bacteria | 2433 |
| 651 | Ga0495646_0076910 | 3300046680 | Bacteria | 1953 |
| 652 | Ga0495658_0132556 | 3300046683 | Bacteria | 1518 |
| 653 | Ga0495669_0035962 | 3300046684 | Bacteria | 2188 |
| 654 | Ga0495669_0084553 | 3300046684 | Bacteria | 1459 |
| 655 | Ga0495669_0102943 | 3300046684 | Bacteria | 1327 |
| 656 | Ga0495613_0002624 | 3300046689 | Bacteria | 13515 |
| 657 | Ga0495613_0010806 | 3300046689 | Bacteria | 6773 |
| 658 | Ga0495624_0009914 | 3300046690 | Bacteria | 6585 |
| 659 | Ga0495624_0010314 | 3300046690 | Bacteria | 6437 |
| 660 | Ga0495624_0016074 | 3300046690 | Bacteria | 5038 |
| 661 | Ga0495624_0016284 | 3300046690 | Bacteria | 5005 |
| 662 | Ga0495624_0017769 | 3300046690 | Bacteria | 4767 |
| 663 | Ga0495624_0053963 | 3300046690 | Bacteria | 2536 |
| 664 | Ga0495624_0121640 | 3300046690 | Bacteria | 1602 |
| 665 | Ga0495624_0179046 | 3300046690 | Bacteria | 1292 |
| 666 | Ga0495670_0064305 | 3300046691 | Bacteria | 1848 |
| 667 | Ga0495670_0089064 | 3300046691 | Bacteria | 1578 |
| 668 | Ga0495671_0002320 | 3300046692 | Bacteria | 12088 |
| 669 | Ga0495671_0016957 | 3300046692 | Bacteria | 3881 |
| 670 | Ga0495671_0038591 | 3300046692 | Bacteria | 2413 |
| 671 | Ga0495671_0076100 | 3300046692 | Bacteria | 1646 |
| 672 | Ga0495649_0001567 | 3300046694 | Bacteria | 17157 |
| 673 | Ga0495649_0004421 | 3300046694 | Bacteria | 9188 |
| 674 | Ga0495649_0068416 | 3300046694 | Bacteria | 1905 |
| 675 | Ga0495649_0079163 | 3300046694 | Bacteria | 1758 |
| 676 | Ga0495649_0083897 | 3300046694 | Bacteria | 1702 |
| 677 | Ga0495589_0005849 | 3300046794 | Bacteria | 6492 |
| 678 | Ga0495589_0010940 | 3300046794 | Bacteria | 4712 |
| 679 | Ga0495589_0082331 | 3300046794 | Bacteria | 1565 |
| 680 | Ga0495600_0013215 | 3300046809 | Bacteria | 5183 |
| 681 | Ga0495600_0032687 | 3300046809 | Bacteria | 3376 |
| 682 | Ga0495600_0044562 | 3300046809 | Bacteria | 2894 |
| 683 | Ga0495600_0143413 | 3300046809 | Bacteria | 1549 |
| 684 | Ga0495660_0138054 | 3300046810 | Bacteria | 1216 |
| 685 | Ga0495581_0005698 | 3300047315 | Bacteria | 7224 |
| 686 | Ga0495581_0006202 | 3300047315 | Bacteria | 6934 |
| 687 | Ga0495581_0006589 | 3300047315 | Bacteria | 6728 |
| 688 | Ga0495581_0023067 | 3300047315 | Bacteria | 3606 |
| 689 | Ga0495604_0005007 | 3300047317 | Bacteria | 10494 |
| 690 | Ga0495604_0036700 | 3300047317 | Bacteria | 3864 |
| 691 | Ga0495604_0037578 | 3300047317 | Bacteria | 3812 |
| 692 | Ga0495604_0126928 | 3300047317 | Bacteria | 1838 |
| 693 | Ga0495674_0022004 | 3300047319 | Bacteria | 5885 |
| 694 | Ga0495674_0023710 | 3300047319 | Bacteria | 5651 |
| 695 | Ga0495674_0036272 | 3300047319 | Bacteria | 4439 |
| 696 | Ga0495674_0045553 | 3300047319 | Bacteria | 3894 |
| 697 | Ga0495674_0082240 | 3300047319 | Bacteria | 2761 |
| 698 | Ga0495674_0094523 | 3300047319 | Bacteria | 2549 |
| 699 | Ga0495674_0294906 | 3300047319 | Bacteria | 1325 |
| 700 | Ga0495672_0003028 | 3300047320 | Bacteria | 14773 |
| 701 | Ga0495676_0017431 | 3300047321 | Bacteria | 6351 |
| 702 | Ga0495676_0038899 | 3300047321 | Bacteria | 3946 |
| 703 | Ga0495676_0046582 | 3300047321 | Bacteria | 3517 |
| 704 | Ga0495676_0105211 | 3300047321 | Bacteria | 2081 |
| 705 | Ga0495680_0007394 | 3300047322 | Bacteria | 10075 |
| 706 | Ga0495680_0021369 | 3300047322 | Bacteria | 5419 |
| 707 | Ga0495680_0035715 | 3300047322 | Bacteria | 4000 |
| 708 | Ga0495680_0086575 | 3300047322 | Bacteria | 2357 |
| 709 | Ga0495683_0002898 | 3300047323 | Bacteria | 10143 |
| 710 | Ga0495683_0006607 | 3300047323 | Bacteria | 6323 |
| 711 | Ga0495683_0075182 | 3300047323 | Bacteria | 1654 |
| 712 | Ga0495683_0084673 | 3300047323 | Bacteria | 1542 |
| 713 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 714 | Ga0495687_006437 | 3300047443 | Bacteria | 7197 |
| 715 | Ga0495687_017752 | 3300047443 | Bacteria | 3535 |
| 716 | Ga0495687_060421 | 3300047443 | Bacteria | 1563 |
| 717 | Ga0495675_0003779 | 3300047444 | Bacteria | 9156 |
| 718 | Ga0495675_0024722 | 3300047444 | Bacteria | 3831 |
| 719 | Ga0495675_0036826 | 3300047444 | Bacteria | 3119 |
| 720 | Ga0495675_0132796 | 3300047444 | Bacteria | 1546 |
| 721 | Ga0495679_000109 | 3300047446 | Bacteria | 74134 |
| 722 | Ga0495679_003488 | 3300047446 | Bacteria | 7534 |
| 723 | Ga0495673_0040365 | 3300047469 | Bacteria | 2109 |
| 724 | Ga0495673_0051646 | 3300047469 | Bacteria | 1799 |
| 725 | Ga0495673_0096997 | 3300047469 | Bacteria | 1197 |
| 726 | Ga0495684_0110236 | 3300047471 | Bacteria | 2078 |
| 727 | Ga0495684_0132016 | 3300047471 | Bacteria | 1875 |
| 728 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 729 | Ga0495686_0014261 | 3300047472 | Bacteria | 5475 |
| 730 | Ga0495593_0001995 | 3300047673 | Bacteria | 12169 |
| 731 | Ga0495593_0004554 | 3300047673 | Bacteria | 8236 |
| 732 | Ga0495593_0006696 | 3300047673 | Bacteria | 6745 |
| 733 | Ga0495593_0010859 | 3300047673 | Bacteria | 5250 |
| 734 | Ga0495593_0018130 | 3300047673 | Bacteria | 3958 |
| 735 | Ga0495593_0025266 | 3300047673 | Bacteria | 3287 |
| 736 | Ga0495602_0019497 | 3300048088 | Bacteria | 6730 |
| 737 | Ga0495602_0027611 | 3300048088 | Bacteria | 5452 |
| 738 | Ga0495614_0000770 | 3300048089 | Bacteria | 13577 |
| 739 | Ga0495614_0006640 | 3300048089 | Bacteria | 5181 |
| 740 | Ga0495614_0082923 | 3300048089 | Bacteria | 1390 |
| 741 | Ga0495626_0017922 | 3300048091 | Bacteria | 3569 |
| 742 | Ga0495626_0021549 | 3300048091 | Bacteria | 3197 |
| 743 | Ga0495626_0049299 | 3300048091 | Bacteria | 1950 |
| 744 | Ga0496100_0003845 | 3300048903 | Bacteria | 7874 |
| 745 | Ga0496100_0009676 | 3300048903 | Bacteria | 5422 |
| 746 | Ga0496100_0018508 | 3300048903 | Bacteria | 4133 |
| 747 | Ga0496100_0039852 | 3300048903 | Bacteria | 2985 |
| 748 | Ga0496100_0136746 | 3300048903 | Bacteria | 1732 |
| 749 | Ga0496101_0006420 | 3300048904 | Bacteria | 7564 |
| 750 | Ga0496101_0128488 | 3300048904 | Bacteria | 1922 |
| 751 | Ga0496102_0001889 | 3300048905 | Bacteria | 18052 |
| 752 | Ga0496102_0003852 | 3300048905 | Bacteria | 12706 |
| 753 | Ga0496102_0021914 | 3300048905 | Bacteria | 5657 |
| 754 | Ga0496102_0035899 | 3300048905 | Bacteria | 4464 |
| 755 | Ga0496102_0048343 | 3300048905 | Bacteria | 3868 |
| 756 | Ga0496102_0269160 | 3300048905 | Bacteria | 1606 |
| 757 | Ga0496103_0006863 | 3300048906 | Bacteria | 6798 |
| 758 | Ga0496103_0011673 | 3300048906 | Bacteria | 5211 |
| 759 | Ga0496103_0019064 | 3300048906 | Bacteria | 4120 |
| 760 | Ga0496103_0040992 | 3300048906 | Bacteria | 2846 |
| 761 | Ga0496104_0028881 | 3300048907 | Bacteria | 5142 |
| 762 | Ga0496104_0054037 | 3300048907 | Bacteria | 3796 |
| 763 | Ga0496105_0008551 | 3300048908 | Bacteria | 7952 |
| 764 | Ga0496105_0052227 | 3300048908 | Bacteria | 3375 |
| 765 | Ga0496105_0107959 | 3300048908 | Bacteria | 2298 |
| 766 | Ga0496105_0171307 | 3300048908 | Bacteria | 1779 |
| 767 | Ga0496105_0173630 | 3300048908 | Bacteria | 1766 |
| 768 | Ga0496105_0208750 | 3300048908 | Bacteria | 1592 |
| 769 | Ga0496106_0000031 | 3300048909 | Bacteria | 135370 |
| 770 | Ga0496106_0019590 | 3300048909 | Bacteria | 5019 |
| 771 | Ga0496106_0089452 | 3300048909 | Bacteria | 2374 |
| 772 | Ga0496107_0023185 | 3300048910 | Bacteria | 4388 |
| 773 | Ga0496107_0085859 | 3300048910 | Bacteria | 2296 |
| 774 | Ga0496107_0116962 | 3300048910 | Bacteria | 1963 |
| 775 | Ga0496108_0232750 | 3300048911 | Bacteria | 1602 |
| 776 | Ga0496109_0240207 | 3300048912 | Bacteria | 1705 |
| 777 | Ga0496109_0281411 | 3300048912 | Bacteria | 1568 |
| 778 | Ga0496110_0026740 | 3300048913 | Bacteria | 4941 |
| 779 | Ga0496110_0156871 | 3300048913 | Bacteria | 2062 |
| 780 | Ga0496111_0060199 | 3300048914 | Bacteria | 2752 |
| 781 | Ga0496112_0008182 | 3300048915 | Bacteria | 9348 |
| 782 | Ga0496112_0041577 | 3300048915 | Bacteria | 4498 |
| 783 | Ga0496113_0011230 | 3300048916 | Bacteria | 5964 |
| 784 | Ga0496113_0256718 | 3300048916 | Bacteria | 1396 |
| 785 | Ga0496114_0001502 | 3300048917 | Bacteria | 17697 |
| 786 | Ga0496114_0275292 | 3300048917 | Bacteria | 1483 |
| 787 | Ga0496114_0318659 | 3300048917 | Bacteria | 1374 |
| 788 | Ga0496115_0113660 | 3300048918 | Bacteria | 2225 |
| 789 | Ga0496116_0012792 | 3300048919 | Bacteria | 6818 |
| 790 | Ga0496116_0066210 | 3300048919 | Bacteria | 2313 |
| 791 | Ga0496116_0104757 | 3300048919 | Bacteria | 1680 |
| 792 | Ga0496117_0004561 | 3300048920 | Bacteria | 15167 |
| 793 | Ga0496117_0008670 | 3300048920 | Bacteria | 9612 |
| 794 | Ga0496117_0010958 | 3300048920 | Bacteria | 8171 |
| 795 | Ga0496117_0011477 | 3300048920 | Bacteria | 7934 |
| 796 | Ga0496117_0017799 | 3300048920 | Bacteria | 5923 |
| 797 | Ga0496117_0064264 | 3300048920 | Bacteria | 2503 |
| 798 | Ga0496118_0001983 | 3300048921 | Bacteria | 29083 |
| 799 | Ga0496118_0002651 | 3300048921 | Bacteria | 23694 |
| 800 | Ga0496118_0013236 | 3300048921 | Bacteria | 7825 |
| 801 | Ga0496118_0017009 | 3300048921 | Bacteria | 6642 |
| 802 | Ga0496118_0020524 | 3300048921 | Bacteria | 5854 |
| 803 | Ga0496118_0022762 | 3300048921 | Bacteria | 5463 |
| 804 | Ga0496118_0027358 | 3300048921 | Bacteria | 4828 |
| 805 | Ga0496118_0043345 | 3300048921 | Bacteria | 3538 |
| 806 | Ga0496118_0056034 | 3300048921 | Bacteria | 2967 |
| 807 | Ga0496118_0104184 | 3300048921 | Bacteria | 1905 |
| 808 | Ga0496118_0131107 | 3300048921 | Bacteria | 1610 |
| 809 | Ga0496121_0000305 | 3300048924 | Bacteria | 102256 |
| 810 | Ga0496121_0006229 | 3300048924 | Bacteria | 14945 |
| 811 | Ga0496121_0028228 | 3300048924 | Bacteria | 5228 |
| 812 | Ga0496121_0074371 | 3300048924 | Bacteria | 2718 |
| 813 | Ga0496121_0082136 | 3300048924 | Bacteria | 2548 |
| 814 | Ga0496121_0156425 | 3300048924 | Bacteria | 1672 |
| 815 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 816 | Ga0496122_0026227 | 3300048925 | Bacteria | 5032 |
| 817 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 818 | Ga0496123_0028101 | 3300048926 | Bacteria | 4172 |
| 819 | Ga0496123_0028452 | 3300048926 | Bacteria | 4137 |
| 820 | Ga0496123_0126072 | 3300048926 | Bacteria | 1429 |
| 821 | Ga0496124_0026584 | 3300048927 | Bacteria | 5215 |
| 822 | Ga0496124_0031416 | 3300048927 | Bacteria | 4701 |
| 823 | Ga0496124_0054648 | 3300048927 | Bacteria | 3379 |
| 824 | Ga0496125_0032287 | 3300048928 | Bacteria | 4652 |
| 825 | Ga0496126_0001240 | 3300048929 | Bacteria | 41387 |
| 826 | Ga0496126_0003440 | 3300048929 | Bacteria | 19979 |
| 827 | Ga0496126_0003523 | 3300048929 | Bacteria | 19696 |
| 828 | Ga0496126_0016774 | 3300048929 | Bacteria | 7314 |
| 829 | Ga0496126_0198119 | 3300048929 | Bacteria | 1697 |
| 830 | Ga0496126_0244826 | 3300048929 | Bacteria | 1496 |
| 831 | Ga0496126_0315125 | 3300048929 | Bacteria | 1287 |
| 832 | Ga0495678_017996 | 3300049459 | Bacteria | 3186 |
| 833 | Ga0495678_051418 | 3300049459 | Bacteria | 1593 |
| 834 | Ga0495678_058272 | 3300049459 | Bacteria | 1460 |
| 835 | Ga0495682_0007262 | 3300049460 | Bacteria | 4423 |
| 836 | Ga0495682_0015318 | 3300049460 | Bacteria | 2905 |
| 837 | Ga0495682_0060012 | 3300049460 | Bacteria | 1374 |
| 838 | Ga0501225_0002703 | 3300049705 | Bacteria | 5446 |
| 839 | Ga0501280_000651 | 3300049776 | Bacteria | 7785 |
| 840 | nmdc:mga03683_11163_c1 | 3300050489 | Bacteria | 3242 |
| 841 | nmdc:mga03683_25651_c1 | 3300050489 | Bacteria | 2318 |
| 842 | nmdc:mga03683_45642_c1 | 3300050489 | Bacteria | 1814 |
| 843 | nmdc:mga03683_51169_c1 | 3300050489 | Bacteria | 1723 |
| 844 | nmdc:mga03683_53022_c1 | 3300050489 | Bacteria | 1697 |
| 845 | nmdc:mga03683_80225_c1 | 3300050489 | Bacteria | 1408 |
| 846 | nmdc:mga03n38_21763_c1 | 3300050490 | Bacteria | 2585 |
| 847 | nmdc:mga03n38_24136_c1 | 3300050490 | Bacteria | 2483 |
| 848 | nmdc:mga03n38_49718_c1 | 3300050490 | Bacteria | 1865 |
| 849 | nmdc:mga00v17_126852_c1 | 3300050491 | Bacteria | 1629 |
| 850 | nmdc:mga00v17_190727_c1 | 3300050491 | Bacteria | 1324 |
| 851 | nmdc:mga0yw44_16735_c1 | 3300050492 | Bacteria | 3971 |
| 852 | nmdc:mga0k408_116628_c1 | 3300050493 | Bacteria | 1580 |
| 853 | nmdc:mga0k408_196920_c1 | 3300050493 | Bacteria | 1202 |
| 854 | nmdc:mga0k408_61213_c1 | 3300050493 | Bacteria | 2188 |
| 855 | nmdc:mga06z11_44049_c1 | 3300050494 | Bacteria | 2248 |
| 856 | nmdc:mga04h51_31327_c1 | 3300050495 | Bacteria | 1680 |
| 857 | nmdc:mga07m45_113912_c1 | 3300050496 | Bacteria | 1559 |
| 858 | nmdc:mga07m45_143028_c1 | 3300050496 | Bacteria | 1386 |
| 859 | nmdc:mga07m45_34458_c1 | 3300050496 | Bacteria | 2814 |
| 860 | nmdc:mga07m45_356_c1 | 3300050496 | Bacteria | 18703 |
| 861 | nmdc:mga07m45_8280_c1 | 3300050496 | Bacteria | 5336 |
| 862 | nmdc:mga07m45_89697_c1 | 3300050496 | Bacteria | 1761 |
| 863 | nmdc:mga0sz30_34877_c1 | 3300050516 | Bacteria | 2097 |
| 864 | Ga0500610_0000451 | 3300053079 | Bacteria | 12670 |
| 865 | Ga0500610_0001074 | 3300053079 | Bacteria | 8980 |
| 866 | Ga0500643_001718 | 3300053087 | Bacteria | 12168 |
| 867 | Ga0500583_0002376 | 3300053092 | Bacteria | 5640 |
| 868 | Ga0500651_0000642 | 3300053093 | Bacteria | 17399 |
| 869 | Ga0500569_023454 | 3300053109 | Bacteria | 1659 |
| 870 | Ga0500571_000477 | 3300053110 | Bacteria | 16305 |
| 871 | Ga0500592_003170 | 3300053116 | Bacteria | 2630 |
| 872 | Ga0500593_000735 | 3300053117 | Bacteria | 12377 |
| 873 | Ga0500594_0007251 | 3300053118 | Bacteria | 2506 |
| 874 | Ga0500597_019885 | 3300053120 | Bacteria | 2627 |
| 875 | Ga0500607_003250 | 3300053121 | Bacteria | 12002 |
| 876 | Ga0500607_010629 | 3300053121 | Bacteria | 5468 |
| 877 | Ga0500608_003396 | 3300053122 | Bacteria | 5963 |
| 878 | Ga0500608_080724 | 3300053122 | Bacteria | 1535 |
| 879 | Ga0500618_001179 | 3300053125 | Bacteria | 12614 |
| 880 | Ga0500655_000925 | 3300053133 | Bacteria | 5678 |
| 881 | Ga0500658_0000263 | 3300053134 | Bacteria | 24167 |
| 882 | Ga0500658_0001281 | 3300053134 | Bacteria | 10197 |
| 883 | Ga0500559_0001594 | 3300053136 | Bacteria | 12620 |
| 884 | Ga0500559_0002800 | 3300053136 | Bacteria | 8815 |
| 885 | Ga0500564_013191 | 3300053138 | Bacteria | 3693 |
| 886 | Ga0500568_0001164 | 3300053139 | Bacteria | 17590 |
| 887 | Ga0500568_0001787 | 3300053139 | Bacteria | 13260 |
| 888 | Ga0500574_039308 | 3300053141 | Bacteria | 1313 |
| 889 | Ga0500604_0000752 | 3300053151 | Bacteria | 8867 |
| 890 | Ga0500616_0011322 | 3300053153 | Bacteria | 5277 |
| 891 | Ga0500624_003981 | 3300053157 | Bacteria | 1939 |
| 892 | Ga0500627_0004123 | 3300053158 | Bacteria | 4613 |
| 893 | Ga0500634_0002263 | 3300053161 | Bacteria | 8034 |
| 894 | Ga0500636_0015064 | 3300053177 | Bacteria | 4552 |
| 895 | Ga0466962_0008411 | 3300061719 | Bacteria | 4944 |
| 896 | Ga0466962_0016712 | 3300061719 | Bacteria | 3538 |
| 897 | Ga0466962_0061442 | 3300061719 | Bacteria | 1793 |
| 898 | Ga0466962_0070809 | 3300061719 | Bacteria | 1666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041999 | Ga0439433_0000895 | Ga0439433_0000895_2803_3816 | 278 |
| 2 | 3300048929 | Ga0496126_0315125 | Ga0496126_0315125_405_1277 | 286 |
| 3 | 3300025893 | Ga0207682_10034113 | Ga0207682_100341132 | 303 |
| 4 | 3300041512 | Ga0451853_4091276 | Ga0451853_4091276_340_1257 | 305 |
| 5 | 3300003354 | JGI25160J50197_1006483 | JGI25160J50197_10064832 | 309 |
| 6 | 3300003374 | JGI25161J50226_1002287 | JGI25161J50226_10022872 | 309 |
| 7 | 3300003771 | Ga0055526_1004608 | Ga0055526_10046085 | 309 |
| 8 | 3300003781 | Ga0055536_1001267 | Ga0055536_100126712 | 309 |
| 9 | 3300003791 | Ga0055530_10001555 | Ga0055530_1000155511 | 309 |
| 10 | 3300003794 | Ga0055531_10004876 | Ga0055531_100048765 | 309 |
| 11 | 3300004625 | Ga0055543_1002259 | Ga0055543_10022597 | 309 |
| 12 | 3300050490 | nmdc:mga03n38_49718_c1 | nmdc:mga03n38_49718_c1_60_1001 | 309 |
| 13 | 3300050493 | nmdc:mga0k408_196920_c1 | nmdc:mga0k408_196920_c1_25_963 | 309 |
| 14 | 3300031238 | Ga0265332_10000013 | Ga0265332_1000001330 | 314 |
| 15 | 3300042007 | Ga0439449_0004140 | Ga0439449_0004140_4215_5177 | 318 |
| 16 | 3300046507 | Ga0495606_0138973 | Ga0495606_0138973_444_1409 | 319 |
| 17 | 3300032133 | Ga0316583_10029627 | Ga0316583_100296272 | 322 |
| 18 | 3300042876 | Ga0451577_0003100 | Ga0451577_0003100_9210_10187 | 323 |
| 19 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_1071226_1072203 | 323 |
| 20 | 3300044712 | Ga0453684_0005751 | Ga0453684_0005751_10521_11498 | 323 |
| 21 | 3300005457 | Ga0070662_100267055 | Ga0070662_1002670551 | 324 |
| 22 | 3300006048 | Ga0075363_100182109 | Ga0075363_1001821092 | 324 |
| 23 | 3300006177 | Ga0075362_10031860 | Ga0075362_100318602 | 324 |
| 24 | 3300006353 | Ga0075370_10031089 | Ga0075370_100310893 | 324 |
| 25 | 3300017792 | Ga0163161_10016751 | Ga0163161_100167512 | 324 |
| 26 | 3300032002 | Ga0307416_100462395 | Ga0307416_1004623952 | 324 |
| 27 | 3300032005 | Ga0307411_10020506 | Ga0307411_100205064 | 324 |
| 28 | 3300041407 | Ga0439447_002633 | Ga0439447_002633_2499_3497 | 324 |
| 29 | 3300042876 | Ga0451577_0091835 | Ga0451577_0091835_358_1338 | 324 |
| 30 | 3300044673 | Ga0453683_0156859 | Ga0453683_0156859_272_1252 | 324 |
| 31 | 3300044712 | Ga0453684_0004902 | Ga0453684_0004902_7956_8936 | 324 |
| 32 | 3300045051 | Ga0451576_0000738 | Ga0451576_0000738_56267_57247 | 324 |
| 33 | 3300046525 | Ga0495663_0002160 | Ga0495663_0002160_3800_4798 | 324 |
| 34 | 3300046616 | Ga0495668_0011933 | Ga0495668_0011933_4087_5085 | 324 |
| 35 | 3300048924 | Ga0496121_0028228 | Ga0496121_0028228_720_1706 | 324 |
| 36 | 3300006195 | Ga0075366_10006163 | Ga0075366_100061636 | 325 |
| 37 | 3300013307 | Ga0157372_10019343 | Ga0157372_100193437 | 325 |
| 38 | 3300028379 | Ga0268266_10240987 | Ga0268266_102409872 | 325 |
| 39 | 3300028794 | Ga0307515_10000028 | Ga0307515_10000028270 | 325 |
| 40 | 3300031456 | Ga0307513_10116636 | Ga0307513_101166363 | 325 |
| 41 | 3300031901 | Ga0307406_10033625 | Ga0307406_100336253 | 325 |
| 42 | 3300046460 | Ga0495638_0028169 | Ga0495638_0028169_1407_2396 | 325 |
| 43 | 3300046512 | Ga0495610_0019946 | Ga0495610_0019946_2649_3638 | 325 |
| 44 | 3300046513 | Ga0495616_0002124 | Ga0495616_0002124_5721_6710 | 325 |
| 45 | 3300046518 | Ga0495631_0001388 | Ga0495631_0001388_3391_4380 | 325 |
| 46 | 3300046530 | Ga0495654_0018415 | Ga0495654_0018415_768_1757 | 325 |
| 47 | 3300046539 | Ga0495621_0009096 | Ga0495621_0009096_612_1601 | 325 |
| 48 | 3300046616 | Ga0495668_0041562 | Ga0495668_0041562_1351_2340 | 325 |
| 49 | 3300047321 | Ga0495676_0038899 | Ga0495676_0038899_654_1643 | 325 |
| 50 | 3300048921 | Ga0496118_0013236 | Ga0496118_0013236_2076_3065 | 325 |
| 51 | 3300048927 | Ga0496124_0054648 | Ga0496124_0054648_19_1008 | 325 |
| 52 | 3300048928 | Ga0496125_0032287 | Ga0496125_0032287_2378_3367 | 325 |
| 53 | 3300053087 | Ga0500643_001718 | Ga0500643_001718_7263_8252 | 325 |
| 54 | 3300053093 | Ga0500651_0000642 | Ga0500651_0000642_6883_7872 | 325 |
| 55 | 3300053110 | Ga0500571_000477 | Ga0500571_000477_4361_5350 | 325 |
| 56 | 3300053116 | Ga0500592_003170 | Ga0500592_003170_773_1762 | 325 |
| 57 | 3300053118 | Ga0500594_0007251 | Ga0500594_0007251_1126_2115 | 325 |
| 58 | 3300053133 | Ga0500655_000925 | Ga0500655_000925_3878_4867 | 325 |
| 59 | 3300053134 | Ga0500658_0000263 | Ga0500658_0000263_10024_11013 | 325 |
| 60 | 3300053136 | Ga0500559_0001594 | Ga0500559_0001594_2885_3874 | 325 |
| 61 | 3300053138 | Ga0500564_013191 | Ga0500564_013191_2658_3647 | 325 |
| 62 | 3300053139 | Ga0500568_0001787 | Ga0500568_0001787_6854_7843 | 325 |
| 63 | 3300053153 | Ga0500616_0011322 | Ga0500616_0011322_4218_5207 | 325 |
| 64 | 3300053157 | Ga0500624_003981 | Ga0500624_003981_393_1382 | 325 |
| 65 | 3300053177 | Ga0500636_0015064 | Ga0500636_0015064_1627_2616 | 325 |
| 66 | iso_pu_bacteria | 2643221593 | 2643975203 | 326 |
| 67 | 3300005339 | Ga0070660_100000032 | Ga0070660_10000003271 | 327 |
| 68 | 3300005366 | Ga0070659_100000355 | Ga0070659_1000003552 | 327 |
| 69 | 3300005455 | Ga0070663_100009295 | Ga0070663_1000092951 | 327 |
| 70 | 3300005563 | Ga0068855_100022698 | Ga0068855_1000226984 | 327 |
| 71 | 3300009093 | Ga0105240_10089914 | Ga0105240_100899142 | 327 |
| 72 | 3300010375 | Ga0105239_10036412 | Ga0105239_100364126 | 327 |
| 73 | 3300013104 | Ga0157370_10193324 | Ga0157370_101933243 | 327 |
| 74 | 3300025919 | Ga0207657_10000051 | Ga0207657_1000005168 | 327 |
| 75 | 3300025932 | Ga0207690_10000034 | Ga0207690_10000034103 | 327 |
| 76 | 3300025949 | Ga0207667_10202305 | Ga0207667_102023052 | 327 |
| 77 | 3300026067 | Ga0207678_10002721 | Ga0207678_100027215 | 327 |
| 78 | 3300031241 | Ga0265325_10000262 | Ga0265325_1000026224 | 327 |
| 79 | 3300003187 | JGI25151J46595_10002025 | JGI25151J46595_1000202512 | 328 |
| 80 | 3300025245 | Ga0207425_1002925 | Ga0207425_10029255 | 328 |
| 81 | 3300025294 | Ga0209025_1000134 | Ga0209025_10001343 | 328 |
| 82 | 3300025297 | Ga0209758_1014045 | Ga0209758_10140452 | 328 |
| 83 | 3300053139 | Ga0500568_0001164 | Ga0500568_0001164_9341_10384 | 328 |
| 84 | 3300046530 | Ga0495654_0028146 | Ga0495654_0028146_996_2000 | 329 |
| 85 | 3300001979 | JGI24740J21852_10007221 | JGI24740J21852_100072214 | 330 |
| 86 | 3300002067 | JGI24735J21928_10049111 | JGI24735J21928_100491111 | 330 |
| 87 | 3300003758 | Ga0055532_1002081 | Ga0055532_10020816 | 330 |
| 88 | 3300003760 | Ga0055527_1001374 | Ga0055527_10013746 | 330 |
| 89 | 3300003761 | Ga0055535_1002982 | Ga0055535_10029826 | 330 |
| 90 | 3300003762 | Ga0055542_1002094 | Ga0055542_10020946 | 330 |
| 91 | 3300005289 | Ga0065704_10072545 | Ga0065704_100725452 | 330 |
| 92 | 3300005616 | Ga0068852_100003043 | Ga0068852_1000030437 | 330 |
| 93 | 3300009092 | Ga0105250_10006717 | Ga0105250_100067176 | 330 |
| 94 | 3300009545 | Ga0105237_10063269 | Ga0105237_100632696 | 330 |
| 95 | 3300009551 | Ga0105238_10037100 | Ga0105238_100371005 | 330 |
| 96 | 3300013306 | Ga0163162_10047011 | Ga0163162_100470113 | 330 |
| 97 | 3300015261 | Ga0182006_1030114 | Ga0182006_10301143 | 330 |
| 98 | 3300017792 | Ga0163161_10005081 | Ga0163161_100050818 | 330 |
| 99 | 3300025228 | Ga0209672_100038 | Ga0209672_100038149 | 330 |
| 100 | 3300025229 | Ga0209147_100112 | Ga0209147_1001128 | 330 |
| 101 | 3300025242 | Ga0209258_100109 | Ga0209258_10010927 | 330 |
| 102 | 3300025254 | Ga0209148_1000997 | Ga0209148_10009978 | 330 |
| 103 | 3300025272 | Ga0209455_1014935 | Ga0209455_10149353 | 330 |
| 104 | 3300025904 | Ga0207647_10004135 | Ga0207647_100041353 | 330 |
| 105 | 3300025913 | Ga0207695_10018782 | Ga0207695_100187825 | 330 |
| 106 | 3300025914 | Ga0207671_10059100 | Ga0207671_100591002 | 330 |
| 107 | 3300025924 | Ga0207694_10019539 | Ga0207694_100195394 | 330 |
| 108 | 3300025986 | Ga0207658_10047893 | Ga0207658_100478934 | 330 |
| 109 | 3300026142 | Ga0207698_10010500 | Ga0207698_100105004 | 330 |
| 110 | 3300042015 | Ga0439462_0017172 | Ga0439462_0017172_721_1734 | 330 |
| 111 | 3300045836 | Ga0466958_0001759 | Ga0466958_0001759_7244_8311 | 330 |
| 112 | 3300046475 | Ga0495639_0009089 | Ga0495639_0009089_487_1503 | 330 |
| 113 | 3300046674 | Ga0495588_0035503 | Ga0495588_0035503_228_1244 | 330 |
| 114 | 3300046683 | Ga0495658_0132556 | Ga0495658_0132556_65_1081 | 330 |
| 115 | 3300048903 | Ga0496100_0003845 | Ga0496100_0003845_404_1420 | 330 |
| 116 | 3300048905 | Ga0496102_0001889 | Ga0496102_0001889_3055_4071 | 330 |
| 117 | 3300048906 | Ga0496103_0019064 | Ga0496103_0019064_850_1866 | 330 |
| 118 | 3300048908 | Ga0496105_0008551 | Ga0496105_0008551_5340_6356 | 330 |
| 119 | 3300048909 | Ga0496106_0089452 | Ga0496106_0089452_313_1329 | 330 |
| 120 | 3300048917 | Ga0496114_0275292 | Ga0496114_0275292_106_1122 | 330 |
| 121 | 3300015262 | Ga0182007_10016384 | Ga0182007_100163843 | 331 |
| 122 | 3300015683 | Ga0183362_10001 | Ga0183362_100011582 | 331 |
| 123 | 3300044683 | Ga0466965_0032927 | Ga0466965_0032927_1030_2094 | 331 |
| 124 | 3300044712 | Ga0453684_0000583 | Ga0453684_0000583_38145_39170 | 331 |
| 125 | 3300045051 | Ga0451576_0000137 | Ga0451576_0000137_96771_97796 | 331 |
| 126 | 3300046674 | Ga0495588_0025253 | Ga0495588_0025253_327_1331 | 331 |
| 127 | iso_pu_bacteria | 2643221658 | 2644328106 | 331 |
| 128 | iso_pu_bacteria | 2643221683 | 2644468670 | 331 |
| 129 | 3300037312 | Ga0395899_0000008 | Ga0395899_0000008_355983_357050 | 332 |
| 130 | 3300037418 | Ga0395900_0000055 | Ga0395900_0000055_8286_9353 | 332 |
| 131 | 3300037466 | Ga0395898_0000119 | Ga0395898_0000119_38765_39832 | 332 |
| 132 | 3300061719 | Ga0466962_0070809 | Ga0466962_0070809_82_1149 | 332 |
| 133 | iso_pu_bacteria | 2885192300 | 2885192875 | 332 |
| 134 | iso_pu_bacteria | 2904541872 | 2904548408 | 332 |
| 135 | iso_pu_bacteria | 2929160207 | 2929163805 | 332 |
| 136 | 3300003781 | Ga0055536_1001135 | Ga0055536_100113512 | 333 |
| 137 | 3300003792 | Ga0055540_1003629 | Ga0055540_10036299 | 333 |
| 138 | 3300009148 | Ga0105243_10004361 | Ga0105243_100043618 | 333 |
| 139 | 3300013104 | Ga0157370_10055529 | Ga0157370_100555293 | 333 |
| 140 | 3300025292 | Ga0209676_1001480 | Ga0209676_10014806 | 333 |
| 141 | 3300025303 | Ga0209051_1001504 | Ga0209051_10015046 | 333 |
| 142 | 3300025935 | Ga0207709_10001032 | Ga0207709_100010329 | 333 |
| 143 | 3300032002 | Ga0307416_100023777 | Ga0307416_1000237772 | 333 |
| 144 | 3300046524 | Ga0495648_0022600 | Ga0495648_0022600_3137_4207 | 333 |
| 145 | iso_pu_bacteria | 2513020051 | 2513227435 | 333 |
| 146 | iso_pu_bacteria | 2599185214 | 2599624543 | 333 |
| 147 | iso_pu_bacteria | 2599185226 | 2599672595 | 333 |
| 148 | iso_pu_bacteria | 2599185227 | 2599683595 | 333 |
| 149 | iso_pu_bacteria | 2599185229 | 2599694204 | 333 |
| 150 | iso_pu_bacteria | 2643221628 | 2644163141 | 333 |
| 151 | iso_pu_bacteria | 2643221672 | 2644398585 | 333 |
| 152 | iso_pu_bacteria | 2738541277 | 2738720157 | 333 |
| 153 | iso_pu_bacteria | 2738543019 | 2739279356 | 333 |
| 154 | iso_pu_bacteria | 2831265667 | 2831266895 | 333 |
| 155 | iso_pu_bacteria | 2838054893 | 2838056954 | 333 |
| 156 | iso_pu_bacteria | 2842677519 | 2842678772 | 333 |
| 157 | iso_pu_bacteria | 2885198086 | 2885199050 | 333 |
| 158 | iso_pu_bacteria | 2885211737 | 2885212687 | 333 |
| 159 | iso_pu_bacteria | 2928070936 | 2928071057 | 333 |
| 160 | 3300048926 | Ga0496123_0028452 | Ga0496123_0028452_2172_3272 | 334 |
| 161 | 3300003187 | JGI25151J46595_10003922 | JGI25151J46595_100039229 | 335 |
| 162 | 3300003773 | Ga0055537_1000390 | Ga0055537_100039014 | 335 |
| 163 | 3300003781 | Ga0055536_1002880 | Ga0055536_10028804 | 335 |
| 164 | 3300003784 | Ga0055534_1000349 | Ga0055534_100034912 | 335 |
| 165 | 3300003790 | Ga0055528_1000914 | Ga0055528_100091412 | 335 |
| 166 | 3300003792 | Ga0055540_1000996 | Ga0055540_100099611 | 335 |
| 167 | 3300003792 | Ga0055540_1003698 | Ga0055540_10036985 | 335 |
| 168 | 3300003794 | Ga0055531_10001175 | Ga0055531_1000117511 | 335 |
| 169 | 3300005288 | Ga0065714_10008370 | Ga0065714_100083703 | 335 |
| 170 | 3300005366 | Ga0070659_100304392 | Ga0070659_1003043922 | 335 |
| 171 | 3300005456 | Ga0070678_100109415 | Ga0070678_1001094152 | 335 |
| 172 | 3300005457 | Ga0070662_100017863 | Ga0070662_1000178633 | 335 |
| 173 | 3300005539 | Ga0068853_100081717 | Ga0068853_1000817172 | 335 |
| 174 | 3300005564 | Ga0070664_100029930 | Ga0070664_1000299302 | 335 |
| 175 | 3300005616 | Ga0068852_100136933 | Ga0068852_1001369333 | 335 |
| 176 | 3300005844 | Ga0068862_100153601 | Ga0068862_1001536013 | 335 |
| 177 | 3300006048 | Ga0075363_100033095 | Ga0075363_1000330951 | 335 |
| 178 | 3300006051 | Ga0075364_10008450 | Ga0075364_100084505 | 335 |
| 179 | 3300006177 | Ga0075362_10030423 | Ga0075362_100304232 | 335 |
| 180 | 3300006177 | Ga0075362_10033809 | Ga0075362_100338093 | 335 |
| 181 | 3300006178 | Ga0075367_10023801 | Ga0075367_100238014 | 335 |
| 182 | 3300006195 | Ga0075366_10003695 | Ga0075366_100036954 | 335 |
| 183 | 3300006353 | Ga0075370_10001351 | Ga0075370_100013515 | 335 |
| 184 | 3300006353 | Ga0075370_10001937 | Ga0075370_100019373 | 335 |
| 185 | 3300006353 | Ga0075370_10128971 | Ga0075370_101289712 | 335 |
| 186 | 3300006358 | Ga0068871_100223272 | Ga0068871_1002232722 | 335 |
| 187 | 3300006948 | Ga0099826_10030220 | Ga0099826_100302202 | 335 |
| 188 | 3300009036 | Ga0105244_10001759 | Ga0105244_100017595 | 335 |
| 189 | 3300009093 | Ga0105240_10045631 | Ga0105240_100456314 | 335 |
| 190 | 3300009148 | Ga0105243_10002439 | Ga0105243_100024395 | 335 |
| 191 | 3300009545 | Ga0105237_10057546 | Ga0105237_100575463 | 335 |
| 192 | 3300011119 | Ga0105246_10061294 | Ga0105246_100612944 | 335 |
| 193 | 3300014497 | Ga0182008_10001707 | Ga0182008_1000170712 | 335 |
| 194 | 3300015261 | Ga0182006_1000990 | Ga0182006_100099011 | 335 |
| 195 | 3300015262 | Ga0182007_10000673 | Ga0182007_1000067311 | 335 |
| 196 | 3300015262 | Ga0182007_10005814 | Ga0182007_100058143 | 335 |
| 197 | 3300017792 | Ga0163161_10011455 | Ga0163161_100114552 | 335 |
| 198 | 3300025208 | Ga0209436_103577 | Ga0209436_1035773 | 335 |
| 199 | 3300025258 | Ga0209129_1001975 | Ga0209129_100197511 | 335 |
| 200 | 3300025263 | Ga0209565_1000288 | Ga0209565_100028814 | 335 |
| 201 | 3300025263 | Ga0209565_1001947 | Ga0209565_10019477 | 335 |
| 202 | 3300025273 | Ga0209673_1000838 | Ga0209673_10008389 | 335 |
| 203 | 3300025273 | Ga0209673_1001258 | Ga0209673_10012587 | 335 |
| 204 | 3300025284 | Ga0209130_1001550 | Ga0209130_100155010 | 335 |
| 205 | 3300025291 | Ga0209675_1000276 | Ga0209675_100027614 | 335 |
| 206 | 3300025291 | Ga0209675_1002155 | Ga0209675_10021556 | 335 |
| 207 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005560 | 335 |
| 208 | 3300025292 | Ga0209676_1003545 | Ga0209676_10035459 | 335 |
| 209 | 3300025292 | Ga0209676_1017071 | Ga0209676_10170713 | 335 |
| 210 | 3300025294 | Ga0209025_1000484 | Ga0209025_100048411 | 335 |
| 211 | 3300025294 | Ga0209025_1009028 | Ga0209025_10090284 | 335 |
| 212 | 3300025295 | Ga0209564_1000394 | Ga0209564_100039444 | 335 |
| 213 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007537 | 335 |
| 214 | 3300025298 | Ga0209050_1001433 | Ga0209050_100143318 | 335 |
| 215 | 3300025298 | Ga0209050_1011252 | Ga0209050_10112526 | 335 |
| 216 | 3300025299 | Ga0209256_1000864 | Ga0209256_100086428 | 335 |
| 217 | 3300025302 | Ga0207426_1000031 | Ga0207426_100003179 | 335 |
| 218 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009560 | 335 |
| 219 | 3300025303 | Ga0209051_1000385 | Ga0209051_100038525 | 335 |
| 220 | 3300025303 | Ga0209051_1000781 | Ga0209051_100078117 | 335 |
| 221 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011534 | 335 |
| 222 | 3300025304 | Ga0209257_1001057 | Ga0209257_100105719 | 335 |
| 223 | 3300025728 | Ga0207655_1013658 | Ga0207655_10136584 | 335 |
| 224 | 3300025913 | Ga0207695_10373598 | Ga0207695_103735982 | 335 |
| 225 | 3300025914 | Ga0207671_10103198 | Ga0207671_101031981 | 335 |
| 226 | 3300025924 | Ga0207694_10065076 | Ga0207694_100650762 | 335 |
| 227 | 3300025935 | Ga0207709_10001454 | Ga0207709_1000145410 | 335 |
| 228 | 3300025945 | Ga0207679_10015470 | Ga0207679_100154706 | 335 |
| 229 | 3300025981 | Ga0207640_10215795 | Ga0207640_102157951 | 335 |
| 230 | 3300026041 | Ga0207639_10065918 | Ga0207639_100659184 | 335 |
| 231 | 3300026116 | Ga0207674_10198781 | Ga0207674_101987813 | 335 |
| 232 | 3300026142 | Ga0207698_10111986 | Ga0207698_101119863 | 335 |
| 233 | 3300027666 | Ga0209282_1000334 | Ga0209282_100033413 | 335 |
| 234 | 3300027907 | Ga0207428_10351654 | Ga0207428_103516541 | 335 |
| 235 | 3300028380 | Ga0268265_10118263 | Ga0268265_101182633 | 335 |
| 236 | 3300030731 | Ga0316177_1029429 | Ga0316177_10294293 | 335 |
| 237 | 3300030732 | Ga0316176_1080864 | Ga0316176_10808642 | 335 |
| 238 | 3300030733 | Ga0314311_1124028 | Ga0314311_11240281 | 335 |
| 239 | 3300030736 | Ga0316180_1012367 | Ga0316180_10123674 | 335 |
| 240 | 3300030745 | Ga0316182_1325098 | Ga0316182_13250983 | 335 |
| 241 | 3300031251 | Ga0265327_10000722 | Ga0265327_1000072233 | 335 |
| 242 | 3300031548 | Ga0307408_100114667 | Ga0307408_1001146672 | 335 |
| 243 | 3300031911 | Ga0307412_10061531 | Ga0307412_100615313 | 335 |
| 244 | 3300032004 | Ga0307414_10071445 | Ga0307414_100714452 | 335 |
| 245 | 3300032005 | Ga0307411_10207668 | Ga0307411_102076682 | 335 |
| 246 | 3300041404 | Ga0439436_0002954 | Ga0439436_0002954_1850_2878 | 335 |
| 247 | 3300041406 | Ga0439439_0002400 | Ga0439439_0002400_1415_2443 | 335 |
| 248 | 3300041413 | Ga0439465_0007545 | Ga0439465_0007545_1569_2603 | 335 |
| 249 | 3300042002 | Ga0439442_004394 | Ga0439442_004394_1354_2388 | 335 |
| 250 | 3300042004 | Ga0439445_0008898 | Ga0439445_0008898_636_1670 | 335 |
| 251 | 3300042006 | Ga0439432_003819 | Ga0439432_003819_1851_2879 | 335 |
| 252 | 3300042007 | Ga0439449_0003981 | Ga0439449_0003981_2363_3391 | 335 |
| 253 | 3300042010 | Ga0439452_005772 | Ga0439452_005772_2349_3377 | 335 |
| 254 | 3300042014 | Ga0439457_029009 | Ga0439457_029009_158_1192 | 335 |
| 255 | 3300042131 | Ga0450894_003722 | Ga0450894_003722_100_1128 | 335 |
| 256 | 3300042145 | Ga0450906_001265 | Ga0450906_001265_499_1533 | 335 |
| 257 | 3300042146 | Ga0450907_010923 | Ga0450907_010923_131_1165 | 335 |
| 258 | 3300042156 | Ga0439446_0010238 | Ga0439446_0010238_155_1189 | 335 |
| 259 | 3300042184 | Ga0450908_000841 | Ga0450908_000841_2143_3177 | 335 |
| 260 | 3300042435 | Ga0439434_0001099 | Ga0439434_0001099_3358_4392 | 335 |
| 261 | 3300046453 | Ga0495627_007509 | Ga0495627_007509_463_1494 | 335 |
| 262 | 3300046520 | Ga0495637_0007495 | Ga0495637_0007495_2048_3079 | 335 |
| 263 | 3300046660 | Ga0495625_0000279 | Ga0495625_0000279_11021_12055 | 335 |
| 264 | 3300046660 | Ga0495625_0147991 | Ga0495625_0147991_199_1230 | 335 |
| 265 | 3300046674 | Ga0495588_0008649 | Ga0495588_0008649_2620_3651 | 335 |
| 266 | 3300046691 | Ga0495670_0064305 | Ga0495670_0064305_630_1661 | 335 |
| 267 | 3300046692 | Ga0495671_0002320 | Ga0495671_0002320_2534_3565 | 335 |
| 268 | 3300048919 | Ga0496116_0012792 | Ga0496116_0012792_3139_4170 | 335 |
| 269 | 3300048921 | Ga0496118_0020524 | Ga0496118_0020524_3757_4794 | 335 |
| 270 | 3300049705 | Ga0501225_0002703 | Ga0501225_0002703_2559_3593 | 335 |
| 271 | 3300050489 | nmdc:mga03683_11163_c1 | nmdc:mga03683_11163_c1_59_1093 | 335 |
| 272 | 3300050489 | nmdc:mga03683_45642_c1 | nmdc:mga03683_45642_c1_208_1236 | 335 |
| 273 | 3300050489 | nmdc:mga03683_80225_c1 | nmdc:mga03683_80225_c1_346_1380 | 335 |
| 274 | 3300050490 | nmdc:mga03n38_21763_c1 | nmdc:mga03n38_21763_c1_1482_2516 | 335 |
| 275 | 3300050491 | nmdc:mga00v17_190727_c1 | nmdc:mga00v17_190727_c1_91_1125 | 335 |
| 276 | 3300050492 | nmdc:mga0yw44_16735_c1 | nmdc:mga0yw44_16735_c1_2067_3101 | 335 |
| 277 | 3300050493 | nmdc:mga0k408_116628_c1 | nmdc:mga0k408_116628_c1_256_1284 | 335 |
| 278 | 3300050494 | nmdc:mga06z11_44049_c1 | nmdc:mga06z11_44049_c1_239_1273 | 335 |
| 279 | 3300050496 | nmdc:mga07m45_143028_c1 | nmdc:mga07m45_143028_c1_180_1217 | 335 |
| 280 | 3300050496 | nmdc:mga07m45_356_c1 | nmdc:mga07m45_356_c1_11335_12369 | 335 |
| 281 | 3300050496 | nmdc:mga07m45_8280_c1 | nmdc:mga07m45_8280_c1_1200_2240 | 335 |
| 282 | 3300053079 | Ga0500610_0000451 | Ga0500610_0000451_7880_8911 | 335 |
| 283 | 3300053079 | Ga0500610_0001074 | Ga0500610_0001074_3103_4134 | 335 |
| 284 | 3300053109 | Ga0500569_023454 | Ga0500569_023454_309_1340 | 335 |
| 285 | 3300053117 | Ga0500593_000735 | Ga0500593_000735_2417_3448 | 335 |
| 286 | 3300053121 | Ga0500607_003250 | Ga0500607_003250_2385_3416 | 335 |
| 287 | 3300053121 | Ga0500607_010629 | Ga0500607_010629_2355_3404 | 335 |
| 288 | 3300053122 | Ga0500608_003396 | Ga0500608_003396_3435_4466 | 335 |
| 289 | 3300053158 | Ga0500627_0004123 | Ga0500627_0004123_2191_3222 | 335 |
| 290 | 3300053161 | Ga0500634_0002263 | Ga0500634_0002263_6487_7518 | 335 |
| 291 | iso_pu_bacteria | 2904449895 | 2904456458 | 335 |
| 292 | iso_pu_bacteria | 2904456579 | 2904460679 | 335 |
| 293 | iso_pu_bacteria | 2919462493 | 2919464400 | 335 |
| 294 | iso_pu_bacteria | 2929520902 | 2929524888 | 335 |
| 295 | iso_pu_bacteria | 2945909444 | 2945912459 | 335 |
| 296 | iso_pu_bacteria | 2945945610 | 2945947233 | 335 |
| 297 | iso_pu_bacteria | 2945972063 | 2945976991 | 335 |
| 298 | iso_pu_bacteria | 2945984333 | 2945985222 | 335 |
| 299 | 3300003187 | JGI25151J46595_10008898 | JGI25151J46595_100088982 | 336 |
| 300 | 3300006051 | Ga0075364_10133357 | Ga0075364_101333572 | 336 |
| 301 | 3300017792 | Ga0163161_10000743 | Ga0163161_1000074316 | 336 |
| 302 | 3300025294 | Ga0209025_1002208 | Ga0209025_100220813 | 336 |
| 303 | 3300031731 | Ga0307405_10002949 | Ga0307405_100029494 | 336 |
| 304 | 3300041404 | Ga0439436_0000470 | Ga0439436_0000470_6030_7061 | 336 |
| 305 | 3300041407 | Ga0439447_012795 | Ga0439447_012795_256_1287 | 336 |
| 306 | 3300041410 | Ga0439461_0018568 | Ga0439461_0018568_200_1231 | 336 |
| 307 | 3300041411 | Ga0439466_0003460 | Ga0439466_0003460_2631_3662 | 336 |
| 308 | 3300041413 | Ga0439465_0000108 | Ga0439465_0000108_16731_17762 | 336 |
| 309 | 3300041997 | Ga0439431_0004413 | Ga0439431_0004413_1631_2662 | 336 |
| 310 | 3300042004 | Ga0439445_0001046 | Ga0439445_0001046_1622_2653 | 336 |
| 311 | 3300042006 | Ga0439432_010034 | Ga0439432_010034_21_1052 | 336 |
| 312 | 3300042007 | Ga0439449_0000245 | Ga0439449_0000245_6217_7248 | 336 |
| 313 | 3300042010 | Ga0439452_000792 | Ga0439452_000792_3787_4818 | 336 |
| 314 | 3300042014 | Ga0439457_001278 | Ga0439457_001278_878_1909 | 336 |
| 315 | 3300042185 | Ga0450909_003757 | Ga0450909_003757_944_1975 | 336 |
| 316 | 3300042435 | Ga0439434_0006472 | Ga0439434_0006472_1407_2438 | 336 |
| 317 | 3300048912 | Ga0496109_0240207 | Ga0496109_0240207_169_1200 | 336 |
| 318 | 3300050489 | nmdc:mga03683_51169_c1 | nmdc:mga03683_51169_c1_464_1495 | 336 |
| 319 | 3300050490 | nmdc:mga03n38_24136_c1 | nmdc:mga03n38_24136_c1_896_1927 | 336 |
| 320 | 3300050493 | nmdc:mga0k408_61213_c1 | nmdc:mga0k408_61213_c1_593_1624 | 336 |
| 321 | 3300050496 | nmdc:mga07m45_34458_c1 | nmdc:mga07m45_34458_c1_558_1589 | 336 |
| 322 | iso_pu_bacteria | 2818991446 | 2819595955 | 336 |
| 323 | iso_pu_bacteria | 2899924645 | 2899925304 | 336 |
| 324 | iso_pu_bacteria | 2928037797 | 2928038574 | 336 |
| 325 | iso_pu_bacteria | 2928044640 | 2928045821 | 336 |
| 326 | iso_pu_bacteria | 2928051484 | 2928053438 | 336 |
| 327 | iso_pu_bacteria | 2928064002 | 2928067043 | 336 |
| 328 | iso_pu_bacteria | 2928084124 | 2928085001 | 336 |
| 329 | iso_pu_bacteria | 2954767861 | 2954771966 | 336 |
| 330 | 3300003578 | Ga0006562J51391_1095652 | Ga0006562J51391_10956523 | 337 |
| 331 | 3300003578 | Ga0006562J51391_1095654 | Ga0006562J51391_10956542 | 337 |
| 332 | 3300003792 | Ga0055540_1004049 | Ga0055540_10040495 | 337 |
| 333 | 3300006177 | Ga0075362_10007125 | Ga0075362_100071255 | 337 |
| 334 | 3300013100 | Ga0157373_10053204 | Ga0157373_100532043 | 337 |
| 335 | 3300025303 | Ga0209051_1002109 | Ga0209051_10021095 | 337 |
| 336 | 3300028800 | Ga0265338_10000113 | Ga0265338_1000011383 | 337 |
| 337 | 3300031548 | Ga0307408_100024541 | Ga0307408_1000245415 | 337 |
| 338 | 3300031548 | Ga0307408_100157292 | Ga0307408_1001572922 | 337 |
| 339 | 3300031901 | Ga0307406_10001482 | Ga0307406_1000148210 | 337 |
| 340 | 3300044706 | Ga0466964_0039190 | Ga0466964_0039190_861_1874 | 337 |
| 341 | 3300048920 | Ga0496117_0064264 | Ga0496117_0064264_23_1039 | 337 |
| 342 | 3300050489 | nmdc:mga03683_25651_c1 | nmdc:mga03683_25651_c1_640_1704 | 337 |
| 343 | iso_pu_bacteria | 2738541307 | 2738881701 | 337 |
| 344 | 3300002773 | JGI25152J39213_1001246 | JGI25152J39213_10012468 | 338 |
| 345 | 3300002774 | JGI25150J39212_1000991 | JGI25150J39212_100099110 | 338 |
| 346 | 3300002774 | JGI25150J39212_1002008 | JGI25150J39212_10020086 | 338 |
| 347 | 3300002987 | JGI25159J45721_1001447 | JGI25159J45721_10014476 | 338 |
| 348 | 3300003187 | JGI25151J46595_10002925 | JGI25151J46595_100029256 | 338 |
| 349 | 3300003215 | JGI25153J46596_10001486 | JGI25153J46596_1000148610 | 338 |
| 350 | 3300003354 | JGI25160J50197_1001502 | JGI25160J50197_10015028 | 338 |
| 351 | 3300003374 | JGI25161J50226_1001006 | JGI25161J50226_10010068 | 338 |
| 352 | 3300003761 | Ga0055535_1000998 | Ga0055535_100099816 | 338 |
| 353 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004163 | 338 |
| 354 | 3300003771 | Ga0055526_1002772 | Ga0055526_10027728 | 338 |
| 355 | 3300003773 | Ga0055537_1001113 | Ga0055537_10011138 | 338 |
| 356 | 3300003775 | Ga0055524_1001840 | Ga0055524_10018408 | 338 |
| 357 | 3300003784 | Ga0055534_1001367 | Ga0055534_10013676 | 338 |
| 358 | 3300003790 | Ga0055528_1002082 | Ga0055528_10020829 | 338 |
| 359 | 3300003792 | Ga0055540_1008591 | Ga0055540_10085913 | 338 |
| 360 | 3300003794 | Ga0055531_10021333 | Ga0055531_100213332 | 338 |
| 361 | 3300004625 | Ga0055543_1002168 | Ga0055543_10021682 | 338 |
| 362 | 3300005262 | Ga0065165_1003400 | Ga0065165_10034007 | 338 |
| 363 | 3300005367 | Ga0070667_100050240 | Ga0070667_1000502404 | 338 |
| 364 | 3300005539 | Ga0068853_100020864 | Ga0068853_1000208643 | 338 |
| 365 | 3300009551 | Ga0105238_10070714 | Ga0105238_100707141 | 338 |
| 366 | 3300025208 | Ga0209436_108792 | Ga0209436_1087922 | 338 |
| 367 | 3300025228 | Ga0209672_101148 | Ga0209672_10114811 | 338 |
| 368 | 3300025229 | Ga0209147_102613 | Ga0209147_1026132 | 338 |
| 369 | 3300025242 | Ga0209258_100022 | Ga0209258_100022162 | 338 |
| 370 | 3300025245 | Ga0207425_1000199 | Ga0207425_100019926 | 338 |
| 371 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034162 | 338 |
| 372 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023242 | 338 |
| 373 | 3300025263 | Ga0209565_1000293 | Ga0209565_100029327 | 338 |
| 374 | 3300025273 | Ga0209673_1000265 | Ga0209673_100026568 | 338 |
| 375 | 3300025284 | Ga0209130_1000113 | Ga0209130_100011359 | 338 |
| 376 | 3300025291 | Ga0209675_1000127 | Ga0209675_100012768 | 338 |
| 377 | 3300025292 | Ga0209676_1004910 | Ga0209676_10049105 | 338 |
| 378 | 3300025294 | Ga0209025_1001331 | Ga0209025_100133121 | 338 |
| 379 | 3300025295 | Ga0209564_1000698 | Ga0209564_100069819 | 338 |
| 380 | 3300025297 | Ga0209758_1000064 | Ga0209758_1000064143 | 338 |
| 381 | 3300025299 | Ga0209256_1000115 | Ga0209256_1000115154 | 338 |
| 382 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011149 | 338 |
| 383 | 3300025303 | Ga0209051_1019996 | Ga0209051_10199962 | 338 |
| 384 | 3300025303 | Ga0209051_1053265 | Ga0209051_10532652 | 338 |
| 385 | 3300025304 | Ga0209257_1003120 | Ga0209257_10031208 | 338 |
| 386 | 3300026041 | Ga0207639_10007462 | Ga0207639_100074625 | 338 |
| 387 | 3300026116 | Ga0207674_10369757 | Ga0207674_103697571 | 338 |
| 388 | 3300044901 | Ga0466960_0010342 | Ga0466960_0010342_217_1266 | 338 |
| 389 | 3300046690 | Ga0495624_0053963 | Ga0495624_0053963_419_1465 | 338 |
| 390 | 3300047673 | Ga0495593_0025266 | Ga0495593_0025266_1656_2702 | 338 |
| 391 | 3300048924 | Ga0496121_0006229 | Ga0496121_0006229_6055_7086 | 338 |
| 392 | 3300053120 | Ga0500597_019885 | Ga0500597_019885_892_1938 | 338 |
| 393 | 3300053134 | Ga0500658_0001281 | Ga0500658_0001281_4244_5290 | 338 |
| 394 | 3300053141 | Ga0500574_039308 | Ga0500574_039308_108_1154 | 338 |
| 395 | 3300003784 | Ga0055534_1006607 | Ga0055534_10066073 | 339 |
| 396 | 3300025284 | Ga0209130_1004836 | Ga0209130_10048366 | 339 |
| 397 | 3300025291 | Ga0209675_1000887 | Ga0209675_100088710 | 339 |
| 398 | 3300025292 | Ga0209676_1009073 | Ga0209676_10090734 | 339 |
| 399 | 3300025303 | Ga0209051_1002621 | Ga0209051_10026217 | 339 |
| 400 | 3300025304 | Ga0209257_1005156 | Ga0209257_10051561 | 339 |
| 401 | 3300031251 | Ga0265327_10015860 | Ga0265327_100158606 | 339 |
| 402 | 3300037418 | Ga0395900_0028412 | Ga0395900_0028412_1935_2990 | 339 |
| 403 | iso_pu_bacteria | 2842733646 | 2842735573 | 339 |
| 404 | iso_pu_bacteria | 2842747753 | 2842751331 | 339 |
| 405 | 3300005327 | Ga0070658_10002647 | Ga0070658_100026476 | 340 |
| 406 | 3300005456 | Ga0070678_100142288 | Ga0070678_1001422882 | 340 |
| 407 | 3300005548 | Ga0070665_100385058 | Ga0070665_1003850582 | 340 |
| 408 | 3300005563 | Ga0068855_100424737 | Ga0068855_1004247371 | 340 |
| 409 | 3300006195 | Ga0075366_10087818 | Ga0075366_100878181 | 340 |
| 410 | 3300006353 | Ga0075370_10040569 | Ga0075370_100405692 | 340 |
| 411 | 3300009148 | Ga0105243_10347035 | Ga0105243_103470351 | 340 |
| 412 | 3300013104 | Ga0157370_10001149 | Ga0157370_100011498 | 340 |
| 413 | 3300025909 | Ga0207705_10000708 | Ga0207705_1000070814 | 340 |
| 414 | 3300025949 | Ga0207667_10003149 | Ga0207667_100031495 | 340 |
| 415 | 3300026121 | Ga0207683_10014003 | Ga0207683_100140035 | 340 |
| 416 | 3300028379 | Ga0268266_10335955 | Ga0268266_103359552 | 340 |
| 417 | 3300050496 | nmdc:mga07m45_113912_c1 | nmdc:mga07m45_113912_c1_426_1454 | 340 |
| 418 | 3300053122 | Ga0500608_080724 | Ga0500608_080724_264_1343 | 340 |
| 419 | 3300002773 | JGI25152J39213_1000915 | JGI25152J39213_10009155 | 341 |
| 420 | 3300003215 | JGI25153J46596_10004452 | JGI25153J46596_100044523 | 341 |
| 421 | 3300003771 | Ga0055526_1000649 | Ga0055526_10006492 | 341 |
| 422 | 3300005617 | Ga0068859_100253636 | Ga0068859_1002536362 | 341 |
| 423 | 3300006931 | Ga0097620_100253623 | Ga0097620_1002536232 | 341 |
| 424 | 3300013104 | Ga0157370_10186502 | Ga0157370_101865022 | 341 |
| 425 | 3300014968 | Ga0157379_10120360 | Ga0157379_101203602 | 341 |
| 426 | 3300025245 | Ga0207425_1000595 | Ga0207425_100059511 | 341 |
| 427 | 3300025258 | Ga0209129_1000089 | Ga0209129_100008961 | 341 |
| 428 | 3300025295 | Ga0209564_1000053 | Ga0209564_1000053237 | 341 |
| 429 | 3300025297 | Ga0209758_1000622 | Ga0209758_100062213 | 341 |
| 430 | 3300028381 | Ga0268264_10171693 | Ga0268264_101716932 | 341 |
| 431 | 3300048925 | Ga0496122_0000217 | Ga0496122_0000217_96440_97516 | 341 |
| 432 | 3300048926 | Ga0496123_0000057 | Ga0496123_0000057_6701_7777 | 341 |
| 433 | 3300048927 | Ga0496124_0031416 | Ga0496124_0031416_827_1903 | 341 |
| 434 | 3300048920 | Ga0496117_0008670 | Ga0496117_0008670_1437_2507 | 342 |
| 435 | 3300048924 | Ga0496121_0000305 | Ga0496121_0000305_21438_22508 | 342 |
| 436 | 3300053136 | Ga0500559_0002800 | Ga0500559_0002800_3259_4332 | 342 |
| 437 | 3300044712 | Ga0453684_0116937 | Ga0453684_0116937_1089_2126 | 343 |
| 438 | 3300028794 | Ga0307515_10024629 | Ga0307515_100246299 | 346 |
| 439 | 3300031649 | Ga0307514_10005152 | Ga0307514_100051523 | 346 |
| 440 | 3300044694 | Ga0466963_0015153 | Ga0466963_0015153_3607_4674 | 346 |
| 441 | 3300061719 | Ga0466962_0008411 | Ga0466962_0008411_3698_4765 | 346 |
| 442 | iso_pu_bacteria | 2734482258 | 2735816181 | 346 |
| 443 | iso_pu_bacteria | 2881101125 | 2881105141 | 346 |
| 444 | 3300031730 | Ga0307516_10003171 | Ga0307516_100031719 | 347 |
| 445 | 3300038443 | Ga0395901_0019159 | Ga0395901_0019159_2329_3396 | 347 |
| 446 | 3300042876 | Ga0451577_0078031 | Ga0451577_0078031_263_1348 | 347 |
| 447 | 3300045051 | Ga0451576_0001961 | Ga0451576_0001961_2701_3786 | 347 |
| 448 | 3300045051 | Ga0451576_0052917 | Ga0451576_0052917_1957_3042 | 347 |
| 449 | iso_pu_bacteria | 2891633521 | 2891634731 | 347 |
| 450 | 3300005338 | Ga0068868_100081982 | Ga0068868_1000819822 | 348 |
| 451 | 3300042007 | Ga0439449_0001647 | Ga0439449_0001647_2341_3444 | 348 |
| 452 | 3300049776 | Ga0501280_000651 | Ga0501280_000651_3005_4102 | 348 |
| 453 | iso_pu_bacteria | 2519103095 | 2519457891 | 348 |
| 454 | iso_pu_bacteria | 2582581311 | 2585295192 | 348 |
| 455 | iso_pu_bacteria | 2599185240 | 2599742865 | 348 |
| 456 | iso_pu_bacteria | 2599185355 | 2600204983 | 348 |
| 457 | iso_pu_bacteria | 2675903129 | 2676741972 | 348 |
| 458 | iso_pu_bacteria | 2816332253 | 2817260070 | 348 |
| 459 | iso_pu_bacteria | 2816332256 | 2817277734 | 348 |
| 460 | iso_pu_bacteria | 2816332286 | 2817456853 | 348 |
| 461 | iso_pu_bacteria | 2863421361 | 2863421566 | 348 |
| 462 | iso_pu_bacteria | 2904564687 | 2904565747 | 348 |
| 463 | iso_pu_bacteria | 2904571731 | 2904572790 | 348 |
| 464 | iso_pu_bacteria | 2928157003 | 2928159856 | 348 |
| 465 | iso_pu_bacteria | 2928163908 | 2928164104 | 348 |
| 466 | iso_pu_bacteria | 2928536128 | 2928538687 | 348 |
| 467 | iso_pu_bacteria | 2981990288 | 2981994294 | 348 |
| 468 | iso_pu_bacteria | 8020807995 | 8020813039 | 348 |
| 469 | iso_pu_bacteria | 8020938398 | 8020944843 | 348 |
| 470 | iso_pu_bacteria | 8020945358 | 8020949716 | 348 |
| 471 | iso_pu_bacteria | 8020953355 | 8020959928 | 348 |
| 472 | iso_pu_bacteria | 8040167225 | 8040172292 | 348 |
| 473 | iso_pu_bacteria | 8040173305 | 8040175757 | 348 |
| 474 | 3300002704 | JGI25155J39150_1000724 | JGI25155J39150_10007243 | 349 |
| 475 | 3300006186 | Ga0075369_10069478 | Ga0075369_100694782 | 349 |
| 476 | 3300009093 | Ga0105240_10008487 | Ga0105240_1000848710 | 349 |
| 477 | 3300030521 | Ga0307511_10000025 | Ga0307511_1000002535 | 349 |
| 478 | 3300031344 | Ga0265316_10000299 | Ga0265316_1000029914 | 349 |
| 479 | 3300033179 | Ga0307507_10088851 | Ga0307507_100888512 | 349 |
| 480 | 3300046507 | Ga0495606_0012257 | Ga0495606_0012257_1677_2783 | 349 |
| 481 | 3300048929 | Ga0496126_0016774 | Ga0496126_0016774_3262_4431 | 349 |
| 482 | 3300050516 | nmdc:mga0sz30_34877_c1 | nmdc:mga0sz30_34877_c1_660_1757 | 349 |
| 483 | 3300053092 | Ga0500583_0002376 | Ga0500583_0002376_3840_4964 | 349 |
| 484 | 3300053125 | Ga0500618_001179 | Ga0500618_001179_2050_3156 | 349 |
| 485 | 3300053151 | Ga0500604_0000752 | Ga0500604_0000752_2176_3300 | 349 |
| 486 | iso_pu_bacteria | 2515154123 | 2515690480 | 349 |
| 487 | iso_pu_bacteria | 2599185239 | 2599737023 | 349 |
| 488 | iso_pu_bacteria | 2808606384 | 2808971581 | 349 |
| 489 | iso_pu_bacteria | 2808606390 | 2809006410 | 349 |
| 490 | iso_pu_bacteria | 2808606391 | 2809013672 | 349 |
| 491 | iso_pu_bacteria | 2818991452 | 2819632525 | 349 |
| 492 | iso_pu_bacteria | 2870068957 | 2870069008 | 349 |
| 493 | iso_pu_bacteria | 2928170801 | 2928173367 | 349 |
| 494 | iso_pu_bacteria | 8018845410 | 8018848983 | 349 |
| 495 | iso_pu_bacteria | 8021120328 | 8021126730 | 349 |
| 496 | iso_pu_bacteria | 8039098773 | 8039099204 | 349 |
| 497 | 3300005344 | Ga0070661_100237510 | Ga0070661_1002375101 | 350 |
| 498 | 3300006042 | Ga0075368_10007239 | Ga0075368_100072392 | 350 |
| 499 | 3300006048 | Ga0075363_100020228 | Ga0075363_1000202284 | 350 |
| 500 | 3300006177 | Ga0075362_10078284 | Ga0075362_100782842 | 350 |
| 501 | 3300006186 | Ga0075369_10048964 | Ga0075369_100489642 | 350 |
| 502 | 3300013105 | Ga0157369_10000206 | Ga0157369_1000020646 | 350 |
| 503 | 3300020069 | Ga0197907_10707312 | Ga0197907_107073125 | 350 |
| 504 | 3300020081 | Ga0206354_11366513 | Ga0206354_113665134 | 350 |
| 505 | 3300020082 | Ga0206353_11314560 | Ga0206353_113145603 | 350 |
| 506 | 3300022467 | Ga0224712_10000022 | Ga0224712_100000226 | 350 |
| 507 | 3300038443 | Ga0395901_0000003 | Ga0395901_0000003_487897_488964 | 350 |
| 508 | 3300042876 | Ga0451577_0072441 | Ga0451577_0072441_1368_2462 | 350 |
| 509 | 3300044712 | Ga0453684_0524355 | Ga0453684_0524355_168_1262 | 350 |
| 510 | 3300046679 | Ga0495623_0135016 | Ga0495623_0135016_308_1360 | 350 |
| 511 | 3300050489 | nmdc:mga03683_53022_c1 | nmdc:mga03683_53022_c1_289_1389 | 350 |
| 512 | 3300050491 | nmdc:mga00v17_126852_c1 | nmdc:mga00v17_126852_c1_385_1485 | 350 |
| 513 | 3300050495 | nmdc:mga04h51_31327_c1 | nmdc:mga04h51_31327_c1_250_1350 | 350 |
| 514 | 3300050496 | nmdc:mga07m45_89697_c1 | nmdc:mga07m45_89697_c1_476_1576 | 350 |
| 515 | iso_pu_bacteria | 2547132512 | 2548846186 | 350 |
| 516 | 3300046454 | Ga0495592_0052099 | Ga0495592_0052099_266_1336 | 351 |
| 517 | 3300046455 | Ga0495603_0001297 | Ga0495603_0001297_805_1875 | 351 |
| 518 | 3300046459 | Ga0495629_0014711 | Ga0495629_0014711_2293_3363 | 351 |
| 519 | 3300046461 | Ga0495641_0003603 | Ga0495641_0003603_461_1531 | 351 |
| 520 | 3300046462 | Ga0495651_0196935 | Ga0495651_0196935_184_1254 | 351 |
| 521 | 3300046463 | Ga0495653_0006567 | Ga0495653_0006567_2287_3357 | 351 |
| 522 | 3300046472 | Ga0495580_0002054 | Ga0495580_0002054_3425_4495 | 351 |
| 523 | 3300046473 | Ga0495582_0002285 | Ga0495582_0002285_6185_7255 | 351 |
| 524 | 3300046476 | Ga0495662_0077914 | Ga0495662_0077914_491_1561 | 351 |
| 525 | 3300046477 | Ga0495664_0001019 | Ga0495664_0001019_11580_12650 | 351 |
| 526 | 3300046514 | Ga0495618_0014447 | Ga0495618_0014447_496_1566 | 351 |
| 527 | 3300046516 | Ga0495628_0002617 | Ga0495628_0002617_12840_13910 | 351 |
| 528 | 3300046524 | Ga0495648_0012380 | Ga0495648_0012380_2975_4045 | 351 |
| 529 | 3300046526 | Ga0495666_0006495 | Ga0495666_0006495_1983_3053 | 351 |
| 530 | 3300046529 | Ga0495652_0029140 | Ga0495652_0029140_677_1747 | 351 |
| 531 | 3300046531 | Ga0495665_0005886 | Ga0495665_0005886_4325_5395 | 351 |
| 532 | 3300046533 | Ga0495640_0026287 | Ga0495640_0026287_743_1813 | 351 |
| 533 | 3300046535 | Ga0495586_0000633 | Ga0495586_0000633_17153_18223 | 351 |
| 534 | 3300046536 | Ga0495587_0018778 | Ga0495587_0018778_2675_3745 | 351 |
| 535 | 3300046543 | Ga0495645_0003050 | Ga0495645_0003050_3383_4453 | 351 |
| 536 | 3300046642 | Ga0495634_0009735 | Ga0495634_0009735_2300_3370 | 351 |
| 537 | 3300046663 | Ga0495635_0040500 | Ga0495635_0040500_177_1247 | 351 |
| 538 | 3300046665 | Ga0495661_0010232 | Ga0495661_0010232_910_1980 | 351 |
| 539 | 3300046678 | Ga0495599_0023267 | Ga0495599_0023267_430_1500 | 351 |
| 540 | 3300046679 | Ga0495623_0021667 | Ga0495623_0021667_2708_3778 | 351 |
| 541 | 3300046680 | Ga0495646_0011483 | Ga0495646_0011483_2266_3336 | 351 |
| 542 | 3300046689 | Ga0495613_0002624 | Ga0495613_0002624_10172_11242 | 351 |
| 543 | 3300046690 | Ga0495624_0010314 | Ga0495624_0010314_2130_3200 | 351 |
| 544 | 3300047315 | Ga0495581_0006202 | Ga0495581_0006202_4289_5359 | 351 |
| 545 | 3300047317 | Ga0495604_0005007 | Ga0495604_0005007_3240_4310 | 351 |
| 546 | 3300047319 | Ga0495674_0022004 | Ga0495674_0022004_3240_4310 | 351 |
| 547 | 3300047321 | Ga0495676_0017431 | Ga0495676_0017431_3408_4478 | 351 |
| 548 | 3300047322 | Ga0495680_0007394 | Ga0495680_0007394_5891_6961 | 351 |
| 549 | 3300047446 | Ga0495679_003488 | Ga0495679_003488_439_1509 | 351 |
| 550 | 3300047673 | Ga0495593_0010859 | Ga0495593_0010859_1703_2773 | 351 |
| 551 | 3300048088 | Ga0495602_0027611 | Ga0495602_0027611_2293_3363 | 351 |
| 552 | 3300048089 | Ga0495614_0000770 | Ga0495614_0000770_3627_4697 | 351 |
| 553 | 3300048912 | Ga0496109_0281411 | Ga0496109_0281411_414_1535 | 351 |
| 554 | iso_pu_bacteria | 2501025501 | 2501071009 | 351 |
| 555 | iso_pu_bacteria | 2501025502 | 2501078836 | 351 |
| 556 | iso_pu_bacteria | 2501025504 | 2501413839 | 351 |
| 557 | iso_pu_bacteria | 2510917014 | 2511094892 | 351 |
| 558 | iso_pu_bacteria | 2510917015 | 2511104551 | 351 |
| 559 | iso_pu_bacteria | 2513237082 | 2513551591 | 351 |
| 560 | iso_pu_bacteria | 2513237083 | 2513560242 | 351 |
| 561 | iso_pu_bacteria | 2515154189 | 2516016996 | 351 |
| 562 | iso_pu_bacteria | 2562617112 | 2563061899 | 351 |
| 563 | iso_pu_bacteria | 2600255067 | 2600814623 | 351 |
| 564 | iso_pu_bacteria | 2711768613 | 2713478265 | 351 |
| 565 | iso_pu_bacteria | 2791355137 | 2792833011 | 351 |
| 566 | iso_pu_bacteria | 2856287931 | 2856289142 | 351 |
| 567 | iso_pu_bacteria | 2857357740 | 2857363488 | 351 |
| 568 | iso_pu_bacteria | 2883087390 | 2883094751 | 351 |
| 569 | iso_pu_bacteria | 2904615490 | 2904618883 | 351 |
| 570 | iso_pu_bacteria | 2921643360 | 2921643715 | 351 |
| 571 | iso_pu_bacteria | 642555112 | 642594292 | 351 |
| 572 | iso_pu_bacteria | 8003955200 | 8003957509 | 351 |
| 573 | 3300001989 | JGI24739J22299_10035620 | JGI24739J22299_100356202 | 352 |
| 574 | 3300003758 | Ga0055532_1002025 | Ga0055532_10020256 | 352 |
| 575 | 3300003761 | Ga0055535_1002924 | Ga0055535_10029246 | 352 |
| 576 | 3300003762 | Ga0055542_1001017 | Ga0055542_10010178 | 352 |
| 577 | 3300003763 | Ga0055529_1001769 | Ga0055529_10017696 | 352 |
| 578 | 3300003856 | Ga0058692_1002599 | Ga0058692_10025998 | 352 |
| 579 | 3300009093 | Ga0105240_10081746 | Ga0105240_100817462 | 352 |
| 580 | 3300025228 | Ga0209672_100028 | Ga0209672_100028177 | 352 |
| 581 | 3300025229 | Ga0209147_100163 | Ga0209147_10016311 | 352 |
| 582 | 3300025242 | Ga0209258_100112 | Ga0209258_10011231 | 352 |
| 583 | 3300025254 | Ga0209148_1000081 | Ga0209148_100008161 | 352 |
| 584 | 3300025272 | Ga0209455_1000050 | Ga0209455_1000050143 | 352 |
| 585 | 3300025273 | Ga0209673_1000038 | Ga0209673_100003881 | 352 |
| 586 | 3300025295 | Ga0209564_1027441 | Ga0209564_10274411 | 352 |
| 587 | 3300025913 | Ga0207695_10005102 | Ga0207695_100051028 | 352 |
| 588 | 3300027312 | Ga0209371_1000090 | Ga0209371_1000090134 | 352 |
| 589 | 3300030500 | Ga0268256_1000115 | Ga0268256_100011581 | 352 |
| 590 | 3300042876 | Ga0451577_0025039 | Ga0451577_0025039_867_1967 | 352 |
| 591 | iso_pu_bacteria | 2508501125 | 2509129383 | 352 |
| 592 | iso_pu_bacteria | 2510065045 | 2510249971 | 352 |
| 593 | iso_pu_bacteria | 2512047030 | 2512347518 | 352 |
| 594 | iso_pu_bacteria | 2513237151 | 2513962461 | 352 |
| 595 | iso_pu_bacteria | 2515154122 | 2515679422 | 352 |
| 596 | iso_pu_bacteria | 2526164713 | 2527079139 | 352 |
| 597 | iso_pu_bacteria | 2718217991 | 2719639129 | 352 |
| 598 | iso_pu_bacteria | 2738541296 | 2738820116 | 352 |
| 599 | iso_pu_bacteria | 2738541298 | 2738832596 | 352 |
| 600 | iso_pu_bacteria | 2738541306 | 2738874123 | 352 |
| 601 | iso_pu_bacteria | 2738543002 | 2739185753 | 352 |
| 602 | iso_pu_bacteria | 2738543008 | 2739220721 | 352 |
| 603 | iso_pu_bacteria | 2744054900 | 2746092230 | 352 |
| 604 | iso_pu_bacteria | 2744054901 | 2746095271 | 352 |
| 605 | iso_pu_bacteria | 2751185846 | 2753568824 | 352 |
| 606 | iso_pu_bacteria | 2818991450 | 2819620873 | 352 |
| 607 | iso_pu_bacteria | 2842324504 | 2842331332 | 352 |
| 608 | iso_pu_bacteria | 2842348783 | 2842355672 | 352 |
| 609 | iso_pu_bacteria | 2842454564 | 2842462024 | 352 |
| 610 | iso_pu_bacteria | 2885270888 | 2885277302 | 352 |
| 611 | iso_pu_bacteria | 2900634093 | 2900636243 | 352 |
| 612 | iso_pu_bacteria | 2902682994 | 2902683440 | 352 |
| 613 | iso_pu_bacteria | 2904483920 | 2904483966 | 352 |
| 614 | iso_pu_bacteria | 2919527303 | 2919529914 | 352 |
| 615 | iso_pu_bacteria | 2928108538 | 2928109675 | 352 |
| 616 | iso_pu_bacteria | 2928135762 | 2928136871 | 352 |
| 617 | iso_pu_bacteria | 2928503688 | 2928506399 | 352 |
| 618 | iso_pu_bacteria | 2945934425 | 2945935425 | 352 |
| 619 | iso_pu_bacteria | 2990703756 | 2990704026 | 352 |
| 620 | iso_pu_bacteria | 641736151 | 642422183 | 352 |
| 621 | iso_pu_bacteria | 641736154 | 642417462 | 352 |
| 622 | iso_pu_bacteria | 642555113 | 642620297 | 352 |
| 623 | iso_pu_bacteria | 8055266321 | 8055266704 | 352 |
| 624 | iso_pu_bacteria | 8055301274 | 8055303920 | 352 |
| 625 | 3300003758 | Ga0055532_1002399 | Ga0055532_10023992 | 353 |
| 626 | 3300005335 | Ga0070666_10057749 | Ga0070666_100577492 | 353 |
| 627 | 3300005456 | Ga0070678_100084625 | Ga0070678_1000846253 | 353 |
| 628 | 3300009011 | Ga0105251_10004896 | Ga0105251_100048967 | 353 |
| 629 | 3300009011 | Ga0105251_10076755 | Ga0105251_100767551 | 353 |
| 630 | 3300009036 | Ga0105244_10050125 | Ga0105244_100501251 | 353 |
| 631 | 3300009174 | Ga0105241_10129036 | Ga0105241_101290362 | 353 |
| 632 | 3300009176 | Ga0105242_10127949 | Ga0105242_101279494 | 353 |
| 633 | 3300009177 | Ga0105248_10036706 | Ga0105248_100367064 | 353 |
| 634 | 3300009551 | Ga0105238_10244627 | Ga0105238_102446272 | 353 |
| 635 | 3300013306 | Ga0163162_10010310 | Ga0163162_100103103 | 353 |
| 636 | 3300025225 | Ga0209566_100216 | Ga0209566_10021643 | 353 |
| 637 | 3300025226 | Ga0209674_101735 | Ga0209674_1017353 | 353 |
| 638 | 3300025229 | Ga0209147_100686 | Ga0209147_1006866 | 353 |
| 639 | 3300025903 | Ga0207680_10008834 | Ga0207680_100088343 | 353 |
| 640 | 3300025904 | Ga0207647_10019591 | Ga0207647_100195913 | 353 |
| 641 | 3300025941 | Ga0207711_10026135 | Ga0207711_100261353 | 353 |
| 642 | 3300026067 | Ga0207678_10037514 | Ga0207678_100375141 | 353 |
| 643 | 3300026121 | Ga0207683_10056358 | Ga0207683_100563583 | 353 |
| 644 | 3300031344 | Ga0265316_10089534 | Ga0265316_100895342 | 353 |
| 645 | 3300031507 | Ga0307509_10000006 | Ga0307509_10000006355 | 353 |
| 646 | 3300031616 | Ga0307508_10059988 | Ga0307508_100599883 | 353 |
| 647 | 3300037471 | Ga0395905_0075175 | Ga0395905_0075175_118_1185 | 353 |
| 648 | 3300044656 | Ga0466969_0004757 | Ga0466969_0004757_2308_3381 | 353 |
| 649 | 3300044684 | Ga0466966_0002909 | Ga0466966_0002909_719_1792 | 353 |
| 650 | 3300044712 | Ga0453684_0008183 | Ga0453684_0008183_10936_12039 | 353 |
| 651 | 3300044765 | Ga0466970_0026347 | Ga0466970_0026347_1265_2338 | 353 |
| 652 | 3300044765 | Ga0466970_0091606 | Ga0466970_0091606_20_1087 | 353 |
| 653 | 3300045049 | Ga0466959_0014675 | Ga0466959_0014675_3214_4287 | 353 |
| 654 | 3300045049 | Ga0466959_0222376 | Ga0466959_0222376_104_1171 | 353 |
| 655 | 3300045051 | Ga0451576_0012728 | Ga0451576_0012728_2476_3579 | 353 |
| 656 | 3300045051 | Ga0451576_0145389 | Ga0451576_0145389_513_1616 | 353 |
| 657 | 3300045976 | Ga0466967_0343404 | Ga0466967_0343404_114_1181 | 353 |
| 658 | 3300046455 | Ga0495603_0007952 | Ga0495603_0007952_4183_5250 | 353 |
| 659 | 3300046457 | Ga0495590_0001947 | Ga0495590_0001947_2693_3760 | 353 |
| 660 | 3300046457 | Ga0495590_0060794 | Ga0495590_0060794_117_1184 | 353 |
| 661 | 3300046459 | Ga0495629_0004351 | Ga0495629_0004351_9361_10428 | 353 |
| 662 | 3300046463 | Ga0495653_0092915 | Ga0495653_0092915_806_1873 | 353 |
| 663 | 3300046463 | Ga0495653_0175644 | Ga0495653_0175644_344_1411 | 353 |
| 664 | 3300046471 | Ga0495650_0004632 | Ga0495650_0004632_5942_7009 | 353 |
| 665 | 3300046474 | Ga0495605_0004899 | Ga0495605_0004899_3231_4298 | 353 |
| 666 | 3300046476 | Ga0495662_0024751 | Ga0495662_0024751_1796_2863 | 353 |
| 667 | 3300046477 | Ga0495664_0083586 | Ga0495664_0083586_604_1671 | 353 |
| 668 | 3300046500 | Ga0495596_0073211 | Ga0495596_0073211_128_1195 | 353 |
| 669 | 3300046506 | Ga0495583_0013530 | Ga0495583_0013530_863_1930 | 353 |
| 670 | 3300046507 | Ga0495606_0039182 | Ga0495606_0039182_1972_3039 | 353 |
| 671 | 3300046507 | Ga0495606_0072098 | Ga0495606_0072098_826_1893 | 353 |
| 672 | 3300046515 | Ga0495620_0011576 | Ga0495620_0011576_335_1402 | 353 |
| 673 | 3300046516 | Ga0495628_0033448 | Ga0495628_0033448_274_1341 | 353 |
| 674 | 3300046516 | Ga0495628_0049906 | Ga0495628_0049906_47_1114 | 353 |
| 675 | 3300046528 | Ga0495642_0021025 | Ga0495642_0021025_1113_2180 | 353 |
| 676 | 3300046530 | Ga0495654_0081073 | Ga0495654_0081073_11_1078 | 353 |
| 677 | 3300046531 | Ga0495665_0021328 | Ga0495665_0021328_1966_3033 | 353 |
| 678 | 3300046542 | Ga0495597_0002648 | Ga0495597_0002648_9234_10301 | 353 |
| 679 | 3300046542 | Ga0495597_0044837 | Ga0495597_0044837_312_1379 | 353 |
| 680 | 3300046543 | Ga0495645_0011091 | Ga0495645_0011091_4792_5859 | 353 |
| 681 | 3300046543 | Ga0495645_0045339 | Ga0495645_0045339_1424_2491 | 353 |
| 682 | 3300046559 | Ga0495667_0017947 | Ga0495667_0017947_1067_2134 | 353 |
| 683 | 3300046663 | Ga0495635_0102843 | Ga0495635_0102843_190_1257 | 353 |
| 684 | 3300046680 | Ga0495646_0053517 | Ga0495646_0053517_305_1372 | 353 |
| 685 | 3300046680 | Ga0495646_0076910 | Ga0495646_0076910_114_1181 | 353 |
| 686 | 3300046684 | Ga0495669_0084553 | Ga0495669_0084553_205_1272 | 353 |
| 687 | 3300046684 | Ga0495669_0102943 | Ga0495669_0102943_215_1282 | 353 |
| 688 | 3300046689 | Ga0495613_0010806 | Ga0495613_0010806_2643_3710 | 353 |
| 689 | 3300046690 | Ga0495624_0179046 | Ga0495624_0179046_208_1275 | 353 |
| 690 | 3300046691 | Ga0495670_0089064 | Ga0495670_0089064_206_1273 | 353 |
| 691 | 3300046692 | Ga0495671_0016957 | Ga0495671_0016957_2432_3499 | 353 |
| 692 | 3300046694 | Ga0495649_0004421 | Ga0495649_0004421_3125_4192 | 353 |
| 693 | 3300046694 | Ga0495649_0079163 | Ga0495649_0079163_435_1502 | 353 |
| 694 | 3300046694 | Ga0495649_0083897 | Ga0495649_0083897_424_1491 | 353 |
| 695 | 3300046794 | Ga0495589_0005849 | Ga0495589_0005849_2501_3568 | 353 |
| 696 | 3300046794 | Ga0495589_0082331 | Ga0495589_0082331_303_1370 | 353 |
| 697 | 3300046809 | Ga0495600_0044562 | Ga0495600_0044562_337_1404 | 353 |
| 698 | 3300046809 | Ga0495600_0143413 | Ga0495600_0143413_217_1284 | 353 |
| 699 | 3300047315 | Ga0495581_0005698 | Ga0495581_0005698_2752_3819 | 353 |
| 700 | 3300047317 | Ga0495604_0126928 | Ga0495604_0126928_556_1623 | 353 |
| 701 | 3300047319 | Ga0495674_0023710 | Ga0495674_0023710_265_1332 | 353 |
| 702 | 3300047320 | Ga0495672_0003028 | Ga0495672_0003028_12322_13389 | 353 |
| 703 | 3300047322 | Ga0495680_0086575 | Ga0495680_0086575_32_1099 | 353 |
| 704 | 3300047323 | Ga0495683_0002898 | Ga0495683_0002898_5944_7011 | 353 |
| 705 | 3300047323 | Ga0495683_0084673 | Ga0495683_0084673_92_1159 | 353 |
| 706 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_291360_292427 | 353 |
| 707 | 3300047469 | Ga0495673_0040365 | Ga0495673_0040365_1010_2077 | 353 |
| 708 | 3300047469 | Ga0495673_0096997 | Ga0495673_0096997_33_1100 | 353 |
| 709 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_332209_333276 | 353 |
| 710 | 3300047673 | Ga0495593_0006696 | Ga0495593_0006696_4656_5723 | 353 |
| 711 | 3300047673 | Ga0495593_0018130 | Ga0495593_0018130_2436_3503 | 353 |
| 712 | 3300048089 | Ga0495614_0082923 | Ga0495614_0082923_20_1087 | 353 |
| 713 | 3300048903 | Ga0496100_0018508 | Ga0496100_0018508_326_1393 | 353 |
| 714 | 3300048903 | Ga0496100_0039852 | Ga0496100_0039852_346_1413 | 353 |
| 715 | 3300048903 | Ga0496100_0136746 | Ga0496100_0136746_448_1515 | 353 |
| 716 | 3300048904 | Ga0496101_0006420 | Ga0496101_0006420_214_1281 | 353 |
| 717 | 3300048904 | Ga0496101_0128488 | Ga0496101_0128488_602_1669 | 353 |
| 718 | 3300048905 | Ga0496102_0021914 | Ga0496102_0021914_4025_5092 | 353 |
| 719 | 3300048905 | Ga0496102_0035899 | Ga0496102_0035899_2922_3989 | 353 |
| 720 | 3300048905 | Ga0496102_0269160 | Ga0496102_0269160_360_1427 | 353 |
| 721 | 3300048906 | Ga0496103_0006863 | Ga0496103_0006863_215_1282 | 353 |
| 722 | 3300048907 | Ga0496104_0054037 | Ga0496104_0054037_1838_2905 | 353 |
| 723 | 3300048908 | Ga0496105_0107959 | Ga0496105_0107959_666_1733 | 353 |
| 724 | 3300048908 | Ga0496105_0173630 | Ga0496105_0173630_239_1306 | 353 |
| 725 | 3300048909 | Ga0496106_0019590 | Ga0496106_0019590_1387_2454 | 353 |
| 726 | 3300048910 | Ga0496107_0023185 | Ga0496107_0023185_3032_4099 | 353 |
| 727 | 3300048910 | Ga0496107_0085859 | Ga0496107_0085859_535_1602 | 353 |
| 728 | 3300048910 | Ga0496107_0116962 | Ga0496107_0116962_451_1518 | 353 |
| 729 | 3300048911 | Ga0496108_0232750 | Ga0496108_0232750_490_1557 | 353 |
| 730 | 3300048913 | Ga0496110_0026740 | Ga0496110_0026740_449_1516 | 353 |
| 731 | 3300048913 | Ga0496110_0156871 | Ga0496110_0156871_152_1219 | 353 |
| 732 | 3300048914 | Ga0496111_0060199 | Ga0496111_0060199_808_1875 | 353 |
| 733 | 3300048915 | Ga0496112_0008182 | Ga0496112_0008182_7731_8798 | 353 |
| 734 | 3300048916 | Ga0496113_0011230 | Ga0496113_0011230_4066_5133 | 353 |
| 735 | 3300048917 | Ga0496114_0001502 | Ga0496114_0001502_2506_3573 | 353 |
| 736 | 3300048917 | Ga0496114_0318659 | Ga0496114_0318659_156_1223 | 353 |
| 737 | 3300048918 | Ga0496115_0113660 | Ga0496115_0113660_1008_2075 | 353 |
| 738 | 3300048920 | Ga0496117_0010958 | Ga0496117_0010958_5287_6354 | 353 |
| 739 | 3300048920 | Ga0496117_0011477 | Ga0496117_0011477_3352_4419 | 353 |
| 740 | 3300048921 | Ga0496118_0017009 | Ga0496118_0017009_2883_3950 | 353 |
| 741 | 3300048921 | Ga0496118_0104184 | Ga0496118_0104184_522_1589 | 353 |
| 742 | 3300048921 | Ga0496118_0131107 | Ga0496118_0131107_362_1429 | 353 |
| 743 | 3300048924 | Ga0496121_0074371 | Ga0496121_0074371_1641_2708 | 353 |
| 744 | 3300048925 | Ga0496122_0026227 | Ga0496122_0026227_564_1631 | 353 |
| 745 | 3300048926 | Ga0496123_0028101 | Ga0496123_0028101_1696_2763 | 353 |
| 746 | 3300048927 | Ga0496124_0026584 | Ga0496124_0026584_1387_2454 | 353 |
| 747 | 3300048929 | Ga0496126_0001240 | Ga0496126_0001240_3267_4334 | 353 |
| 748 | 3300048929 | Ga0496126_0198119 | Ga0496126_0198119_248_1315 | 353 |
| 749 | 3300049459 | Ga0495678_058272 | Ga0495678_058272_165_1232 | 353 |
| 750 | 3300013105 | Ga0157369_10387518 | Ga0157369_103875182 | 354 |
| 751 | 3300025941 | Ga0207711_10031612 | Ga0207711_100316125 | 354 |
| 752 | 3300003322 | rootL2_10002479 | rootL2_1000247911 | 355 |
| 753 | 3300003322 | rootL2_10084409 | rootL2_100844092 | 355 |
| 754 | 3300003354 | JGI25160J50197_1000171 | JGI25160J50197_100017117 | 355 |
| 755 | 3300005262 | Ga0065165_1001193 | Ga0065165_100119317 | 355 |
| 756 | 3300005327 | Ga0070658_10014898 | Ga0070658_100148986 | 355 |
| 757 | 3300005339 | Ga0070660_100002402 | Ga0070660_1000024028 | 355 |
| 758 | 3300005563 | Ga0068855_100009319 | Ga0068855_1000093198 | 355 |
| 759 | 3300009093 | Ga0105240_10000656 | Ga0105240_1000065637 | 355 |
| 760 | 3300009177 | Ga0105248_10177643 | Ga0105248_101776432 | 355 |
| 761 | 3300009177 | Ga0105248_10179120 | Ga0105248_101791202 | 355 |
| 762 | 3300009545 | Ga0105237_10013204 | Ga0105237_100132042 | 355 |
| 763 | 3300010375 | Ga0105239_10007406 | Ga0105239_100074065 | 355 |
| 764 | 3300013100 | Ga0157373_10003547 | Ga0157373_100035477 | 355 |
| 765 | 3300013102 | Ga0157371_10027247 | Ga0157371_100272473 | 355 |
| 766 | 3300013104 | Ga0157370_10000328 | Ga0157370_1000032831 | 355 |
| 767 | 3300013105 | Ga0157369_10000556 | Ga0157369_1000055623 | 355 |
| 768 | 3300013105 | Ga0157369_10000953 | Ga0157369_1000095330 | 355 |
| 769 | 3300013296 | Ga0157374_10000370 | Ga0157374_1000037010 | 355 |
| 770 | 3300013307 | Ga0157372_10003805 | Ga0157372_100038055 | 355 |
| 771 | 3300014497 | Ga0182008_10029056 | Ga0182008_100290562 | 355 |
| 772 | 3300016635 | Ga0183361_10012 | Ga0183361_1001218 | 355 |
| 773 | 3300025228 | Ga0209672_101654 | Ga0209672_1016545 | 355 |
| 774 | 3300025295 | Ga0209564_1006730 | Ga0209564_10067305 | 355 |
| 775 | 3300025302 | Ga0207426_1000037 | Ga0207426_1000037192 | 355 |
| 776 | 3300025904 | Ga0207647_10000268 | Ga0207647_1000026837 | 355 |
| 777 | 3300025913 | Ga0207695_10099910 | Ga0207695_100999102 | 355 |
| 778 | 3300025914 | Ga0207671_10026696 | Ga0207671_100266962 | 355 |
| 779 | 3300025919 | Ga0207657_10000131 | Ga0207657_1000013133 | 355 |
| 780 | 3300025941 | Ga0207711_10228248 | Ga0207711_102282482 | 355 |
| 781 | 3300025949 | Ga0207667_10009431 | Ga0207667_100094317 | 355 |
| 782 | 3300037418 | Ga0395900_0002303 | Ga0395900_0002303_15459_16526 | 355 |
| 783 | 3300037418 | Ga0395900_0007321 | Ga0395900_0007321_9315_10382 | 355 |
| 784 | 3300037418 | Ga0395900_0134985 | Ga0395900_0134985_629_1696 | 355 |
| 785 | 3300037418 | Ga0395900_0138938 | Ga0395900_0138938_109_1176 | 355 |
| 786 | 3300037418 | Ga0395900_0250241 | Ga0395900_0250241_524_1591 | 355 |
| 787 | 3300037466 | Ga0395898_0001260 | Ga0395898_0001260_8091_9158 | 355 |
| 788 | 3300037466 | Ga0395898_0032722 | Ga0395898_0032722_161_1228 | 355 |
| 789 | 3300037471 | Ga0395905_0000168 | Ga0395905_0000168_21734_22804 | 355 |
| 790 | 3300038443 | Ga0395901_0010491 | Ga0395901_0010491_2362_3429 | 355 |
| 791 | 3300038443 | Ga0395901_0170239 | Ga0395901_0170239_753_1820 | 355 |
| 792 | 3300038443 | Ga0395901_0194691 | Ga0395901_0194691_305_1372 | 355 |
| 793 | 3300039447 | Ga0436361_0131139 | Ga0436361_0131139_5237_6310 | 355 |
| 794 | 3300042005 | Ga0439448_0001330 | Ga0439448_0001330_19_1086 | 355 |
| 795 | 3300044656 | Ga0466969_0002847 | Ga0466969_0002847_2360_3427 | 355 |
| 796 | 3300044659 | Ga0466973_0009139 | Ga0466973_0009139_6085_7152 | 355 |
| 797 | 3300044683 | Ga0466965_0001211 | Ga0466965_0001211_8088_9155 | 355 |
| 798 | 3300044683 | Ga0466965_0001863 | Ga0466965_0001863_1731_2798 | 355 |
| 799 | 3300044684 | Ga0466966_0000032 | Ga0466966_0000032_22878_23945 | 355 |
| 800 | 3300044684 | Ga0466966_0016532 | Ga0466966_0016532_789_1856 | 355 |
| 801 | 3300044684 | Ga0466966_0063721 | Ga0466966_0063721_127_1194 | 355 |
| 802 | 3300044693 | Ga0466961_0004925 | Ga0466961_0004925_7029_8096 | 355 |
| 803 | 3300044693 | Ga0466961_0116424 | Ga0466961_0116424_76_1143 | 355 |
| 804 | 3300044694 | Ga0466963_0001953 | Ga0466963_0001953_2856_3923 | 355 |
| 805 | 3300044706 | Ga0466964_0002026 | Ga0466964_0002026_2586_3653 | 355 |
| 806 | 3300044735 | Ga0466968_0005823 | Ga0466968_0005823_2945_4012 | 355 |
| 807 | 3300044842 | Ga0466957_0015351 | Ga0466957_0015351_297_1364 | 355 |
| 808 | 3300044842 | Ga0466957_0047793 | Ga0466957_0047793_238_1305 | 355 |
| 809 | 3300044842 | Ga0466957_0097795 | Ga0466957_0097795_355_1422 | 355 |
| 810 | 3300045049 | Ga0466959_0010040 | Ga0466959_0010040_1641_2708 | 355 |
| 811 | 3300045836 | Ga0466958_0005164 | Ga0466958_0005164_2041_3108 | 355 |
| 812 | 3300045836 | Ga0466958_0009785 | Ga0466958_0009785_243_1310 | 355 |
| 813 | 3300045836 | Ga0466958_0021413 | Ga0466958_0021413_2617_3684 | 355 |
| 814 | 3300046455 | Ga0495603_0009400 | Ga0495603_0009400_1412_2482 | 355 |
| 815 | 3300046474 | Ga0495605_0010712 | Ga0495605_0010712_222_1292 | 355 |
| 816 | 3300046506 | Ga0495583_0006862 | Ga0495583_0006862_3476_4546 | 355 |
| 817 | 3300046513 | Ga0495616_0073811 | Ga0495616_0073811_108_1178 | 355 |
| 818 | 3300046524 | Ga0495648_0021277 | Ga0495648_0021277_3246_4316 | 355 |
| 819 | 3300046557 | Ga0495622_0016921 | Ga0495622_0016921_2229_3299 | 355 |
| 820 | 3300046684 | Ga0495669_0035962 | Ga0495669_0035962_565_1635 | 355 |
| 821 | 3300047319 | Ga0495674_0294906 | Ga0495674_0294906_138_1208 | 355 |
| 822 | 3300047323 | Ga0495683_0075182 | Ga0495683_0075182_199_1269 | 355 |
| 823 | 3300047443 | Ga0495687_006437 | Ga0495687_006437_2787_3857 | 355 |
| 824 | 3300048903 | Ga0496100_0009676 | Ga0496100_0009676_404_1474 | 355 |
| 825 | 3300048905 | Ga0496102_0003852 | Ga0496102_0003852_6261_7331 | 355 |
| 826 | 3300048906 | Ga0496103_0011673 | Ga0496103_0011673_996_2066 | 355 |
| 827 | 3300048907 | Ga0496104_0028881 | Ga0496104_0028881_3125_4195 | 355 |
| 828 | 3300048908 | Ga0496105_0052227 | Ga0496105_0052227_1017_2087 | 355 |
| 829 | 3300048908 | Ga0496105_0171307 | Ga0496105_0171307_342_1412 | 355 |
| 830 | 3300048908 | Ga0496105_0208750 | Ga0496105_0208750_364_1434 | 355 |
| 831 | 3300048909 | Ga0496106_0000031 | Ga0496106_0000031_69021_70091 | 355 |
| 832 | 3300048915 | Ga0496112_0041577 | Ga0496112_0041577_2332_3402 | 355 |
| 833 | 3300048916 | Ga0496113_0256718 | Ga0496113_0256718_136_1206 | 355 |
| 834 | 3300048919 | Ga0496116_0104757 | Ga0496116_0104757_567_1637 | 355 |
| 835 | 3300048921 | Ga0496118_0027358 | Ga0496118_0027358_2847_3917 | 355 |
| 836 | 3300048921 | Ga0496118_0043345 | Ga0496118_0043345_2066_3136 | 355 |
| 837 | 3300048921 | Ga0496118_0056034 | Ga0496118_0056034_694_1764 | 355 |
| 838 | 3300048924 | Ga0496121_0082136 | Ga0496121_0082136_1338_2408 | 355 |
| 839 | 3300048924 | Ga0496121_0156425 | Ga0496121_0156425_509_1579 | 355 |
| 840 | 3300048929 | Ga0496126_0003523 | Ga0496126_0003523_4910_5980 | 355 |
| 841 | 3300048929 | Ga0496126_0244826 | Ga0496126_0244826_400_1470 | 355 |
| 842 | 3300049459 | Ga0495678_051418 | Ga0495678_051418_416_1486 | 355 |
| 843 | 3300049460 | Ga0495682_0015318 | Ga0495682_0015318_482_1552 | 355 |
| 844 | 3300061719 | Ga0466962_0016712 | Ga0466962_0016712_2425_3492 | 355 |
| 845 | 3300061719 | Ga0466962_0061442 | Ga0466962_0061442_190_1257 | 355 |
| 846 | iso_pu_bacteria | 2510917013 | 2511089475 | 355 |
| 847 | iso_pu_bacteria | 2513237166 | 2514046283 | 355 |
| 848 | 3300001979 | JGI24740J21852_10003397 | JGI24740J21852_100033977 | 356 |
| 849 | 3300001989 | JGI24739J22299_10002664 | JGI24739J22299_100026646 | 356 |
| 850 | 3300001989 | JGI24739J22299_10005575 | JGI24739J22299_100055756 | 356 |
| 851 | 3300001990 | JGI24737J22298_10023739 | JGI24737J22298_100237391 | 356 |
| 852 | 3300002067 | JGI24735J21928_10002378 | JGI24735J21928_100023784 | 356 |
| 853 | 3300002075 | JGI24738J21930_10001505 | JGI24738J21930_100015054 | 356 |
| 854 | 3300002705 | JGI25156J39149_1000504 | JGI25156J39149_10005044 | 356 |
| 855 | 3300002705 | JGI25156J39149_1000735 | JGI25156J39149_10007357 | 356 |
| 856 | 3300002705 | JGI25156J39149_1002542 | JGI25156J39149_10025425 | 356 |
| 857 | 3300003214 | JGI25165J46597_1001196 | JGI25165J46597_10011965 | 356 |
| 858 | 3300003756 | Ga0055533_1000292 | Ga0055533_100029221 | 356 |
| 859 | 3300003758 | Ga0055532_1000001 | Ga0055532_1000001959 | 356 |
| 860 | 3300003760 | Ga0055527_1000014 | Ga0055527_100001445 | 356 |
| 861 | 3300003761 | Ga0055535_1000001 | Ga0055535_100000145 | 356 |
| 862 | 3300003762 | Ga0055542_1000001 | Ga0055542_1000001958 | 356 |
| 863 | 3300003763 | Ga0055529_1000001 | Ga0055529_100000145 | 356 |
| 864 | 3300005327 | Ga0070658_10265732 | Ga0070658_102657321 | 356 |
| 865 | 3300009011 | Ga0105251_10000097 | Ga0105251_1000009738 | 356 |
| 866 | 3300009093 | Ga0105240_10345382 | Ga0105240_103453821 | 356 |
| 867 | 3300011119 | Ga0105246_10352220 | Ga0105246_103522201 | 356 |
| 868 | 3300015262 | Ga0182007_10000150 | Ga0182007_1000015044 | 356 |
| 869 | 3300025226 | Ga0209674_100005 | Ga0209674_1000051391 | 356 |
| 870 | 3300025226 | Ga0209674_100092 | Ga0209674_10009259 | 356 |
| 871 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011788 | 356 |
| 872 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011788 | 356 |
| 873 | 3300025230 | Ga0209563_104011 | Ga0209563_1040112 | 356 |
| 874 | 3300025231 | Ga0207427_103987 | Ga0207427_1039872 | 356 |
| 875 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011788 | 356 |
| 876 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031788 | 356 |
| 877 | 3300025256 | Ga0209759_1000053 | Ga0209759_100005397 | 356 |
| 878 | 3300025256 | Ga0209759_1000074 | Ga0209759_100007427 | 356 |
| 879 | 3300025256 | Ga0209759_1000601 | Ga0209759_100060124 | 356 |
| 880 | 3300025261 | Ga0209233_1000016 | Ga0209233_1000016748 | 356 |
| 881 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011788 | 356 |
| 882 | 3300025735 | Ga0207713_1000305 | Ga0207713_10003053 | 356 |
| 883 | 3300025904 | Ga0207647_10008546 | Ga0207647_100085464 | 356 |
| 884 | 3300025904 | Ga0207647_10027493 | Ga0207647_100274936 | 356 |
| 885 | 3300025904 | Ga0207647_10043031 | Ga0207647_100430312 | 356 |
| 886 | 3300025909 | Ga0207705_10134982 | Ga0207705_101349822 | 356 |
| 887 | 3300025913 | Ga0207695_10188464 | Ga0207695_101884642 | 356 |
| 888 | 3300025949 | Ga0207667_10113941 | Ga0207667_101139414 | 356 |
| 889 | 3300025986 | Ga0207658_10057051 | Ga0207658_100570512 | 356 |
| 890 | 3300026067 | Ga0207678_10262867 | Ga0207678_102628672 | 356 |
| 891 | 3300027312 | Ga0209371_1001109 | Ga0209371_10011094 | 356 |
| 892 | 3300030500 | Ga0268256_1000921 | Ga0268256_100092115 | 356 |
| 893 | 3300031548 | Ga0307408_100002431 | Ga0307408_1000024314 | 356 |
| 894 | 3300031911 | Ga0307412_10000051 | Ga0307412_1000005113 | 356 |
| 895 | 3300031911 | Ga0307412_10194031 | Ga0307412_101940312 | 356 |
| 896 | 3300032005 | Ga0307411_10118497 | Ga0307411_101184972 | 356 |
| 897 | 3300046454 | Ga0495592_0040557 | Ga0495592_0040557_2336_3406 | 356 |
| 898 | 3300046454 | Ga0495592_0197290 | Ga0495592_0197290_95_1177 | 356 |
| 899 | 3300046458 | Ga0495591_006781 | Ga0495591_006781_422_1498 | 356 |
| 900 | 3300046459 | Ga0495629_0000369 | Ga0495629_0000369_2270_3340 | 356 |
| 901 | 3300046459 | Ga0495629_0005165 | Ga0495629_0005165_6323_7393 | 356 |
| 902 | 3300046459 | Ga0495629_0041923 | Ga0495629_0041923_1935_3011 | 356 |
| 903 | 3300046459 | Ga0495629_0049525 | Ga0495629_0049525_1427_2497 | 356 |
| 904 | 3300046460 | Ga0495638_0074310 | Ga0495638_0074310_766_1836 | 356 |
| 905 | 3300046462 | Ga0495651_0009952 | Ga0495651_0009952_2605_3681 | 356 |
| 906 | 3300046462 | Ga0495651_0023058 | Ga0495651_0023058_1263_2333 | 356 |
| 907 | 3300046462 | Ga0495651_0218439 | Ga0495651_0218439_59_1129 | 356 |
| 908 | 3300046463 | Ga0495653_0018833 | Ga0495653_0018833_865_1935 | 356 |
| 909 | 3300046463 | Ga0495653_0023696 | Ga0495653_0023696_2038_3114 | 356 |
| 910 | 3300046463 | Ga0495653_0037748 | Ga0495653_0037748_836_1918 | 356 |
| 911 | 3300046471 | Ga0495650_0014058 | Ga0495650_0014058_398_1468 | 356 |
| 912 | 3300046471 | Ga0495650_0017226 | Ga0495650_0017226_1043_2113 | 356 |
| 913 | 3300046471 | Ga0495650_0019000 | Ga0495650_0019000_491_1567 | 356 |
| 914 | 3300046471 | Ga0495650_0027417 | Ga0495650_0027417_1042_2112 | 356 |
| 915 | 3300046472 | Ga0495580_0005418 | Ga0495580_0005418_2461_3531 | 356 |
| 916 | 3300046472 | Ga0495580_0023500 | Ga0495580_0023500_2906_3976 | 356 |
| 917 | 3300046472 | Ga0495580_0070077 | Ga0495580_0070077_585_1655 | 356 |
| 918 | 3300046472 | Ga0495580_0113459 | Ga0495580_0113459_31_1107 | 356 |
| 919 | 3300046472 | Ga0495580_0149687 | Ga0495580_0149687_433_1503 | 356 |
| 920 | 3300046472 | Ga0495580_0159856 | Ga0495580_0159856_396_1466 | 356 |
| 921 | 3300046473 | Ga0495582_0052398 | Ga0495582_0052398_252_1322 | 356 |
| 922 | 3300046474 | Ga0495605_0002196 | Ga0495605_0002196_4006_5076 | 356 |
| 923 | 3300046474 | Ga0495605_0016596 | Ga0495605_0016596_557_1627 | 356 |
| 924 | 3300046477 | Ga0495664_0015601 | Ga0495664_0015601_1320_2396 | 356 |
| 925 | 3300046500 | Ga0495596_0005025 | Ga0495596_0005025_3448_4524 | 356 |
| 926 | 3300046500 | Ga0495596_0039764 | Ga0495596_0039764_539_1609 | 356 |
| 927 | 3300046506 | Ga0495583_0003894 | Ga0495583_0003894_5179_6249 | 356 |
| 928 | 3300046507 | Ga0495606_0083444 | Ga0495606_0083444_510_1580 | 356 |
| 929 | 3300046507 | Ga0495606_0099160 | Ga0495606_0099160_582_1652 | 356 |
| 930 | 3300046511 | Ga0495608_0007446 | Ga0495608_0007446_5045_6121 | 356 |
| 931 | 3300046511 | Ga0495608_0042458 | Ga0495608_0042458_912_1982 | 356 |
| 932 | 3300046514 | Ga0495618_0001663 | Ga0495618_0001663_2080_3156 | 356 |
| 933 | 3300046514 | Ga0495618_0011271 | Ga0495618_0011271_442_1512 | 356 |
| 934 | 3300046515 | Ga0495620_0036745 | Ga0495620_0036745_833_1903 | 356 |
| 935 | 3300046516 | Ga0495628_0027908 | Ga0495628_0027908_2370_3440 | 356 |
| 936 | 3300046516 | Ga0495628_0037443 | Ga0495628_0037443_2038_3114 | 356 |
| 937 | 3300046516 | Ga0495628_0174155 | Ga0495628_0174155_478_1548 | 356 |
| 938 | 3300046517 | Ga0495630_0020532 | Ga0495630_0020532_718_1788 | 356 |
| 939 | 3300046517 | Ga0495630_0044761 | Ga0495630_0044761_1748_2818 | 356 |
| 940 | 3300046517 | Ga0495630_0235052 | Ga0495630_0235052_295_1371 | 356 |
| 941 | 3300046524 | Ga0495648_0044551 | Ga0495648_0044551_1491_2561 | 356 |
| 942 | 3300046524 | Ga0495648_0142954 | Ga0495648_0142954_107_1177 | 356 |
| 943 | 3300046526 | Ga0495666_0004704 | Ga0495666_0004704_3982_5058 | 356 |
| 944 | 3300046526 | Ga0495666_0005594 | Ga0495666_0005594_2467_3537 | 356 |
| 945 | 3300046528 | Ga0495642_0006746 | Ga0495642_0006746_3183_4253 | 356 |
| 946 | 3300046529 | Ga0495652_0033248 | Ga0495652_0033248_2146_3216 | 356 |
| 947 | 3300046531 | Ga0495665_0025686 | Ga0495665_0025686_877_1953 | 356 |
| 948 | 3300046533 | Ga0495640_0002933 | Ga0495640_0002933_3016_4092 | 356 |
| 949 | 3300046533 | Ga0495640_0005861 | Ga0495640_0005861_2136_3206 | 356 |
| 950 | 3300046533 | Ga0495640_0113370 | Ga0495640_0113370_302_1372 | 356 |
| 951 | 3300046535 | Ga0495586_0031997 | Ga0495586_0031997_1421_2491 | 356 |
| 952 | 3300046535 | Ga0495586_0092520 | Ga0495586_0092520_484_1554 | 356 |
| 953 | 3300046542 | Ga0495597_0016569 | Ga0495597_0016569_2377_3447 | 356 |
| 954 | 3300046543 | Ga0495645_0122181 | Ga0495645_0122181_572_1642 | 356 |
| 955 | 3300046557 | Ga0495622_0004831 | Ga0495622_0004831_4642_5718 | 356 |
| 956 | 3300046559 | Ga0495667_0022585 | Ga0495667_0022585_1207_2283 | 356 |
| 957 | 3300046642 | Ga0495634_0011188 | Ga0495634_0011188_4788_5858 | 356 |
| 958 | 3300046642 | Ga0495634_0022513 | Ga0495634_0022513_2588_3664 | 356 |
| 959 | 3300046660 | Ga0495625_0155597 | Ga0495625_0155597_252_1322 | 356 |
| 960 | 3300046663 | Ga0495635_0013627 | Ga0495635_0013627_1446_2516 | 356 |
| 961 | 3300046663 | Ga0495635_0034889 | Ga0495635_0034889_1784_2860 | 356 |
| 962 | 3300046665 | Ga0495661_0005519 | Ga0495661_0005519_4749_5825 | 356 |
| 963 | 3300046678 | Ga0495599_0015425 | Ga0495599_0015425_1748_2818 | 356 |
| 964 | 3300046678 | Ga0495599_0032828 | Ga0495599_0032828_1816_2892 | 356 |
| 965 | 3300046678 | Ga0495599_0048735 | Ga0495599_0048735_1566_2636 | 356 |
| 966 | 3300046678 | Ga0495599_0131437 | Ga0495599_0131437_212_1282 | 356 |
| 967 | 3300046679 | Ga0495623_0007011 | Ga0495623_0007011_4455_5531 | 356 |
| 968 | 3300046679 | Ga0495623_0010956 | Ga0495623_0010956_592_1662 | 356 |
| 969 | 3300046680 | Ga0495646_0001320 | Ga0495646_0001320_2170_3246 | 356 |
| 970 | 3300046680 | Ga0495646_0021365 | Ga0495646_0021365_334_1404 | 356 |
| 971 | 3300046680 | Ga0495646_0023967 | Ga0495646_0023967_243_1313 | 356 |
| 972 | 3300046680 | Ga0495646_0034617 | Ga0495646_0034617_583_1653 | 356 |
| 973 | 3300046690 | Ga0495624_0009914 | Ga0495624_0009914_4931_6001 | 356 |
| 974 | 3300046690 | Ga0495624_0016074 | Ga0495624_0016074_1712_2788 | 356 |
| 975 | 3300046690 | Ga0495624_0016284 | Ga0495624_0016284_437_1507 | 356 |
| 976 | 3300046690 | Ga0495624_0017769 | Ga0495624_0017769_2495_3565 | 356 |
| 977 | 3300046690 | Ga0495624_0121640 | Ga0495624_0121640_99_1169 | 356 |
| 978 | 3300046692 | Ga0495671_0038591 | Ga0495671_0038591_107_1177 | 356 |
| 979 | 3300046692 | Ga0495671_0076100 | Ga0495671_0076100_131_1207 | 356 |
| 980 | 3300046694 | Ga0495649_0001567 | Ga0495649_0001567_3373_4443 | 356 |
| 981 | 3300046694 | Ga0495649_0068416 | Ga0495649_0068416_431_1501 | 356 |
| 982 | 3300046794 | Ga0495589_0010940 | Ga0495589_0010940_3482_4558 | 356 |
| 983 | 3300046809 | Ga0495600_0013215 | Ga0495600_0013215_1840_2916 | 356 |
| 984 | 3300046809 | Ga0495600_0032687 | Ga0495600_0032687_1483_2553 | 356 |
| 985 | 3300046810 | Ga0495660_0138054 | Ga0495660_0138054_12_1082 | 356 |
| 986 | 3300047315 | Ga0495581_0006589 | Ga0495581_0006589_5279_6355 | 356 |
| 987 | 3300047315 | Ga0495581_0023067 | Ga0495581_0023067_1061_2131 | 356 |
| 988 | 3300047317 | Ga0495604_0036700 | Ga0495604_0036700_2275_3345 | 356 |
| 989 | 3300047317 | Ga0495604_0037578 | Ga0495604_0037578_602_1672 | 356 |
| 990 | 3300047319 | Ga0495674_0036272 | Ga0495674_0036272_60_1136 | 356 |
| 991 | 3300047319 | Ga0495674_0045553 | Ga0495674_0045553_1083_2153 | 356 |
| 992 | 3300047319 | Ga0495674_0082240 | Ga0495674_0082240_155_1225 | 356 |
| 993 | 3300047319 | Ga0495674_0094523 | Ga0495674_0094523_1307_2377 | 356 |
| 994 | 3300047321 | Ga0495676_0046582 | Ga0495676_0046582_2035_3111 | 356 |
| 995 | 3300047321 | Ga0495676_0105211 | Ga0495676_0105211_503_1573 | 356 |
| 996 | 3300047322 | Ga0495680_0021369 | Ga0495680_0021369_2248_3324 | 356 |
| 997 | 3300047322 | Ga0495680_0035715 | Ga0495680_0035715_489_1559 | 356 |
| 998 | 3300047323 | Ga0495683_0006607 | Ga0495683_0006607_2584_3654 | 356 |
| 999 | 3300047443 | Ga0495687_017752 | Ga0495687_017752_149_1219 | 356 |
| 1000 | 3300047443 | Ga0495687_060421 | Ga0495687_060421_321_1391 | 356 |
| 1001 | 3300047444 | Ga0495675_0003779 | Ga0495675_0003779_1843_2919 | 356 |
| 1002 | 3300047444 | Ga0495675_0024722 | Ga0495675_0024722_2303_3373 | 356 |
| 1003 | 3300047444 | Ga0495675_0036826 | Ga0495675_0036826_1231_2301 | 356 |
| 1004 | 3300047444 | Ga0495675_0132796 | Ga0495675_0132796_338_1408 | 356 |
| 1005 | 3300047446 | Ga0495679_000109 | Ga0495679_000109_26841_27911 | 356 |
| 1006 | 3300047469 | Ga0495673_0051646 | Ga0495673_0051646_321_1397 | 356 |
| 1007 | 3300047471 | Ga0495684_0110236 | Ga0495684_0110236_566_1636 | 356 |
| 1008 | 3300047471 | Ga0495684_0132016 | Ga0495684_0132016_479_1549 | 356 |
| 1009 | 3300047472 | Ga0495686_0014261 | Ga0495686_0014261_2645_3715 | 356 |
| 1010 | 3300047673 | Ga0495593_0001995 | Ga0495593_0001995_8893_9969 | 356 |
| 1011 | 3300047673 | Ga0495593_0004554 | Ga0495593_0004554_515_1585 | 356 |
| 1012 | 3300048088 | Ga0495602_0019497 | Ga0495602_0019497_5293_6375 | 356 |
| 1013 | 3300048089 | Ga0495614_0006640 | Ga0495614_0006640_252_1328 | 356 |
| 1014 | 3300048091 | Ga0495626_0017922 | Ga0495626_0017922_392_1462 | 356 |
| 1015 | 3300048091 | Ga0495626_0021549 | Ga0495626_0021549_1136_2206 | 356 |
| 1016 | 3300048091 | Ga0495626_0049299 | Ga0495626_0049299_276_1346 | 356 |
| 1017 | 3300048905 | Ga0496102_0048343 | Ga0496102_0048343_2142_3218 | 356 |
| 1018 | 3300048906 | Ga0496103_0040992 | Ga0496103_0040992_1009_2085 | 356 |
| 1019 | 3300048919 | Ga0496116_0066210 | Ga0496116_0066210_649_1719 | 356 |
| 1020 | 3300048920 | Ga0496117_0004561 | Ga0496117_0004561_2051_3127 | 356 |
| 1021 | 3300048920 | Ga0496117_0017799 | Ga0496117_0017799_2175_3245 | 356 |
| 1022 | 3300048921 | Ga0496118_0001983 | Ga0496118_0001983_13336_14412 | 356 |
| 1023 | 3300048921 | Ga0496118_0002651 | Ga0496118_0002651_3412_4482 | 356 |
| 1024 | 3300048921 | Ga0496118_0022762 | Ga0496118_0022762_4121_5191 | 356 |
| 1025 | 3300048926 | Ga0496123_0126072 | Ga0496123_0126072_182_1252 | 356 |
| 1026 | 3300048929 | Ga0496126_0003440 | Ga0496126_0003440_4142_5212 | 356 |
| 1027 | 3300049459 | Ga0495678_017996 | Ga0495678_017996_475_1545 | 356 |
| 1028 | 3300049460 | Ga0495682_0007262 | Ga0495682_0007262_2559_3629 | 356 |
| 1029 | 3300049460 | Ga0495682_0060012 | Ga0495682_0060012_290_1360 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4klc-assembly1.cif.gz_B | e343d/f110a double mutant of human ferrochelatase | 0.9106 | 16 | 341 |
| 2pnj-assembly1.cif.gz_A | crystal structure of human ferrochelatase mutant with phe 337 replaced by ala | 0.9092 | 14 | 341 |
| 2pnj-assembly1.cif.gz_B | crystal structure of human ferrochelatase mutant with phe 337 replaced by ala | 0.9062 | 16 | 341 |
| 3aqi-assembly1.cif.gz_B | h240a variant of human ferrochelatase | 0.8989 | 14 | 341 |
| 2po7-assembly1.cif.gz_B | crystal structure of human ferrochelatase mutant with his 341 replaced by cys | 0.8981 | 14 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23871_188_298_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9849 | 209 | 317 | 3.40.50.1400 |
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9793 | 18 | 176 | 3.40.50.1400 |
| af_P23871_6_250_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.977 | 18 | 269 | 3.40.605.10 |
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.967 | 18 | 176 | 3.40.50.1400 |
| af_Q8ID58_27_285_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9656 | 18 | 278 | 3.40.50.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2EL70-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9922 | 20 | 347 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A0G4JB43-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9919 | 1 | 348 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A2M7FPN8-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) | 0.9908 | 42 | 347 |
GO:0004325
GO:0005737 GO:0006783 |
| AF-A0A259PFH2-F1-model_v4 | coproporphyrin ferrochelatase (EC 4.99.1.9) | 0.9894 | 90 | 346 |
GO:0004325
GO:0006783 |
| AF-A0A537GB29-F1-model_v4 | Ferrochelatase | 0.9876 | 18 | 121 |
GO:0004325
GO:0006783 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar