F488588

General Info

Members Datasets Scaffolds Average Seq Length
1029 500 898 349

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237166|2514046283
Length 397
Sequence MRGVFRLANWPNGQVSPSDRAAIMSFSPLRAAPLRGFCLLPMRFDLERPLQSATAHRVAVLLINLGTPDAPTPRAVRRYLAQFLSDPRVVEIPAFVWQIILRLFILPFRGVASAKKYASVWMPEGSPLRVHTQKQVEGLRHLLHLNDYTVIVDYAMRYGTPDIPAMLNQLKLAGAERILLMPMYPQYSSSTTATAFDDAFAALKRMRNQPEIRTVRQYADHPAYIAALAAQVNHYWHTHGRPDFAAGDKLVLSFHGVPKRTLDLGDPYHDQCQQTASLLMHALGLTSVECRVTFQSRFGKAEWLQPYTAPTLKELGAAGVHRADVFCPGFTADCLETIEEIGMEVRDEFVHAGGKVFHAIPCLNAAPAWIAALGEIVAQHLQGWPVQAVAPQSASVA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
15 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
16 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
17 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
18 2519103095 Burkholderia sp. KJ006 Isolate Nodule
19 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
20 2547132512 Azospira oryzae 6a3 Isolate Unclassified
21 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
22 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
23 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
24 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
25 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
26 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
27 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
28 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
29 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
30 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
31 2643221593 Lysobacter sp. Root690 Isolate Unclassified
32 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
33 2643221658 Variovorax sp. Root411 Isolate Unclassified
34 2643221672 Variovorax sp. Root434 Isolate Unclassified
35 2643221683 Variovorax sp. Root473 Isolate Unclassified
36 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
37 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
38 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
39 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
40 2738541277 Variovorax sp. GV051 Isolate Unclassified
41 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
42 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
43 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
44 2738541307 Variovorax sp. GV008 Isolate Unclassified
45 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
46 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
47 2738543019 Variovorax sp. GV040 Isolate Unclassified
48 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
49 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
50 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
51 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
52 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
53 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
54 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
55 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
56 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
57 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
58 2818991446 Variovorax sp. 1180 Isolate Unclassified
59 2818991450 Burkholderia sp. 604 Isolate Unclassified
60 2818991452 Burkholderia cepacia 561 Isolate Unclassified
61 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
62 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
63 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
64 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
65 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
66 2842677519 Variovorax sp. R-72495 Isolate Unclassified
67 2842733646 Variovorax sp. R-72446 Isolate Unclassified
68 2842747753 Variovorax sp. R-72060 Isolate Unclassified
69 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
70 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
71 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
72 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
73 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
74 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
75 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
76 2885198086 Variovorax sp. 679 Isolate Unclassified
77 2885211737 Variovorax sp. 553 Isolate Unclassified
78 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
79 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
80 2899924645 Variovorax sp. 369 Isolate Unclassified
81 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
82 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
83 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
84 2904456579 Variovorax sp. 2002 Isolate Unclassified
85 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
86 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
87 2904564687 Burkholderia sp. 571 Isolate Unclassified
88 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
89 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
90 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
91 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
92 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
93 2928037797 Variovorax sp. 1126 Isolate Unclassified
94 2928044640 Variovorax sp. 1128 Isolate Unclassified
95 2928051484 Variovorax sp. 1133 Isolate Unclassified
96 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
97 2928070936 Variovorax gossypii 1167 Isolate Unclassified
98 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
99 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
100 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
101 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
102 2928163908 Burkholderia sp. 567 Isolate Unclassified
103 2928170801 Burkholderia sp. 572 Isolate Unclassified
104 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
105 2928536128 Burkholderia sola 565 Isolate Unclassified
106 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
107 2929520902 Variovorax beijingensis 502 Isolate Unclassified
108 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
109 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
110 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
111 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
112 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
113 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
114 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
115 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
116 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
117 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
118 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
119 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
120 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
121 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
122 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
123 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
124 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
125 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
126 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
127 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
128 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
129 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
130 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
131 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
132 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
133 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
134 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
135 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
136 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
137 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
138 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
139 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
140 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
141 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
142 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
143 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
144 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
145 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
146 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
147 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
148 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
152 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
153 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
154 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
155 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
156 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
157 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
162 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
163 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
164 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
165 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
166 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
167 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
168 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
171 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
172 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
173 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
174 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
175 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
176 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
181 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
182 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
183 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
184 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
192 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
193 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
194 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
198 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
199 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
203 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
204 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
205 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
212 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
218 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
220 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
222 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
223 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
224 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
233 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
269 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
270 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
271 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
272 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
273 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
274 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
277 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
283 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
284 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
292 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
293 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
301 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
302 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
303 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
306 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
307 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
308 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
309 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
310 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
311 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
312 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
313 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
314 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
315 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
316 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
317 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
318 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
319 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
320 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
321 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
333 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
355 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
356 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
357 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
358 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
370 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
371 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
372 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
373 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
374 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
375 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
376 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
377 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
378 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
379 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
380 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
381 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
385 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
405 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
406 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
411 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
412 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
413 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
414 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
415 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
416 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
419 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
420 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
425 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
426 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
427 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
428 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
436 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
437 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
441 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
442 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
443 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
444 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
445 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
446 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
447 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
448 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
449 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
450 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
457 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
458 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
459 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
460 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
461 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
462 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
463 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
464 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
465 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
466 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
467 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
468 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
469 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
470 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
471 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
472 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
473 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
474 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
475 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
476 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
477 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
478 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
479 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
480 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
481 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
482 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
483 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
484 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
485 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
486 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
487 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
488 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
489 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
490 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
491 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
492 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
493 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
494 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
495 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
496 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
497 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
498 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
499 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
500 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.69
Metatranscriptomes 0.58
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 2.24
Rhizoplane 5.15
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 12.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003397 3300001979 Bacteria 7006
2 JGI24740J21852_10007221 3300001979 Bacteria 4529
3 JGI24739J22299_10002664 3300001989 Bacteria 6874
4 JGI24739J22299_10005575 3300001989 Bacteria 4773
5 JGI24739J22299_10035620 3300001989 Bacteria 1686
6 JGI24737J22298_10023739 3300001990 Bacteria 1944
7 JGI24735J21928_10002378 3300002067 Bacteria 6546
8 JGI24735J21928_10049111 3300002067 Bacteria 1220
9 JGI24738J21930_10001505 3300002075 Bacteria 6459
10 JGI25155J39150_1000724 3300002704 Bacteria 5734
11 JGI25156J39149_1000504 3300002705 Bacteria 22869
12 JGI25156J39149_1000735 3300002705 Bacteria 17392
13 JGI25156J39149_1002542 3300002705 Bacteria 6479
14 JGI25152J39213_1000915 3300002773 Bacteria 14469
15 JGI25152J39213_1001246 3300002773 Bacteria 11617
16 JGI25150J39212_1000991 3300002774 Bacteria 8877
17 JGI25150J39212_1002008 3300002774 Bacteria 5305
18 JGI25159J45721_1001447 3300002987 Bacteria 9805
19 JGI25151J46595_10002025 3300003187 Bacteria 12673
20 JGI25151J46595_10002925 3300003187 Bacteria 9778
21 JGI25151J46595_10003922 3300003187 Bacteria 8027
22 JGI25151J46595_10008898 3300003187 Bacteria 4792
23 JGI25165J46597_1001196 3300003214 Bacteria 15743
24 JGI25153J46596_10001486 3300003215 Bacteria 13976
25 JGI25153J46596_10004452 3300003215 Bacteria 7551
26 rootL2_10002479 3300003322 Bacteria 16465
27 rootL2_10084409 3300003322 Bacteria 1779
28 JGI25160J50197_1000171 3300003354 Bacteria 55915
29 JGI25160J50197_1001502 3300003354 Bacteria 11587
30 JGI25160J50197_1006483 3300003354 Bacteria 4729
31 JGI25161J50226_1001006 3300003374 Bacteria 9840
32 JGI25161J50226_1002287 3300003374 Bacteria 5010
33 Ga0006562J51391_1095652 3300003578 Bacteria 5267
34 Ga0006562J51391_1095654 3300003578 Bacteria 2270
35 Ga0055533_1000292 3300003756 Bacteria 25514
36 Ga0055532_1000001 3300003758 Bacteria 1119836
37 Ga0055532_1002025 3300003758 Bacteria 4653
38 Ga0055532_1002081 3300003758 Bacteria 4552
39 Ga0055532_1002399 3300003758 Bacteria 3929
40 Ga0055527_1000014 3300003760 Bacteria 289449
41 Ga0055527_1001374 3300003760 Bacteria 5199
42 Ga0055535_1000001 3300003761 Bacteria 1119836
43 Ga0055535_1000998 3300003761 Bacteria 18248
44 Ga0055535_1002924 3300003761 Bacteria 5304
45 Ga0055535_1002982 3300003761 Bacteria 5199
46 Ga0055542_1000001 3300003762 Bacteria 1119836
47 Ga0055542_1000004 3300003762 Bacteria 553532
48 Ga0055542_1001017 3300003762 Bacteria 17787
49 Ga0055542_1002094 3300003762 Bacteria 7418
50 Ga0055529_1000001 3300003763 Bacteria 826680
51 Ga0055529_1001769 3300003763 Bacteria 5337
52 Ga0055526_1000649 3300003771 Bacteria 26986
53 Ga0055526_1002772 3300003771 Bacteria 11617
54 Ga0055526_1004608 3300003771 Bacteria 8220
55 Ga0055537_1000390 3300003773 Bacteria 29440
56 Ga0055537_1001113 3300003773 Bacteria 11617
57 Ga0055524_1001840 3300003775 Bacteria 11617
58 Ga0055536_1001135 3300003781 Bacteria 16683
59 Ga0055536_1001267 3300003781 Bacteria 15565
60 Ga0055536_1002880 3300003781 Bacteria 9461
61 Ga0055534_1000349 3300003784 Bacteria 29554
62 Ga0055534_1001367 3300003784 Bacteria 9769
63 Ga0055534_1006607 3300003784 Bacteria 2895
64 Ga0055528_1000914 3300003790 Bacteria 19888
65 Ga0055528_1002082 3300003790 Bacteria 11117
66 Ga0055530_10001555 3300003791 Bacteria 16471
67 Ga0055540_1000996 3300003792 Bacteria 18262
68 Ga0055540_1003629 3300003792 Bacteria 7362
69 Ga0055540_1003698 3300003792 Bacteria 7248
70 Ga0055540_1004049 3300003792 Bacteria 6808
71 Ga0055540_1008591 3300003792 Bacteria 3661
72 Ga0055531_10001175 3300003794 Bacteria 20153
73 Ga0055531_10004876 3300003794 Bacteria 7995
74 Ga0055531_10021333 3300003794 Bacteria 2516
75 Ga0058692_1002599 3300003856 Bacteria 5962
76 Ga0055543_1002168 3300004625 Bacteria 6752
77 Ga0055543_1002259 3300004625 Bacteria 6516
78 Ga0065165_1001193 3300005262 Bacteria 30041
79 Ga0065165_1003400 3300005262 Bacteria 11243
80 Ga0065714_10008370 3300005288 Bacteria 2574
81 Ga0065704_10072545 3300005289 Bacteria 8347
82 Ga0070658_10002647 3300005327 Bacteria 14905
83 Ga0070658_10014898 3300005327 Bacteria 6228
84 Ga0070658_10265732 3300005327 Bacteria 1458
85 Ga0070666_10057749 3300005335 Bacteria 2623
86 Ga0068868_100081982 3300005338 Bacteria 2587
87 Ga0070660_100000032 3300005339 Bacteria 85304
88 Ga0070660_100002402 3300005339 Bacteria 12862
89 Ga0070661_100237510 3300005344 Bacteria 1402
90 Ga0070659_100000355 3300005366 Bacteria 34908
91 Ga0070659_100304392 3300005366 Bacteria 1330
92 Ga0070667_100050240 3300005367 Bacteria 3514
93 Ga0070663_100009295 3300005455 Bacteria 6083
94 Ga0070678_100084625 3300005456 Bacteria 2415
95 Ga0070678_100109415 3300005456 Bacteria 2159
96 Ga0070678_100142288 3300005456 Bacteria 1921
97 Ga0070662_100017863 3300005457 Bacteria 4787
98 Ga0070662_100267055 3300005457 Bacteria 1380
99 Ga0068853_100020864 3300005539 Bacteria 5450
100 Ga0068853_100081717 3300005539 Bacteria 2830
101 Ga0070665_100385058 3300005548 Bacteria 1410
102 Ga0068855_100009319 3300005563 Bacteria 11857
103 Ga0068855_100022698 3300005563 Bacteria 7520
104 Ga0068855_100424737 3300005563 Bacteria 1453
105 Ga0070664_100029930 3300005564 Bacteria 4540
106 Ga0068852_100003043 3300005616 Bacteria 11665
107 Ga0068852_100136933 3300005616 Bacteria 2261
108 Ga0068859_100253636 3300005617 Bacteria 1850
109 Ga0068862_100153601 3300005844 Bacteria 2050
110 Ga0075368_10007239 3300006042 Bacteria 3911
111 Ga0075363_100020228 3300006048 Bacteria 3336
112 Ga0075363_100033095 3300006048 Bacteria 2690
113 Ga0075363_100182109 3300006048 Bacteria 1196
114 Ga0075364_10008450 3300006051 Bacteria 6154
115 Ga0075364_10133357 3300006051 Bacteria 1668
116 Ga0075362_10007125 3300006177 Bacteria 4212
117 Ga0075362_10030423 3300006177 Bacteria 2331
118 Ga0075362_10031860 3300006177 Bacteria 2284
119 Ga0075362_10033809 3300006177 Bacteria 2225
120 Ga0075362_10078284 3300006177 Bacteria 1520
121 Ga0075367_10023801 3300006178 Bacteria 3450
122 Ga0075369_10048964 3300006186 Bacteria 1824
123 Ga0075369_10069478 3300006186 Bacteria 1549
124 Ga0075366_10003695 3300006195 Bacteria 8120
125 Ga0075366_10006163 3300006195 Bacteria 6542
126 Ga0075366_10087818 3300006195 Bacteria 1862
127 Ga0075370_10001351 3300006353 Bacteria 10561
128 Ga0075370_10001937 3300006353 Bacteria 9340
129 Ga0075370_10031089 3300006353 Bacteria 2980
130 Ga0075370_10040569 3300006353 Bacteria 2626
131 Ga0075370_10128971 3300006353 Bacteria 1475
132 Ga0068871_100223272 3300006358 Bacteria 1633
133 Ga0097620_100253623 3300006931 Bacteria 1850
134 Ga0099826_10030220 3300006948 Bacteria 3939
135 Ga0105251_10000097 3300009011 Bacteria 85550
136 Ga0105251_10004896 3300009011 Bacteria 8933
137 Ga0105251_10076755 3300009011 Bacteria 1550
138 Ga0105244_10001759 3300009036 Bacteria 17026
139 Ga0105244_10050125 3300009036 Bacteria 2130
140 Ga0105250_10006717 3300009092 Bacteria 4998
141 Ga0105240_10000656 3300009093 Bacteria 63756
142 Ga0105240_10008487 3300009093 Bacteria 14693
143 Ga0105240_10045631 3300009093 Bacteria 5558
144 Ga0105240_10081746 3300009093 Bacteria 3969
145 Ga0105240_10089914 3300009093 Bacteria 3754
146 Ga0105240_10345382 3300009093 Bacteria 1689
147 Ga0105243_10002439 3300009148 Bacteria 15527
148 Ga0105243_10004361 3300009148 Bacteria 11207
149 Ga0105243_10347035 3300009148 Bacteria 1362
150 Ga0105241_10129036 3300009174 Bacteria 2045
151 Ga0105242_10127949 3300009176 Bacteria 2188
152 Ga0105248_10036706 3300009177 Bacteria 5481
153 Ga0105248_10177643 3300009177 Bacteria 2399
154 Ga0105248_10179120 3300009177 Bacteria 2389
155 Ga0105237_10013204 3300009545 Bacteria 8665
156 Ga0105237_10057546 3300009545 Bacteria 3890
157 Ga0105237_10063269 3300009545 Bacteria 3698
158 Ga0105238_10037100 3300009551 Bacteria 4956
159 Ga0105238_10070714 3300009551 Bacteria 3488
160 Ga0105238_10244627 3300009551 Bacteria 1772
161 Ga0105239_10007406 3300010375 Bacteria 12591
162 Ga0105239_10036412 3300010375 Bacteria 5402
163 Ga0105246_10061294 3300011119 Bacteria 2617
164 Ga0105246_10352220 3300011119 Bacteria 1207
165 Ga0157373_10003547 3300013100 Bacteria 11784
166 Ga0157373_10053204 3300013100 Bacteria 2879
167 Ga0157371_10027247 3300013102 Bacteria 4147
168 Ga0157370_10000328 3300013104 Bacteria 59681
169 Ga0157370_10001149 3300013104 Bacteria 32991
170 Ga0157370_10055529 3300013104 Bacteria 3772
171 Ga0157370_10186502 3300013104 Bacteria 1926
172 Ga0157370_10193324 3300013104 Bacteria 1889
173 Ga0157369_10000206 3300013105 Bacteria 81958
174 Ga0157369_10000556 3300013105 Bacteria 49013
175 Ga0157369_10000953 3300013105 Bacteria 36714
176 Ga0157369_10387518 3300013105 Bacteria 1450
177 Ga0157374_10000370 3300013296 Bacteria 41402
178 Ga0163162_10010310 3300013306 Bacteria 9081
179 Ga0163162_10047011 3300013306 Bacteria 4326
180 Ga0157372_10003805 3300013307 Bacteria 16207
181 Ga0157372_10019343 3300013307 Bacteria 7336
182 Ga0182008_10001707 3300014497 Bacteria 14407
183 Ga0182008_10029056 3300014497 Bacteria 2794
184 Ga0157379_10120360 3300014968 Bacteria 2361
185 Ga0182006_1000990 3300015261 Bacteria 18649
186 Ga0182006_1030114 3300015261 Bacteria 2196
187 Ga0182007_10000150 3300015262 Bacteria 47210
188 Ga0182007_10000673 3300015262 Bacteria 19643
189 Ga0182007_10005814 3300015262 Bacteria 5362
190 Ga0182007_10016384 3300015262 Bacteria 2736
191 Ga0183362_10001 3300015683 Bacteria 2046624
192 Ga0183361_10012 3300016635 Bacteria 203395
193 Ga0163161_10000743 3300017792 Bacteria 25623
194 Ga0163161_10005081 3300017792 Bacteria 9158
195 Ga0163161_10011455 3300017792 Bacteria 6153
196 Ga0163161_10016751 3300017792 Bacteria 5122
197 Ga0197907_10707312 3300020069 Bacteria 4514
198 Ga0206354_11366513 3300020081 Bacteria 2607
199 Ga0206353_11314560 3300020082 Bacteria 2421
200 Ga0224712_10000022 3300022467 Bacteria 23225
201 Ga0209436_103577 3300025208 Bacteria 4075
202 Ga0209436_108792 3300025208 Bacteria 1976
203 Ga0209566_100216 3300025225 Bacteria 57945
204 Ga0209674_100005 3300025226 Bacteria 1708125
205 Ga0209674_100092 3300025226 Bacteria 172272
206 Ga0209674_101735 3300025226 Bacteria 5354
207 Ga0209672_100001 3300025228 Bacteria 2828210
208 Ga0209672_100028 3300025228 Bacteria 341962
209 Ga0209672_100038 3300025228 Bacteria 286731
210 Ga0209672_101148 3300025228 Bacteria 10893
211 Ga0209672_101654 3300025228 Bacteria 7273
212 Ga0209147_100001 3300025229 Bacteria 2384371
213 Ga0209147_100112 3300025229 Bacteria 145046
214 Ga0209147_100163 3300025229 Bacteria 90494
215 Ga0209147_100686 3300025229 Bacteria 17369
216 Ga0209147_102613 3300025229 Bacteria 4260
217 Ga0209563_104011 3300025230 Bacteria 2900
218 Ga0207427_103987 3300025231 Bacteria 2703
219 Ga0209258_100001 3300025242 Bacteria 2384269
220 Ga0209258_100022 3300025242 Bacteria 553584
221 Ga0209258_100109 3300025242 Bacteria 203881
222 Ga0209258_100112 3300025242 Bacteria 192884
223 Ga0207425_1000199 3300025245 Bacteria 48186
224 Ga0207425_1000595 3300025245 Bacteria 21041
225 Ga0207425_1002925 3300025245 Bacteria 5720
226 Ga0209148_1000003 3300025254 Bacteria 2384288
227 Ga0209148_1000034 3300025254 Bacteria 553584
228 Ga0209148_1000081 3300025254 Bacteria 273676
229 Ga0209148_1000997 3300025254 Bacteria 18101
230 Ga0209759_1000053 3300025256 Bacteria 212789
231 Ga0209759_1000074 3300025256 Bacteria 177152
232 Ga0209759_1000601 3300025256 Bacteria 34849
233 Ga0209129_1000023 3300025258 Bacteria 420646
234 Ga0209129_1000089 3300025258 Bacteria 177344
235 Ga0209129_1001975 3300025258 Bacteria 10674
236 Ga0209233_1000016 3300025261 Bacteria 907830
237 Ga0209565_1000288 3300025263 Bacteria 49295
238 Ga0209565_1000293 3300025263 Bacteria 48108
239 Ga0209565_1001947 3300025263 Bacteria 8104
240 Ga0209455_1000001 3300025272 Bacteria 2384278
241 Ga0209455_1000050 3300025272 Bacteria 373239
242 Ga0209455_1014935 3300025272 Bacteria 1732
243 Ga0209673_1000038 3300025273 Bacteria 312957
244 Ga0209673_1000265 3300025273 Bacteria 98501
245 Ga0209673_1000838 3300025273 Bacteria 40184
246 Ga0209673_1001258 3300025273 Bacteria 26126
247 Ga0209130_1000113 3300025284 Bacteria 130804
248 Ga0209130_1001550 3300025284 Bacteria 14636
249 Ga0209130_1004836 3300025284 Bacteria 4931
250 Ga0209675_1000127 3300025291 Bacteria 104257
251 Ga0209675_1000276 3300025291 Bacteria 49295
252 Ga0209675_1000887 3300025291 Bacteria 19242
253 Ga0209675_1002155 3300025291 Bacteria 10373
254 Ga0209676_1000005 3300025292 Bacteria 1076001
255 Ga0209676_1001480 3300025292 Bacteria 21721
256 Ga0209676_1003545 3300025292 Bacteria 9484
257 Ga0209676_1004910 3300025292 Bacteria 7202
258 Ga0209676_1009073 3300025292 Bacteria 4340
259 Ga0209676_1017071 3300025292 Bacteria 2586
260 Ga0209025_1000134 3300025294 Bacteria 194505
261 Ga0209025_1000484 3300025294 Bacteria 76831
262 Ga0209025_1001331 3300025294 Bacteria 33405
263 Ga0209025_1002208 3300025294 Bacteria 21511
264 Ga0209025_1009028 3300025294 Bacteria 7034
265 Ga0209564_1000053 3300025295 Bacteria 351452
266 Ga0209564_1000394 3300025295 Bacteria 78197
267 Ga0209564_1000698 3300025295 Bacteria 49135
268 Ga0209564_1006730 3300025295 Bacteria 6108
269 Ga0209564_1027441 3300025295 Bacteria 1849
270 Ga0209758_1000064 3300025297 Bacteria 311812
271 Ga0209758_1000622 3300025297 Bacteria 54385
272 Ga0209758_1014045 3300025297 Bacteria 4303
273 Ga0209050_1000007 3300025298 Bacteria 1187891
274 Ga0209050_1001433 3300025298 Bacteria 25685
275 Ga0209050_1011252 3300025298 Bacteria 4274
276 Ga0209256_1000115 3300025299 Bacteria 173607
277 Ga0209256_1000864 3300025299 Bacteria 37672
278 Ga0207426_1000001 3300025302 Bacteria 1341301
279 Ga0207426_1000031 3300025302 Bacteria 460699
280 Ga0207426_1000037 3300025302 Bacteria 442735
281 Ga0209051_1000009 3300025303 Bacteria 706778
282 Ga0209051_1000385 3300025303 Bacteria 62270
283 Ga0209051_1000781 3300025303 Bacteria 33617
284 Ga0209051_1001504 3300025303 Bacteria 19477
285 Ga0209051_1002109 3300025303 Bacteria 14875
286 Ga0209051_1002621 3300025303 Bacteria 12630
287 Ga0209051_1019996 3300025303 Bacteria 2903
288 Ga0209051_1053265 3300025303 Bacteria 1330
289 Ga0209257_1000011 3300025304 Bacteria 1112630
290 Ga0209257_1001057 3300025304 Bacteria 36450
291 Ga0209257_1003120 3300025304 Bacteria 14812
292 Ga0209257_1005156 3300025304 Bacteria 9429
293 Ga0207655_1013658 3300025728 Bacteria 4646
294 Ga0207713_1000305 3300025735 Bacteria 56170
295 Ga0207682_10034113 3300025893 Bacteria 2051
296 Ga0207680_10008834 3300025903 Bacteria 4966
297 Ga0207647_10000268 3300025904 Bacteria 42845
298 Ga0207647_10004135 3300025904 Bacteria 10770
299 Ga0207647_10008546 3300025904 Bacteria 7332
300 Ga0207647_10019591 3300025904 Bacteria 4548
301 Ga0207647_10027493 3300025904 Bacteria 3708
302 Ga0207647_10043031 3300025904 Bacteria 2828
303 Ga0207705_10000708 3300025909 Bacteria 27547
304 Ga0207705_10134982 3300025909 Bacteria 1839
305 Ga0207695_10005102 3300025913 Bacteria 17594
306 Ga0207695_10018782 3300025913 Bacteria 7979
307 Ga0207695_10099910 3300025913 Bacteria 2898
308 Ga0207695_10188464 3300025913 Bacteria 1981
309 Ga0207695_10373598 3300025913 Bacteria 1312
310 Ga0207671_10026696 3300025914 Bacteria 4323
311 Ga0207671_10059100 3300025914 Bacteria 2842
312 Ga0207671_10103198 3300025914 Bacteria 2162
313 Ga0207657_10000051 3300025919 Bacteria 109129
314 Ga0207657_10000131 3300025919 Bacteria 75479
315 Ga0207694_10019539 3300025924 Bacteria 5122
316 Ga0207694_10065076 3300025924 Bacteria 2842
317 Ga0207690_10000034 3300025932 Bacteria 149574
318 Ga0207709_10001032 3300025935 Bacteria 20578
319 Ga0207709_10001454 3300025935 Bacteria 16482
320 Ga0207711_10026135 3300025941 Bacteria 4897
321 Ga0207711_10031612 3300025941 Bacteria 4469
322 Ga0207711_10228248 3300025941 Bacteria 1705
323 Ga0207679_10015470 3300025945 Bacteria 5043
324 Ga0207667_10003149 3300025949 Bacteria 20416
325 Ga0207667_10009431 3300025949 Bacteria 11496
326 Ga0207667_10113941 3300025949 Bacteria 2787
327 Ga0207667_10202305 3300025949 Bacteria 2037
328 Ga0207640_10215795 3300025981 Bacteria 1465
329 Ga0207658_10047893 3300025986 Bacteria 3131
330 Ga0207658_10057051 3300025986 Bacteria 2901
331 Ga0207639_10007462 3300026041 Bacteria 7459
332 Ga0207639_10065918 3300026041 Bacteria 2812
333 Ga0207678_10002721 3300026067 Bacteria 16032
334 Ga0207678_10037514 3300026067 Bacteria 4214
335 Ga0207678_10262867 3300026067 Bacteria 1479
336 Ga0207674_10198781 3300026116 Bacteria 1954
337 Ga0207674_10369757 3300026116 Bacteria 1386
338 Ga0207683_10014003 3300026121 Bacteria 6839
339 Ga0207683_10056358 3300026121 Bacteria 3447
340 Ga0207698_10010500 3300026142 Bacteria 5958
341 Ga0207698_10111986 3300026142 Bacteria 2290
342 Ga0209371_1000090 3300027312 Bacteria 173119
343 Ga0209371_1001109 3300027312 Bacteria 19951
344 Ga0209282_1000334 3300027666 Bacteria 23330
345 Ga0207428_10351654 3300027907 Bacteria 1084
346 Ga0268266_10240987 3300028379 Bacteria 1669
347 Ga0268266_10335955 3300028379 Bacteria 1417
348 Ga0268265_10118263 3300028380 Bacteria 2178
349 Ga0268264_10171693 3300028381 Bacteria 1962
350 Ga0307515_10000028 3300028794 Bacteria 368467
351 Ga0307515_10024629 3300028794 Bacteria 10474
352 Ga0265338_10000113 3300028800 Bacteria 150993
353 Ga0268256_1000115 3300030500 Bacteria 116918
354 Ga0268256_1000921 3300030500 Bacteria 20306
355 Ga0307511_10000025 3300030521 Bacteria 112344
356 Ga0316177_1029429 3300030731 Bacteria 3928
357 Ga0316176_1080864 3300030732 Bacteria 2014
358 Ga0314311_1124028 3300030733 Bacteria 3356
359 Ga0316180_1012367 3300030736 Bacteria 2491
360 Ga0316182_1325098 3300030745 Bacteria 2859
361 Ga0265332_10000013 3300031238 Bacteria 250095
362 Ga0265325_10000262 3300031241 Bacteria 37299
363 Ga0265327_10000722 3300031251 Bacteria 51801
364 Ga0265327_10015860 3300031251 Bacteria 4831
365 Ga0265316_10000299 3300031344 Bacteria 55433
366 Ga0265316_10089534 3300031344 Bacteria 2348
367 Ga0307513_10116636 3300031456 Bacteria 2649
368 Ga0307509_10000006 3300031507 Bacteria 421538
369 Ga0307408_100002431 3300031548 Bacteria 13091
370 Ga0307408_100024541 3300031548 Bacteria 4118
371 Ga0307408_100114667 3300031548 Bacteria 2076
372 Ga0307408_100157292 3300031548 Bacteria 1801
373 Ga0307508_10059988 3300031616 Bacteria 3365
374 Ga0307514_10005152 3300031649 Bacteria 11799
375 Ga0307516_10003171 3300031730 Bacteria 21396
376 Ga0307405_10002949 3300031731 Bacteria 7680
377 Ga0307406_10001482 3300031901 Bacteria 12962
378 Ga0307406_10033625 3300031901 Bacteria 3140
379 Ga0307412_10000051 3300031911 Bacteria 150433
380 Ga0307412_10061531 3300031911 Bacteria 2524
381 Ga0307412_10194031 3300031911 Bacteria 1537
382 Ga0307416_100023777 3300032002 Bacteria 4456
383 Ga0307416_100462395 3300032002 Bacteria 1324
384 Ga0307414_10071445 3300032004 Bacteria 2503
385 Ga0307411_10020506 3300032005 Bacteria 3846
386 Ga0307411_10118497 3300032005 Bacteria 1910
387 Ga0307411_10207668 3300032005 Bacteria 1509
388 Ga0316583_10029627 3300032133 Bacteria 1951
389 Ga0307507_10088851 3300033179 Bacteria 2663
390 Ga0395899_0000008 3300037312 Bacteria 567572
391 Ga0395900_0000055 3300037418 Bacteria 219875
392 Ga0395900_0002303 3300037418 Bacteria 21211
393 Ga0395900_0007321 3300037418 Bacteria 11416
394 Ga0395900_0028412 3300037418 Bacteria 5728
395 Ga0395900_0134985 3300037418 Bacteria 2528
396 Ga0395900_0138938 3300037418 Bacteria 2489
397 Ga0395900_0250241 3300037418 Bacteria 1774
398 Ga0395898_0000119 3300037466 Bacteria 209937
399 Ga0395898_0001260 3300037466 Bacteria 37617
400 Ga0395898_0032722 3300037466 Bacteria 5191
401 Ga0395905_0000168 3300037471 Bacteria 107034
402 Ga0395905_0075175 3300037471 Bacteria 3166
403 Ga0395901_0000003 3300038443 Bacteria 701538
404 Ga0395901_0010491 3300038443 Bacteria 9383
405 Ga0395901_0019159 3300038443 Bacteria 6996
406 Ga0395901_0170239 3300038443 Bacteria 2285
407 Ga0395901_0194691 3300038443 Bacteria 2125
408 Ga0436361_0131139 3300039447 Bacteria 6535
409 Ga0439436_0000470 3300041404 Bacteria 10385
410 Ga0439436_0002954 3300041404 Bacteria 5157
411 Ga0439439_0002400 3300041406 Bacteria 3974
412 Ga0439447_002633 3300041407 Bacteria 6511
413 Ga0439447_012795 3300041407 Bacteria 2399
414 Ga0439461_0018568 3300041410 Bacteria 1362
415 Ga0439466_0003460 3300041411 Bacteria 6117
416 Ga0439465_0000108 3300041413 Bacteria 19156
417 Ga0439465_0007545 3300041413 Bacteria 3454
418 Ga0451853_4091276 3300041512 Bacteria 1447
419 Ga0439431_0004413 3300041997 Bacteria 3092
420 Ga0439433_0000895 3300041999 Bacteria 5940
421 Ga0439442_004394 3300042002 Bacteria 2799
422 Ga0439445_0001046 3300042004 Bacteria 5909
423 Ga0439445_0008898 3300042004 Bacteria 2358
424 Ga0439448_0001330 3300042005 Bacteria 6326
425 Ga0439432_003819 3300042006 Bacteria 5559
426 Ga0439432_010034 3300042006 Bacteria 3293
427 Ga0439449_0000245 3300042007 Bacteria 19553
428 Ga0439449_0001647 3300042007 Bacteria 8764
429 Ga0439449_0003981 3300042007 Bacteria 5711
430 Ga0439449_0004140 3300042007 Bacteria 5609
431 Ga0439452_000792 3300042010 Bacteria 14976
432 Ga0439452_005772 3300042010 Bacteria 3955
433 Ga0439457_001278 3300042014 Bacteria 7554
434 Ga0439457_029009 3300042014 Bacteria 1226
435 Ga0439462_0017172 3300042015 Bacteria 1874
436 Ga0450894_003722 3300042131 Bacteria 1992
437 Ga0450906_001265 3300042145 Bacteria 5568
438 Ga0450907_010923 3300042146 Bacteria 1509
439 Ga0439446_0010238 3300042156 Bacteria 2524
440 Ga0450908_000841 3300042184 Bacteria 5923
441 Ga0450909_003757 3300042185 Bacteria 2156
442 Ga0439434_0001099 3300042435 Bacteria 7827
443 Ga0439434_0006472 3300042435 Bacteria 3423
444 Ga0451577_0003100 3300042876 Bacteria 18746
445 Ga0451577_0025039 3300042876 Bacteria 5418
446 Ga0451577_0072441 3300042876 Bacteria 3073
447 Ga0451577_0078031 3300042876 Bacteria 2953
448 Ga0451577_0091835 3300042876 Bacteria 2711
449 Ga0466969_0002847 3300044656 Bacteria 9244
450 Ga0466969_0004757 3300044656 Bacteria 7223
451 Ga0466973_0009139 3300044659 Bacteria 9055
452 Ga0453683_0156859 3300044673 Bacteria 1439
453 Ga0466965_0001211 3300044683 Bacteria 10198
454 Ga0466965_0001863 3300044683 Bacteria 8779
455 Ga0466965_0032927 3300044683 Bacteria 2532
456 Ga0466966_0000032 3300044684 Bacteria 102181
457 Ga0466966_0002909 3300044684 Bacteria 11277
458 Ga0466966_0016532 3300044684 Bacteria 4872
459 Ga0466966_0063721 3300044684 Bacteria 2322
460 Ga0466961_0004925 3300044693 Bacteria 8398
461 Ga0466961_0116424 3300044693 Bacteria 1679
462 Ga0466963_0001953 3300044694 Bacteria 11306
463 Ga0466963_0015153 3300044694 Bacteria 4768
464 Ga0466964_0002026 3300044706 Bacteria 7123
465 Ga0466964_0039190 3300044706 Bacteria 1908
466 Ga0453684_0000005 3300044712 Bacteria 1431632
467 Ga0453684_0000583 3300044712 Bacteria 135940
468 Ga0453684_0004902 3300044712 Bacteria 27396
469 Ga0453684_0005751 3300044712 Bacteria 24224
470 Ga0453684_0008183 3300044712 Bacteria 18861
471 Ga0453684_0116937 3300044712 Bacteria 3227
472 Ga0453684_0524355 3300044712 Bacteria 1308
473 Ga0466968_0005823 3300044735 Bacteria 4626
474 Ga0466970_0026347 3300044765 Bacteria 3047
475 Ga0466970_0091606 3300044765 Bacteria 1650
476 Ga0466957_0015351 3300044842 Bacteria 4474
477 Ga0466957_0047793 3300044842 Bacteria 2600
478 Ga0466957_0097795 3300044842 Bacteria 1846
479 Ga0466960_0010342 3300044901 Bacteria 3872
480 Ga0466959_0010040 3300045049 Bacteria 6747
481 Ga0466959_0014675 3300045049 Bacteria 5701
482 Ga0466959_0222376 3300045049 Bacteria 1309
483 Ga0451576_0000137 3300045051 Bacteria 185212
484 Ga0451576_0000738 3300045051 Bacteria 65424
485 Ga0451576_0001961 3300045051 Bacteria 32770
486 Ga0451576_0012728 3300045051 Bacteria 9445
487 Ga0451576_0052917 3300045051 Bacteria 4254
488 Ga0451576_0145389 3300045051 Bacteria 2472
489 Ga0466958_0001759 3300045836 Bacteria 10489
490 Ga0466958_0005164 3300045836 Bacteria 6984
491 Ga0466958_0009785 3300045836 Bacteria 5349
492 Ga0466958_0021413 3300045836 Bacteria 3778
493 Ga0466967_0343404 3300045976 Bacteria 1444
494 Ga0495627_007509 3300046453 Bacteria 4167
495 Ga0495592_0040557 3300046454 Bacteria 3494
496 Ga0495592_0052099 3300046454 Bacteria 3039
497 Ga0495592_0197290 3300046454 Bacteria 1360
498 Ga0495603_0001297 3300046455 Bacteria 14577
499 Ga0495603_0007952 3300046455 Bacteria 6400
500 Ga0495603_0009400 3300046455 Bacteria 5907
501 Ga0495590_0001947 3300046457 Bacteria 8729
502 Ga0495590_0060794 3300046457 Bacteria 1323
503 Ga0495591_006781 3300046458 Bacteria 4985
504 Ga0495629_0000369 3300046459 Bacteria 38164
505 Ga0495629_0004351 3300046459 Bacteria 10617
506 Ga0495629_0005165 3300046459 Bacteria 9767
507 Ga0495629_0014711 3300046459 Bacteria 5628
508 Ga0495629_0041923 3300046459 Bacteria 3217
509 Ga0495629_0049525 3300046459 Bacteria 2944
510 Ga0495638_0028169 3300046460 Bacteria 3630
511 Ga0495638_0074310 3300046460 Bacteria 2073
512 Ga0495641_0003603 3300046461 Bacteria 11474
513 Ga0495651_0009952 3300046462 Bacteria 7311
514 Ga0495651_0023058 3300046462 Bacteria 4841
515 Ga0495651_0196935 3300046462 Bacteria 1413
516 Ga0495651_0218439 3300046462 Bacteria 1321
517 Ga0495653_0006567 3300046463 Bacteria 9545
518 Ga0495653_0018833 3300046463 Bacteria 5601
519 Ga0495653_0023696 3300046463 Bacteria 4955
520 Ga0495653_0037748 3300046463 Bacteria 3793
521 Ga0495653_0092915 3300046463 Bacteria 2202
522 Ga0495653_0175644 3300046463 Bacteria 1474
523 Ga0495650_0004632 3300046471 Bacteria 9321
524 Ga0495650_0014058 3300046471 Bacteria 4192
525 Ga0495650_0017226 3300046471 Bacteria 3627
526 Ga0495650_0019000 3300046471 Bacteria 3399
527 Ga0495650_0027417 3300046471 Bacteria 2632
528 Ga0495580_0002054 3300046472 Bacteria 17674
529 Ga0495580_0005418 3300046472 Bacteria 10546
530 Ga0495580_0023500 3300046472 Bacteria 4525
531 Ga0495580_0070077 3300046472 Bacteria 2449
532 Ga0495580_0113459 3300046472 Bacteria 1882
533 Ga0495580_0149687 3300046472 Bacteria 1617
534 Ga0495580_0159856 3300046472 Bacteria 1559
535 Ga0495582_0002285 3300046473 Bacteria 10726
536 Ga0495582_0052398 3300046473 Bacteria 2250
537 Ga0495605_0002196 3300046474 Bacteria 12190
538 Ga0495605_0004899 3300046474 Bacteria 7821
539 Ga0495605_0010712 3300046474 Bacteria 5124
540 Ga0495605_0016596 3300046474 Bacteria 3984
541 Ga0495639_0009089 3300046475 Bacteria 4260
542 Ga0495662_0024751 3300046476 Bacteria 2897
543 Ga0495662_0077914 3300046476 Bacteria 1610
544 Ga0495664_0001019 3300046477 Bacteria 14491
545 Ga0495664_0015601 3300046477 Bacteria 4320
546 Ga0495664_0083586 3300046477 Bacteria 1916
547 Ga0495596_0005025 3300046500 Bacteria 6324
548 Ga0495596_0039764 3300046500 Bacteria 1857
549 Ga0495596_0073211 3300046500 Bacteria 1330
550 Ga0495583_0003894 3300046506 Bacteria 11050
551 Ga0495583_0006862 3300046506 Bacteria 7331
552 Ga0495583_0013530 3300046506 Bacteria 4547
553 Ga0495606_0012257 3300046507 Bacteria 6896
554 Ga0495606_0039182 3300046507 Bacteria 3197
555 Ga0495606_0072098 3300046507 Bacteria 2172
556 Ga0495606_0083444 3300046507 Bacteria 1981
557 Ga0495606_0099160 3300046507 Bacteria 1776
558 Ga0495606_0138973 3300046507 Bacteria 1436
559 Ga0495608_0007446 3300046511 Bacteria 7734
560 Ga0495608_0042458 3300046511 Bacteria 3041
561 Ga0495610_0019946 3300046512 Bacteria 3735
562 Ga0495616_0002124 3300046513 Bacteria 13283
563 Ga0495616_0073811 3300046513 Bacteria 1645
564 Ga0495618_0001663 3300046514 Bacteria 14785
565 Ga0495618_0011271 3300046514 Bacteria 5417
566 Ga0495618_0014447 3300046514 Bacteria 4811
567 Ga0495620_0011576 3300046515 Bacteria 4597
568 Ga0495620_0036745 3300046515 Bacteria 2189
569 Ga0495628_0002617 3300046516 Bacteria 16154
570 Ga0495628_0027908 3300046516 Bacteria 4589
571 Ga0495628_0033448 3300046516 Bacteria 4145
572 Ga0495628_0037443 3300046516 Bacteria 3889
573 Ga0495628_0049906 3300046516 Bacteria 3311
574 Ga0495628_0174155 3300046516 Bacteria 1630
575 Ga0495630_0020532 3300046517 Bacteria 4870
576 Ga0495630_0044761 3300046517 Bacteria 3307
577 Ga0495630_0235052 3300046517 Bacteria 1400
578 Ga0495631_0001388 3300046518 Bacteria 14713
579 Ga0495637_0007495 3300046520 Bacteria 5402
580 Ga0495648_0012380 3300046524 Bacteria 6371
581 Ga0495648_0021277 3300046524 Bacteria 4496
582 Ga0495648_0022600 3300046524 Bacteria 4324
583 Ga0495648_0044551 3300046524 Bacteria 2768
584 Ga0495648_0142954 3300046524 Bacteria 1257
585 Ga0495663_0002160 3300046525 Bacteria 5990
586 Ga0495666_0004704 3300046526 Bacteria 6903
587 Ga0495666_0005594 3300046526 Bacteria 6331
588 Ga0495666_0006495 3300046526 Bacteria 5887
589 Ga0495642_0006746 3300046528 Bacteria 4401
590 Ga0495642_0021025 3300046528 Bacteria 2565
591 Ga0495652_0029140 3300046529 Bacteria 4850
592 Ga0495652_0033248 3300046529 Bacteria 4504
593 Ga0495654_0018415 3300046530 Bacteria 3661
594 Ga0495654_0028146 3300046530 Bacteria 2875
595 Ga0495654_0081073 3300046530 Bacteria 1521
596 Ga0495665_0005886 3300046531 Bacteria 6604
597 Ga0495665_0021328 3300046531 Bacteria 3480
598 Ga0495665_0025686 3300046531 Bacteria 3163
599 Ga0495640_0002933 3300046533 Bacteria 13734
600 Ga0495640_0005861 3300046533 Bacteria 9748
601 Ga0495640_0026287 3300046533 Bacteria 4208
602 Ga0495640_0113370 3300046533 Bacteria 1769
603 Ga0495586_0000633 3300046535 Bacteria 20275
604 Ga0495586_0031997 3300046535 Bacteria 2820
605 Ga0495586_0092520 3300046535 Bacteria 1672
606 Ga0495587_0018778 3300046536 Bacteria 4287
607 Ga0495621_0009096 3300046539 Bacteria 3004
608 Ga0495597_0002648 3300046542 Bacteria 11102
609 Ga0495597_0016569 3300046542 Bacteria 3480
610 Ga0495597_0044837 3300046542 Bacteria 1965
611 Ga0495645_0003050 3300046543 Bacteria 11342
612 Ga0495645_0011091 3300046543 Bacteria 6336
613 Ga0495645_0045339 3300046543 Bacteria 3207
614 Ga0495645_0122181 3300046543 Bacteria 1832
615 Ga0495622_0004831 3300046557 Bacteria 6242
616 Ga0495622_0016921 3300046557 Bacteria 3394
617 Ga0495667_0017947 3300046559 Bacteria 4779
618 Ga0495667_0022585 3300046559 Bacteria 4239
619 Ga0495668_0011933 3300046616 Bacteria 5174
620 Ga0495668_0041562 3300046616 Bacteria 2561
621 Ga0495634_0009735 3300046642 Bacteria 7071
622 Ga0495634_0011188 3300046642 Bacteria 6543
623 Ga0495634_0022513 3300046642 Bacteria 4439
624 Ga0495625_0000279 3300046660 Bacteria 79498
625 Ga0495625_0147991 3300046660 Bacteria 1580
626 Ga0495625_0155597 3300046660 Bacteria 1534
627 Ga0495635_0013627 3300046663 Bacteria 5690
628 Ga0495635_0034889 3300046663 Bacteria 3489
629 Ga0495635_0040500 3300046663 Bacteria 3219
630 Ga0495635_0102843 3300046663 Bacteria 1952
631 Ga0495661_0005519 3300046665 Bacteria 8973
632 Ga0495661_0010232 3300046665 Bacteria 6410
633 Ga0495588_0008649 3300046674 Bacteria 4678
634 Ga0495588_0025253 3300046674 Bacteria 2959
635 Ga0495588_0035503 3300046674 Bacteria 2526
636 Ga0495599_0015425 3300046678 Bacteria 4741
637 Ga0495599_0023267 3300046678 Bacteria 3871
638 Ga0495599_0032828 3300046678 Bacteria 3259
639 Ga0495599_0048735 3300046678 Bacteria 2655
640 Ga0495599_0131437 3300046678 Bacteria 1555
641 Ga0495623_0007011 3300046679 Bacteria 7325
642 Ga0495623_0010956 3300046679 Bacteria 5867
643 Ga0495623_0021667 3300046679 Bacteria 4150
644 Ga0495623_0135016 3300046679 Bacteria 1473
645 Ga0495646_0001320 3300046680 Bacteria 14655
646 Ga0495646_0011483 3300046680 Bacteria 5622
647 Ga0495646_0021365 3300046680 Bacteria 4088
648 Ga0495646_0023967 3300046680 Bacteria 3842
649 Ga0495646_0034617 3300046680 Bacteria 3136
650 Ga0495646_0053517 3300046680 Bacteria 2433
651 Ga0495646_0076910 3300046680 Bacteria 1953
652 Ga0495658_0132556 3300046683 Bacteria 1518
653 Ga0495669_0035962 3300046684 Bacteria 2188
654 Ga0495669_0084553 3300046684 Bacteria 1459
655 Ga0495669_0102943 3300046684 Bacteria 1327
656 Ga0495613_0002624 3300046689 Bacteria 13515
657 Ga0495613_0010806 3300046689 Bacteria 6773
658 Ga0495624_0009914 3300046690 Bacteria 6585
659 Ga0495624_0010314 3300046690 Bacteria 6437
660 Ga0495624_0016074 3300046690 Bacteria 5038
661 Ga0495624_0016284 3300046690 Bacteria 5005
662 Ga0495624_0017769 3300046690 Bacteria 4767
663 Ga0495624_0053963 3300046690 Bacteria 2536
664 Ga0495624_0121640 3300046690 Bacteria 1602
665 Ga0495624_0179046 3300046690 Bacteria 1292
666 Ga0495670_0064305 3300046691 Bacteria 1848
667 Ga0495670_0089064 3300046691 Bacteria 1578
668 Ga0495671_0002320 3300046692 Bacteria 12088
669 Ga0495671_0016957 3300046692 Bacteria 3881
670 Ga0495671_0038591 3300046692 Bacteria 2413
671 Ga0495671_0076100 3300046692 Bacteria 1646
672 Ga0495649_0001567 3300046694 Bacteria 17157
673 Ga0495649_0004421 3300046694 Bacteria 9188
674 Ga0495649_0068416 3300046694 Bacteria 1905
675 Ga0495649_0079163 3300046694 Bacteria 1758
676 Ga0495649_0083897 3300046694 Bacteria 1702
677 Ga0495589_0005849 3300046794 Bacteria 6492
678 Ga0495589_0010940 3300046794 Bacteria 4712
679 Ga0495589_0082331 3300046794 Bacteria 1565
680 Ga0495600_0013215 3300046809 Bacteria 5183
681 Ga0495600_0032687 3300046809 Bacteria 3376
682 Ga0495600_0044562 3300046809 Bacteria 2894
683 Ga0495600_0143413 3300046809 Bacteria 1549
684 Ga0495660_0138054 3300046810 Bacteria 1216
685 Ga0495581_0005698 3300047315 Bacteria 7224
686 Ga0495581_0006202 3300047315 Bacteria 6934
687 Ga0495581_0006589 3300047315 Bacteria 6728
688 Ga0495581_0023067 3300047315 Bacteria 3606
689 Ga0495604_0005007 3300047317 Bacteria 10494
690 Ga0495604_0036700 3300047317 Bacteria 3864
691 Ga0495604_0037578 3300047317 Bacteria 3812
692 Ga0495604_0126928 3300047317 Bacteria 1838
693 Ga0495674_0022004 3300047319 Bacteria 5885
694 Ga0495674_0023710 3300047319 Bacteria 5651
695 Ga0495674_0036272 3300047319 Bacteria 4439
696 Ga0495674_0045553 3300047319 Bacteria 3894
697 Ga0495674_0082240 3300047319 Bacteria 2761
698 Ga0495674_0094523 3300047319 Bacteria 2549
699 Ga0495674_0294906 3300047319 Bacteria 1325
700 Ga0495672_0003028 3300047320 Bacteria 14773
701 Ga0495676_0017431 3300047321 Bacteria 6351
702 Ga0495676_0038899 3300047321 Bacteria 3946
703 Ga0495676_0046582 3300047321 Bacteria 3517
704 Ga0495676_0105211 3300047321 Bacteria 2081
705 Ga0495680_0007394 3300047322 Bacteria 10075
706 Ga0495680_0021369 3300047322 Bacteria 5419
707 Ga0495680_0035715 3300047322 Bacteria 4000
708 Ga0495680_0086575 3300047322 Bacteria 2357
709 Ga0495683_0002898 3300047323 Bacteria 10143
710 Ga0495683_0006607 3300047323 Bacteria 6323
711 Ga0495683_0075182 3300047323 Bacteria 1654
712 Ga0495683_0084673 3300047323 Bacteria 1542
713 Ga0495687_000011 3300047443 Bacteria 397225
714 Ga0495687_006437 3300047443 Bacteria 7197
715 Ga0495687_017752 3300047443 Bacteria 3535
716 Ga0495687_060421 3300047443 Bacteria 1563
717 Ga0495675_0003779 3300047444 Bacteria 9156
718 Ga0495675_0024722 3300047444 Bacteria 3831
719 Ga0495675_0036826 3300047444 Bacteria 3119
720 Ga0495675_0132796 3300047444 Bacteria 1546
721 Ga0495679_000109 3300047446 Bacteria 74134
722 Ga0495679_003488 3300047446 Bacteria 7534
723 Ga0495673_0040365 3300047469 Bacteria 2109
724 Ga0495673_0051646 3300047469 Bacteria 1799
725 Ga0495673_0096997 3300047469 Bacteria 1197
726 Ga0495684_0110236 3300047471 Bacteria 2078
727 Ga0495684_0132016 3300047471 Bacteria 1875
728 Ga0495686_0000014 3300047472 Bacteria 474014
729 Ga0495686_0014261 3300047472 Bacteria 5475
730 Ga0495593_0001995 3300047673 Bacteria 12169
731 Ga0495593_0004554 3300047673 Bacteria 8236
732 Ga0495593_0006696 3300047673 Bacteria 6745
733 Ga0495593_0010859 3300047673 Bacteria 5250
734 Ga0495593_0018130 3300047673 Bacteria 3958
735 Ga0495593_0025266 3300047673 Bacteria 3287
736 Ga0495602_0019497 3300048088 Bacteria 6730
737 Ga0495602_0027611 3300048088 Bacteria 5452
738 Ga0495614_0000770 3300048089 Bacteria 13577
739 Ga0495614_0006640 3300048089 Bacteria 5181
740 Ga0495614_0082923 3300048089 Bacteria 1390
741 Ga0495626_0017922 3300048091 Bacteria 3569
742 Ga0495626_0021549 3300048091 Bacteria 3197
743 Ga0495626_0049299 3300048091 Bacteria 1950
744 Ga0496100_0003845 3300048903 Bacteria 7874
745 Ga0496100_0009676 3300048903 Bacteria 5422
746 Ga0496100_0018508 3300048903 Bacteria 4133
747 Ga0496100_0039852 3300048903 Bacteria 2985
748 Ga0496100_0136746 3300048903 Bacteria 1732
749 Ga0496101_0006420 3300048904 Bacteria 7564
750 Ga0496101_0128488 3300048904 Bacteria 1922
751 Ga0496102_0001889 3300048905 Bacteria 18052
752 Ga0496102_0003852 3300048905 Bacteria 12706
753 Ga0496102_0021914 3300048905 Bacteria 5657
754 Ga0496102_0035899 3300048905 Bacteria 4464
755 Ga0496102_0048343 3300048905 Bacteria 3868
756 Ga0496102_0269160 3300048905 Bacteria 1606
757 Ga0496103_0006863 3300048906 Bacteria 6798
758 Ga0496103_0011673 3300048906 Bacteria 5211
759 Ga0496103_0019064 3300048906 Bacteria 4120
760 Ga0496103_0040992 3300048906 Bacteria 2846
761 Ga0496104_0028881 3300048907 Bacteria 5142
762 Ga0496104_0054037 3300048907 Bacteria 3796
763 Ga0496105_0008551 3300048908 Bacteria 7952
764 Ga0496105_0052227 3300048908 Bacteria 3375
765 Ga0496105_0107959 3300048908 Bacteria 2298
766 Ga0496105_0171307 3300048908 Bacteria 1779
767 Ga0496105_0173630 3300048908 Bacteria 1766
768 Ga0496105_0208750 3300048908 Bacteria 1592
769 Ga0496106_0000031 3300048909 Bacteria 135370
770 Ga0496106_0019590 3300048909 Bacteria 5019
771 Ga0496106_0089452 3300048909 Bacteria 2374
772 Ga0496107_0023185 3300048910 Bacteria 4388
773 Ga0496107_0085859 3300048910 Bacteria 2296
774 Ga0496107_0116962 3300048910 Bacteria 1963
775 Ga0496108_0232750 3300048911 Bacteria 1602
776 Ga0496109_0240207 3300048912 Bacteria 1705
777 Ga0496109_0281411 3300048912 Bacteria 1568
778 Ga0496110_0026740 3300048913 Bacteria 4941
779 Ga0496110_0156871 3300048913 Bacteria 2062
780 Ga0496111_0060199 3300048914 Bacteria 2752
781 Ga0496112_0008182 3300048915 Bacteria 9348
782 Ga0496112_0041577 3300048915 Bacteria 4498
783 Ga0496113_0011230 3300048916 Bacteria 5964
784 Ga0496113_0256718 3300048916 Bacteria 1396
785 Ga0496114_0001502 3300048917 Bacteria 17697
786 Ga0496114_0275292 3300048917 Bacteria 1483
787 Ga0496114_0318659 3300048917 Bacteria 1374
788 Ga0496115_0113660 3300048918 Bacteria 2225
789 Ga0496116_0012792 3300048919 Bacteria 6818
790 Ga0496116_0066210 3300048919 Bacteria 2313
791 Ga0496116_0104757 3300048919 Bacteria 1680
792 Ga0496117_0004561 3300048920 Bacteria 15167
793 Ga0496117_0008670 3300048920 Bacteria 9612
794 Ga0496117_0010958 3300048920 Bacteria 8171
795 Ga0496117_0011477 3300048920 Bacteria 7934
796 Ga0496117_0017799 3300048920 Bacteria 5923
797 Ga0496117_0064264 3300048920 Bacteria 2503
798 Ga0496118_0001983 3300048921 Bacteria 29083
799 Ga0496118_0002651 3300048921 Bacteria 23694
800 Ga0496118_0013236 3300048921 Bacteria 7825
801 Ga0496118_0017009 3300048921 Bacteria 6642
802 Ga0496118_0020524 3300048921 Bacteria 5854
803 Ga0496118_0022762 3300048921 Bacteria 5463
804 Ga0496118_0027358 3300048921 Bacteria 4828
805 Ga0496118_0043345 3300048921 Bacteria 3538
806 Ga0496118_0056034 3300048921 Bacteria 2967
807 Ga0496118_0104184 3300048921 Bacteria 1905
808 Ga0496118_0131107 3300048921 Bacteria 1610
809 Ga0496121_0000305 3300048924 Bacteria 102256
810 Ga0496121_0006229 3300048924 Bacteria 14945
811 Ga0496121_0028228 3300048924 Bacteria 5228
812 Ga0496121_0074371 3300048924 Bacteria 2718
813 Ga0496121_0082136 3300048924 Bacteria 2548
814 Ga0496121_0156425 3300048924 Bacteria 1672
815 Ga0496122_0000217 3300048925 Bacteria 128502
816 Ga0496122_0026227 3300048925 Bacteria 5032
817 Ga0496123_0000057 3300048926 Bacteria 228608
818 Ga0496123_0028101 3300048926 Bacteria 4172
819 Ga0496123_0028452 3300048926 Bacteria 4137
820 Ga0496123_0126072 3300048926 Bacteria 1429
821 Ga0496124_0026584 3300048927 Bacteria 5215
822 Ga0496124_0031416 3300048927 Bacteria 4701
823 Ga0496124_0054648 3300048927 Bacteria 3379
824 Ga0496125_0032287 3300048928 Bacteria 4652
825 Ga0496126_0001240 3300048929 Bacteria 41387
826 Ga0496126_0003440 3300048929 Bacteria 19979
827 Ga0496126_0003523 3300048929 Bacteria 19696
828 Ga0496126_0016774 3300048929 Bacteria 7314
829 Ga0496126_0198119 3300048929 Bacteria 1697
830 Ga0496126_0244826 3300048929 Bacteria 1496
831 Ga0496126_0315125 3300048929 Bacteria 1287
832 Ga0495678_017996 3300049459 Bacteria 3186
833 Ga0495678_051418 3300049459 Bacteria 1593
834 Ga0495678_058272 3300049459 Bacteria 1460
835 Ga0495682_0007262 3300049460 Bacteria 4423
836 Ga0495682_0015318 3300049460 Bacteria 2905
837 Ga0495682_0060012 3300049460 Bacteria 1374
838 Ga0501225_0002703 3300049705 Bacteria 5446
839 Ga0501280_000651 3300049776 Bacteria 7785
840 nmdc:mga03683_11163_c1 3300050489 Bacteria 3242
841 nmdc:mga03683_25651_c1 3300050489 Bacteria 2318
842 nmdc:mga03683_45642_c1 3300050489 Bacteria 1814
843 nmdc:mga03683_51169_c1 3300050489 Bacteria 1723
844 nmdc:mga03683_53022_c1 3300050489 Bacteria 1697
845 nmdc:mga03683_80225_c1 3300050489 Bacteria 1408
846 nmdc:mga03n38_21763_c1 3300050490 Bacteria 2585
847 nmdc:mga03n38_24136_c1 3300050490 Bacteria 2483
848 nmdc:mga03n38_49718_c1 3300050490 Bacteria 1865
849 nmdc:mga00v17_126852_c1 3300050491 Bacteria 1629
850 nmdc:mga00v17_190727_c1 3300050491 Bacteria 1324
851 nmdc:mga0yw44_16735_c1 3300050492 Bacteria 3971
852 nmdc:mga0k408_116628_c1 3300050493 Bacteria 1580
853 nmdc:mga0k408_196920_c1 3300050493 Bacteria 1202
854 nmdc:mga0k408_61213_c1 3300050493 Bacteria 2188
855 nmdc:mga06z11_44049_c1 3300050494 Bacteria 2248
856 nmdc:mga04h51_31327_c1 3300050495 Bacteria 1680
857 nmdc:mga07m45_113912_c1 3300050496 Bacteria 1559
858 nmdc:mga07m45_143028_c1 3300050496 Bacteria 1386
859 nmdc:mga07m45_34458_c1 3300050496 Bacteria 2814
860 nmdc:mga07m45_356_c1 3300050496 Bacteria 18703
861 nmdc:mga07m45_8280_c1 3300050496 Bacteria 5336
862 nmdc:mga07m45_89697_c1 3300050496 Bacteria 1761
863 nmdc:mga0sz30_34877_c1 3300050516 Bacteria 2097
864 Ga0500610_0000451 3300053079 Bacteria 12670
865 Ga0500610_0001074 3300053079 Bacteria 8980
866 Ga0500643_001718 3300053087 Bacteria 12168
867 Ga0500583_0002376 3300053092 Bacteria 5640
868 Ga0500651_0000642 3300053093 Bacteria 17399
869 Ga0500569_023454 3300053109 Bacteria 1659
870 Ga0500571_000477 3300053110 Bacteria 16305
871 Ga0500592_003170 3300053116 Bacteria 2630
872 Ga0500593_000735 3300053117 Bacteria 12377
873 Ga0500594_0007251 3300053118 Bacteria 2506
874 Ga0500597_019885 3300053120 Bacteria 2627
875 Ga0500607_003250 3300053121 Bacteria 12002
876 Ga0500607_010629 3300053121 Bacteria 5468
877 Ga0500608_003396 3300053122 Bacteria 5963
878 Ga0500608_080724 3300053122 Bacteria 1535
879 Ga0500618_001179 3300053125 Bacteria 12614
880 Ga0500655_000925 3300053133 Bacteria 5678
881 Ga0500658_0000263 3300053134 Bacteria 24167
882 Ga0500658_0001281 3300053134 Bacteria 10197
883 Ga0500559_0001594 3300053136 Bacteria 12620
884 Ga0500559_0002800 3300053136 Bacteria 8815
885 Ga0500564_013191 3300053138 Bacteria 3693
886 Ga0500568_0001164 3300053139 Bacteria 17590
887 Ga0500568_0001787 3300053139 Bacteria 13260
888 Ga0500574_039308 3300053141 Bacteria 1313
889 Ga0500604_0000752 3300053151 Bacteria 8867
890 Ga0500616_0011322 3300053153 Bacteria 5277
891 Ga0500624_003981 3300053157 Bacteria 1939
892 Ga0500627_0004123 3300053158 Bacteria 4613
893 Ga0500634_0002263 3300053161 Bacteria 8034
894 Ga0500636_0015064 3300053177 Bacteria 4552
895 Ga0466962_0008411 3300061719 Bacteria 4944
896 Ga0466962_0016712 3300061719 Bacteria 3538
897 Ga0466962_0061442 3300061719 Bacteria 1793
898 Ga0466962_0070809 3300061719 Bacteria 1666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0000895 Ga0439433_0000895_2803_3816 278
2 3300048929 Ga0496126_0315125 Ga0496126_0315125_405_1277 286
3 3300025893 Ga0207682_10034113 Ga0207682_100341132 303
4 3300041512 Ga0451853_4091276 Ga0451853_4091276_340_1257 305
5 3300003354 JGI25160J50197_1006483 JGI25160J50197_10064832 309
6 3300003374 JGI25161J50226_1002287 JGI25161J50226_10022872 309
7 3300003771 Ga0055526_1004608 Ga0055526_10046085 309
8 3300003781 Ga0055536_1001267 Ga0055536_100126712 309
9 3300003791 Ga0055530_10001555 Ga0055530_1000155511 309
10 3300003794 Ga0055531_10004876 Ga0055531_100048765 309
11 3300004625 Ga0055543_1002259 Ga0055543_10022597 309
12 3300050490 nmdc:mga03n38_49718_c1 nmdc:mga03n38_49718_c1_60_1001 309
13 3300050493 nmdc:mga0k408_196920_c1 nmdc:mga0k408_196920_c1_25_963 309
14 3300031238 Ga0265332_10000013 Ga0265332_1000001330 314
15 3300042007 Ga0439449_0004140 Ga0439449_0004140_4215_5177 318
16 3300046507 Ga0495606_0138973 Ga0495606_0138973_444_1409 319
17 3300032133 Ga0316583_10029627 Ga0316583_100296272 322
18 3300042876 Ga0451577_0003100 Ga0451577_0003100_9210_10187 323
19 3300044712 Ga0453684_0000005 Ga0453684_0000005_1071226_1072203 323
20 3300044712 Ga0453684_0005751 Ga0453684_0005751_10521_11498 323
21 3300005457 Ga0070662_100267055 Ga0070662_1002670551 324
22 3300006048 Ga0075363_100182109 Ga0075363_1001821092 324
23 3300006177 Ga0075362_10031860 Ga0075362_100318602 324
24 3300006353 Ga0075370_10031089 Ga0075370_100310893 324
25 3300017792 Ga0163161_10016751 Ga0163161_100167512 324
26 3300032002 Ga0307416_100462395 Ga0307416_1004623952 324
27 3300032005 Ga0307411_10020506 Ga0307411_100205064 324
28 3300041407 Ga0439447_002633 Ga0439447_002633_2499_3497 324
29 3300042876 Ga0451577_0091835 Ga0451577_0091835_358_1338 324
30 3300044673 Ga0453683_0156859 Ga0453683_0156859_272_1252 324
31 3300044712 Ga0453684_0004902 Ga0453684_0004902_7956_8936 324
32 3300045051 Ga0451576_0000738 Ga0451576_0000738_56267_57247 324
33 3300046525 Ga0495663_0002160 Ga0495663_0002160_3800_4798 324
34 3300046616 Ga0495668_0011933 Ga0495668_0011933_4087_5085 324
35 3300048924 Ga0496121_0028228 Ga0496121_0028228_720_1706 324
36 3300006195 Ga0075366_10006163 Ga0075366_100061636 325
37 3300013307 Ga0157372_10019343 Ga0157372_100193437 325
38 3300028379 Ga0268266_10240987 Ga0268266_102409872 325
39 3300028794 Ga0307515_10000028 Ga0307515_10000028270 325
40 3300031456 Ga0307513_10116636 Ga0307513_101166363 325
41 3300031901 Ga0307406_10033625 Ga0307406_100336253 325
42 3300046460 Ga0495638_0028169 Ga0495638_0028169_1407_2396 325
43 3300046512 Ga0495610_0019946 Ga0495610_0019946_2649_3638 325
44 3300046513 Ga0495616_0002124 Ga0495616_0002124_5721_6710 325
45 3300046518 Ga0495631_0001388 Ga0495631_0001388_3391_4380 325
46 3300046530 Ga0495654_0018415 Ga0495654_0018415_768_1757 325
47 3300046539 Ga0495621_0009096 Ga0495621_0009096_612_1601 325
48 3300046616 Ga0495668_0041562 Ga0495668_0041562_1351_2340 325
49 3300047321 Ga0495676_0038899 Ga0495676_0038899_654_1643 325
50 3300048921 Ga0496118_0013236 Ga0496118_0013236_2076_3065 325
51 3300048927 Ga0496124_0054648 Ga0496124_0054648_19_1008 325
52 3300048928 Ga0496125_0032287 Ga0496125_0032287_2378_3367 325
53 3300053087 Ga0500643_001718 Ga0500643_001718_7263_8252 325
54 3300053093 Ga0500651_0000642 Ga0500651_0000642_6883_7872 325
55 3300053110 Ga0500571_000477 Ga0500571_000477_4361_5350 325
56 3300053116 Ga0500592_003170 Ga0500592_003170_773_1762 325
57 3300053118 Ga0500594_0007251 Ga0500594_0007251_1126_2115 325
58 3300053133 Ga0500655_000925 Ga0500655_000925_3878_4867 325
59 3300053134 Ga0500658_0000263 Ga0500658_0000263_10024_11013 325
60 3300053136 Ga0500559_0001594 Ga0500559_0001594_2885_3874 325
61 3300053138 Ga0500564_013191 Ga0500564_013191_2658_3647 325
62 3300053139 Ga0500568_0001787 Ga0500568_0001787_6854_7843 325
63 3300053153 Ga0500616_0011322 Ga0500616_0011322_4218_5207 325
64 3300053157 Ga0500624_003981 Ga0500624_003981_393_1382 325
65 3300053177 Ga0500636_0015064 Ga0500636_0015064_1627_2616 325
66 iso_pu_bacteria 2643221593 2643975203 326
67 3300005339 Ga0070660_100000032 Ga0070660_10000003271 327
68 3300005366 Ga0070659_100000355 Ga0070659_1000003552 327
69 3300005455 Ga0070663_100009295 Ga0070663_1000092951 327
70 3300005563 Ga0068855_100022698 Ga0068855_1000226984 327
71 3300009093 Ga0105240_10089914 Ga0105240_100899142 327
72 3300010375 Ga0105239_10036412 Ga0105239_100364126 327
73 3300013104 Ga0157370_10193324 Ga0157370_101933243 327
74 3300025919 Ga0207657_10000051 Ga0207657_1000005168 327
75 3300025932 Ga0207690_10000034 Ga0207690_10000034103 327
76 3300025949 Ga0207667_10202305 Ga0207667_102023052 327
77 3300026067 Ga0207678_10002721 Ga0207678_100027215 327
78 3300031241 Ga0265325_10000262 Ga0265325_1000026224 327
79 3300003187 JGI25151J46595_10002025 JGI25151J46595_1000202512 328
80 3300025245 Ga0207425_1002925 Ga0207425_10029255 328
81 3300025294 Ga0209025_1000134 Ga0209025_10001343 328
82 3300025297 Ga0209758_1014045 Ga0209758_10140452 328
83 3300053139 Ga0500568_0001164 Ga0500568_0001164_9341_10384 328
84 3300046530 Ga0495654_0028146 Ga0495654_0028146_996_2000 329
85 3300001979 JGI24740J21852_10007221 JGI24740J21852_100072214 330
86 3300002067 JGI24735J21928_10049111 JGI24735J21928_100491111 330
87 3300003758 Ga0055532_1002081 Ga0055532_10020816 330
88 3300003760 Ga0055527_1001374 Ga0055527_10013746 330
89 3300003761 Ga0055535_1002982 Ga0055535_10029826 330
90 3300003762 Ga0055542_1002094 Ga0055542_10020946 330
91 3300005289 Ga0065704_10072545 Ga0065704_100725452 330
92 3300005616 Ga0068852_100003043 Ga0068852_1000030437 330
93 3300009092 Ga0105250_10006717 Ga0105250_100067176 330
94 3300009545 Ga0105237_10063269 Ga0105237_100632696 330
95 3300009551 Ga0105238_10037100 Ga0105238_100371005 330
96 3300013306 Ga0163162_10047011 Ga0163162_100470113 330
97 3300015261 Ga0182006_1030114 Ga0182006_10301143 330
98 3300017792 Ga0163161_10005081 Ga0163161_100050818 330
99 3300025228 Ga0209672_100038 Ga0209672_100038149 330
100 3300025229 Ga0209147_100112 Ga0209147_1001128 330
101 3300025242 Ga0209258_100109 Ga0209258_10010927 330
102 3300025254 Ga0209148_1000997 Ga0209148_10009978 330
103 3300025272 Ga0209455_1014935 Ga0209455_10149353 330
104 3300025904 Ga0207647_10004135 Ga0207647_100041353 330
105 3300025913 Ga0207695_10018782 Ga0207695_100187825 330
106 3300025914 Ga0207671_10059100 Ga0207671_100591002 330
107 3300025924 Ga0207694_10019539 Ga0207694_100195394 330
108 3300025986 Ga0207658_10047893 Ga0207658_100478934 330
109 3300026142 Ga0207698_10010500 Ga0207698_100105004 330
110 3300042015 Ga0439462_0017172 Ga0439462_0017172_721_1734 330
111 3300045836 Ga0466958_0001759 Ga0466958_0001759_7244_8311 330
112 3300046475 Ga0495639_0009089 Ga0495639_0009089_487_1503 330
113 3300046674 Ga0495588_0035503 Ga0495588_0035503_228_1244 330
114 3300046683 Ga0495658_0132556 Ga0495658_0132556_65_1081 330
115 3300048903 Ga0496100_0003845 Ga0496100_0003845_404_1420 330
116 3300048905 Ga0496102_0001889 Ga0496102_0001889_3055_4071 330
117 3300048906 Ga0496103_0019064 Ga0496103_0019064_850_1866 330
118 3300048908 Ga0496105_0008551 Ga0496105_0008551_5340_6356 330
119 3300048909 Ga0496106_0089452 Ga0496106_0089452_313_1329 330
120 3300048917 Ga0496114_0275292 Ga0496114_0275292_106_1122 330
121 3300015262 Ga0182007_10016384 Ga0182007_100163843 331
122 3300015683 Ga0183362_10001 Ga0183362_100011582 331
123 3300044683 Ga0466965_0032927 Ga0466965_0032927_1030_2094 331
124 3300044712 Ga0453684_0000583 Ga0453684_0000583_38145_39170 331
125 3300045051 Ga0451576_0000137 Ga0451576_0000137_96771_97796 331
126 3300046674 Ga0495588_0025253 Ga0495588_0025253_327_1331 331
127 iso_pu_bacteria 2643221658 2644328106 331
128 iso_pu_bacteria 2643221683 2644468670 331
129 3300037312 Ga0395899_0000008 Ga0395899_0000008_355983_357050 332
130 3300037418 Ga0395900_0000055 Ga0395900_0000055_8286_9353 332
131 3300037466 Ga0395898_0000119 Ga0395898_0000119_38765_39832 332
132 3300061719 Ga0466962_0070809 Ga0466962_0070809_82_1149 332
133 iso_pu_bacteria 2885192300 2885192875 332
134 iso_pu_bacteria 2904541872 2904548408 332
135 iso_pu_bacteria 2929160207 2929163805 332
136 3300003781 Ga0055536_1001135 Ga0055536_100113512 333
137 3300003792 Ga0055540_1003629 Ga0055540_10036299 333
138 3300009148 Ga0105243_10004361 Ga0105243_100043618 333
139 3300013104 Ga0157370_10055529 Ga0157370_100555293 333
140 3300025292 Ga0209676_1001480 Ga0209676_10014806 333
141 3300025303 Ga0209051_1001504 Ga0209051_10015046 333
142 3300025935 Ga0207709_10001032 Ga0207709_100010329 333
143 3300032002 Ga0307416_100023777 Ga0307416_1000237772 333
144 3300046524 Ga0495648_0022600 Ga0495648_0022600_3137_4207 333
145 iso_pu_bacteria 2513020051 2513227435 333
146 iso_pu_bacteria 2599185214 2599624543 333
147 iso_pu_bacteria 2599185226 2599672595 333
148 iso_pu_bacteria 2599185227 2599683595 333
149 iso_pu_bacteria 2599185229 2599694204 333
150 iso_pu_bacteria 2643221628 2644163141 333
151 iso_pu_bacteria 2643221672 2644398585 333
152 iso_pu_bacteria 2738541277 2738720157 333
153 iso_pu_bacteria 2738543019 2739279356 333
154 iso_pu_bacteria 2831265667 2831266895 333
155 iso_pu_bacteria 2838054893 2838056954 333
156 iso_pu_bacteria 2842677519 2842678772 333
157 iso_pu_bacteria 2885198086 2885199050 333
158 iso_pu_bacteria 2885211737 2885212687 333
159 iso_pu_bacteria 2928070936 2928071057 333
160 3300048926 Ga0496123_0028452 Ga0496123_0028452_2172_3272 334
161 3300003187 JGI25151J46595_10003922 JGI25151J46595_100039229 335
162 3300003773 Ga0055537_1000390 Ga0055537_100039014 335
163 3300003781 Ga0055536_1002880 Ga0055536_10028804 335
164 3300003784 Ga0055534_1000349 Ga0055534_100034912 335
165 3300003790 Ga0055528_1000914 Ga0055528_100091412 335
166 3300003792 Ga0055540_1000996 Ga0055540_100099611 335
167 3300003792 Ga0055540_1003698 Ga0055540_10036985 335
168 3300003794 Ga0055531_10001175 Ga0055531_1000117511 335
169 3300005288 Ga0065714_10008370 Ga0065714_100083703 335
170 3300005366 Ga0070659_100304392 Ga0070659_1003043922 335
171 3300005456 Ga0070678_100109415 Ga0070678_1001094152 335
172 3300005457 Ga0070662_100017863 Ga0070662_1000178633 335
173 3300005539 Ga0068853_100081717 Ga0068853_1000817172 335
174 3300005564 Ga0070664_100029930 Ga0070664_1000299302 335
175 3300005616 Ga0068852_100136933 Ga0068852_1001369333 335
176 3300005844 Ga0068862_100153601 Ga0068862_1001536013 335
177 3300006048 Ga0075363_100033095 Ga0075363_1000330951 335
178 3300006051 Ga0075364_10008450 Ga0075364_100084505 335
179 3300006177 Ga0075362_10030423 Ga0075362_100304232 335
180 3300006177 Ga0075362_10033809 Ga0075362_100338093 335
181 3300006178 Ga0075367_10023801 Ga0075367_100238014 335
182 3300006195 Ga0075366_10003695 Ga0075366_100036954 335
183 3300006353 Ga0075370_10001351 Ga0075370_100013515 335
184 3300006353 Ga0075370_10001937 Ga0075370_100019373 335
185 3300006353 Ga0075370_10128971 Ga0075370_101289712 335
186 3300006358 Ga0068871_100223272 Ga0068871_1002232722 335
187 3300006948 Ga0099826_10030220 Ga0099826_100302202 335
188 3300009036 Ga0105244_10001759 Ga0105244_100017595 335
189 3300009093 Ga0105240_10045631 Ga0105240_100456314 335
190 3300009148 Ga0105243_10002439 Ga0105243_100024395 335
191 3300009545 Ga0105237_10057546 Ga0105237_100575463 335
192 3300011119 Ga0105246_10061294 Ga0105246_100612944 335
193 3300014497 Ga0182008_10001707 Ga0182008_1000170712 335
194 3300015261 Ga0182006_1000990 Ga0182006_100099011 335
195 3300015262 Ga0182007_10000673 Ga0182007_1000067311 335
196 3300015262 Ga0182007_10005814 Ga0182007_100058143 335
197 3300017792 Ga0163161_10011455 Ga0163161_100114552 335
198 3300025208 Ga0209436_103577 Ga0209436_1035773 335
199 3300025258 Ga0209129_1001975 Ga0209129_100197511 335
200 3300025263 Ga0209565_1000288 Ga0209565_100028814 335
201 3300025263 Ga0209565_1001947 Ga0209565_10019477 335
202 3300025273 Ga0209673_1000838 Ga0209673_10008389 335
203 3300025273 Ga0209673_1001258 Ga0209673_10012587 335
204 3300025284 Ga0209130_1001550 Ga0209130_100155010 335
205 3300025291 Ga0209675_1000276 Ga0209675_100027614 335
206 3300025291 Ga0209675_1002155 Ga0209675_10021556 335
207 3300025292 Ga0209676_1000005 Ga0209676_1000005560 335
208 3300025292 Ga0209676_1003545 Ga0209676_10035459 335
209 3300025292 Ga0209676_1017071 Ga0209676_10170713 335
210 3300025294 Ga0209025_1000484 Ga0209025_100048411 335
211 3300025294 Ga0209025_1009028 Ga0209025_10090284 335
212 3300025295 Ga0209564_1000394 Ga0209564_100039444 335
213 3300025298 Ga0209050_1000007 Ga0209050_1000007537 335
214 3300025298 Ga0209050_1001433 Ga0209050_100143318 335
215 3300025298 Ga0209050_1011252 Ga0209050_10112526 335
216 3300025299 Ga0209256_1000864 Ga0209256_100086428 335
217 3300025302 Ga0207426_1000031 Ga0207426_100003179 335
218 3300025303 Ga0209051_1000009 Ga0209051_1000009560 335
219 3300025303 Ga0209051_1000385 Ga0209051_100038525 335
220 3300025303 Ga0209051_1000781 Ga0209051_100078117 335
221 3300025304 Ga0209257_1000011 Ga0209257_1000011534 335
222 3300025304 Ga0209257_1001057 Ga0209257_100105719 335
223 3300025728 Ga0207655_1013658 Ga0207655_10136584 335
224 3300025913 Ga0207695_10373598 Ga0207695_103735982 335
225 3300025914 Ga0207671_10103198 Ga0207671_101031981 335
226 3300025924 Ga0207694_10065076 Ga0207694_100650762 335
227 3300025935 Ga0207709_10001454 Ga0207709_1000145410 335
228 3300025945 Ga0207679_10015470 Ga0207679_100154706 335
229 3300025981 Ga0207640_10215795 Ga0207640_102157951 335
230 3300026041 Ga0207639_10065918 Ga0207639_100659184 335
231 3300026116 Ga0207674_10198781 Ga0207674_101987813 335
232 3300026142 Ga0207698_10111986 Ga0207698_101119863 335
233 3300027666 Ga0209282_1000334 Ga0209282_100033413 335
234 3300027907 Ga0207428_10351654 Ga0207428_103516541 335
235 3300028380 Ga0268265_10118263 Ga0268265_101182633 335
236 3300030731 Ga0316177_1029429 Ga0316177_10294293 335
237 3300030732 Ga0316176_1080864 Ga0316176_10808642 335
238 3300030733 Ga0314311_1124028 Ga0314311_11240281 335
239 3300030736 Ga0316180_1012367 Ga0316180_10123674 335
240 3300030745 Ga0316182_1325098 Ga0316182_13250983 335
241 3300031251 Ga0265327_10000722 Ga0265327_1000072233 335
242 3300031548 Ga0307408_100114667 Ga0307408_1001146672 335
243 3300031911 Ga0307412_10061531 Ga0307412_100615313 335
244 3300032004 Ga0307414_10071445 Ga0307414_100714452 335
245 3300032005 Ga0307411_10207668 Ga0307411_102076682 335
246 3300041404 Ga0439436_0002954 Ga0439436_0002954_1850_2878 335
247 3300041406 Ga0439439_0002400 Ga0439439_0002400_1415_2443 335
248 3300041413 Ga0439465_0007545 Ga0439465_0007545_1569_2603 335
249 3300042002 Ga0439442_004394 Ga0439442_004394_1354_2388 335
250 3300042004 Ga0439445_0008898 Ga0439445_0008898_636_1670 335
251 3300042006 Ga0439432_003819 Ga0439432_003819_1851_2879 335
252 3300042007 Ga0439449_0003981 Ga0439449_0003981_2363_3391 335
253 3300042010 Ga0439452_005772 Ga0439452_005772_2349_3377 335
254 3300042014 Ga0439457_029009 Ga0439457_029009_158_1192 335
255 3300042131 Ga0450894_003722 Ga0450894_003722_100_1128 335
256 3300042145 Ga0450906_001265 Ga0450906_001265_499_1533 335
257 3300042146 Ga0450907_010923 Ga0450907_010923_131_1165 335
258 3300042156 Ga0439446_0010238 Ga0439446_0010238_155_1189 335
259 3300042184 Ga0450908_000841 Ga0450908_000841_2143_3177 335
260 3300042435 Ga0439434_0001099 Ga0439434_0001099_3358_4392 335
261 3300046453 Ga0495627_007509 Ga0495627_007509_463_1494 335
262 3300046520 Ga0495637_0007495 Ga0495637_0007495_2048_3079 335
263 3300046660 Ga0495625_0000279 Ga0495625_0000279_11021_12055 335
264 3300046660 Ga0495625_0147991 Ga0495625_0147991_199_1230 335
265 3300046674 Ga0495588_0008649 Ga0495588_0008649_2620_3651 335
266 3300046691 Ga0495670_0064305 Ga0495670_0064305_630_1661 335
267 3300046692 Ga0495671_0002320 Ga0495671_0002320_2534_3565 335
268 3300048919 Ga0496116_0012792 Ga0496116_0012792_3139_4170 335
269 3300048921 Ga0496118_0020524 Ga0496118_0020524_3757_4794 335
270 3300049705 Ga0501225_0002703 Ga0501225_0002703_2559_3593 335
271 3300050489 nmdc:mga03683_11163_c1 nmdc:mga03683_11163_c1_59_1093 335
272 3300050489 nmdc:mga03683_45642_c1 nmdc:mga03683_45642_c1_208_1236 335
273 3300050489 nmdc:mga03683_80225_c1 nmdc:mga03683_80225_c1_346_1380 335
274 3300050490 nmdc:mga03n38_21763_c1 nmdc:mga03n38_21763_c1_1482_2516 335
275 3300050491 nmdc:mga00v17_190727_c1 nmdc:mga00v17_190727_c1_91_1125 335
276 3300050492 nmdc:mga0yw44_16735_c1 nmdc:mga0yw44_16735_c1_2067_3101 335
277 3300050493 nmdc:mga0k408_116628_c1 nmdc:mga0k408_116628_c1_256_1284 335
278 3300050494 nmdc:mga06z11_44049_c1 nmdc:mga06z11_44049_c1_239_1273 335
279 3300050496 nmdc:mga07m45_143028_c1 nmdc:mga07m45_143028_c1_180_1217 335
280 3300050496 nmdc:mga07m45_356_c1 nmdc:mga07m45_356_c1_11335_12369 335
281 3300050496 nmdc:mga07m45_8280_c1 nmdc:mga07m45_8280_c1_1200_2240 335
282 3300053079 Ga0500610_0000451 Ga0500610_0000451_7880_8911 335
283 3300053079 Ga0500610_0001074 Ga0500610_0001074_3103_4134 335
284 3300053109 Ga0500569_023454 Ga0500569_023454_309_1340 335
285 3300053117 Ga0500593_000735 Ga0500593_000735_2417_3448 335
286 3300053121 Ga0500607_003250 Ga0500607_003250_2385_3416 335
287 3300053121 Ga0500607_010629 Ga0500607_010629_2355_3404 335
288 3300053122 Ga0500608_003396 Ga0500608_003396_3435_4466 335
289 3300053158 Ga0500627_0004123 Ga0500627_0004123_2191_3222 335
290 3300053161 Ga0500634_0002263 Ga0500634_0002263_6487_7518 335
291 iso_pu_bacteria 2904449895 2904456458 335
292 iso_pu_bacteria 2904456579 2904460679 335
293 iso_pu_bacteria 2919462493 2919464400 335
294 iso_pu_bacteria 2929520902 2929524888 335
295 iso_pu_bacteria 2945909444 2945912459 335
296 iso_pu_bacteria 2945945610 2945947233 335
297 iso_pu_bacteria 2945972063 2945976991 335
298 iso_pu_bacteria 2945984333 2945985222 335
299 3300003187 JGI25151J46595_10008898 JGI25151J46595_100088982 336
300 3300006051 Ga0075364_10133357 Ga0075364_101333572 336
301 3300017792 Ga0163161_10000743 Ga0163161_1000074316 336
302 3300025294 Ga0209025_1002208 Ga0209025_100220813 336
303 3300031731 Ga0307405_10002949 Ga0307405_100029494 336
304 3300041404 Ga0439436_0000470 Ga0439436_0000470_6030_7061 336
305 3300041407 Ga0439447_012795 Ga0439447_012795_256_1287 336
306 3300041410 Ga0439461_0018568 Ga0439461_0018568_200_1231 336
307 3300041411 Ga0439466_0003460 Ga0439466_0003460_2631_3662 336
308 3300041413 Ga0439465_0000108 Ga0439465_0000108_16731_17762 336
309 3300041997 Ga0439431_0004413 Ga0439431_0004413_1631_2662 336
310 3300042004 Ga0439445_0001046 Ga0439445_0001046_1622_2653 336
311 3300042006 Ga0439432_010034 Ga0439432_010034_21_1052 336
312 3300042007 Ga0439449_0000245 Ga0439449_0000245_6217_7248 336
313 3300042010 Ga0439452_000792 Ga0439452_000792_3787_4818 336
314 3300042014 Ga0439457_001278 Ga0439457_001278_878_1909 336
315 3300042185 Ga0450909_003757 Ga0450909_003757_944_1975 336
316 3300042435 Ga0439434_0006472 Ga0439434_0006472_1407_2438 336
317 3300048912 Ga0496109_0240207 Ga0496109_0240207_169_1200 336
318 3300050489 nmdc:mga03683_51169_c1 nmdc:mga03683_51169_c1_464_1495 336
319 3300050490 nmdc:mga03n38_24136_c1 nmdc:mga03n38_24136_c1_896_1927 336
320 3300050493 nmdc:mga0k408_61213_c1 nmdc:mga0k408_61213_c1_593_1624 336
321 3300050496 nmdc:mga07m45_34458_c1 nmdc:mga07m45_34458_c1_558_1589 336
322 iso_pu_bacteria 2818991446 2819595955 336
323 iso_pu_bacteria 2899924645 2899925304 336
324 iso_pu_bacteria 2928037797 2928038574 336
325 iso_pu_bacteria 2928044640 2928045821 336
326 iso_pu_bacteria 2928051484 2928053438 336
327 iso_pu_bacteria 2928064002 2928067043 336
328 iso_pu_bacteria 2928084124 2928085001 336
329 iso_pu_bacteria 2954767861 2954771966 336
330 3300003578 Ga0006562J51391_1095652 Ga0006562J51391_10956523 337
331 3300003578 Ga0006562J51391_1095654 Ga0006562J51391_10956542 337
332 3300003792 Ga0055540_1004049 Ga0055540_10040495 337
333 3300006177 Ga0075362_10007125 Ga0075362_100071255 337
334 3300013100 Ga0157373_10053204 Ga0157373_100532043 337
335 3300025303 Ga0209051_1002109 Ga0209051_10021095 337
336 3300028800 Ga0265338_10000113 Ga0265338_1000011383 337
337 3300031548 Ga0307408_100024541 Ga0307408_1000245415 337
338 3300031548 Ga0307408_100157292 Ga0307408_1001572922 337
339 3300031901 Ga0307406_10001482 Ga0307406_1000148210 337
340 3300044706 Ga0466964_0039190 Ga0466964_0039190_861_1874 337
341 3300048920 Ga0496117_0064264 Ga0496117_0064264_23_1039 337
342 3300050489 nmdc:mga03683_25651_c1 nmdc:mga03683_25651_c1_640_1704 337
343 iso_pu_bacteria 2738541307 2738881701 337
344 3300002773 JGI25152J39213_1001246 JGI25152J39213_10012468 338
345 3300002774 JGI25150J39212_1000991 JGI25150J39212_100099110 338
346 3300002774 JGI25150J39212_1002008 JGI25150J39212_10020086 338
347 3300002987 JGI25159J45721_1001447 JGI25159J45721_10014476 338
348 3300003187 JGI25151J46595_10002925 JGI25151J46595_100029256 338
349 3300003215 JGI25153J46596_10001486 JGI25153J46596_1000148610 338
350 3300003354 JGI25160J50197_1001502 JGI25160J50197_10015028 338
351 3300003374 JGI25161J50226_1001006 JGI25161J50226_10010068 338
352 3300003761 Ga0055535_1000998 Ga0055535_100099816 338
353 3300003762 Ga0055542_1000004 Ga0055542_1000004163 338
354 3300003771 Ga0055526_1002772 Ga0055526_10027728 338
355 3300003773 Ga0055537_1001113 Ga0055537_10011138 338
356 3300003775 Ga0055524_1001840 Ga0055524_10018408 338
357 3300003784 Ga0055534_1001367 Ga0055534_10013676 338
358 3300003790 Ga0055528_1002082 Ga0055528_10020829 338
359 3300003792 Ga0055540_1008591 Ga0055540_10085913 338
360 3300003794 Ga0055531_10021333 Ga0055531_100213332 338
361 3300004625 Ga0055543_1002168 Ga0055543_10021682 338
362 3300005262 Ga0065165_1003400 Ga0065165_10034007 338
363 3300005367 Ga0070667_100050240 Ga0070667_1000502404 338
364 3300005539 Ga0068853_100020864 Ga0068853_1000208643 338
365 3300009551 Ga0105238_10070714 Ga0105238_100707141 338
366 3300025208 Ga0209436_108792 Ga0209436_1087922 338
367 3300025228 Ga0209672_101148 Ga0209672_10114811 338
368 3300025229 Ga0209147_102613 Ga0209147_1026132 338
369 3300025242 Ga0209258_100022 Ga0209258_100022162 338
370 3300025245 Ga0207425_1000199 Ga0207425_100019926 338
371 3300025254 Ga0209148_1000034 Ga0209148_1000034162 338
372 3300025258 Ga0209129_1000023 Ga0209129_1000023242 338
373 3300025263 Ga0209565_1000293 Ga0209565_100029327 338
374 3300025273 Ga0209673_1000265 Ga0209673_100026568 338
375 3300025284 Ga0209130_1000113 Ga0209130_100011359 338
376 3300025291 Ga0209675_1000127 Ga0209675_100012768 338
377 3300025292 Ga0209676_1004910 Ga0209676_10049105 338
378 3300025294 Ga0209025_1001331 Ga0209025_100133121 338
379 3300025295 Ga0209564_1000698 Ga0209564_100069819 338
380 3300025297 Ga0209758_1000064 Ga0209758_1000064143 338
381 3300025299 Ga0209256_1000115 Ga0209256_1000115154 338
382 3300025302 Ga0207426_1000001 Ga0207426_10000011149 338
383 3300025303 Ga0209051_1019996 Ga0209051_10199962 338
384 3300025303 Ga0209051_1053265 Ga0209051_10532652 338
385 3300025304 Ga0209257_1003120 Ga0209257_10031208 338
386 3300026041 Ga0207639_10007462 Ga0207639_100074625 338
387 3300026116 Ga0207674_10369757 Ga0207674_103697571 338
388 3300044901 Ga0466960_0010342 Ga0466960_0010342_217_1266 338
389 3300046690 Ga0495624_0053963 Ga0495624_0053963_419_1465 338
390 3300047673 Ga0495593_0025266 Ga0495593_0025266_1656_2702 338
391 3300048924 Ga0496121_0006229 Ga0496121_0006229_6055_7086 338
392 3300053120 Ga0500597_019885 Ga0500597_019885_892_1938 338
393 3300053134 Ga0500658_0001281 Ga0500658_0001281_4244_5290 338
394 3300053141 Ga0500574_039308 Ga0500574_039308_108_1154 338
395 3300003784 Ga0055534_1006607 Ga0055534_10066073 339
396 3300025284 Ga0209130_1004836 Ga0209130_10048366 339
397 3300025291 Ga0209675_1000887 Ga0209675_100088710 339
398 3300025292 Ga0209676_1009073 Ga0209676_10090734 339
399 3300025303 Ga0209051_1002621 Ga0209051_10026217 339
400 3300025304 Ga0209257_1005156 Ga0209257_10051561 339
401 3300031251 Ga0265327_10015860 Ga0265327_100158606 339
402 3300037418 Ga0395900_0028412 Ga0395900_0028412_1935_2990 339
403 iso_pu_bacteria 2842733646 2842735573 339
404 iso_pu_bacteria 2842747753 2842751331 339
405 3300005327 Ga0070658_10002647 Ga0070658_100026476 340
406 3300005456 Ga0070678_100142288 Ga0070678_1001422882 340
407 3300005548 Ga0070665_100385058 Ga0070665_1003850582 340
408 3300005563 Ga0068855_100424737 Ga0068855_1004247371 340
409 3300006195 Ga0075366_10087818 Ga0075366_100878181 340
410 3300006353 Ga0075370_10040569 Ga0075370_100405692 340
411 3300009148 Ga0105243_10347035 Ga0105243_103470351 340
412 3300013104 Ga0157370_10001149 Ga0157370_100011498 340
413 3300025909 Ga0207705_10000708 Ga0207705_1000070814 340
414 3300025949 Ga0207667_10003149 Ga0207667_100031495 340
415 3300026121 Ga0207683_10014003 Ga0207683_100140035 340
416 3300028379 Ga0268266_10335955 Ga0268266_103359552 340
417 3300050496 nmdc:mga07m45_113912_c1 nmdc:mga07m45_113912_c1_426_1454 340
418 3300053122 Ga0500608_080724 Ga0500608_080724_264_1343 340
419 3300002773 JGI25152J39213_1000915 JGI25152J39213_10009155 341
420 3300003215 JGI25153J46596_10004452 JGI25153J46596_100044523 341
421 3300003771 Ga0055526_1000649 Ga0055526_10006492 341
422 3300005617 Ga0068859_100253636 Ga0068859_1002536362 341
423 3300006931 Ga0097620_100253623 Ga0097620_1002536232 341
424 3300013104 Ga0157370_10186502 Ga0157370_101865022 341
425 3300014968 Ga0157379_10120360 Ga0157379_101203602 341
426 3300025245 Ga0207425_1000595 Ga0207425_100059511 341
427 3300025258 Ga0209129_1000089 Ga0209129_100008961 341
428 3300025295 Ga0209564_1000053 Ga0209564_1000053237 341
429 3300025297 Ga0209758_1000622 Ga0209758_100062213 341
430 3300028381 Ga0268264_10171693 Ga0268264_101716932 341
431 3300048925 Ga0496122_0000217 Ga0496122_0000217_96440_97516 341
432 3300048926 Ga0496123_0000057 Ga0496123_0000057_6701_7777 341
433 3300048927 Ga0496124_0031416 Ga0496124_0031416_827_1903 341
434 3300048920 Ga0496117_0008670 Ga0496117_0008670_1437_2507 342
435 3300048924 Ga0496121_0000305 Ga0496121_0000305_21438_22508 342
436 3300053136 Ga0500559_0002800 Ga0500559_0002800_3259_4332 342
437 3300044712 Ga0453684_0116937 Ga0453684_0116937_1089_2126 343
438 3300028794 Ga0307515_10024629 Ga0307515_100246299 346
439 3300031649 Ga0307514_10005152 Ga0307514_100051523 346
440 3300044694 Ga0466963_0015153 Ga0466963_0015153_3607_4674 346
441 3300061719 Ga0466962_0008411 Ga0466962_0008411_3698_4765 346
442 iso_pu_bacteria 2734482258 2735816181 346
443 iso_pu_bacteria 2881101125 2881105141 346
444 3300031730 Ga0307516_10003171 Ga0307516_100031719 347
445 3300038443 Ga0395901_0019159 Ga0395901_0019159_2329_3396 347
446 3300042876 Ga0451577_0078031 Ga0451577_0078031_263_1348 347
447 3300045051 Ga0451576_0001961 Ga0451576_0001961_2701_3786 347
448 3300045051 Ga0451576_0052917 Ga0451576_0052917_1957_3042 347
449 iso_pu_bacteria 2891633521 2891634731 347
450 3300005338 Ga0068868_100081982 Ga0068868_1000819822 348
451 3300042007 Ga0439449_0001647 Ga0439449_0001647_2341_3444 348
452 3300049776 Ga0501280_000651 Ga0501280_000651_3005_4102 348
453 iso_pu_bacteria 2519103095 2519457891 348
454 iso_pu_bacteria 2582581311 2585295192 348
455 iso_pu_bacteria 2599185240 2599742865 348
456 iso_pu_bacteria 2599185355 2600204983 348
457 iso_pu_bacteria 2675903129 2676741972 348
458 iso_pu_bacteria 2816332253 2817260070 348
459 iso_pu_bacteria 2816332256 2817277734 348
460 iso_pu_bacteria 2816332286 2817456853 348
461 iso_pu_bacteria 2863421361 2863421566 348
462 iso_pu_bacteria 2904564687 2904565747 348
463 iso_pu_bacteria 2904571731 2904572790 348
464 iso_pu_bacteria 2928157003 2928159856 348
465 iso_pu_bacteria 2928163908 2928164104 348
466 iso_pu_bacteria 2928536128 2928538687 348
467 iso_pu_bacteria 2981990288 2981994294 348
468 iso_pu_bacteria 8020807995 8020813039 348
469 iso_pu_bacteria 8020938398 8020944843 348
470 iso_pu_bacteria 8020945358 8020949716 348
471 iso_pu_bacteria 8020953355 8020959928 348
472 iso_pu_bacteria 8040167225 8040172292 348
473 iso_pu_bacteria 8040173305 8040175757 348
474 3300002704 JGI25155J39150_1000724 JGI25155J39150_10007243 349
475 3300006186 Ga0075369_10069478 Ga0075369_100694782 349
476 3300009093 Ga0105240_10008487 Ga0105240_1000848710 349
477 3300030521 Ga0307511_10000025 Ga0307511_1000002535 349
478 3300031344 Ga0265316_10000299 Ga0265316_1000029914 349
479 3300033179 Ga0307507_10088851 Ga0307507_100888512 349
480 3300046507 Ga0495606_0012257 Ga0495606_0012257_1677_2783 349
481 3300048929 Ga0496126_0016774 Ga0496126_0016774_3262_4431 349
482 3300050516 nmdc:mga0sz30_34877_c1 nmdc:mga0sz30_34877_c1_660_1757 349
483 3300053092 Ga0500583_0002376 Ga0500583_0002376_3840_4964 349
484 3300053125 Ga0500618_001179 Ga0500618_001179_2050_3156 349
485 3300053151 Ga0500604_0000752 Ga0500604_0000752_2176_3300 349
486 iso_pu_bacteria 2515154123 2515690480 349
487 iso_pu_bacteria 2599185239 2599737023 349
488 iso_pu_bacteria 2808606384 2808971581 349
489 iso_pu_bacteria 2808606390 2809006410 349
490 iso_pu_bacteria 2808606391 2809013672 349
491 iso_pu_bacteria 2818991452 2819632525 349
492 iso_pu_bacteria 2870068957 2870069008 349
493 iso_pu_bacteria 2928170801 2928173367 349
494 iso_pu_bacteria 8018845410 8018848983 349
495 iso_pu_bacteria 8021120328 8021126730 349
496 iso_pu_bacteria 8039098773 8039099204 349
497 3300005344 Ga0070661_100237510 Ga0070661_1002375101 350
498 3300006042 Ga0075368_10007239 Ga0075368_100072392 350
499 3300006048 Ga0075363_100020228 Ga0075363_1000202284 350
500 3300006177 Ga0075362_10078284 Ga0075362_100782842 350
501 3300006186 Ga0075369_10048964 Ga0075369_100489642 350
502 3300013105 Ga0157369_10000206 Ga0157369_1000020646 350
503 3300020069 Ga0197907_10707312 Ga0197907_107073125 350
504 3300020081 Ga0206354_11366513 Ga0206354_113665134 350
505 3300020082 Ga0206353_11314560 Ga0206353_113145603 350
506 3300022467 Ga0224712_10000022 Ga0224712_100000226 350
507 3300038443 Ga0395901_0000003 Ga0395901_0000003_487897_488964 350
508 3300042876 Ga0451577_0072441 Ga0451577_0072441_1368_2462 350
509 3300044712 Ga0453684_0524355 Ga0453684_0524355_168_1262 350
510 3300046679 Ga0495623_0135016 Ga0495623_0135016_308_1360 350
511 3300050489 nmdc:mga03683_53022_c1 nmdc:mga03683_53022_c1_289_1389 350
512 3300050491 nmdc:mga00v17_126852_c1 nmdc:mga00v17_126852_c1_385_1485 350
513 3300050495 nmdc:mga04h51_31327_c1 nmdc:mga04h51_31327_c1_250_1350 350
514 3300050496 nmdc:mga07m45_89697_c1 nmdc:mga07m45_89697_c1_476_1576 350
515 iso_pu_bacteria 2547132512 2548846186 350
516 3300046454 Ga0495592_0052099 Ga0495592_0052099_266_1336 351
517 3300046455 Ga0495603_0001297 Ga0495603_0001297_805_1875 351
518 3300046459 Ga0495629_0014711 Ga0495629_0014711_2293_3363 351
519 3300046461 Ga0495641_0003603 Ga0495641_0003603_461_1531 351
520 3300046462 Ga0495651_0196935 Ga0495651_0196935_184_1254 351
521 3300046463 Ga0495653_0006567 Ga0495653_0006567_2287_3357 351
522 3300046472 Ga0495580_0002054 Ga0495580_0002054_3425_4495 351
523 3300046473 Ga0495582_0002285 Ga0495582_0002285_6185_7255 351
524 3300046476 Ga0495662_0077914 Ga0495662_0077914_491_1561 351
525 3300046477 Ga0495664_0001019 Ga0495664_0001019_11580_12650 351
526 3300046514 Ga0495618_0014447 Ga0495618_0014447_496_1566 351
527 3300046516 Ga0495628_0002617 Ga0495628_0002617_12840_13910 351
528 3300046524 Ga0495648_0012380 Ga0495648_0012380_2975_4045 351
529 3300046526 Ga0495666_0006495 Ga0495666_0006495_1983_3053 351
530 3300046529 Ga0495652_0029140 Ga0495652_0029140_677_1747 351
531 3300046531 Ga0495665_0005886 Ga0495665_0005886_4325_5395 351
532 3300046533 Ga0495640_0026287 Ga0495640_0026287_743_1813 351
533 3300046535 Ga0495586_0000633 Ga0495586_0000633_17153_18223 351
534 3300046536 Ga0495587_0018778 Ga0495587_0018778_2675_3745 351
535 3300046543 Ga0495645_0003050 Ga0495645_0003050_3383_4453 351
536 3300046642 Ga0495634_0009735 Ga0495634_0009735_2300_3370 351
537 3300046663 Ga0495635_0040500 Ga0495635_0040500_177_1247 351
538 3300046665 Ga0495661_0010232 Ga0495661_0010232_910_1980 351
539 3300046678 Ga0495599_0023267 Ga0495599_0023267_430_1500 351
540 3300046679 Ga0495623_0021667 Ga0495623_0021667_2708_3778 351
541 3300046680 Ga0495646_0011483 Ga0495646_0011483_2266_3336 351
542 3300046689 Ga0495613_0002624 Ga0495613_0002624_10172_11242 351
543 3300046690 Ga0495624_0010314 Ga0495624_0010314_2130_3200 351
544 3300047315 Ga0495581_0006202 Ga0495581_0006202_4289_5359 351
545 3300047317 Ga0495604_0005007 Ga0495604_0005007_3240_4310 351
546 3300047319 Ga0495674_0022004 Ga0495674_0022004_3240_4310 351
547 3300047321 Ga0495676_0017431 Ga0495676_0017431_3408_4478 351
548 3300047322 Ga0495680_0007394 Ga0495680_0007394_5891_6961 351
549 3300047446 Ga0495679_003488 Ga0495679_003488_439_1509 351
550 3300047673 Ga0495593_0010859 Ga0495593_0010859_1703_2773 351
551 3300048088 Ga0495602_0027611 Ga0495602_0027611_2293_3363 351
552 3300048089 Ga0495614_0000770 Ga0495614_0000770_3627_4697 351
553 3300048912 Ga0496109_0281411 Ga0496109_0281411_414_1535 351
554 iso_pu_bacteria 2501025501 2501071009 351
555 iso_pu_bacteria 2501025502 2501078836 351
556 iso_pu_bacteria 2501025504 2501413839 351
557 iso_pu_bacteria 2510917014 2511094892 351
558 iso_pu_bacteria 2510917015 2511104551 351
559 iso_pu_bacteria 2513237082 2513551591 351
560 iso_pu_bacteria 2513237083 2513560242 351
561 iso_pu_bacteria 2515154189 2516016996 351
562 iso_pu_bacteria 2562617112 2563061899 351
563 iso_pu_bacteria 2600255067 2600814623 351
564 iso_pu_bacteria 2711768613 2713478265 351
565 iso_pu_bacteria 2791355137 2792833011 351
566 iso_pu_bacteria 2856287931 2856289142 351
567 iso_pu_bacteria 2857357740 2857363488 351
568 iso_pu_bacteria 2883087390 2883094751 351
569 iso_pu_bacteria 2904615490 2904618883 351
570 iso_pu_bacteria 2921643360 2921643715 351
571 iso_pu_bacteria 642555112 642594292 351
572 iso_pu_bacteria 8003955200 8003957509 351
573 3300001989 JGI24739J22299_10035620 JGI24739J22299_100356202 352
574 3300003758 Ga0055532_1002025 Ga0055532_10020256 352
575 3300003761 Ga0055535_1002924 Ga0055535_10029246 352
576 3300003762 Ga0055542_1001017 Ga0055542_10010178 352
577 3300003763 Ga0055529_1001769 Ga0055529_10017696 352
578 3300003856 Ga0058692_1002599 Ga0058692_10025998 352
579 3300009093 Ga0105240_10081746 Ga0105240_100817462 352
580 3300025228 Ga0209672_100028 Ga0209672_100028177 352
581 3300025229 Ga0209147_100163 Ga0209147_10016311 352
582 3300025242 Ga0209258_100112 Ga0209258_10011231 352
583 3300025254 Ga0209148_1000081 Ga0209148_100008161 352
584 3300025272 Ga0209455_1000050 Ga0209455_1000050143 352
585 3300025273 Ga0209673_1000038 Ga0209673_100003881 352
586 3300025295 Ga0209564_1027441 Ga0209564_10274411 352
587 3300025913 Ga0207695_10005102 Ga0207695_100051028 352
588 3300027312 Ga0209371_1000090 Ga0209371_1000090134 352
589 3300030500 Ga0268256_1000115 Ga0268256_100011581 352
590 3300042876 Ga0451577_0025039 Ga0451577_0025039_867_1967 352
591 iso_pu_bacteria 2508501125 2509129383 352
592 iso_pu_bacteria 2510065045 2510249971 352
593 iso_pu_bacteria 2512047030 2512347518 352
594 iso_pu_bacteria 2513237151 2513962461 352
595 iso_pu_bacteria 2515154122 2515679422 352
596 iso_pu_bacteria 2526164713 2527079139 352
597 iso_pu_bacteria 2718217991 2719639129 352
598 iso_pu_bacteria 2738541296 2738820116 352
599 iso_pu_bacteria 2738541298 2738832596 352
600 iso_pu_bacteria 2738541306 2738874123 352
601 iso_pu_bacteria 2738543002 2739185753 352
602 iso_pu_bacteria 2738543008 2739220721 352
603 iso_pu_bacteria 2744054900 2746092230 352
604 iso_pu_bacteria 2744054901 2746095271 352
605 iso_pu_bacteria 2751185846 2753568824 352
606 iso_pu_bacteria 2818991450 2819620873 352
607 iso_pu_bacteria 2842324504 2842331332 352
608 iso_pu_bacteria 2842348783 2842355672 352
609 iso_pu_bacteria 2842454564 2842462024 352
610 iso_pu_bacteria 2885270888 2885277302 352
611 iso_pu_bacteria 2900634093 2900636243 352
612 iso_pu_bacteria 2902682994 2902683440 352
613 iso_pu_bacteria 2904483920 2904483966 352
614 iso_pu_bacteria 2919527303 2919529914 352
615 iso_pu_bacteria 2928108538 2928109675 352
616 iso_pu_bacteria 2928135762 2928136871 352
617 iso_pu_bacteria 2928503688 2928506399 352
618 iso_pu_bacteria 2945934425 2945935425 352
619 iso_pu_bacteria 2990703756 2990704026 352
620 iso_pu_bacteria 641736151 642422183 352
621 iso_pu_bacteria 641736154 642417462 352
622 iso_pu_bacteria 642555113 642620297 352
623 iso_pu_bacteria 8055266321 8055266704 352
624 iso_pu_bacteria 8055301274 8055303920 352
625 3300003758 Ga0055532_1002399 Ga0055532_10023992 353
626 3300005335 Ga0070666_10057749 Ga0070666_100577492 353
627 3300005456 Ga0070678_100084625 Ga0070678_1000846253 353
628 3300009011 Ga0105251_10004896 Ga0105251_100048967 353
629 3300009011 Ga0105251_10076755 Ga0105251_100767551 353
630 3300009036 Ga0105244_10050125 Ga0105244_100501251 353
631 3300009174 Ga0105241_10129036 Ga0105241_101290362 353
632 3300009176 Ga0105242_10127949 Ga0105242_101279494 353
633 3300009177 Ga0105248_10036706 Ga0105248_100367064 353
634 3300009551 Ga0105238_10244627 Ga0105238_102446272 353
635 3300013306 Ga0163162_10010310 Ga0163162_100103103 353
636 3300025225 Ga0209566_100216 Ga0209566_10021643 353
637 3300025226 Ga0209674_101735 Ga0209674_1017353 353
638 3300025229 Ga0209147_100686 Ga0209147_1006866 353
639 3300025903 Ga0207680_10008834 Ga0207680_100088343 353
640 3300025904 Ga0207647_10019591 Ga0207647_100195913 353
641 3300025941 Ga0207711_10026135 Ga0207711_100261353 353
642 3300026067 Ga0207678_10037514 Ga0207678_100375141 353
643 3300026121 Ga0207683_10056358 Ga0207683_100563583 353
644 3300031344 Ga0265316_10089534 Ga0265316_100895342 353
645 3300031507 Ga0307509_10000006 Ga0307509_10000006355 353
646 3300031616 Ga0307508_10059988 Ga0307508_100599883 353
647 3300037471 Ga0395905_0075175 Ga0395905_0075175_118_1185 353
648 3300044656 Ga0466969_0004757 Ga0466969_0004757_2308_3381 353
649 3300044684 Ga0466966_0002909 Ga0466966_0002909_719_1792 353
650 3300044712 Ga0453684_0008183 Ga0453684_0008183_10936_12039 353
651 3300044765 Ga0466970_0026347 Ga0466970_0026347_1265_2338 353
652 3300044765 Ga0466970_0091606 Ga0466970_0091606_20_1087 353
653 3300045049 Ga0466959_0014675 Ga0466959_0014675_3214_4287 353
654 3300045049 Ga0466959_0222376 Ga0466959_0222376_104_1171 353
655 3300045051 Ga0451576_0012728 Ga0451576_0012728_2476_3579 353
656 3300045051 Ga0451576_0145389 Ga0451576_0145389_513_1616 353
657 3300045976 Ga0466967_0343404 Ga0466967_0343404_114_1181 353
658 3300046455 Ga0495603_0007952 Ga0495603_0007952_4183_5250 353
659 3300046457 Ga0495590_0001947 Ga0495590_0001947_2693_3760 353
660 3300046457 Ga0495590_0060794 Ga0495590_0060794_117_1184 353
661 3300046459 Ga0495629_0004351 Ga0495629_0004351_9361_10428 353
662 3300046463 Ga0495653_0092915 Ga0495653_0092915_806_1873 353
663 3300046463 Ga0495653_0175644 Ga0495653_0175644_344_1411 353
664 3300046471 Ga0495650_0004632 Ga0495650_0004632_5942_7009 353
665 3300046474 Ga0495605_0004899 Ga0495605_0004899_3231_4298 353
666 3300046476 Ga0495662_0024751 Ga0495662_0024751_1796_2863 353
667 3300046477 Ga0495664_0083586 Ga0495664_0083586_604_1671 353
668 3300046500 Ga0495596_0073211 Ga0495596_0073211_128_1195 353
669 3300046506 Ga0495583_0013530 Ga0495583_0013530_863_1930 353
670 3300046507 Ga0495606_0039182 Ga0495606_0039182_1972_3039 353
671 3300046507 Ga0495606_0072098 Ga0495606_0072098_826_1893 353
672 3300046515 Ga0495620_0011576 Ga0495620_0011576_335_1402 353
673 3300046516 Ga0495628_0033448 Ga0495628_0033448_274_1341 353
674 3300046516 Ga0495628_0049906 Ga0495628_0049906_47_1114 353
675 3300046528 Ga0495642_0021025 Ga0495642_0021025_1113_2180 353
676 3300046530 Ga0495654_0081073 Ga0495654_0081073_11_1078 353
677 3300046531 Ga0495665_0021328 Ga0495665_0021328_1966_3033 353
678 3300046542 Ga0495597_0002648 Ga0495597_0002648_9234_10301 353
679 3300046542 Ga0495597_0044837 Ga0495597_0044837_312_1379 353
680 3300046543 Ga0495645_0011091 Ga0495645_0011091_4792_5859 353
681 3300046543 Ga0495645_0045339 Ga0495645_0045339_1424_2491 353
682 3300046559 Ga0495667_0017947 Ga0495667_0017947_1067_2134 353
683 3300046663 Ga0495635_0102843 Ga0495635_0102843_190_1257 353
684 3300046680 Ga0495646_0053517 Ga0495646_0053517_305_1372 353
685 3300046680 Ga0495646_0076910 Ga0495646_0076910_114_1181 353
686 3300046684 Ga0495669_0084553 Ga0495669_0084553_205_1272 353
687 3300046684 Ga0495669_0102943 Ga0495669_0102943_215_1282 353
688 3300046689 Ga0495613_0010806 Ga0495613_0010806_2643_3710 353
689 3300046690 Ga0495624_0179046 Ga0495624_0179046_208_1275 353
690 3300046691 Ga0495670_0089064 Ga0495670_0089064_206_1273 353
691 3300046692 Ga0495671_0016957 Ga0495671_0016957_2432_3499 353
692 3300046694 Ga0495649_0004421 Ga0495649_0004421_3125_4192 353
693 3300046694 Ga0495649_0079163 Ga0495649_0079163_435_1502 353
694 3300046694 Ga0495649_0083897 Ga0495649_0083897_424_1491 353
695 3300046794 Ga0495589_0005849 Ga0495589_0005849_2501_3568 353
696 3300046794 Ga0495589_0082331 Ga0495589_0082331_303_1370 353
697 3300046809 Ga0495600_0044562 Ga0495600_0044562_337_1404 353
698 3300046809 Ga0495600_0143413 Ga0495600_0143413_217_1284 353
699 3300047315 Ga0495581_0005698 Ga0495581_0005698_2752_3819 353
700 3300047317 Ga0495604_0126928 Ga0495604_0126928_556_1623 353
701 3300047319 Ga0495674_0023710 Ga0495674_0023710_265_1332 353
702 3300047320 Ga0495672_0003028 Ga0495672_0003028_12322_13389 353
703 3300047322 Ga0495680_0086575 Ga0495680_0086575_32_1099 353
704 3300047323 Ga0495683_0002898 Ga0495683_0002898_5944_7011 353
705 3300047323 Ga0495683_0084673 Ga0495683_0084673_92_1159 353
706 3300047443 Ga0495687_000011 Ga0495687_000011_291360_292427 353
707 3300047469 Ga0495673_0040365 Ga0495673_0040365_1010_2077 353
708 3300047469 Ga0495673_0096997 Ga0495673_0096997_33_1100 353
709 3300047472 Ga0495686_0000014 Ga0495686_0000014_332209_333276 353
710 3300047673 Ga0495593_0006696 Ga0495593_0006696_4656_5723 353
711 3300047673 Ga0495593_0018130 Ga0495593_0018130_2436_3503 353
712 3300048089 Ga0495614_0082923 Ga0495614_0082923_20_1087 353
713 3300048903 Ga0496100_0018508 Ga0496100_0018508_326_1393 353
714 3300048903 Ga0496100_0039852 Ga0496100_0039852_346_1413 353
715 3300048903 Ga0496100_0136746 Ga0496100_0136746_448_1515 353
716 3300048904 Ga0496101_0006420 Ga0496101_0006420_214_1281 353
717 3300048904 Ga0496101_0128488 Ga0496101_0128488_602_1669 353
718 3300048905 Ga0496102_0021914 Ga0496102_0021914_4025_5092 353
719 3300048905 Ga0496102_0035899 Ga0496102_0035899_2922_3989 353
720 3300048905 Ga0496102_0269160 Ga0496102_0269160_360_1427 353
721 3300048906 Ga0496103_0006863 Ga0496103_0006863_215_1282 353
722 3300048907 Ga0496104_0054037 Ga0496104_0054037_1838_2905 353
723 3300048908 Ga0496105_0107959 Ga0496105_0107959_666_1733 353
724 3300048908 Ga0496105_0173630 Ga0496105_0173630_239_1306 353
725 3300048909 Ga0496106_0019590 Ga0496106_0019590_1387_2454 353
726 3300048910 Ga0496107_0023185 Ga0496107_0023185_3032_4099 353
727 3300048910 Ga0496107_0085859 Ga0496107_0085859_535_1602 353
728 3300048910 Ga0496107_0116962 Ga0496107_0116962_451_1518 353
729 3300048911 Ga0496108_0232750 Ga0496108_0232750_490_1557 353
730 3300048913 Ga0496110_0026740 Ga0496110_0026740_449_1516 353
731 3300048913 Ga0496110_0156871 Ga0496110_0156871_152_1219 353
732 3300048914 Ga0496111_0060199 Ga0496111_0060199_808_1875 353
733 3300048915 Ga0496112_0008182 Ga0496112_0008182_7731_8798 353
734 3300048916 Ga0496113_0011230 Ga0496113_0011230_4066_5133 353
735 3300048917 Ga0496114_0001502 Ga0496114_0001502_2506_3573 353
736 3300048917 Ga0496114_0318659 Ga0496114_0318659_156_1223 353
737 3300048918 Ga0496115_0113660 Ga0496115_0113660_1008_2075 353
738 3300048920 Ga0496117_0010958 Ga0496117_0010958_5287_6354 353
739 3300048920 Ga0496117_0011477 Ga0496117_0011477_3352_4419 353
740 3300048921 Ga0496118_0017009 Ga0496118_0017009_2883_3950 353
741 3300048921 Ga0496118_0104184 Ga0496118_0104184_522_1589 353
742 3300048921 Ga0496118_0131107 Ga0496118_0131107_362_1429 353
743 3300048924 Ga0496121_0074371 Ga0496121_0074371_1641_2708 353
744 3300048925 Ga0496122_0026227 Ga0496122_0026227_564_1631 353
745 3300048926 Ga0496123_0028101 Ga0496123_0028101_1696_2763 353
746 3300048927 Ga0496124_0026584 Ga0496124_0026584_1387_2454 353
747 3300048929 Ga0496126_0001240 Ga0496126_0001240_3267_4334 353
748 3300048929 Ga0496126_0198119 Ga0496126_0198119_248_1315 353
749 3300049459 Ga0495678_058272 Ga0495678_058272_165_1232 353
750 3300013105 Ga0157369_10387518 Ga0157369_103875182 354
751 3300025941 Ga0207711_10031612 Ga0207711_100316125 354
752 3300003322 rootL2_10002479 rootL2_1000247911 355
753 3300003322 rootL2_10084409 rootL2_100844092 355
754 3300003354 JGI25160J50197_1000171 JGI25160J50197_100017117 355
755 3300005262 Ga0065165_1001193 Ga0065165_100119317 355
756 3300005327 Ga0070658_10014898 Ga0070658_100148986 355
757 3300005339 Ga0070660_100002402 Ga0070660_1000024028 355
758 3300005563 Ga0068855_100009319 Ga0068855_1000093198 355
759 3300009093 Ga0105240_10000656 Ga0105240_1000065637 355
760 3300009177 Ga0105248_10177643 Ga0105248_101776432 355
761 3300009177 Ga0105248_10179120 Ga0105248_101791202 355
762 3300009545 Ga0105237_10013204 Ga0105237_100132042 355
763 3300010375 Ga0105239_10007406 Ga0105239_100074065 355
764 3300013100 Ga0157373_10003547 Ga0157373_100035477 355
765 3300013102 Ga0157371_10027247 Ga0157371_100272473 355
766 3300013104 Ga0157370_10000328 Ga0157370_1000032831 355
767 3300013105 Ga0157369_10000556 Ga0157369_1000055623 355
768 3300013105 Ga0157369_10000953 Ga0157369_1000095330 355
769 3300013296 Ga0157374_10000370 Ga0157374_1000037010 355
770 3300013307 Ga0157372_10003805 Ga0157372_100038055 355
771 3300014497 Ga0182008_10029056 Ga0182008_100290562 355
772 3300016635 Ga0183361_10012 Ga0183361_1001218 355
773 3300025228 Ga0209672_101654 Ga0209672_1016545 355
774 3300025295 Ga0209564_1006730 Ga0209564_10067305 355
775 3300025302 Ga0207426_1000037 Ga0207426_1000037192 355
776 3300025904 Ga0207647_10000268 Ga0207647_1000026837 355
777 3300025913 Ga0207695_10099910 Ga0207695_100999102 355
778 3300025914 Ga0207671_10026696 Ga0207671_100266962 355
779 3300025919 Ga0207657_10000131 Ga0207657_1000013133 355
780 3300025941 Ga0207711_10228248 Ga0207711_102282482 355
781 3300025949 Ga0207667_10009431 Ga0207667_100094317 355
782 3300037418 Ga0395900_0002303 Ga0395900_0002303_15459_16526 355
783 3300037418 Ga0395900_0007321 Ga0395900_0007321_9315_10382 355
784 3300037418 Ga0395900_0134985 Ga0395900_0134985_629_1696 355
785 3300037418 Ga0395900_0138938 Ga0395900_0138938_109_1176 355
786 3300037418 Ga0395900_0250241 Ga0395900_0250241_524_1591 355
787 3300037466 Ga0395898_0001260 Ga0395898_0001260_8091_9158 355
788 3300037466 Ga0395898_0032722 Ga0395898_0032722_161_1228 355
789 3300037471 Ga0395905_0000168 Ga0395905_0000168_21734_22804 355
790 3300038443 Ga0395901_0010491 Ga0395901_0010491_2362_3429 355
791 3300038443 Ga0395901_0170239 Ga0395901_0170239_753_1820 355
792 3300038443 Ga0395901_0194691 Ga0395901_0194691_305_1372 355
793 3300039447 Ga0436361_0131139 Ga0436361_0131139_5237_6310 355
794 3300042005 Ga0439448_0001330 Ga0439448_0001330_19_1086 355
795 3300044656 Ga0466969_0002847 Ga0466969_0002847_2360_3427 355
796 3300044659 Ga0466973_0009139 Ga0466973_0009139_6085_7152 355
797 3300044683 Ga0466965_0001211 Ga0466965_0001211_8088_9155 355
798 3300044683 Ga0466965_0001863 Ga0466965_0001863_1731_2798 355
799 3300044684 Ga0466966_0000032 Ga0466966_0000032_22878_23945 355
800 3300044684 Ga0466966_0016532 Ga0466966_0016532_789_1856 355
801 3300044684 Ga0466966_0063721 Ga0466966_0063721_127_1194 355
802 3300044693 Ga0466961_0004925 Ga0466961_0004925_7029_8096 355
803 3300044693 Ga0466961_0116424 Ga0466961_0116424_76_1143 355
804 3300044694 Ga0466963_0001953 Ga0466963_0001953_2856_3923 355
805 3300044706 Ga0466964_0002026 Ga0466964_0002026_2586_3653 355
806 3300044735 Ga0466968_0005823 Ga0466968_0005823_2945_4012 355
807 3300044842 Ga0466957_0015351 Ga0466957_0015351_297_1364 355
808 3300044842 Ga0466957_0047793 Ga0466957_0047793_238_1305 355
809 3300044842 Ga0466957_0097795 Ga0466957_0097795_355_1422 355
810 3300045049 Ga0466959_0010040 Ga0466959_0010040_1641_2708 355
811 3300045836 Ga0466958_0005164 Ga0466958_0005164_2041_3108 355
812 3300045836 Ga0466958_0009785 Ga0466958_0009785_243_1310 355
813 3300045836 Ga0466958_0021413 Ga0466958_0021413_2617_3684 355
814 3300046455 Ga0495603_0009400 Ga0495603_0009400_1412_2482 355
815 3300046474 Ga0495605_0010712 Ga0495605_0010712_222_1292 355
816 3300046506 Ga0495583_0006862 Ga0495583_0006862_3476_4546 355
817 3300046513 Ga0495616_0073811 Ga0495616_0073811_108_1178 355
818 3300046524 Ga0495648_0021277 Ga0495648_0021277_3246_4316 355
819 3300046557 Ga0495622_0016921 Ga0495622_0016921_2229_3299 355
820 3300046684 Ga0495669_0035962 Ga0495669_0035962_565_1635 355
821 3300047319 Ga0495674_0294906 Ga0495674_0294906_138_1208 355
822 3300047323 Ga0495683_0075182 Ga0495683_0075182_199_1269 355
823 3300047443 Ga0495687_006437 Ga0495687_006437_2787_3857 355
824 3300048903 Ga0496100_0009676 Ga0496100_0009676_404_1474 355
825 3300048905 Ga0496102_0003852 Ga0496102_0003852_6261_7331 355
826 3300048906 Ga0496103_0011673 Ga0496103_0011673_996_2066 355
827 3300048907 Ga0496104_0028881 Ga0496104_0028881_3125_4195 355
828 3300048908 Ga0496105_0052227 Ga0496105_0052227_1017_2087 355
829 3300048908 Ga0496105_0171307 Ga0496105_0171307_342_1412 355
830 3300048908 Ga0496105_0208750 Ga0496105_0208750_364_1434 355
831 3300048909 Ga0496106_0000031 Ga0496106_0000031_69021_70091 355
832 3300048915 Ga0496112_0041577 Ga0496112_0041577_2332_3402 355
833 3300048916 Ga0496113_0256718 Ga0496113_0256718_136_1206 355
834 3300048919 Ga0496116_0104757 Ga0496116_0104757_567_1637 355
835 3300048921 Ga0496118_0027358 Ga0496118_0027358_2847_3917 355
836 3300048921 Ga0496118_0043345 Ga0496118_0043345_2066_3136 355
837 3300048921 Ga0496118_0056034 Ga0496118_0056034_694_1764 355
838 3300048924 Ga0496121_0082136 Ga0496121_0082136_1338_2408 355
839 3300048924 Ga0496121_0156425 Ga0496121_0156425_509_1579 355
840 3300048929 Ga0496126_0003523 Ga0496126_0003523_4910_5980 355
841 3300048929 Ga0496126_0244826 Ga0496126_0244826_400_1470 355
842 3300049459 Ga0495678_051418 Ga0495678_051418_416_1486 355
843 3300049460 Ga0495682_0015318 Ga0495682_0015318_482_1552 355
844 3300061719 Ga0466962_0016712 Ga0466962_0016712_2425_3492 355
845 3300061719 Ga0466962_0061442 Ga0466962_0061442_190_1257 355
846 iso_pu_bacteria 2510917013 2511089475 355
847 iso_pu_bacteria 2513237166 2514046283 355
848 3300001979 JGI24740J21852_10003397 JGI24740J21852_100033977 356
849 3300001989 JGI24739J22299_10002664 JGI24739J22299_100026646 356
850 3300001989 JGI24739J22299_10005575 JGI24739J22299_100055756 356
851 3300001990 JGI24737J22298_10023739 JGI24737J22298_100237391 356
852 3300002067 JGI24735J21928_10002378 JGI24735J21928_100023784 356
853 3300002075 JGI24738J21930_10001505 JGI24738J21930_100015054 356
854 3300002705 JGI25156J39149_1000504 JGI25156J39149_10005044 356
855 3300002705 JGI25156J39149_1000735 JGI25156J39149_10007357 356
856 3300002705 JGI25156J39149_1002542 JGI25156J39149_10025425 356
857 3300003214 JGI25165J46597_1001196 JGI25165J46597_10011965 356
858 3300003756 Ga0055533_1000292 Ga0055533_100029221 356
859 3300003758 Ga0055532_1000001 Ga0055532_1000001959 356
860 3300003760 Ga0055527_1000014 Ga0055527_100001445 356
861 3300003761 Ga0055535_1000001 Ga0055535_100000145 356
862 3300003762 Ga0055542_1000001 Ga0055542_1000001958 356
863 3300003763 Ga0055529_1000001 Ga0055529_100000145 356
864 3300005327 Ga0070658_10265732 Ga0070658_102657321 356
865 3300009011 Ga0105251_10000097 Ga0105251_1000009738 356
866 3300009093 Ga0105240_10345382 Ga0105240_103453821 356
867 3300011119 Ga0105246_10352220 Ga0105246_103522201 356
868 3300015262 Ga0182007_10000150 Ga0182007_1000015044 356
869 3300025226 Ga0209674_100005 Ga0209674_1000051391 356
870 3300025226 Ga0209674_100092 Ga0209674_10009259 356
871 3300025228 Ga0209672_100001 Ga0209672_1000011788 356
872 3300025229 Ga0209147_100001 Ga0209147_1000011788 356
873 3300025230 Ga0209563_104011 Ga0209563_1040112 356
874 3300025231 Ga0207427_103987 Ga0207427_1039872 356
875 3300025242 Ga0209258_100001 Ga0209258_1000011788 356
876 3300025254 Ga0209148_1000003 Ga0209148_10000031788 356
877 3300025256 Ga0209759_1000053 Ga0209759_100005397 356
878 3300025256 Ga0209759_1000074 Ga0209759_100007427 356
879 3300025256 Ga0209759_1000601 Ga0209759_100060124 356
880 3300025261 Ga0209233_1000016 Ga0209233_1000016748 356
881 3300025272 Ga0209455_1000001 Ga0209455_10000011788 356
882 3300025735 Ga0207713_1000305 Ga0207713_10003053 356
883 3300025904 Ga0207647_10008546 Ga0207647_100085464 356
884 3300025904 Ga0207647_10027493 Ga0207647_100274936 356
885 3300025904 Ga0207647_10043031 Ga0207647_100430312 356
886 3300025909 Ga0207705_10134982 Ga0207705_101349822 356
887 3300025913 Ga0207695_10188464 Ga0207695_101884642 356
888 3300025949 Ga0207667_10113941 Ga0207667_101139414 356
889 3300025986 Ga0207658_10057051 Ga0207658_100570512 356
890 3300026067 Ga0207678_10262867 Ga0207678_102628672 356
891 3300027312 Ga0209371_1001109 Ga0209371_10011094 356
892 3300030500 Ga0268256_1000921 Ga0268256_100092115 356
893 3300031548 Ga0307408_100002431 Ga0307408_1000024314 356
894 3300031911 Ga0307412_10000051 Ga0307412_1000005113 356
895 3300031911 Ga0307412_10194031 Ga0307412_101940312 356
896 3300032005 Ga0307411_10118497 Ga0307411_101184972 356
897 3300046454 Ga0495592_0040557 Ga0495592_0040557_2336_3406 356
898 3300046454 Ga0495592_0197290 Ga0495592_0197290_95_1177 356
899 3300046458 Ga0495591_006781 Ga0495591_006781_422_1498 356
900 3300046459 Ga0495629_0000369 Ga0495629_0000369_2270_3340 356
901 3300046459 Ga0495629_0005165 Ga0495629_0005165_6323_7393 356
902 3300046459 Ga0495629_0041923 Ga0495629_0041923_1935_3011 356
903 3300046459 Ga0495629_0049525 Ga0495629_0049525_1427_2497 356
904 3300046460 Ga0495638_0074310 Ga0495638_0074310_766_1836 356
905 3300046462 Ga0495651_0009952 Ga0495651_0009952_2605_3681 356
906 3300046462 Ga0495651_0023058 Ga0495651_0023058_1263_2333 356
907 3300046462 Ga0495651_0218439 Ga0495651_0218439_59_1129 356
908 3300046463 Ga0495653_0018833 Ga0495653_0018833_865_1935 356
909 3300046463 Ga0495653_0023696 Ga0495653_0023696_2038_3114 356
910 3300046463 Ga0495653_0037748 Ga0495653_0037748_836_1918 356
911 3300046471 Ga0495650_0014058 Ga0495650_0014058_398_1468 356
912 3300046471 Ga0495650_0017226 Ga0495650_0017226_1043_2113 356
913 3300046471 Ga0495650_0019000 Ga0495650_0019000_491_1567 356
914 3300046471 Ga0495650_0027417 Ga0495650_0027417_1042_2112 356
915 3300046472 Ga0495580_0005418 Ga0495580_0005418_2461_3531 356
916 3300046472 Ga0495580_0023500 Ga0495580_0023500_2906_3976 356
917 3300046472 Ga0495580_0070077 Ga0495580_0070077_585_1655 356
918 3300046472 Ga0495580_0113459 Ga0495580_0113459_31_1107 356
919 3300046472 Ga0495580_0149687 Ga0495580_0149687_433_1503 356
920 3300046472 Ga0495580_0159856 Ga0495580_0159856_396_1466 356
921 3300046473 Ga0495582_0052398 Ga0495582_0052398_252_1322 356
922 3300046474 Ga0495605_0002196 Ga0495605_0002196_4006_5076 356
923 3300046474 Ga0495605_0016596 Ga0495605_0016596_557_1627 356
924 3300046477 Ga0495664_0015601 Ga0495664_0015601_1320_2396 356
925 3300046500 Ga0495596_0005025 Ga0495596_0005025_3448_4524 356
926 3300046500 Ga0495596_0039764 Ga0495596_0039764_539_1609 356
927 3300046506 Ga0495583_0003894 Ga0495583_0003894_5179_6249 356
928 3300046507 Ga0495606_0083444 Ga0495606_0083444_510_1580 356
929 3300046507 Ga0495606_0099160 Ga0495606_0099160_582_1652 356
930 3300046511 Ga0495608_0007446 Ga0495608_0007446_5045_6121 356
931 3300046511 Ga0495608_0042458 Ga0495608_0042458_912_1982 356
932 3300046514 Ga0495618_0001663 Ga0495618_0001663_2080_3156 356
933 3300046514 Ga0495618_0011271 Ga0495618_0011271_442_1512 356
934 3300046515 Ga0495620_0036745 Ga0495620_0036745_833_1903 356
935 3300046516 Ga0495628_0027908 Ga0495628_0027908_2370_3440 356
936 3300046516 Ga0495628_0037443 Ga0495628_0037443_2038_3114 356
937 3300046516 Ga0495628_0174155 Ga0495628_0174155_478_1548 356
938 3300046517 Ga0495630_0020532 Ga0495630_0020532_718_1788 356
939 3300046517 Ga0495630_0044761 Ga0495630_0044761_1748_2818 356
940 3300046517 Ga0495630_0235052 Ga0495630_0235052_295_1371 356
941 3300046524 Ga0495648_0044551 Ga0495648_0044551_1491_2561 356
942 3300046524 Ga0495648_0142954 Ga0495648_0142954_107_1177 356
943 3300046526 Ga0495666_0004704 Ga0495666_0004704_3982_5058 356
944 3300046526 Ga0495666_0005594 Ga0495666_0005594_2467_3537 356
945 3300046528 Ga0495642_0006746 Ga0495642_0006746_3183_4253 356
946 3300046529 Ga0495652_0033248 Ga0495652_0033248_2146_3216 356
947 3300046531 Ga0495665_0025686 Ga0495665_0025686_877_1953 356
948 3300046533 Ga0495640_0002933 Ga0495640_0002933_3016_4092 356
949 3300046533 Ga0495640_0005861 Ga0495640_0005861_2136_3206 356
950 3300046533 Ga0495640_0113370 Ga0495640_0113370_302_1372 356
951 3300046535 Ga0495586_0031997 Ga0495586_0031997_1421_2491 356
952 3300046535 Ga0495586_0092520 Ga0495586_0092520_484_1554 356
953 3300046542 Ga0495597_0016569 Ga0495597_0016569_2377_3447 356
954 3300046543 Ga0495645_0122181 Ga0495645_0122181_572_1642 356
955 3300046557 Ga0495622_0004831 Ga0495622_0004831_4642_5718 356
956 3300046559 Ga0495667_0022585 Ga0495667_0022585_1207_2283 356
957 3300046642 Ga0495634_0011188 Ga0495634_0011188_4788_5858 356
958 3300046642 Ga0495634_0022513 Ga0495634_0022513_2588_3664 356
959 3300046660 Ga0495625_0155597 Ga0495625_0155597_252_1322 356
960 3300046663 Ga0495635_0013627 Ga0495635_0013627_1446_2516 356
961 3300046663 Ga0495635_0034889 Ga0495635_0034889_1784_2860 356
962 3300046665 Ga0495661_0005519 Ga0495661_0005519_4749_5825 356
963 3300046678 Ga0495599_0015425 Ga0495599_0015425_1748_2818 356
964 3300046678 Ga0495599_0032828 Ga0495599_0032828_1816_2892 356
965 3300046678 Ga0495599_0048735 Ga0495599_0048735_1566_2636 356
966 3300046678 Ga0495599_0131437 Ga0495599_0131437_212_1282 356
967 3300046679 Ga0495623_0007011 Ga0495623_0007011_4455_5531 356
968 3300046679 Ga0495623_0010956 Ga0495623_0010956_592_1662 356
969 3300046680 Ga0495646_0001320 Ga0495646_0001320_2170_3246 356
970 3300046680 Ga0495646_0021365 Ga0495646_0021365_334_1404 356
971 3300046680 Ga0495646_0023967 Ga0495646_0023967_243_1313 356
972 3300046680 Ga0495646_0034617 Ga0495646_0034617_583_1653 356
973 3300046690 Ga0495624_0009914 Ga0495624_0009914_4931_6001 356
974 3300046690 Ga0495624_0016074 Ga0495624_0016074_1712_2788 356
975 3300046690 Ga0495624_0016284 Ga0495624_0016284_437_1507 356
976 3300046690 Ga0495624_0017769 Ga0495624_0017769_2495_3565 356
977 3300046690 Ga0495624_0121640 Ga0495624_0121640_99_1169 356
978 3300046692 Ga0495671_0038591 Ga0495671_0038591_107_1177 356
979 3300046692 Ga0495671_0076100 Ga0495671_0076100_131_1207 356
980 3300046694 Ga0495649_0001567 Ga0495649_0001567_3373_4443 356
981 3300046694 Ga0495649_0068416 Ga0495649_0068416_431_1501 356
982 3300046794 Ga0495589_0010940 Ga0495589_0010940_3482_4558 356
983 3300046809 Ga0495600_0013215 Ga0495600_0013215_1840_2916 356
984 3300046809 Ga0495600_0032687 Ga0495600_0032687_1483_2553 356
985 3300046810 Ga0495660_0138054 Ga0495660_0138054_12_1082 356
986 3300047315 Ga0495581_0006589 Ga0495581_0006589_5279_6355 356
987 3300047315 Ga0495581_0023067 Ga0495581_0023067_1061_2131 356
988 3300047317 Ga0495604_0036700 Ga0495604_0036700_2275_3345 356
989 3300047317 Ga0495604_0037578 Ga0495604_0037578_602_1672 356
990 3300047319 Ga0495674_0036272 Ga0495674_0036272_60_1136 356
991 3300047319 Ga0495674_0045553 Ga0495674_0045553_1083_2153 356
992 3300047319 Ga0495674_0082240 Ga0495674_0082240_155_1225 356
993 3300047319 Ga0495674_0094523 Ga0495674_0094523_1307_2377 356
994 3300047321 Ga0495676_0046582 Ga0495676_0046582_2035_3111 356
995 3300047321 Ga0495676_0105211 Ga0495676_0105211_503_1573 356
996 3300047322 Ga0495680_0021369 Ga0495680_0021369_2248_3324 356
997 3300047322 Ga0495680_0035715 Ga0495680_0035715_489_1559 356
998 3300047323 Ga0495683_0006607 Ga0495683_0006607_2584_3654 356
999 3300047443 Ga0495687_017752 Ga0495687_017752_149_1219 356
1000 3300047443 Ga0495687_060421 Ga0495687_060421_321_1391 356
1001 3300047444 Ga0495675_0003779 Ga0495675_0003779_1843_2919 356
1002 3300047444 Ga0495675_0024722 Ga0495675_0024722_2303_3373 356
1003 3300047444 Ga0495675_0036826 Ga0495675_0036826_1231_2301 356
1004 3300047444 Ga0495675_0132796 Ga0495675_0132796_338_1408 356
1005 3300047446 Ga0495679_000109 Ga0495679_000109_26841_27911 356
1006 3300047469 Ga0495673_0051646 Ga0495673_0051646_321_1397 356
1007 3300047471 Ga0495684_0110236 Ga0495684_0110236_566_1636 356
1008 3300047471 Ga0495684_0132016 Ga0495684_0132016_479_1549 356
1009 3300047472 Ga0495686_0014261 Ga0495686_0014261_2645_3715 356
1010 3300047673 Ga0495593_0001995 Ga0495593_0001995_8893_9969 356
1011 3300047673 Ga0495593_0004554 Ga0495593_0004554_515_1585 356
1012 3300048088 Ga0495602_0019497 Ga0495602_0019497_5293_6375 356
1013 3300048089 Ga0495614_0006640 Ga0495614_0006640_252_1328 356
1014 3300048091 Ga0495626_0017922 Ga0495626_0017922_392_1462 356
1015 3300048091 Ga0495626_0021549 Ga0495626_0021549_1136_2206 356
1016 3300048091 Ga0495626_0049299 Ga0495626_0049299_276_1346 356
1017 3300048905 Ga0496102_0048343 Ga0496102_0048343_2142_3218 356
1018 3300048906 Ga0496103_0040992 Ga0496103_0040992_1009_2085 356
1019 3300048919 Ga0496116_0066210 Ga0496116_0066210_649_1719 356
1020 3300048920 Ga0496117_0004561 Ga0496117_0004561_2051_3127 356
1021 3300048920 Ga0496117_0017799 Ga0496117_0017799_2175_3245 356
1022 3300048921 Ga0496118_0001983 Ga0496118_0001983_13336_14412 356
1023 3300048921 Ga0496118_0002651 Ga0496118_0002651_3412_4482 356
1024 3300048921 Ga0496118_0022762 Ga0496118_0022762_4121_5191 356
1025 3300048926 Ga0496123_0126072 Ga0496123_0126072_182_1252 356
1026 3300048929 Ga0496126_0003440 Ga0496126_0003440_4142_5212 356
1027 3300049459 Ga0495678_017996 Ga0495678_017996_475_1545 356
1028 3300049460 Ga0495682_0007262 Ga0495682_0007262_2559_3629 356
1029 3300049460 Ga0495682_0060012 Ga0495682_0060012_290_1360 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

57

381

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.9106 16 341
2pnj-assembly1.cif.gz_A crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.9092 14 341
2pnj-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.9062 16 341
3aqi-assembly1.cif.gz_B h240a variant of human ferrochelatase 0.8989 14 341
2po7-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 341 replaced by cys 0.8981 14 341
ID Description Score Start End Superfamily
af_P23871_188_298_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9849 209 317 3.40.50.1400
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9793 18 176 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.977 18 269 3.40.605.10
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.967 18 176 3.40.50.1400
af_Q8ID58_27_285_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9656 18 278 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A6P2EL70-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9922 20 347 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A0G4JB43-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9919 1 348 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A2M7FPN8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9908 42 347 GO:0004325
GO:0005737
GO:0006783
AF-A0A259PFH2-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9894 90 346 GO:0004325
GO:0006783
AF-A0A537GB29-F1-model_v4 Ferrochelatase 0.9876 18 121 GO:0004325
GO:0006783

Feature Viewer

pLDDT pTM Quality
93.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map