F488555

General Info

Members Datasets Scaffolds Average Seq Length
1028 372 1018 267

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0024455|Ga0439435_0024455_390_1271
Length 293
Sequence MAASMHDLRDVSSADRSERPGEAMLEVERLSKTFNPASPNEVRALQGLSLTIAEGSFVVVVGTNGSGKSSLLNAIAGTFRPDDGRIRLNGVDVTRWPEHRRAALIGRVFQNPFSGTAASMSIAENVVLAARRGQSRGLAWAIRKSMREELRTRVRQLNMGLEDRLDNAIGSLSGGQRQALTLLMATWRQPKLLLLDEHTAALDPKSADQVIVLSEQIVSRSQLTTLMVTHSMQQAVHVGDRVVMMHRGHVLHDFRGAEKRRLRVEDLLARFEALRRADRLDESAAEMLRRQYV

Samples

Sample ID Description Type Environment
1 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
2 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
3 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
4 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
5 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
6 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
7 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
8 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
9 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
10 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
244 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
265 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.1
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 5.74
Rhizosphere 89.2
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1000149 3300002155 Bacteria 8986
2 Ga0065715_10002119 3300005293 Bacteria 23084
3 Ga0065715_10030856 3300005293 Bacteria 1367
4 Ga0065707_10001658 3300005295 Bacteria 11490
5 Ga0065707_10118864 3300005295 Bacteria 2131
6 Ga0070658_10089977 3300005327 Bacteria 2528
7 Ga0070683_100002845 3300005329 Bacteria 13852
8 Ga0070683_100004548 3300005329 Bacteria 11446
9 Ga0070683_100054463 3300005329 Bacteria 3709
10 Ga0070683_100123270 3300005329 Bacteria 2449
11 Ga0070690_100033965 3300005330 Bacteria 3195
12 Ga0070690_100241362 3300005330 Bacteria 1274
13 Ga0070690_100320693 3300005330 Bacteria 1116
14 Ga0070670_100000820 3300005331 Bacteria 24241
15 Ga0070670_100003875 3300005331 Bacteria 12479
16 Ga0070670_100010463 3300005331 Bacteria 7916
17 Ga0070670_100069892 3300005331 Bacteria 3014
18 Ga0070670_100090414 3300005331 Bacteria 2631
19 Ga0070670_100254825 3300005331 Bacteria 1529
20 Ga0068869_100012999 3300005334 Bacteria 5523
21 Ga0068869_100255203 3300005334 Bacteria 1402
22 Ga0068869_100287621 3300005334 Bacteria 1323
23 Ga0068869_100378361 3300005334 Bacteria 1160
24 Ga0070680_100033895 3300005336 Bacteria 4118
25 Ga0070680_100419531 3300005336 Bacteria 1141
26 Ga0070682_100000004 3300005337 Bacteria 388780
27 Ga0070682_100194608 3300005337 Bacteria 1426
28 Ga0068868_100078134 3300005338 Bacteria 2649
29 Ga0068868_100091353 3300005338 Bacteria 2453
30 Ga0068868_100106402 3300005338 Bacteria 2275
31 Ga0068868_100124236 3300005338 Bacteria 2107
32 Ga0070660_100047624 3300005339 Bacteria 3290
33 Ga0070689_100001924 3300005340 Bacteria 13432
34 Ga0070689_100013571 3300005340 Bacteria 5900
35 Ga0070689_100057944 3300005340 Unclassified 3008
36 Ga0070689_100249136 3300005340 Bacteria 1465
37 Ga0070689_100342164 3300005340 Bacteria 1253
38 Ga0070689_100493901 3300005340 Bacteria 1047
39 Ga0070691_10011278 3300005341 Bacteria 4078
40 Ga0070687_100049508 3300005343 Bacteria 2166
41 Ga0070661_100000291 3300005344 Bacteria 40590
42 Ga0070661_100002867 3300005344 Bacteria 11845
43 Ga0070661_100004118 3300005344 Bacteria 10026
44 Ga0070661_100024937 3300005344 Bacteria 4293
45 Ga0070661_100073714 3300005344 Bacteria 2513
46 Ga0070692_10431632 3300005345 Bacteria 839
47 Ga0070668_100009618 3300005347 Bacteria 7173
48 Ga0070668_100024023 3300005347 Bacteria 4616
49 Ga0070675_100000001 3300005354 Bacteria 448137
50 Ga0070675_100011820 3300005354 Bacteria 6840
51 Ga0070675_100018439 3300005354 Bacteria 5554
52 Ga0070675_100035820 3300005354 Bacteria 4035
53 Ga0070671_100007890 3300005355 Bacteria 8510
54 Ga0070671_100022410 3300005355 Bacteria 5158
55 Ga0070671_100024298 3300005355 Unclassified 4961
56 Ga0070671_100025797 3300005355 Unclassified 4825
57 Ga0070671_100179197 3300005355 Bacteria 1794
58 Ga0070674_100001535 3300005356 Bacteria 12331
59 Ga0070674_100031586 3300005356 Bacteria 3510
60 Ga0070674_100035635 3300005356 Bacteria 3334
61 Ga0070673_100003439 3300005364 Bacteria 9865
62 Ga0070673_100079913 3300005364 Bacteria 2649
63 Ga0070673_100163274 3300005364 Bacteria 1896
64 Ga0070673_100194377 3300005364 Bacteria 1744
65 Ga0070673_100315350 3300005364 Unclassified 1380
66 Ga0070688_100051863 3300005365 Bacteria 2560
67 Ga0070688_100124157 3300005365 Unclassified 1733
68 Ga0070659_100089356 3300005366 Unclassified 2468
69 Ga0070659_100093537 3300005366 Bacteria 2412
70 Ga0070659_100162214 3300005366 Bacteria 1828
71 Ga0070667_100032389 3300005367 Bacteria 4360
72 Ga0070667_100210066 3300005367 Bacteria 1730
73 Ga0070667_100298785 3300005367 Bacteria 1449
74 Ga0070667_100377910 3300005367 Bacteria 1286
75 Ga0070709_10006794 3300005434 Bacteria 6244
76 Ga0070709_10035864 3300005434 Bacteria 3016
77 Ga0070709_10042037 3300005434 Bacteria 2820
78 Ga0070709_10288995 3300005434 Bacteria 1194
79 Ga0070714_100008442 3300005435 Bacteria 8045
80 Ga0070713_100007824 3300005436 Bacteria 7534
81 Ga0070701_10001225 3300005438 Bacteria 9412
82 Ga0070701_10082508 3300005438 Bacteria 1743
83 Ga0070711_100019931 3300005439 Bacteria 4313
84 Ga0070711_100177033 3300005439 Bacteria 1630
85 Ga0070711_100282450 3300005439 Bacteria 1314
86 Ga0070705_100018362 3300005440 Bacteria 3665
87 Ga0070700_100001362 3300005441 Bacteria 12140
88 Ga0070700_100365152 3300005441 Bacteria 1075
89 Ga0070694_100075624 3300005444 Bacteria 2330
90 Ga0070694_100186069 3300005444 Bacteria 1539
91 Ga0070694_100187170 3300005444 Bacteria 1535
92 Ga0070694_100616851 3300005444 Bacteria 875
93 Ga0070708_100013131 3300005445 Bacteria 6777
94 Ga0070708_100019263 3300005445 Bacteria 5731
95 Ga0070663_100001965 3300005455 Bacteria 11484
96 Ga0070663_100069031 3300005455 Bacteria 2567
97 Ga0070663_100174639 3300005455 Bacteria 1663
98 Ga0070678_100002371 3300005456 Bacteria 10298
99 Ga0070678_100053693 3300005456 Bacteria 2932
100 Ga0070678_100506208 3300005456 Bacteria 1066
101 Ga0070662_100012872 3300005457 Bacteria 5558
102 Ga0070662_100089713 3300005457 Bacteria 2306
103 Ga0070662_100166455 3300005457 Bacteria 1728
104 Ga0070662_100467109 3300005457 Bacteria 1049
105 Ga0070681_10001833 3300005458 Bacteria 19168
106 Ga0070681_10021049 3300005458 Bacteria 6535
107 Ga0070681_10174970 3300005458 Bacteria 2068
108 Ga0068867_100106884 3300005459 Bacteria 2144
109 Ga0068867_100114793 3300005459 Bacteria 2074
110 Ga0068867_100450462 3300005459 Bacteria 1096
111 Ga0070706_100023104 3300005467 Bacteria 5726
112 Ga0070706_100378242 3300005467 Bacteria 1319
113 Ga0070707_100033375 3300005468 Bacteria 4908
114 Ga0070707_100062110 3300005468 Bacteria 3584
115 Ga0070707_100183181 3300005468 Bacteria 2042
116 Ga0070707_100407805 3300005468 Bacteria 1319
117 Ga0070698_100023178 3300005471 Bacteria 6490
118 Ga0070698_100052910 3300005471 Bacteria 4128
119 Ga0070698_100099145 3300005471 Bacteria 2887
120 Ga0070698_100129233 3300005471 Bacteria 2482
121 Ga0070698_100160277 3300005471 Bacteria 2194
122 Ga0070698_100164765 3300005471 Bacteria 2160
123 Ga0070699_100052632 3300005518 Bacteria 3522
124 Ga0070699_100276536 3300005518 Bacteria 1503
125 Ga0070679_100005867 3300005530 Bacteria 11403
126 Ga0070679_100066120 3300005530 Bacteria 3604
127 Ga0070679_100089510 3300005530 Unclassified 3065
128 Ga0070679_100679455 3300005530 Bacteria 972
129 Ga0070684_100000323 3300005535 Bacteria 33038
130 Ga0070684_100007259 3300005535 Bacteria 8614
131 Ga0070684_100018965 3300005535 Bacteria 5681
132 Ga0070684_100040965 3300005535 Bacteria 3991
133 Ga0070684_100049281 3300005535 Bacteria 3655
134 Ga0070697_100027246 3300005536 Bacteria 4570
135 Ga0070697_100207715 3300005536 Bacteria 1666
136 Ga0068853_100043718 3300005539 Bacteria 3832
137 Ga0068853_100290963 3300005539 Bacteria 1508
138 Ga0068853_100494428 3300005539 Bacteria 1154
139 Ga0068853_100603366 3300005539 Archaea 1042
140 Ga0070672_100000404 3300005543 Bacteria 24981
141 Ga0070672_100006663 3300005543 Bacteria 7779
142 Ga0070672_100017030 3300005543 Bacteria 5220
143 Ga0070672_100048222 3300005543 Bacteria 3309
144 Ga0070672_100127658 3300005543 Bacteria 2088
145 Ga0070672_100156897 3300005543 Bacteria 1885
146 Ga0070686_100054708 3300005544 Bacteria 2554
147 Ga0070686_100280339 3300005544 Bacteria 1229
148 Ga0070686_100328628 3300005544 Bacteria 1142
149 Ga0070686_100523939 3300005544 Bacteria 923
150 Ga0070695_100063711 3300005545 Bacteria 2397
151 Ga0070695_100105009 3300005545 Unclassified 1908
152 Ga0070695_100443962 3300005545 Bacteria 993
153 Ga0070696_100031894 3300005546 Bacteria 3613
154 Ga0070696_100105744 3300005546 Unclassified 2022
155 Ga0070665_100026495 3300005548 Bacteria 5837
156 Ga0070665_100055826 3300005548 Bacteria 3960
157 Ga0070665_100060764 3300005548 Bacteria 3788
158 Ga0070665_100075373 3300005548 Bacteria 3380
159 Ga0070665_100416494 3300005548 Bacteria 1352
160 Ga0070665_100444477 3300005548 Bacteria 1306
161 Ga0070704_100107327 3300005549 Bacteria 2118
162 Ga0070704_100190714 3300005549 Unclassified 1647
163 Ga0068855_100083845 3300005563 Bacteria 3692
164 Ga0068855_100448432 3300005563 Bacteria 1408
165 Ga0070664_100001560 3300005564 Bacteria 18306
166 Ga0070664_100002496 3300005564 Bacteria 14830
167 Ga0070664_100007228 3300005564 Bacteria 8958
168 Ga0070664_100016193 3300005564 Bacteria 6110
169 Ga0070664_100053908 3300005564 Bacteria 3410
170 Ga0070664_100072646 3300005564 Bacteria 2951
171 Ga0070664_100249761 3300005564 Bacteria 1594
172 Ga0070664_100279260 3300005564 Bacteria 1506
173 Ga0070664_100363563 3300005564 Bacteria 1318
174 Ga0068857_100017696 3300005577 Bacteria 6250
175 Ga0068857_100056596 3300005577 Bacteria 3480
176 Ga0068857_100259523 3300005577 Bacteria 1594
177 Ga0068857_100393248 3300005577 Bacteria 1289
178 Ga0070702_100020189 3300005615 Bacteria 3486
179 Ga0070702_100195351 3300005615 Bacteria 1335
180 Ga0068852_100027709 3300005616 Bacteria 4622
181 Ga0068852_100366736 3300005616 Unclassified 1410
182 Ga0068852_100565516 3300005616 Bacteria 1138
183 Ga0068859_100000017 3300005617 Bacteria 249478
184 Ga0068859_100028633 3300005617 Bacteria 5586
185 Ga0068859_100034615 3300005617 Bacteria 5068
186 Ga0068859_100056009 3300005617 Bacteria 3967
187 Ga0068859_100061477 3300005617 Bacteria 3784
188 Ga0068859_100115968 3300005617 Bacteria 2743
189 Ga0068859_100144462 3300005617 Bacteria 2454
190 Ga0068859_100156809 3300005617 Bacteria 2354
191 Ga0068859_100216018 3300005617 Bacteria 2005
192 Ga0068859_100401179 3300005617 Unclassified 1467
193 Ga0068859_100698440 3300005617 Bacteria 1105
194 Ga0068864_100000001 3300005618 Bacteria 686767
195 Ga0068864_100004348 3300005618 Bacteria 11627
196 Ga0068864_100008707 3300005618 Bacteria 8370
197 Ga0068864_100010686 3300005618 Bacteria 7587
198 Ga0068864_100032014 3300005618 Bacteria 4465
199 Ga0068864_100058229 3300005618 Bacteria 3339
200 Ga0068864_100114151 3300005618 Unclassified 2408
201 Ga0068864_100116214 3300005618 Bacteria 2387
202 Ga0068866_10086309 3300005718 Unclassified 1698
203 Ga0068866_10166863 3300005718 Bacteria 1289
204 Ga0068866_10214392 3300005718 Bacteria 1158
205 Ga0068866_10368872 3300005718 Bacteria 917
206 Ga0068861_100089126 3300005719 Bacteria 2431
207 Ga0068861_100092805 3300005719 Bacteria 2385
208 Ga0068861_100248715 3300005719 Bacteria 1516
209 Ga0068851_10103581 3300005834 Unclassified 1512
210 Ga0068870_10270863 3300005840 Bacteria 1060
211 Ga0068863_100006299 3300005841 Bacteria 11646
212 Ga0068863_100015396 3300005841 Bacteria 7352
213 Ga0068863_100185337 3300005841 Bacteria 1999
214 Ga0068863_100256243 3300005841 Bacteria 1691
215 Ga0068863_100347529 3300005841 Bacteria 1444
216 Ga0068863_100393507 3300005841 Bacteria 1354
217 Ga0068858_100000072 3300005842 Bacteria 105094
218 Ga0068858_100023674 3300005842 Bacteria 5720
219 Ga0068858_100028403 3300005842 Bacteria 5197
220 Ga0068858_100043612 3300005842 Unclassified 4159
221 Ga0068858_100090268 3300005842 Bacteria 2851
222 Ga0068858_100161888 3300005842 Bacteria 2107
223 Ga0068860_100003719 3300005843 Bacteria 15686
224 Ga0068860_100014916 3300005843 Bacteria 7598
225 Ga0068860_100075183 3300005843 Bacteria 3213
226 Ga0068860_100306182 3300005843 Bacteria 1557
227 Ga0068860_100595079 3300005843 Bacteria 1111
228 Ga0068862_100010877 3300005844 Bacteria 7514
229 Ga0068862_100023180 3300005844 Bacteria 5198
230 Ga0068862_100046468 3300005844 Bacteria 3704
231 Ga0068862_100276902 3300005844 Bacteria 1536
232 Ga0068862_100289062 3300005844 Bacteria 1505
233 Ga0068862_100505777 3300005844 Bacteria 1147
234 Ga0081540_1116864 3300005983 Bacteria 1115
235 Ga0081539_10000071 3300005985 Bacteria 233094
236 Ga0081539_10001123 3300005985 Bacteria 48558
237 Ga0070717_10003798 3300006028 Bacteria 10861
238 Ga0070717_10007368 3300006028 Bacteria 8170
239 Ga0070717_10274949 3300006028 Bacteria 1492
240 Ga0070717_10309652 3300006028 Bacteria 1405
241 Ga0075365_10010341 3300006038 Bacteria 5427
242 Ga0075365_10031532 3300006038 Bacteria 3400
243 Ga0075365_10101634 3300006038 Bacteria 1969
244 Ga0075365_10249058 3300006038 Bacteria 1248
245 Ga0075368_10016277 3300006042 Bacteria 2772
246 Ga0075368_10016609 3300006042 Bacteria 2745
247 Ga0075363_100007068 3300006048 Bacteria 5133
248 Ga0075364_10056798 3300006051 Bacteria 2563
249 Ga0075364_10270264 3300006051 Bacteria 1156
250 Ga0075432_10008373 3300006058 Bacteria 3528
251 Ga0070715_10056923 3300006163 Unclassified 1702
252 Ga0070716_100051834 3300006173 Bacteria 2335
253 Ga0070716_100055634 3300006173 Bacteria 2265
254 Ga0070716_100076310 3300006173 Bacteria 1986
255 Ga0070712_100055300 3300006175 Bacteria 2779
256 Ga0070712_100059425 3300006175 Unclassified 2693
257 Ga0070712_100119722 3300006175 Bacteria 1979
258 Ga0075362_10077281 3300006177 Bacteria 1529
259 Ga0075367_10017651 3300006178 Bacteria 3921
260 Ga0075367_10031906 3300006178 Bacteria 3027
261 Ga0075367_10096849 3300006178 Bacteria 1799
262 Ga0075367_10331316 3300006178 Bacteria 960
263 Ga0075369_10110697 3300006186 Bacteria 1237
264 Ga0075366_10018376 3300006195 Bacteria 4035
265 Ga0075366_10020552 3300006195 Bacteria 3832
266 Ga0097621_100028848 3300006237 Bacteria 4378
267 Ga0097621_100037028 3300006237 Bacteria 3906
268 Ga0097621_100049804 3300006237 Bacteria 3405
269 Ga0097621_100066492 3300006237 Bacteria 2969
270 Ga0097621_100078981 3300006237 Bacteria 2735
271 Ga0097621_100283030 3300006237 Bacteria 1460
272 Ga0097621_100561450 3300006237 Bacteria 1040
273 Ga0075370_10043762 3300006353 Bacteria 2531
274 Ga0068871_100011210 3300006358 Bacteria 6570
275 Ga0068871_100013024 3300006358 Bacteria 6163
276 Ga0068871_100016778 3300006358 Bacteria 5527
277 Ga0068871_100023567 3300006358 Bacteria 4764
278 Ga0068871_100025979 3300006358 Bacteria 4563
279 Ga0068871_100063614 3300006358 Unclassified 3018
280 Ga0068871_100361480 3300006358 Bacteria 1286
281 Ga0075428_100006816 3300006844 Bacteria 12708
282 Ga0075428_100038920 3300006844 Bacteria 5232
283 Ga0075428_100078699 3300006844 Bacteria 3599
284 Ga0075428_100245934 3300006844 Unclassified 1929
285 Ga0075428_100263185 3300006844 Bacteria 1857
286 Ga0075428_100569999 3300006844 Bacteria 1210
287 Ga0075428_100687329 3300006844 Bacteria 1090
288 Ga0075430_100035227 3300006846 Bacteria 4247
289 Ga0075430_100058695 3300006846 Bacteria 3235
290 Ga0075430_100090572 3300006846 Bacteria 2558
291 Ga0075431_100001217 3300006847 Bacteria 23292
292 Ga0075431_100001237 3300006847 Bacteria 23180
293 Ga0075431_100025479 3300006847 Bacteria 6062
294 Ga0075431_100188852 3300006847 Unclassified 2112
295 Ga0075431_100218727 3300006847 Bacteria 1943
296 Ga0075431_100253268 3300006847 Unclassified 1788
297 Ga0075433_10005566 3300006852 Bacteria 9894
298 Ga0075433_10038492 3300006852 Bacteria 4130
299 Ga0075433_10091518 3300006852 Bacteria 2689
300 Ga0075433_10358030 3300006852 Bacteria 1289
301 Ga0075434_100010349 3300006871 Bacteria 8741
302 Ga0075434_100017091 3300006871 Bacteria 6982
303 Ga0075434_100017259 3300006871 Bacteria 6951
304 Ga0075434_100051427 3300006871 Unclassified 4095
305 Ga0075434_100162539 3300006871 Bacteria 2253
306 Ga0075434_100234937 3300006871 Bacteria 1853
307 Ga0075434_100331315 3300006871 Bacteria 1543
308 Ga0075434_100416757 3300006871 Bacteria 1364
309 Ga0075434_100426210 3300006871 Bacteria 1348
310 Ga0075434_100650352 3300006871 Bacteria 1072
311 Ga0075429_100002046 3300006880 Bacteria 16786
312 Ga0075429_100031235 3300006880 Bacteria 4629
313 Ga0075429_100172421 3300006880 Bacteria 1895
314 Ga0075429_100222102 3300006880 Bacteria 1655
315 Ga0075429_100301976 3300006880 Bacteria 1401
316 Ga0068865_100002817 3300006881 Bacteria 10340
317 Ga0068865_100062193 3300006881 Unclassified 2620
318 Ga0068865_100080476 3300006881 Bacteria 2336
319 Ga0068865_100087178 3300006881 Bacteria 2256
320 Ga0068865_100327528 3300006881 Bacteria 1234
321 Ga0075436_100017691 3300006914 Unclassified 4879
322 Ga0075436_100028234 3300006914 Bacteria 3860
323 Ga0075436_100069780 3300006914 Bacteria 2428
324 Ga0097620_100000017 3300006931 Bacteria 249478
325 Ga0097620_100028633 3300006931 Bacteria 5586
326 Ga0097620_100034617 3300006931 Bacteria 5068
327 Ga0097620_100056007 3300006931 Bacteria 3967
328 Ga0097620_100061477 3300006931 Bacteria 3784
329 Ga0097620_100115969 3300006931 Bacteria 2743
330 Ga0097620_100144470 3300006931 Bacteria 2454
331 Ga0097620_100156815 3300006931 Bacteria 2354
332 Ga0097620_100216018 3300006931 Bacteria 2005
333 Ga0097620_100401159 3300006931 Unclassified 1467
334 Ga0097620_100698646 3300006931 Bacteria 1105
335 Ga0075435_100007726 3300007076 Bacteria 7685
336 Ga0075435_100010295 3300007076 Bacteria 6832
337 Ga0075435_100019481 3300007076 Bacteria 5185
338 Ga0075435_100048463 3300007076 Bacteria 3414
339 Ga0075435_100127798 3300007076 Unclassified 2125
340 Ga0105240_10078220 3300009093 Bacteria 4073
341 Ga0105240_10110214 3300009093 Bacteria 3332
342 Ga0111539_10000021 3300009094 Bacteria 246864
343 Ga0111539_10020650 3300009094 Bacteria 8113
344 Ga0111539_10026924 3300009094 Bacteria 7025
345 Ga0111539_10045595 3300009094 Bacteria 5248
346 Ga0111539_10054202 3300009094 Unclassified 4771
347 Ga0111539_10099518 3300009094 Bacteria 3414
348 Ga0111539_10445629 3300009094 Bacteria 1508
349 Ga0105245_10000055 3300009098 Bacteria 124667
350 Ga0105245_10000148 3300009098 Bacteria 66317
351 Ga0105245_10000268 3300009098 Bacteria 49610
352 Ga0105245_10009229 3300009098 Bacteria 8598
353 Ga0105245_10010876 3300009098 Bacteria 7916
354 Ga0105245_10051105 3300009098 Bacteria 3706
355 Ga0105245_10074125 3300009098 Bacteria 3096
356 Ga0105245_10265350 3300009098 Bacteria 1672
357 Ga0105247_10235569 3300009101 Bacteria 1245
358 Ga0114129_10000095 3300009147 Bacteria 85485
359 Ga0114129_10011206 3300009147 Bacteria 12782
360 Ga0114129_10021293 3300009147 Bacteria 9205
361 Ga0114129_10035942 3300009147 Bacteria 6996
362 Ga0114129_10153606 3300009147 Bacteria 3149
363 Ga0114129_10180838 3300009147 Bacteria 2869
364 Ga0114129_10284758 3300009147 Bacteria 2207
365 Ga0114129_10399170 3300009147 Bacteria 1812
366 Ga0114129_10511798 3300009147 Bacteria 1566
367 Ga0105243_10008744 3300009148 Bacteria 7762
368 Ga0105243_10055425 3300009148 Bacteria 3150
369 Ga0105243_10101952 3300009148 Bacteria 2384
370 Ga0105243_10436195 3300009148 Bacteria 1225
371 Ga0105243_10462595 3300009148 Bacteria 1193
372 Ga0105241_10126009 3300009174 Bacteria 2068
373 Ga0105242_10003906 3300009176 Bacteria 11588
374 Ga0105242_10007476 3300009176 Bacteria 8411
375 Ga0105242_10009232 3300009176 Bacteria 7566
376 Ga0105242_10079295 3300009176 Bacteria 2742
377 Ga0105242_10174863 3300009176 Bacteria 1889
378 Ga0105242_10310344 3300009176 Bacteria 1443
379 Ga0105248_10040499 3300009177 Bacteria 5223
380 Ga0105248_10083416 3300009177 Bacteria 3595
381 Ga0105248_10089051 3300009177 Unclassified 3474
382 Ga0105248_10121221 3300009177 Bacteria 2950
383 Ga0105248_10133657 3300009177 Bacteria 2799
384 Ga0105248_10490757 3300009177 Bacteria 1384
385 Ga0105237_10227852 3300009545 Bacteria 1864
386 Ga0105237_10444306 3300009545 Bacteria 1303
387 Ga0105238_10000029 3300009551 Bacteria 182309
388 Ga0105249_10005943 3300009553 Bacteria 10574
389 Ga0105249_10033156 3300009553 Unclassified 4675
390 Ga0105249_10224643 3300009553 Bacteria 1849
391 Ga0105249_10259855 3300009553 Bacteria 1725
392 Ga0105249_10331652 3300009553 Bacteria 1535
393 Ga0105249_10596894 3300009553 Bacteria 1158
394 Ga0105239_10028869 3300010375 Bacteria 6098
395 Ga0105239_10081900 3300010375 Bacteria 3553
396 Ga0105239_10458384 3300010375 Bacteria 1447
397 Ga0105239_10542346 3300010375 Bacteria 1324
398 Ga0105239_10663142 3300010375 Bacteria 1192
399 Ga0105239_10785643 3300010375 Bacteria 1090
400 Ga0105246_10007633 3300011119 Bacteria 6636
401 Ga0105246_10045953 3300011119 Unclassified 2977
402 Ga0157373_10097785 3300013100 Unclassified 2066
403 Ga0157373_10165797 3300013100 Bacteria 1555
404 Ga0157371_10206266 3300013102 Bacteria 1410
405 Ga0157371_10226748 3300013102 Bacteria 1342
406 Ga0157369_10000378 3300013105 Bacteria 58796
407 Ga0157374_10000008 3300013296 Bacteria 588863
408 Ga0157374_10011468 3300013296 Bacteria 7676
409 Ga0157374_10024443 3300013296 Bacteria 5419
410 Ga0157374_10041257 3300013296 Bacteria 4252
411 Ga0157374_10052698 3300013296 Bacteria 3790
412 Ga0157374_10192173 3300013296 Bacteria 1997
413 Ga0157378_10000584 3300013297 Bacteria 34260
414 Ga0157378_10008675 3300013297 Bacteria 8846
415 Ga0157378_10012784 3300013297 Bacteria 7348
416 Ga0157378_10015464 3300013297 Bacteria 6685
417 Ga0157378_10026603 3300013297 Bacteria 5098
418 Ga0157378_10029725 3300013297 Bacteria 4825
419 Ga0157378_10033479 3300013297 Bacteria 4544
420 Ga0157378_10035072 3300013297 Bacteria 4436
421 Ga0157378_10039658 3300013297 Bacteria 4177
422 Ga0157378_10077784 3300013297 Bacteria 2991
423 Ga0157378_10142890 3300013297 Bacteria 2224
424 Ga0163162_10011632 3300013306 Bacteria 8582
425 Ga0163162_10015763 3300013306 Bacteria 7387
426 Ga0163162_10040099 3300013306 Bacteria 4681
427 Ga0163162_10152061 3300013306 Bacteria 2433
428 Ga0163162_10162096 3300013306 Bacteria 2358
429 Ga0163162_10312649 3300013306 Bacteria 1703
430 Ga0163162_10394633 3300013306 Bacteria 1516
431 Ga0157372_10096509 3300013307 Bacteria 3369
432 Ga0157372_10349764 3300013307 Bacteria 1722
433 Ga0157372_10496849 3300013307 Bacteria 1423
434 Ga0157375_10000024 3300013308 Bacteria 231767
435 Ga0157375_10000028 3300013308 Bacteria 218924
436 Ga0157375_10000373 3300013308 Bacteria 40703
437 Ga0157375_10012531 3300013308 Bacteria 7525
438 Ga0157375_10012636 3300013308 Bacteria 7495
439 Ga0157375_10086942 3300013308 Bacteria 3178
440 Ga0157375_10176518 3300013308 Bacteria 2286
441 Ga0157375_10254292 3300013308 Bacteria 1918
442 Ga0157375_10763039 3300013308 Bacteria 1118
443 Ga0163163_10007747 3300014325 Bacteria 9492
444 Ga0163163_10027634 3300014325 Bacteria 5437
445 Ga0163163_10027983 3300014325 Bacteria 5407
446 Ga0163163_10033387 3300014325 Bacteria 4977
447 Ga0163163_10118003 3300014325 Bacteria 2686
448 Ga0163163_10225857 3300014325 Unclassified 1921
449 Ga0163163_10275443 3300014325 Unclassified 1734
450 Ga0157380_10000625 3300014326 Bacteria 21697
451 Ga0157380_10020175 3300014326 Bacteria 4979
452 Ga0157380_10149718 3300014326 Bacteria 2016
453 Ga0157380_10295988 3300014326 Bacteria 1488
454 Ga0157380_10626504 3300014326 Unclassified 1069
455 Ga0157380_10643949 3300014326 Bacteria 1056
456 Ga0157377_10000012 3300014745 Bacteria 274497
457 Ga0157377_10000383 3300014745 Bacteria 19268
458 Ga0157377_10000656 3300014745 Bacteria 14427
459 Ga0157377_10014325 3300014745 Bacteria 4032
460 Ga0157379_10063788 3300014968 Bacteria 3293
461 Ga0157379_10068283 3300014968 Unclassified 3178
462 Ga0157376_10000044 3300014969 Bacteria 110557
463 Ga0157376_10000051 3300014969 Bacteria 102604
464 Ga0157376_10001532 3300014969 Bacteria 15244
465 Ga0157376_10009169 3300014969 Bacteria 7178
466 Ga0157376_10203784 3300014969 Unclassified 1822
467 Ga0157376_10539304 3300014969 Bacteria 1153
468 Ga0163161_10059736 3300017792 Bacteria 2773
469 Ga0163161_10340412 3300017792 Unclassified 1190
470 Ga0213873_10000004 3300021358 Bacteria 774374
471 Ga0213873_10008288 3300021358 Bacteria 2117
472 Ga0213876_10000001 3300021384 Bacteria 1186326
473 Ga0213876_10000067 3300021384 Bacteria 126770
474 Ga0209147_100184 3300025229 Bacteria 74911
475 Ga0209675_1001593 3300025291 Bacteria 12833
476 Ga0207697_10005033 3300025315 Bacteria 6199
477 Ga0207697_10015461 3300025315 Bacteria 3153
478 Ga0207697_10026004 3300025315 Bacteria 2393
479 Ga0207692_10014799 3300025898 Bacteria 3416
480 Ga0207692_10150771 3300025898 Bacteria 1331
481 Ga0207642_10038043 3300025899 Bacteria 2078
482 Ga0207688_10038019 3300025901 Bacteria 2670
483 Ga0207688_10041359 3300025901 Bacteria 2564
484 Ga0207680_10065281 3300025903 Bacteria 2234
485 Ga0207680_10114508 3300025903 Bacteria 1755
486 Ga0207685_10133402 3300025905 Bacteria 1105
487 Ga0207699_10007617 3300025906 Bacteria 5302
488 Ga0207699_10038557 3300025906 Bacteria 2740
489 Ga0207699_10305736 3300025906 Bacteria 1111
490 Ga0207645_10001146 3300025907 Bacteria 21888
491 Ga0207645_10014401 3300025907 Bacteria 5290
492 Ga0207645_10185662 3300025907 Bacteria 1365
493 Ga0207643_10053926 3300025908 Bacteria 2285
494 Ga0207705_10053368 3300025909 Bacteria 2912
495 Ga0207705_10364294 3300025909 Bacteria 1115
496 Ga0207684_10018155 3300025910 Bacteria 6028
497 Ga0207684_10360307 3300025910 Bacteria 1251
498 Ga0207707_10002076 3300025912 Bacteria 18130
499 Ga0207707_10047515 3300025912 Unclassified 3737
500 Ga0207707_10437300 3300025912 Bacteria 1120
501 Ga0207695_10079052 3300025913 Bacteria 3335
502 Ga0207695_10401416 3300025913 Bacteria 1255
503 Ga0207693_10044620 3300025915 Bacteria 3484
504 Ga0207693_10051785 3300025915 Unclassified 3220
505 Ga0207693_10121085 3300025915 Bacteria 2055
506 Ga0207663_10034247 3300025916 Bacteria 3035
507 Ga0207663_10152343 3300025916 Bacteria 1623
508 Ga0207663_10326981 3300025916 Bacteria 1154
509 Ga0207662_10011697 3300025918 Bacteria 4875
510 Ga0207662_10095290 3300025918 Bacteria 1837
511 Ga0207662_10340627 3300025918 Bacteria 1005
512 Ga0207657_10017689 3300025919 Bacteria 6828
513 Ga0207657_10094132 3300025919 Unclassified 2495
514 Ga0207649_10000125 3300025920 Bacteria 64941
515 Ga0207649_10000368 3300025920 Bacteria 33617
516 Ga0207649_10002457 3300025920 Bacteria 10372
517 Ga0207652_10055127 3300025921 Bacteria 3418
518 Ga0207652_10319674 3300025921 Bacteria 1401
519 Ga0207652_10595904 3300025921 Bacteria 991
520 Ga0207646_10034770 3300025922 Bacteria 4555
521 Ga0207646_10040676 3300025922 Unclassified 4180
522 Ga0207646_10086805 3300025922 Bacteria 2800
523 Ga0207681_10345012 3300025923 Bacteria 1190
524 Ga0207681_10505478 3300025923 Bacteria 990
525 Ga0207694_10000002 3300025924 Bacteria 1165763
526 Ga0207694_10000003 3300025924 Bacteria 1165533
527 Ga0207650_10000042 3300025925 Bacteria 191592
528 Ga0207650_10000096 3300025925 Bacteria 115850
529 Ga0207650_10006717 3300025925 Bacteria 7844
530 Ga0207650_10021093 3300025925 Bacteria 4604
531 Ga0207650_10047313 3300025925 Bacteria 3169
532 Ga0207650_10101155 3300025925 Bacteria 2218
533 Ga0207650_10162572 3300025925 Bacteria 1770
534 Ga0207650_10180669 3300025925 Bacteria 1681
535 Ga0207650_10301272 3300025925 Bacteria 1309
536 Ga0207650_10323563 3300025925 Bacteria 1263
537 Ga0207650_10428142 3300025925 Bacteria 1099
538 Ga0207659_10000004 3300025926 Bacteria 476977
539 Ga0207659_10051333 3300025926 Bacteria 2932
540 Ga0207659_10106308 3300025926 Bacteria 2125
541 Ga0207659_10193331 3300025926 Bacteria 1620
542 Ga0207659_10269945 3300025926 Bacteria 1387
543 Ga0207659_10416496 3300025926 Bacteria 1126
544 Ga0207687_10000035 3300025927 Bacteria 124800
545 Ga0207687_10000168 3300025927 Bacteria 43449
546 Ga0207687_10000464 3300025927 Bacteria 27657
547 Ga0207687_10006656 3300025927 Bacteria 7622
548 Ga0207687_10016240 3300025927 Bacteria 4889
549 Ga0207687_10113901 3300025927 Bacteria 2012
550 Ga0207700_10005786 3300025928 Bacteria 7429
551 Ga0207700_10243953 3300025928 Bacteria 1532
552 Ga0207664_10001776 3300025929 Bacteria 14203
553 Ga0207664_10217767 3300025929 Bacteria 1654
554 Ga0207644_10015351 3300025931 Bacteria 5139
555 Ga0207644_10015403 3300025931 Bacteria 5131
556 Ga0207644_10049069 3300025931 Bacteria 3020
557 Ga0207644_10118265 3300025931 Bacteria 2014
558 Ga0207690_10117646 3300025932 Unclassified 1925
559 Ga0207690_10214505 3300025932 Bacteria 1469
560 Ga0207706_10001272 3300025933 Bacteria 25443
561 Ga0207706_10011170 3300025933 Bacteria 8187
562 Ga0207706_10148125 3300025933 Bacteria 2065
563 Ga0207706_10397579 3300025933 Bacteria 1195
564 Ga0207706_10600576 3300025933 Unclassified 945
565 Ga0207686_10003869 3300025934 Bacteria 8031
566 Ga0207686_10018790 3300025934 Bacteria 3918
567 Ga0207686_10059590 3300025934 Bacteria 2412
568 Ga0207686_10236074 3300025934 Bacteria 1328
569 Ga0207709_10129734 3300025935 Bacteria 1716
570 Ga0207709_10415055 3300025935 Bacteria 1032
571 Ga0207670_10006036 3300025936 Bacteria 6695
572 Ga0207670_10043755 3300025936 Unclassified 2960
573 Ga0207670_10045863 3300025936 Bacteria 2900
574 Ga0207670_10116275 3300025936 Bacteria 1936
575 Ga0207669_10116102 3300025937 Bacteria 1806
576 Ga0207669_10137517 3300025937 Bacteria 1690
577 Ga0207669_10242330 3300025937 Bacteria 1337
578 Ga0207704_10004800 3300025938 Bacteria 6204
579 Ga0207704_10169097 3300025938 Bacteria 1565
580 Ga0207704_10199952 3300025938 Bacteria 1461
581 Ga0207704_10210470 3300025938 Bacteria 1431
582 Ga0207704_10267320 3300025938 Bacteria 1293
583 Ga0207665_10012109 3300025939 Bacteria 5661
584 Ga0207665_10014317 3300025939 Bacteria 5222
585 Ga0207665_10164650 3300025939 Bacteria 1597
586 Ga0207691_10002082 3300025940 Bacteria 19531
587 Ga0207691_10003224 3300025940 Bacteria 15914
588 Ga0207691_10005085 3300025940 Bacteria 12695
589 Ga0207691_10016359 3300025940 Bacteria 7041
590 Ga0207711_10020961 3300025941 Bacteria 5457
591 Ga0207711_10105223 3300025941 Bacteria 2502
592 Ga0207689_10016216 3300025942 Bacteria 6310
593 Ga0207689_10016882 3300025942 Bacteria 6177
594 Ga0207689_10028224 3300025942 Bacteria 4695
595 Ga0207689_10199489 3300025942 Bacteria 1651
596 Ga0207689_10202642 3300025942 Bacteria 1638
597 Ga0207689_10295027 3300025942 Bacteria 1343
598 Ga0207689_10423705 3300025942 Bacteria 1111
599 Ga0207661_10000672 3300025944 Bacteria 22163
600 Ga0207661_10001945 3300025944 Bacteria 14196
601 Ga0207661_10010066 3300025944 Bacteria 6796
602 Ga0207661_10023960 3300025944 Bacteria 4618
603 Ga0207661_10120271 3300025944 Bacteria 2235
604 Ga0207661_10199654 3300025944 Bacteria 1758
605 Ga0207679_10000989 3300025945 Bacteria 18241
606 Ga0207679_10003506 3300025945 Bacteria 9706
607 Ga0207679_10011505 3300025945 Bacteria 5735
608 Ga0207679_10058119 3300025945 Bacteria 2864
609 Ga0207679_10063361 3300025945 Bacteria 2759
610 Ga0207679_10070066 3300025945 Bacteria 2641
611 Ga0207679_10086587 3300025945 Bacteria 2410
612 Ga0207679_10132425 3300025945 Unclassified 2002
613 Ga0207679_10133214 3300025945 Bacteria 1997
614 Ga0207667_10419648 3300025949 Bacteria 1361
615 Ga0207651_10126776 3300025960 Bacteria 1946
616 Ga0207712_10182895 3300025961 Bacteria 1648
617 Ga0207712_10198495 3300025961 Bacteria 1589
618 Ga0207668_10092308 3300025972 Bacteria 2228
619 Ga0207668_10271298 3300025972 Bacteria 1387
620 Ga0207640_10014894 3300025981 Bacteria 4487
621 Ga0207640_10537571 3300025981 Bacteria 980
622 Ga0207658_10121517 3300025986 Bacteria 2083
623 Ga0207658_10216305 3300025986 Bacteria 1609
624 Ga0207658_10257740 3300025986 Unclassified 1485
625 Ga0207658_10300341 3300025986 Bacteria 1383
626 Ga0207658_10327839 3300025986 Unclassified 1327
627 Ga0207658_10683426 3300025986 Bacteria 927
628 Ga0207677_10001337 3300026023 Bacteria 13215
629 Ga0207677_10132619 3300026023 Bacteria 1894
630 Ga0207677_10180448 3300026023 Bacteria 1660
631 Ga0207677_10308309 3300026023 Bacteria 1310
632 Ga0207677_10318353 3300026023 Bacteria 1292
633 Ga0207703_10000016 3300026035 Bacteria 285487
634 Ga0207703_10004941 3300026035 Bacteria 10824
635 Ga0207703_10068898 3300026035 Bacteria 2916
636 Ga0207703_10101548 3300026035 Bacteria 2439
637 Ga0207703_10126475 3300026035 Unclassified 2201
638 Ga0207703_10158903 3300026035 Bacteria 1978
639 Ga0207703_10159156 3300026035 Bacteria 1976
640 Ga0207639_10000042 3300026041 Bacteria 141299
641 Ga0207639_10116652 3300026041 Archaea 2186
642 Ga0207639_10125944 3300026041 Bacteria 2113
643 Ga0207639_10251758 3300026041 Unclassified 1541
644 Ga0207639_10690230 3300026041 Bacteria 947
645 Ga0207678_10009373 3300026067 Bacteria 8616
646 Ga0207678_10021390 3300026067 Bacteria 5672
647 Ga0207678_10110233 3300026067 Bacteria 2348
648 Ga0207708_10003095 3300026075 Bacteria 12245
649 Ga0207708_10373485 3300026075 Bacteria 1174
650 Ga0207702_10041525 3300026078 Bacteria 3857
651 Ga0207641_10001156 3300026088 Bacteria 26503
652 Ga0207641_10055117 3300026088 Bacteria 3376
653 Ga0207641_10133252 3300026088 Bacteria 2234
654 Ga0207641_10245408 3300026088 Bacteria 1670
655 Ga0207641_10261002 3300026088 Bacteria 1622
656 Ga0207641_10287080 3300026088 Unclassified 1550
657 Ga0207641_10450068 3300026088 Bacteria 1244
658 Ga0207641_10648626 3300026088 Bacteria 1037
659 Ga0207648_10001445 3300026089 Bacteria 26161
660 Ga0207648_10179390 3300026089 Bacteria 1874
661 Ga0207648_10182747 3300026089 Bacteria 1856
662 Ga0207676_10000002 3300026095 Bacteria 1198607
663 Ga0207676_10001312 3300026095 Bacteria 18514
664 Ga0207676_10011182 3300026095 Bacteria 6408
665 Ga0207676_10040858 3300026095 Bacteria 3557
666 Ga0207676_10041537 3300026095 Bacteria 3531
667 Ga0207676_10061723 3300026095 Unclassified 2969
668 Ga0207676_10103721 3300026095 Bacteria 2364
669 Ga0207676_10132830 3300026095 Bacteria 2119
670 Ga0207676_10189353 3300026095 Bacteria 1809
671 Ga0207676_10288890 3300026095 Bacteria 1492
672 Ga0207676_10662430 3300026095 Bacteria 1008
673 Ga0207674_10000819 3300026116 Bacteria 40453
674 Ga0207674_10022320 3300026116 Bacteria 6796
675 Ga0207674_10319374 3300026116 Bacteria 1502
676 Ga0207674_10323509 3300026116 Bacteria 1491
677 Ga0207675_100002475 3300026118 Bacteria 18287
678 Ga0207675_100048240 3300026118 Bacteria 3976
679 Ga0207683_10003266 3300026121 Bacteria 14141
680 Ga0207683_10029038 3300026121 Bacteria 4787
681 Ga0207683_10035313 3300026121 Bacteria 4347
682 Ga0207683_10108516 3300026121 Bacteria 2484
683 Ga0207683_10172876 3300026121 Bacteria 1957
684 Ga0209967_1000723 3300027364 Bacteria 4248
685 Ga0209981_1000419 3300027378 Bacteria 5414
686 Ga0209996_1000408 3300027395 Bacteria 5224
687 Ga0209984_1000281 3300027424 Bacteria 5794
688 Ga0210000_1000240 3300027462 Bacteria 7813
689 Ga0209995_1000559 3300027471 Bacteria 5661
690 Ga0209968_1001231 3300027526 Bacteria 3910
691 Ga0209982_1001014 3300027552 Bacteria 3728
692 Ga0209970_1002927 3300027614 Bacteria 2879
693 Ga0210002_1000456 3300027617 Bacteria 5540
694 Ga0209983_1000664 3300027665 Bacteria 7355
695 Ga0209971_1001145 3300027682 Bacteria 6692
696 Ga0209966_1000697 3300027695 Bacteria 7277
697 Ga0209966_1008228 3300027695 Unclassified 1848
698 Ga0209998_10000329 3300027717 Bacteria 14121
699 Ga0209998_10003233 3300027717 Unclassified 3596
700 Ga0209813_10007652 3300027866 Bacteria 2699
701 Ga0209974_10006156 3300027876 Bacteria 4204
702 Ga0207428_10000014 3300027907 Bacteria 345246
703 Ga0207428_10009277 3300027907 Bacteria 8831
704 Ga0207428_10011414 3300027907 Bacteria 7852
705 Ga0207428_10022302 3300027907 Bacteria 5346
706 Ga0207428_10247048 3300027907 Bacteria 1332
707 Ga0207428_10380340 3300027907 Bacteria 1036
708 Ga0268266_10000153 3300028379 Bacteria 131887
709 Ga0268266_10006720 3300028379 Bacteria 10487
710 Ga0268266_10047773 3300028379 Bacteria 3668
711 Ga0268266_10268721 3300028379 Bacteria 1582
712 Ga0268265_10006690 3300028380 Bacteria 7803
713 Ga0268265_10026702 3300028380 Bacteria 4110
714 Ga0268265_10036360 3300028380 Bacteria 3607
715 Ga0268265_10225836 3300028380 Bacteria 1642
716 Ga0268265_10293460 3300028380 Bacteria 1461
717 Ga0268265_10673348 3300028380 Bacteria 997
718 Ga0268265_10824549 3300028380 Bacteria 906
719 Ga0268264_10011082 3300028381 Bacteria 7446
720 Ga0268264_10082755 3300028381 Unclassified 2747
721 Ga0268264_10123289 3300028381 Bacteria 2287
722 Ga0268264_10420158 3300028381 Bacteria 1289
723 Ga0268264_10600621 3300028381 Bacteria 1084
724 Ga0268264_10862023 3300028381 Unclassified 907
725 Ga0307511_10006985 3300030521 Bacteria 11369
726 Ga0265760_10048931 3300031090 Bacteria 1270
727 Ga0265330_10003447 3300031235 Bacteria 8262
728 Ga0265332_10000139 3300031238 Bacteria 59640
729 Ga0265328_10003149 3300031239 Bacteria 7342
730 Ga0265325_10082013 3300031241 Bacteria 1601
731 Ga0265339_10089361 3300031249 Bacteria 1617
732 Ga0265331_10000224 3300031250 Bacteria 68220
733 Ga0265327_10069309 3300031251 Bacteria 1771
734 Ga0265316_10000266 3300031344 Bacteria 59349
735 Ga0265316_10190630 3300031344 Bacteria 1523
736 Ga0265316_10358239 3300031344 Bacteria 1055
737 Ga0307408_100233379 3300031548 Bacteria 1508
738 Ga0307408_100339603 3300031548 Bacteria 1271
739 Ga0265314_10000743 3300031711 Bacteria 39113
740 Ga0265314_10145657 3300031711 Bacteria 1459
741 Ga0265342_10010095 3300031712 Bacteria 6583
742 Ga0316576_10099416 3300031727 Bacteria 2173
743 Ga0307405_10137826 3300031731 Bacteria 1696
744 Ga0307405_10329179 3300031731 Bacteria 1170
745 Ga0307413_10044453 3300031824 Bacteria 2625
746 Ga0307410_10000637 3300031852 Bacteria 14487
747 Ga0307406_10050853 3300031901 Bacteria 2629
748 Ga0307407_10012848 3300031903 Bacteria 4043
749 Ga0307412_10005347 3300031911 Bacteria 7206
750 Ga0307409_100015869 3300031995 Bacteria 4962
751 Ga0307409_100190285 3300031995 Bacteria 1826
752 Ga0307409_100506949 3300031995 Bacteria 1176
753 Ga0307416_100002857 3300032002 Bacteria 10050
754 Ga0307414_10131553 3300032004 Bacteria 1943
755 Ga0307411_10058820 3300032005 Bacteria 2545
756 Ga0307415_100011025 3300032126 Bacteria 5149
757 Ga0307415_100024113 3300032126 Bacteria 3792
758 Ga0316583_10117819 3300032133 Bacteria 926
759 Ga0373930_0016333 3300034816 Bacteria 1403
760 Ga0373928_0019135 3300035084 Bacteria 1426
761 Ga0373940_0015791 3300035088 Bacteria 1862
762 Ga0373954_0136394 3300035118 Bacteria 1196
763 Ga0373960_0005070 3300035121 Bacteria 3035
764 Ga0373960_0067418 3300035121 Bacteria 1099
765 Ga0373946_0108141 3300035171 Unclassified 1255
766 Ga0373955_0173250 3300035172 Bacteria 1278
767 Ga0316574_0061256 3300035398 Bacteria 2363
768 Ga0316574_0062635 3300035398 Bacteria 2338
769 Ga0373931_0007641 3300035691 Bacteria 5098
770 Ga0373931_0024310 3300035691 Bacteria 3068
771 Ga0373931_0071776 3300035691 Bacteria 1892
772 Ga0373931_0226850 3300035691 Bacteria 1127
773 Ga0373931_0274999 3300035691 Bacteria 1032
774 Ga0373947_0097197 3300035725 Unclassified 1845
775 Ga0395898_0000051 3300037466 Bacteria 281872
776 Ga0395905_0590589 3300037471 Bacteria 1012
777 Ga0242420_000212 3300038996 Bacteria 6214
778 Ga0436365_0703007 3300039437 Bacteria 34772
779 Ga0436365_0962899 3300039437 Bacteria 122258
780 Ga0436363_0797270 3300039450 Bacteria 1951
781 Ga0436363_1660411 3300039450 Bacteria 1400
782 Ga0436362_0093143 3300039453 Bacteria 1073
783 Ga0436362_0290430 3300039453 Bacteria 772596
784 Ga0436362_1080070 3300039453 Bacteria 17855
785 Ga0439465_0017433 3300041413 Bacteria 2242
786 Ga0451839_1391315 3300041496 Bacteria 1615
787 Ga0450908_017695 3300042184 Bacteria 1264
788 Ga0439435_0024455 3300042436 Bacteria 1594
789 Ga0439464_0003061 3300042439 Bacteria 4181
790 Ga0439464_0013195 3300042439 Bacteria 2209
791 Ga0439464_0035168 3300042439 Bacteria 1414
792 Ga0439460_0010392 3300042461 Bacteria 2380
793 Ga0439460_0082584 3300042461 Bacteria 1011
794 Ga0451577_0117378 3300042876 Bacteria 2383
795 Ga0453683_0093706 3300044673 Bacteria 1884
796 Ga0466965_0191429 3300044683 Bacteria 1082
797 Ga0466963_0126674 3300044694 Bacteria 1761
798 Ga0466964_0166114 3300044706 Bacteria 1035
799 Ga0453684_0012582 3300044712 Bacteria 13925
800 Ga0453684_0013830 3300044712 Bacteria 13033
801 Ga0453684_0071548 3300044712 Bacteria 4384
802 Ga0453684_0700050 3300044712 Bacteria 1101
803 Ga0466971_0000027 3300044719 Bacteria 60553
804 Ga0466957_0002787 3300044842 Bacteria 9450
805 Ga0466957_0007651 3300044842 Bacteria 6110
806 Ga0451576_0029097 3300045051 Bacteria 5913
807 Ga0451576_0032985 3300045051 Bacteria 5506
808 Ga0451576_0195712 3300045051 Bacteria 2111
809 Ga0451576_0259957 3300045051 Bacteria 1814
810 Ga0451576_0292860 3300045051 Bacteria 1702
811 Ga0451576_0562763 3300045051 Bacteria 1198
812 Ga0451576_0813242 3300045051 Bacteria 981
813 Ga0466967_0043333 3300045976 Bacteria 3896
814 Ga0495592_0470141 3300046454 Bacteria 785
815 Ga0495629_0265996 3300046459 Bacteria 1178
816 Ga0495638_0010324 3300046460 Bacteria 6494
817 Ga0495651_0036005 3300046462 Bacteria 3852
818 Ga0495653_0120513 3300046463 Bacteria 1871
819 Ga0495580_0000846 3300046472 Bacteria 26530
820 Ga0495580_0142249 3300046472 Bacteria 1663
821 Ga0495582_0000930 3300046473 Bacteria 16319
822 Ga0495582_0251875 3300046473 Bacteria 1013
823 Ga0495662_0002226 3300046476 Bacteria 9789
824 Ga0495662_0218607 3300046476 Bacteria 939
825 Ga0495664_0053849 3300046477 Bacteria 2392
826 Ga0495594_0079089 3300046499 Bacteria 1835
827 Ga0495608_0233315 3300046511 Bacteria 1151
828 Ga0495618_0043471 3300046514 Bacteria 2835
829 Ga0495628_0008311 3300046516 Bacteria 8917
830 Ga0495630_0032627 3300046517 Bacteria 3882
831 Ga0495630_0041419 3300046517 Bacteria 3439
832 Ga0495666_0118955 3300046526 Bacteria 1238
833 Ga0495652_0121564 3300046529 Bacteria 2081
834 Ga0495586_0028557 3300046535 Bacteria 2985
835 Ga0495621_0067349 3300046539 Bacteria 1312
836 Ga0495645_0001895 3300046543 Bacteria 14223
837 Ga0495633_0202564 3300046558 Bacteria 911
838 Ga0495667_0023218 3300046559 Bacteria 4179
839 Ga0495634_0142707 3300046642 Bacteria 1519
840 Ga0495599_0086881 3300046678 Bacteria 1953
841 Ga0495623_0035368 3300046679 Bacteria 3202
842 Ga0495658_0270237 3300046683 Bacteria 1071
843 Ga0495669_0114628 3300046684 Unclassified 1261
844 Ga0495604_0300875 3300047317 Bacteria 1077
845 Ga0495674_0104304 3300047319 Unclassified 2410
846 Ga0495680_0015803 3300047322 Bacteria 6498
847 Ga0495675_0071358 3300047444 Bacteria 2192
848 Ga0495593_0216594 3300047673 Bacteria 961
849 Ga0495602_0040722 3300048088 Bacteria 4255
850 Ga0496101_0011136 3300048904 Bacteria 5960
851 Ga0496101_0023085 3300048904 Bacteria 4292
852 Ga0496102_0018879 3300048905 Bacteria 6066
853 Ga0496102_0039382 3300048905 Bacteria 4271
854 Ga0496102_0077079 3300048905 Bacteria 3068
855 Ga0496102_0150216 3300048905 Bacteria 2189
856 Ga0496102_0151165 3300048905 Bacteria 2182
857 Ga0496102_0236967 3300048905 Bacteria 1721
858 Ga0496102_0375297 3300048905 Bacteria 1338
859 Ga0496103_0028010 3300048906 Bacteria 3418
860 Ga0496103_0163800 3300048906 Bacteria 1427
861 Ga0496104_0004299 3300048907 Bacteria 12382
862 Ga0496104_0018651 3300048907 Bacteria 6333
863 Ga0496104_0157238 3300048907 Bacteria 2181
864 Ga0496104_0220399 3300048907 Bacteria 1809
865 Ga0496104_0386337 3300048907 Unclassified 1312
866 Ga0496104_0638750 3300048907 Bacteria 973
867 Ga0496105_0016946 3300048908 Bacteria 5830
868 Ga0496105_0476175 3300048908 Bacteria 983
869 Ga0496106_0066522 3300048909 Unclassified 2745
870 Ga0496106_0232266 3300048909 Unclassified 1473
871 Ga0496106_0256197 3300048909 Bacteria 1400
872 Ga0496107_0192850 3300048910 Bacteria 1514
873 Ga0496108_0001670 3300048911 Bacteria 17610
874 Ga0496108_0006367 3300048911 Bacteria 9569
875 Ga0496108_0011573 3300048911 Bacteria 7174
876 Ga0496108_0043711 3300048911 Bacteria 3742
877 Ga0496108_0123640 3300048911 Bacteria 2220
878 Ga0496109_0000059 3300048912 Bacteria 118169
879 Ga0496109_0037614 3300048912 Bacteria 4372
880 Ga0496109_0044575 3300048912 Bacteria 4024
881 Ga0496109_0062367 3300048912 Bacteria 3408
882 Ga0496109_0100183 3300048912 Bacteria 2688
883 Ga0496109_0100546 3300048912 Bacteria 2683
884 Ga0496110_0048813 3300048913 Unclassified 3711
885 Ga0496110_0067434 3300048913 Bacteria 3166
886 Ga0496110_0256083 3300048913 Bacteria 1593
887 Ga0496110_0406198 3300048913 Bacteria 1242
888 Ga0496111_0028871 3300048914 Unclassified 3934
889 Ga0496111_0053860 3300048914 Bacteria 2907
890 Ga0496111_0161122 3300048914 Bacteria 1666
891 Ga0496111_0254356 3300048914 Bacteria 1303
892 Ga0496112_0000504 3300048915 Bacteria 26451
893 Ga0496112_0000524 3300048915 Bacteria 26174
894 Ga0496112_0002385 3300048915 Bacteria 15116
895 Ga0496112_0014024 3300048915 Bacteria 7417
896 Ga0496112_0577263 3300048915 Bacteria 1057
897 Ga0496113_0001118 3300048916 Bacteria 14549
898 Ga0496113_0003691 3300048916 Bacteria 9223
899 Ga0496113_0080682 3300048916 Bacteria 2492
900 Ga0496113_0083239 3300048916 Bacteria 2455
901 Ga0496113_0122054 3300048916 Bacteria 2038
902 Ga0496113_0342268 3300048916 Bacteria 1199
903 Ga0496114_0002356 3300048917 Bacteria 14384
904 Ga0496114_0054600 3300048917 Bacteria 3332
905 Ga0496115_0002416 3300048918 Bacteria 13408
906 Ga0496115_0133026 3300048918 Bacteria 2050
907 Ga0496126_0407811 3300048929 Bacteria 1101
908 Ga0501031_0001872 3300049568 Bacteria 13235
909 Ga0501032_0000027 3300049569 Bacteria 136304
910 Ga0501032_0125309 3300049569 Bacteria 1697
911 Ga0501033_0000002 3300049570 Bacteria 668574
912 Ga0501033_0000008 3300049570 Bacteria 274368
913 Ga0501036_0007735 3300049572 Bacteria 8783
914 Ga0501037_0000002 3300049573 Bacteria 292291
915 Ga0501037_0154617 3300049573 Bacteria 1638
916 Ga0501038_0000801 3300049574 Bacteria 27926
917 Ga0501039_0044587 3300049575 Bacteria 3426
918 Ga0501039_0070008 3300049575 Bacteria 2725
919 Ga0501039_0471435 3300049575 Bacteria 986
920 Ga0501040_0007525 3300049576 Bacteria 7042
921 Ga0501041_0025890 3300049577 Bacteria 3528
922 Ga0501042_0021910 3300049578 Bacteria 4460
923 Ga0501043_0003304 3300049579 Bacteria 13283
924 Ga0501043_0012458 3300049579 Bacteria 6652
925 Ga0501048_0039099 3300049582 Bacteria 3404
926 Ga0501070_0000465 3300049586 Bacteria 36826
927 Ga0501071_0054505 3300049587 Bacteria 2885
928 Ga0501072_0004986 3300049588 Bacteria 10100
929 Ga0501075_0055592 3300049591 Bacteria 2978
930 Ga0501077_0172901 3300049593 Bacteria 1372
931 Ga0501079_0042388 3300049741 Bacteria 3515
932 Ga0501080_0394408 3300049742 Bacteria 1246
933 Ga0501081_0107736 3300049743 Bacteria 1976
934 Ga0501081_0156377 3300049743 Bacteria 1641
935 Ga0501035_0000007 3300049822 Bacteria 359281
936 Ga0501035_0051602 3300049822 Bacteria 3682
937 Ga0501044_0001568 3300049823 Bacteria 26747
938 Ga0501044_0221690 3300049823 Bacteria 1842
939 Ga0501045_0018375 3300049824 Bacteria 4973
940 Ga0501045_0208192 3300049824 Bacteria 1457
941 nmdc:mga03683_91956_c1 3300050489 Bacteria 1324
942 nmdc:mga00v17_104421_c1 3300050491 Bacteria 1792
943 nmdc:mga00v17_167751_c1 3300050491 Bacteria 1415
944 nmdc:mga00v17_19417_c1 3300050491 Bacteria 3880
945 nmdc:mga0yw44_9395_c1 3300050492 Bacteria 4941
946 nmdc:mga0k408_4424_c1 3300050493 Bacteria 7455
947 nmdc:mga06z11_27460_c1 3300050494 Bacteria 2721
948 nmdc:mga06z11_61189_c1 3300050494 Bacteria 1963
949 nmdc:mga04h51_28042_c1 3300050495 Bacteria 1754
950 nmdc:mga07m45_148768_c1 3300050496 Bacteria 1357
951 nmdc:mga07m45_5600_c1 3300050496 Bacteria 6272
952 nmdc:mga05p37_188212_c1 3300050507 Bacteria 2508
953 nmdc:mga05p37_27870_c1 3300050507 Bacteria 6881
954 nmdc:mga05p37_31532_c1 3300050507 Bacteria 6474
955 nmdc:mga05p37_437715_c1 3300050507 Bacteria 1517
956 nmdc:mga05p37_5248_c1 3300050507 Bacteria 15212
957 nmdc:mga05p37_645163_c1 3300050507 Bacteria 1187
958 nmdc:mga05p37_7929_c1 3300050507 Bacteria 12534
959 nmdc:mga05p37_82009_c1 3300050507 Bacteria 3973
960 nmdc:mga05p37_824274_c1 3300050507 Bacteria 1011
961 nmdc:mga05p37_984_c1 3300050507 Bacteria 32420
962 nmdc:mga09592_18276_c1 3300050508 Bacteria 5748
963 nmdc:mga09592_857_c1 3300050508 Bacteria 23716
964 nmdc:mga09592_89964_c1 3300050508 Bacteria 2622
965 nmdc:mga09592_94837_c1 3300050508 Bacteria 2552
966 nmdc:mga0qj67_19750_c1 3300050509 Bacteria 5152
967 nmdc:mga0qj67_91286_c1 3300050509 Bacteria 2448
968 nmdc:mga06r32_13422_c1 3300050510 Bacteria 6372
969 nmdc:mga06r32_253175_c1 3300050510 Unclassified 1749
970 nmdc:mga06r32_3603_c1 3300050510 Bacteria 13819
971 nmdc:mga06r32_553_c1 3300050510 Bacteria 32512
972 nmdc:mga08y16_123850_c1 3300050511 Unclassified 2690
973 nmdc:mga08y16_139391_c1 3300050511 Bacteria 2521
974 nmdc:mga08y16_1473_c2 3300050511 Bacteria 20895
975 nmdc:mga08y16_148389_c1 3300050511 Bacteria 2437
976 nmdc:mga08y16_21091_c1 3300050511 Bacteria 6879
977 nmdc:mga08y16_220766_c1 3300050511 Bacteria 1962
978 nmdc:mga08y16_222051_c1 3300050511 Bacteria 1956
979 nmdc:mga08y16_23_c1 3300050511 Bacteria 246918
980 nmdc:mga08y16_26456_c1 3300050511 Bacteria 6118
981 nmdc:mga08y16_69453_c1 3300050511 Bacteria 3673
982 nmdc:mga0n895_106927_c1 3300050512 Bacteria 2811
983 nmdc:mga0n895_167183_c1 3300050512 Bacteria 2231
984 nmdc:mga0n895_16854_c1 3300050512 Bacteria 6716
985 nmdc:mga0n895_17787_c1 3300050512 Bacteria 6562
986 nmdc:mga0n895_243492_c1 3300050512 Bacteria 1825
987 nmdc:mga0n895_388976_c1 3300050512 Bacteria 1411
988 nmdc:mga0n895_400320_c2 3300050512 Bacteria 1012
989 nmdc:mga0n895_65895_c1 3300050512 Unclassified 3586
990 nmdc:mga0rr50_14388_c1 3300050513 Bacteria 5187
991 nmdc:mga0rr50_167_c2 3300050513 Unclassified 3878
992 nmdc:mga0rr50_320162_c1 3300050513 Bacteria 1300
993 nmdc:mga0rr50_339463_c1 3300050513 Bacteria 1262
994 nmdc:mga0rr50_520818_c1 3300050513 Bacteria 1012
995 nmdc:mga0rr50_64578_c1 3300050513 Bacteria 2769
996 nmdc:mga0rr50_7803_c1 3300050513 Bacteria 6633
997 nmdc:mga08x19_115725_c1 3300050514 Bacteria 1792
998 nmdc:mga08x19_30835_c1 3300050514 Bacteria 3370
999 nmdc:mga08x19_57641_c1 3300050514 Bacteria 2511
1000 nmdc:mga0a205_112129_c1 3300050515 Bacteria 2626
1001 nmdc:mga0a205_21835_c1 3300050515 Bacteria 6054
1002 nmdc:mga0a205_257952_c1 3300050515 Bacteria 1621
1003 nmdc:mga0a205_270381_c1 3300050515 Bacteria 1577
1004 nmdc:mga0a205_469705_c1 3300050515 Bacteria 1117
1005 nmdc:mga0a205_60997_c1 3300050515 Bacteria 3642
1006 nmdc:mga0a205_89653_c1 3300050515 Bacteria 2972
1007 nmdc:mga0a205_9887_c1 3300050515 Bacteria 8749
1008 Ga0495601_0144125 3300053077 Bacteria 1554
1009 Ga0495595_0168370 3300053084 Bacteria 1084
1010 Ga0495619_0216901 3300053085 Bacteria 1325
1011 Ga0500641_0018512 3300053096 Bacteria 2621
1012 Ga0500568_0125893 3300053139 Bacteria 954
1013 Ga0500634_0019126 3300053161 Bacteria 3686
1014 Ga0500636_0065300 3300053177 Bacteria 2118
1015 Ga0501084_0300456 3300054114 Bacteria 1356
1016 Ga0501084_0528549 3300054114 Bacteria 997
1017 Ga0466962_0000032 3300061719 Bacteria 67996
1018 Ga0530510_0003691 3300061734 Bacteria 10532

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0470141 Ga0495592_0470141_10_645 211
2 3300049742 Ga0501080_0394408 Ga0501080_0394408_269_925 218
3 3300050508 nmdc:mga09592_89964_c1 nmdc:mga09592_89964_c1_23_745 219
4 3300005617 Ga0068859_100056009 Ga0068859_1000560092 231
5 3300006931 Ga0097620_100056007 Ga0097620_1000560072 231
6 3300005471 Ga0070698_100164765 Ga0070698_1001647652 234
7 3300005842 Ga0068858_100023674 Ga0068858_1000236744 235
8 3300014968 Ga0157379_10063788 Ga0157379_100637883 235
9 3300025925 Ga0207650_10162572 Ga0207650_101625722 235
10 3300026035 Ga0207703_10004941 Ga0207703_100049417 235
11 3300026095 Ga0207676_10662430 Ga0207676_106624302 235
12 3300031995 Ga0307409_100190285 Ga0307409_1001902852 237
13 3300049568 Ga0501031_0001872 Ga0501031_0001872_12204_13019 237
14 3300049572 Ga0501036_0007735 Ga0501036_0007735_3630_4445 237
15 3300049575 Ga0501039_0044587 Ga0501039_0044587_1979_2794 237
16 3300049579 Ga0501043_0003304 Ga0501043_0003304_12160_12975 237
17 3300049586 Ga0501070_0000465 Ga0501070_0000465_19537_20352 237
18 3300049822 Ga0501035_0000007 Ga0501035_0000007_236448_237263 237
19 3300046460 Ga0495638_0010324 Ga0495638_0010324_828_1622 238
20 3300050496 nmdc:mga07m45_148768_c1 nmdc:mga07m45_148768_c1_418_1212 239
21 3300009147 Ga0114129_10399170 Ga0114129_103991702 241
22 3300050507 nmdc:mga05p37_188212_c1 nmdc:mga05p37_188212_c1_1007_1819 241
23 3300050515 nmdc:mga0a205_257952_c1 nmdc:mga0a205_257952_c1_153_965 241
24 3300009553 Ga0105249_10259855 Ga0105249_102598552 242
25 3300046526 Ga0495666_0118955 Ga0495666_0118955_498_1226 242
26 3300050507 nmdc:mga05p37_824274_c1 nmdc:mga05p37_824274_c1_31_843 242
27 3300048905 Ga0496102_0018879 Ga0496102_0018879_873_1685 243
28 3300048916 Ga0496113_0083239 Ga0496113_0083239_345_1157 243
29 3300005336 Ga0070680_100419531 Ga0070680_1004195311 244
30 3300006880 Ga0075429_100301976 Ga0075429_1003019762 244
31 3300009094 Ga0111539_10445629 Ga0111539_104456292 244
32 3300050507 nmdc:mga05p37_437715_c1 nmdc:mga05p37_437715_c1_183_995 244
33 3300050511 nmdc:mga08y16_222051_c1 nmdc:mga08y16_222051_c1_176_988 244
34 3300050515 nmdc:mga0a205_112129_c1 nmdc:mga0a205_112129_c1_1353_2165 244
35 3300031727 Ga0316576_10099416 Ga0316576_100994162 245
36 3300045051 Ga0451576_0562763 Ga0451576_0562763_27_767 245
37 3300006880 Ga0075429_100222102 Ga0075429_1002221022 247
38 3300005340 Ga0070689_100342164 Ga0070689_1003421641 248
39 3300005343 Ga0070687_100049508 Ga0070687_1000495082 248
40 3300025918 Ga0207662_10095290 Ga0207662_100952901 248
41 3300053139 Ga0500568_0125893 Ga0500568_0125893_31_777 248
42 3300006871 Ga0075434_100162539 Ga0075434_1001625392 249
43 3300009098 Ga0105245_10074125 Ga0105245_100741252 249
44 3300009176 Ga0105242_10174863 Ga0105242_101748632 249
45 3300025927 Ga0207687_10113901 Ga0207687_101139012 249
46 3300045051 Ga0451576_0029097 Ga0451576_0029097_4977_5726 249
47 3300050512 nmdc:mga0n895_106927_c1 nmdc:mga0n895_106927_c1_1084_1896 249
48 3300013306 Ga0163162_10162096 Ga0163162_101620963 250
49 3300014325 Ga0163163_10275443 Ga0163163_102754432 250
50 3300014326 Ga0157380_10295988 Ga0157380_102959882 250
51 3300026035 Ga0207703_10158903 Ga0207703_101589032 250
52 3300053161 Ga0500634_0019126 Ga0500634_0019126_2611_3387 250
53 3300005367 Ga0070667_100377910 Ga0070667_1003779102 251
54 3300005441 Ga0070700_100365152 Ga0070700_1003651521 251
55 3300005617 Ga0068859_100144462 Ga0068859_1001444623 251
56 3300005841 Ga0068863_100185337 Ga0068863_1001853372 251
57 3300006931 Ga0097620_100144470 Ga0097620_1001444703 251
58 3300009094 Ga0111539_10099518 Ga0111539_100995183 251
59 3300009101 Ga0105247_10235569 Ga0105247_102355692 251
60 3300025986 Ga0207658_10300341 Ga0207658_103003412 251
61 3300026075 Ga0207708_10373485 Ga0207708_103734851 251
62 3300048907 Ga0496104_0018651 Ga0496104_0018651_1620_2432 251
63 3300048908 Ga0496105_0016946 Ga0496105_0016946_2456_3268 251
64 3300048917 Ga0496114_0002356 Ga0496114_0002356_2173_2985 251
65 3300048918 Ga0496115_0133026 Ga0496115_0133026_1090_1902 251
66 3300050511 nmdc:mga08y16_220766_c1 nmdc:mga08y16_220766_c1_205_1017 251
67 3300053096 Ga0500641_0018512 Ga0500641_0018512_344_1138 251
68 3300005330 Ga0070690_100320693 Ga0070690_1003206931 252
69 3300005434 Ga0070709_10035864 Ga0070709_100358642 252
70 3300005544 Ga0070686_100328628 Ga0070686_1003286282 252
71 3300005545 Ga0070695_100105009 Ga0070695_1001050092 252
72 3300005546 Ga0070696_100105744 Ga0070696_1001057443 252
73 3300005549 Ga0070704_100190714 Ga0070704_1001907142 252
74 3300005563 Ga0068855_100448432 Ga0068855_1004484322 252
75 3300005616 Ga0068852_100565516 Ga0068852_1005655162 252
76 3300005617 Ga0068859_100156809 Ga0068859_1001568093 252
77 3300005718 Ga0068866_10086309 Ga0068866_100863092 252
78 3300005718 Ga0068866_10214392 Ga0068866_102143922 252
79 3300005843 Ga0068860_100003719 Ga0068860_1000037193 252
80 3300006163 Ga0070715_10056923 Ga0070715_100569232 252
81 3300006173 Ga0070716_100051834 Ga0070716_1000518341 252
82 3300006175 Ga0070712_100059425 Ga0070712_1000594252 252
83 3300006358 Ga0068871_100025979 Ga0068871_1000259792 252
84 3300006881 Ga0068865_100062193 Ga0068865_1000621932 252
85 3300006881 Ga0068865_100087178 Ga0068865_1000871784 252
86 3300006931 Ga0097620_100156815 Ga0097620_1001568153 252
87 3300009098 Ga0105245_10051105 Ga0105245_100511053 252
88 3300009148 Ga0105243_10101952 Ga0105243_101019522 252
89 3300010375 Ga0105239_10028869 Ga0105239_100288692 252
90 3300013297 Ga0157378_10008675 Ga0157378_100086756 252
91 3300013306 Ga0163162_10312649 Ga0163162_103126492 252
92 3300017792 Ga0163161_10059736 Ga0163161_100597364 252
93 3300025915 Ga0207693_10051785 Ga0207693_100517853 252
94 3300025935 Ga0207709_10129734 Ga0207709_101297342 252
95 3300025938 Ga0207704_10267320 Ga0207704_102673202 252
96 3300025939 Ga0207665_10014317 Ga0207665_100143171 252
97 3300026023 Ga0207677_10318353 Ga0207677_103183532 252
98 3300026041 Ga0207639_10251758 Ga0207639_102517582 252
99 3300026088 Ga0207641_10055117 Ga0207641_100551172 252
100 3300028381 Ga0268264_10082755 Ga0268264_100827553 252
101 3300048905 Ga0496102_0375297 Ga0496102_0375297_199_1011 252
102 3300048906 Ga0496103_0028010 Ga0496103_0028010_595_1407 252
103 3300048909 Ga0496106_0066522 Ga0496106_0066522_868_1680 252
104 3300048911 Ga0496108_0043711 Ga0496108_0043711_1809_2621 252
105 3300048912 Ga0496109_0100546 Ga0496109_0100546_935_1747 252
106 3300048914 Ga0496111_0161122 Ga0496111_0161122_286_1098 252
107 3300005367 Ga0070667_100210066 Ga0070667_1002100662 253
108 3300005844 Ga0068862_100505777 Ga0068862_1005057772 253
109 3300009174 Ga0105241_10126009 Ga0105241_101260091 253
110 3300025972 Ga0207668_10271298 Ga0207668_102712981 253
111 3300026089 Ga0207648_10179390 Ga0207648_101793902 253
112 3300026095 Ga0207676_10103721 Ga0207676_101037212 253
113 3300035121 Ga0373960_0067418 Ga0373960_0067418_218_1030 253
114 3300035691 Ga0373931_0007641 Ga0373931_0007641_652_1464 253
115 3300005434 Ga0070709_10288995 Ga0070709_102889952 254
116 3300013100 Ga0157373_10165797 Ga0157373_101657972 254
117 3300025906 Ga0207699_10305736 Ga0207699_103057361 254
118 3300031344 Ga0265316_10358239 Ga0265316_103582392 254
119 3300005327 Ga0070658_10089977 Ga0070658_100899772 255
120 3300005544 Ga0070686_100280339 Ga0070686_1002803391 255
121 3300013308 Ga0157375_10000024 Ga0157375_10000024202 255
122 3300025909 Ga0207705_10053368 Ga0207705_100533682 255
123 3300025935 Ga0207709_10415055 Ga0207709_104150551 255
124 3300035691 Ga0373931_0274999 Ga0373931_0274999_145_1014 255
125 3300034816 Ga0373930_0016333 Ga0373930_0016333_516_1328 256
126 3300035084 Ga0373928_0019135 Ga0373928_0019135_276_1088 256
127 3300035088 Ga0373940_0015791 Ga0373940_0015791_117_929 256
128 3300035691 Ga0373931_0024310 Ga0373931_0024310_326_1138 256
129 3300038996 Ga0242420_000212 Ga0242420_000212_2891_3703 256
130 3300046539 Ga0495621_0067349 Ga0495621_0067349_385_1197 257
131 3300049823 Ga0501044_0221690 Ga0501044_0221690_697_1515 257
132 3300005330 Ga0070690_100033965 Ga0070690_1000339653 258
133 3300005345 Ga0070692_10431632 Ga0070692_104316321 258
134 3300005444 Ga0070694_100616851 Ga0070694_1006168511 258
135 3300005457 Ga0070662_100467109 Ga0070662_1004671091 258
136 3300005471 Ga0070698_100023178 Ga0070698_1000231786 258
137 3300005548 Ga0070665_100416494 Ga0070665_1004164943 258
138 3300005618 Ga0068864_100116214 Ga0068864_1001162143 258
139 3300005842 Ga0068858_100090268 Ga0068858_1000902682 258
140 3300005844 Ga0068862_100276902 Ga0068862_1002769022 258
141 3300005983 Ga0081540_1116864 Ga0081540_11168642 258
142 3300006038 Ga0075365_10249058 Ga0075365_102490582 258
143 3300006042 Ga0075368_10016277 Ga0075368_100162772 258
144 3300006048 Ga0075363_100007068 Ga0075363_1000070684 258
145 3300006175 Ga0070712_100055300 Ga0070712_1000553002 258
146 3300006177 Ga0075362_10077281 Ga0075362_100772812 258
147 3300006178 Ga0075367_10331316 Ga0075367_103313161 258
148 3300006186 Ga0075369_10110697 Ga0075369_101106972 258
149 3300006237 Ga0097621_100028848 Ga0097621_1000288485 258
150 3300006358 Ga0068871_100013024 Ga0068871_1000130244 258
151 3300006844 Ga0075428_100006816 Ga0075428_1000068162 258
152 3300006844 Ga0075428_100687329 Ga0075428_1006873292 258
153 3300006846 Ga0075430_100035227 Ga0075430_1000352272 258
154 3300006847 Ga0075431_100001217 Ga0075431_1000012177 258
155 3300006880 Ga0075429_100002046 Ga0075429_1000020469 258
156 3300009094 Ga0111539_10020650 Ga0111539_100206507 258
157 3300009098 Ga0105245_10009229 Ga0105245_100092295 258
158 3300009147 Ga0114129_10021293 Ga0114129_100212937 258
159 3300009147 Ga0114129_10284758 Ga0114129_102847582 258
160 3300009148 Ga0105243_10055425 Ga0105243_100554254 258
161 3300009176 Ga0105242_10079295 Ga0105242_100792952 258
162 3300009177 Ga0105248_10121221 Ga0105248_101212213 258
163 3300010375 Ga0105239_10542346 Ga0105239_105423462 258
164 3300013297 Ga0157378_10077784 Ga0157378_100777843 258
165 3300025927 Ga0207687_10006656 Ga0207687_100066564 258
166 3300025934 Ga0207686_10236074 Ga0207686_102360742 258
167 3300025986 Ga0207658_10216305 Ga0207658_102163051 258
168 3300026035 Ga0207703_10068898 Ga0207703_100688982 258
169 3300026041 Ga0207639_10125944 Ga0207639_101259442 258
170 3300026095 Ga0207676_10189353 Ga0207676_101893532 258
171 3300026121 Ga0207683_10108516 Ga0207683_101085163 258
172 3300027866 Ga0209813_10007652 Ga0209813_100076522 258
173 3300027907 Ga0207428_10009277 Ga0207428_100092777 258
174 3300028380 Ga0268265_10824549 Ga0268265_108245491 258
175 3300035171 Ga0373946_0108141 Ga0373946_0108141_41_817 258
176 3300035725 Ga0373947_0097197 Ga0373947_0097197_906_1682 258
177 3300046517 Ga0495630_0032627 Ga0495630_0032627_965_1741 258
178 3300047319 Ga0495674_0104304 Ga0495674_0104304_435_1211 258
179 3300050489 nmdc:mga03683_91956_c1 nmdc:mga03683_91956_c1_223_999 258
180 3300050491 nmdc:mga00v17_104421_c1 nmdc:mga00v17_104421_c1_47_823 258
181 3300050494 nmdc:mga06z11_27460_c1 nmdc:mga06z11_27460_c1_504_1280 258
182 3300050495 nmdc:mga04h51_28042_c1 nmdc:mga04h51_28042_c1_503_1279 258
183 3300050507 nmdc:mga05p37_984_c1 nmdc:mga05p37_984_c1_25064_25840 258
184 3300050508 nmdc:mga09592_857_c1 nmdc:mga09592_857_c1_16422_17198 258
185 3300050509 nmdc:mga0qj67_19750_c1 nmdc:mga0qj67_19750_c1_559_1335 258
186 3300050510 nmdc:mga06r32_553_c1 nmdc:mga06r32_553_c1_6682_7458 258
187 3300050511 nmdc:mga08y16_1473_c2 nmdc:mga08y16_1473_c2_659_1435 258
188 3300025291 Ga0209675_1001593 Ga0209675_10015933 259
189 3300031548 Ga0307408_100233379 Ga0307408_1002333792 259
190 3300031731 Ga0307405_10137826 Ga0307405_101378261 259
191 3300031824 Ga0307413_10044453 Ga0307413_100444531 259
192 3300031852 Ga0307410_10000637 Ga0307410_100006376 259
193 3300031901 Ga0307406_10050853 Ga0307406_100508531 259
194 3300031903 Ga0307407_10012848 Ga0307407_100128483 259
195 3300031911 Ga0307412_10005347 Ga0307412_100053475 259
196 3300031995 Ga0307409_100015869 Ga0307409_1000158692 259
197 3300032002 Ga0307416_100002857 Ga0307416_10000285710 259
198 3300032004 Ga0307414_10131553 Ga0307414_101315532 259
199 3300032005 Ga0307411_10058820 Ga0307411_100588201 259
200 3300032126 Ga0307415_100011025 Ga0307415_1000110253 259
201 3300049576 Ga0501040_0007525 Ga0501040_0007525_3019_3798 259
202 3300053177 Ga0500636_0065300 Ga0500636_0065300_974_1753 259
203 3300005355 Ga0070671_100007890 Ga0070671_1000078903 260
204 3300005367 Ga0070667_100032389 Ga0070667_1000323892 260
205 3300005468 Ga0070707_100407805 Ga0070707_1004078052 260
206 3300005539 Ga0068853_100494428 Ga0068853_1004944282 260
207 3300005543 Ga0070672_100048222 Ga0070672_1000482223 260
208 3300009177 Ga0105248_10490757 Ga0105248_104907572 260
209 3300013308 Ga0157375_10176518 Ga0157375_101765182 260
210 3300025986 Ga0207658_10121517 Ga0207658_101215172 260
211 3300027695 Ga0209966_1008228 Ga0209966_10082282 260
212 3300027717 Ga0209998_10003233 Ga0209998_100032332 260
213 3300045051 Ga0451576_0032985 Ga0451576_0032985_4492_5304 260
214 iso_pu_bacteria 2765235802 2765468898 260
215 iso_pu_bacteria 2767802442 2770199710 260
216 iso_pu_bacteria 2775506902 2776267706 260
217 iso_pu_bacteria 2839993093 2839997395 260
218 iso_pu_bacteria 2840764183 2840770187 260
219 iso_pu_bacteria 2904578770 2904583761 260
220 iso_pu_bacteria 2919119836 2919124330 260
221 iso_pu_bacteria 3002141150 3002146378 260
222 3300032126 Ga0307415_100024113 Ga0307415_1000241132 261
223 iso_pu_bacteria 2744054657 2745166600 261
224 iso_pu_bacteria 2816332336 2817619035 261
225 3300005617 Ga0068859_100000017 Ga0068859_100000017130 262
226 3300005718 Ga0068866_10368872 Ga0068866_103688721 262
227 3300006847 Ga0075431_100218727 Ga0075431_1002187272 262
228 3300006931 Ga0097620_100000017 Ga0097620_100000017130 262
229 3300025981 Ga0207640_10537571 Ga0207640_105375712 262
230 3300026088 Ga0207641_10648626 Ga0207641_106486261 262
231 3300026121 Ga0207683_10035313 Ga0207683_100353134 262
232 3300045051 Ga0451576_0292860 Ga0451576_0292860_169_981 262
233 3300046459 Ga0495629_0265996 Ga0495629_0265996_71_883 262
234 3300048909 Ga0496106_0256197 Ga0496106_0256197_72_884 262
235 3300005331 Ga0070670_100090414 Ga0070670_1000904143 263
236 3300005445 Ga0070708_100013131 Ga0070708_1000131314 263
237 3300005457 Ga0070662_100166455 Ga0070662_1001664552 263
238 3300005535 Ga0070684_100049281 Ga0070684_1000492813 263
239 3300005564 Ga0070664_100279260 Ga0070664_1002792602 263
240 3300005617 Ga0068859_100216018 Ga0068859_1002160181 263
241 3300006038 Ga0075365_10031532 Ga0075365_100315322 263
242 3300006931 Ga0097620_100216018 Ga0097620_1002160183 263
243 3300025925 Ga0207650_10323563 Ga0207650_103235632 263
244 3300025933 Ga0207706_10148125 Ga0207706_101481252 263
245 3300025945 Ga0207679_10086587 Ga0207679_100865871 263
246 3300026041 Ga0207639_10690230 Ga0207639_106902302 263
247 3300041413 Ga0439465_0017433 Ga0439465_0017433_1197_1991 263
248 3300044673 Ga0453683_0093706 Ga0453683_0093706_141_935 263
249 3300046683 Ga0495658_0270237 Ga0495658_0270237_35_865 263
250 3300047673 Ga0495593_0216594 Ga0495593_0216594_30_860 263
251 3300048905 Ga0496102_0151165 Ga0496102_0151165_12_806 263
252 3300050511 nmdc:mga08y16_139391_c1 nmdc:mga08y16_139391_c1_579_1370 263
253 3300006178 Ga0075367_10017651 Ga0075367_100176513 264
254 3300006195 Ga0075366_10018376 Ga0075366_100183764 264
255 3300031241 Ga0265325_10082013 Ga0265325_100820132 264
256 3300031249 Ga0265339_10089361 Ga0265339_100893612 264
257 3300031548 Ga0307408_100339603 Ga0307408_1003396031 264
258 3300048929 Ga0496126_0407811 Ga0496126_0407811_99_893 264
259 3300050494 nmdc:mga06z11_61189_c1 nmdc:mga06z11_61189_c1_988_1782 264
260 3300005471 Ga0070698_100099145 Ga0070698_1000991452 265
261 3300006846 Ga0075430_100090572 Ga0075430_1000905722 265
262 3300013105 Ga0157369_10000378 Ga0157369_100003782 265
263 3300025229 Ga0209147_100184 Ga0209147_10018457 265
264 3300025910 Ga0207684_10360307 Ga0207684_103603072 265
265 3300044694 Ga0466963_0126674 Ga0466963_0126674_930_1727 265
266 3300050507 nmdc:mga05p37_31532_c1 nmdc:mga05p37_31532_c1_1732_2544 265
267 3300050509 nmdc:mga0qj67_91286_c1 nmdc:mga0qj67_91286_c1_960_1772 265
268 3300050510 nmdc:mga06r32_13422_c1 nmdc:mga06r32_13422_c1_5511_6323 265
269 3300005329 Ga0070683_100004548 Ga0070683_1000045484 267
270 3300005331 Ga0070670_100010463 Ga0070670_1000104632 267
271 3300005334 Ga0068869_100012999 Ga0068869_1000129993 267
272 3300005334 Ga0068869_100378361 Ga0068869_1003783612 267
273 3300005337 Ga0070682_100194608 Ga0070682_1001946082 267
274 3300005344 Ga0070661_100004118 Ga0070661_1000041182 267
275 3300005344 Ga0070661_100024937 Ga0070661_1000249374 267
276 3300005347 Ga0070668_100009618 Ga0070668_1000096183 267
277 3300005354 Ga0070675_100011820 Ga0070675_1000118205 267
278 3300005354 Ga0070675_100035820 Ga0070675_1000358203 267
279 3300005364 Ga0070673_100079913 Ga0070673_1000799133 267
280 3300005364 Ga0070673_100163274 Ga0070673_1001632741 267
281 3300005366 Ga0070659_100093537 Ga0070659_1000935372 267
282 3300005444 Ga0070694_100187170 Ga0070694_1001871701 267
283 3300005455 Ga0070663_100174639 Ga0070663_1001746392 267
284 3300005457 Ga0070662_100089713 Ga0070662_1000897131 267
285 3300005458 Ga0070681_10001833 Ga0070681_1000183313 267
286 3300005459 Ga0068867_100114793 Ga0068867_1001147932 267
287 3300005471 Ga0070698_100129233 Ga0070698_1001292334 267
288 3300005530 Ga0070679_100005867 Ga0070679_1000058677 267
289 3300005535 Ga0070684_100018965 Ga0070684_1000189654 267
290 3300005543 Ga0070672_100127658 Ga0070672_1001276582 267
291 3300005543 Ga0070672_100156897 Ga0070672_1001568972 267
292 3300005548 Ga0070665_100444477 Ga0070665_1004444772 267
293 3300005564 Ga0070664_100001560 Ga0070664_10000156012 267
294 3300005564 Ga0070664_100016193 Ga0070664_1000161932 267
295 3300005564 Ga0070664_100249761 Ga0070664_1002497612 267
296 3300005577 Ga0068857_100056596 Ga0068857_1000565962 267
297 3300005577 Ga0068857_100259523 Ga0068857_1002595232 267
298 3300005616 Ga0068852_100027709 Ga0068852_1000277092 267
299 3300005719 Ga0068861_100092805 Ga0068861_1000928052 267
300 3300005841 Ga0068863_100393507 Ga0068863_1003935072 267
301 3300006844 Ga0075428_100038920 Ga0075428_1000389202 267
302 3300006852 Ga0075433_10091518 Ga0075433_100915182 267
303 3300006871 Ga0075434_100017259 Ga0075434_1000172593 267
304 3300006871 Ga0075434_100234937 Ga0075434_1002349372 267
305 3300006881 Ga0068865_100080476 Ga0068865_1000804761 267
306 3300009148 Ga0105243_10462595 Ga0105243_104625951 267
307 3300009176 Ga0105242_10003906 Ga0105242_100039063 267
308 3300009553 Ga0105249_10224643 Ga0105249_102246432 267
309 3300010375 Ga0105239_10081900 Ga0105239_100819002 267
310 3300013297 Ga0157378_10012784 Ga0157378_100127842 267
311 3300013297 Ga0157378_10142890 Ga0157378_101428903 267
312 3300013306 Ga0163162_10394633 Ga0163162_103946331 267
313 3300013307 Ga0157372_10496849 Ga0157372_104968492 267
314 3300013308 Ga0157375_10763039 Ga0157375_107630391 267
315 3300014326 Ga0157380_10149718 Ga0157380_101497182 267
316 3300025315 Ga0207697_10005033 Ga0207697_100050335 267
317 3300025899 Ga0207642_10038043 Ga0207642_100380431 267
318 3300025903 Ga0207680_10065281 Ga0207680_100652812 267
319 3300025907 Ga0207645_10001146 Ga0207645_1000114616 267
320 3300025912 Ga0207707_10002076 Ga0207707_100020769 267
321 3300025920 Ga0207649_10002457 Ga0207649_100024572 267
322 3300025921 Ga0207652_10055127 Ga0207652_100551272 267
323 3300025923 Ga0207681_10345012 Ga0207681_103450122 267
324 3300025925 Ga0207650_10006717 Ga0207650_100067175 267
325 3300025925 Ga0207650_10047313 Ga0207650_100473132 267
326 3300025926 Ga0207659_10193331 Ga0207659_101933312 267
327 3300025926 Ga0207659_10269945 Ga0207659_102699451 267
328 3300025926 Ga0207659_10416496 Ga0207659_104164962 267
329 3300025932 Ga0207690_10214505 Ga0207690_102145052 267
330 3300025933 Ga0207706_10001272 Ga0207706_100012725 267
331 3300025934 Ga0207686_10018790 Ga0207686_100187902 267
332 3300025937 Ga0207669_10137517 Ga0207669_101375172 267
333 3300025938 Ga0207704_10169097 Ga0207704_101690972 267
334 3300025940 Ga0207691_10016359 Ga0207691_100163592 267
335 3300025942 Ga0207689_10016216 Ga0207689_100162162 267
336 3300025942 Ga0207689_10423705 Ga0207689_104237052 267
337 3300025944 Ga0207661_10010066 Ga0207661_100100663 267
338 3300025944 Ga0207661_10023960 Ga0207661_100239602 267
339 3300025944 Ga0207661_10120271 Ga0207661_101202712 267
340 3300025945 Ga0207679_10003506 Ga0207679_100035065 267
341 3300025945 Ga0207679_10070066 Ga0207679_100700662 267
342 3300025949 Ga0207667_10419648 Ga0207667_104196482 267
343 3300025960 Ga0207651_10126776 Ga0207651_101267762 267
344 3300026023 Ga0207677_10132619 Ga0207677_101326192 267
345 3300026067 Ga0207678_10110233 Ga0207678_101102331 267
346 3300026088 Ga0207641_10133252 Ga0207641_101332522 267
347 3300026088 Ga0207641_10245408 Ga0207641_102454081 267
348 3300026089 Ga0207648_10182747 Ga0207648_101827472 267
349 3300026095 Ga0207676_10040858 Ga0207676_100408584 267
350 3300026116 Ga0207674_10000819 Ga0207674_1000081915 267
351 3300026118 Ga0207675_100002475 Ga0207675_1000024751 267
352 3300028380 Ga0268265_10026702 Ga0268265_100267023 267
353 3300035398 Ga0316574_0061256 Ga0316574_0061256_225_1034 267
354 3300035398 Ga0316574_0062635 Ga0316574_0062635_1394_2203 267
355 3300046499 Ga0495594_0079089 Ga0495594_0079089_886_1698 267
356 3300050507 nmdc:mga05p37_82009_c1 nmdc:mga05p37_82009_c1_1418_2227 267
357 3300050512 nmdc:mga0n895_167183_c1 nmdc:mga0n895_167183_c1_914_1723 267
358 3300050512 nmdc:mga0n895_16854_c1 nmdc:mga0n895_16854_c1_4234_5046 267
359 3300050515 nmdc:mga0a205_89653_c1 nmdc:mga0a205_89653_c1_816_1625 267
360 3300005331 Ga0070670_100254825 Ga0070670_1002548252 268
361 3300005564 Ga0070664_100072646 Ga0070664_1000726462 268
362 3300006175 Ga0070712_100119722 Ga0070712_1001197222 268
363 3300025945 Ga0207679_10058119 Ga0207679_100581192 268
364 3300006852 Ga0075433_10005566 Ga0075433_100055665 269
365 3300026095 Ga0207676_10288890 Ga0207676_102888902 269
366 3300048904 Ga0496101_0011136 Ga0496101_0011136_4859_5671 269
367 3300048907 Ga0496104_0220399 Ga0496104_0220399_939_1751 269
368 3300048908 Ga0496105_0476175 Ga0496105_0476175_56_868 269
369 3300048911 Ga0496108_0123640 Ga0496108_0123640_44_856 269
370 3300048912 Ga0496109_0062367 Ga0496109_0062367_2575_3387 269
371 3300048913 Ga0496110_0256083 Ga0496110_0256083_97_909 269
372 3300048913 Ga0496110_0406198 Ga0496110_0406198_179_991 269
373 3300048914 Ga0496111_0254356 Ga0496111_0254356_188_1000 269
374 3300048915 Ga0496112_0002385 Ga0496112_0002385_90_902 269
375 3300048916 Ga0496113_0342268 Ga0496113_0342268_220_1032 269
376 3300048917 Ga0496114_0054600 Ga0496114_0054600_1159_1971 269
377 3300050512 nmdc:mga0n895_243492_c1 nmdc:mga0n895_243492_c1_250_1062 269
378 3300050515 nmdc:mga0a205_9887_c1 nmdc:mga0a205_9887_c1_4077_4889 269
379 3300005293 Ga0065715_10002119 Ga0065715_100021194 270
380 3300005293 Ga0065715_10030856 Ga0065715_100308562 270
381 3300005295 Ga0065707_10001658 Ga0065707_100016581 270
382 3300005295 Ga0065707_10118864 Ga0065707_101188642 270
383 3300005329 Ga0070683_100002845 Ga0070683_1000028459 270
384 3300005329 Ga0070683_100123270 Ga0070683_1001232702 270
385 3300005330 Ga0070690_100241362 Ga0070690_1002413622 270
386 3300005331 Ga0070670_100000820 Ga0070670_1000008209 270
387 3300005331 Ga0070670_100003875 Ga0070670_1000038758 270
388 3300005331 Ga0070670_100069892 Ga0070670_1000698923 270
389 3300005334 Ga0068869_100255203 Ga0068869_1002552031 270
390 3300005334 Ga0068869_100287621 Ga0068869_1002876211 270
391 3300005336 Ga0070680_100033895 Ga0070680_1000338953 270
392 3300005337 Ga0070682_100000004 Ga0070682_100000004303 270
393 3300005338 Ga0068868_100078134 Ga0068868_1000781342 270
394 3300005338 Ga0068868_100091353 Ga0068868_1000913532 270
395 3300005338 Ga0068868_100106402 Ga0068868_1001064023 270
396 3300005338 Ga0068868_100124236 Ga0068868_1001242362 270
397 3300005339 Ga0070660_100047624 Ga0070660_1000476242 270
398 3300005340 Ga0070689_100001924 Ga0070689_1000019246 270
399 3300005340 Ga0070689_100013571 Ga0070689_1000135714 270
400 3300005340 Ga0070689_100057944 Ga0070689_1000579441 270
401 3300005340 Ga0070689_100249136 Ga0070689_1002491362 270
402 3300005340 Ga0070689_100493901 Ga0070689_1004939012 270
403 3300005341 Ga0070691_10011278 Ga0070691_100112782 270
404 3300005344 Ga0070661_100002867 Ga0070661_1000028675 270
405 3300005344 Ga0070661_100073714 Ga0070661_1000737143 270
406 3300005347 Ga0070668_100024023 Ga0070668_1000240233 270
407 3300005354 Ga0070675_100000001 Ga0070675_10000000161 270
408 3300005354 Ga0070675_100018439 Ga0070675_1000184393 270
409 3300005355 Ga0070671_100022410 Ga0070671_1000224105 270
410 3300005355 Ga0070671_100024298 Ga0070671_1000242985 270
411 3300005355 Ga0070671_100025797 Ga0070671_1000257974 270
412 3300005355 Ga0070671_100179197 Ga0070671_1001791973 270
413 3300005356 Ga0070674_100001535 Ga0070674_10000153511 270
414 3300005356 Ga0070674_100031586 Ga0070674_1000315862 270
415 3300005356 Ga0070674_100035635 Ga0070674_1000356353 270
416 3300005364 Ga0070673_100003439 Ga0070673_1000034394 270
417 3300005364 Ga0070673_100194377 Ga0070673_1001943772 270
418 3300005364 Ga0070673_100315350 Ga0070673_1003153502 270
419 3300005365 Ga0070688_100051863 Ga0070688_1000518632 270
420 3300005365 Ga0070688_100124157 Ga0070688_1001241573 270
421 3300005366 Ga0070659_100089356 Ga0070659_1000893562 270
422 3300005366 Ga0070659_100162214 Ga0070659_1001622142 270
423 3300005367 Ga0070667_100298785 Ga0070667_1002987852 270
424 3300005434 Ga0070709_10006794 Ga0070709_100067945 270
425 3300005434 Ga0070709_10042037 Ga0070709_100420372 270
426 3300005435 Ga0070714_100008442 Ga0070714_1000084422 270
427 3300005436 Ga0070713_100007824 Ga0070713_1000078245 270
428 3300005438 Ga0070701_10001225 Ga0070701_100012254 270
429 3300005438 Ga0070701_10082508 Ga0070701_100825082 270
430 3300005439 Ga0070711_100019931 Ga0070711_1000199316 270
431 3300005439 Ga0070711_100177033 Ga0070711_1001770331 270
432 3300005439 Ga0070711_100282450 Ga0070711_1002824501 270
433 3300005440 Ga0070705_100018362 Ga0070705_1000183623 270
434 3300005441 Ga0070700_100001362 Ga0070700_10000136211 270
435 3300005444 Ga0070694_100075624 Ga0070694_1000756242 270
436 3300005445 Ga0070708_100019263 Ga0070708_1000192636 270
437 3300005455 Ga0070663_100001965 Ga0070663_1000019654 270
438 3300005455 Ga0070663_100069031 Ga0070663_1000690313 270
439 3300005456 Ga0070678_100002371 Ga0070678_1000023714 270
440 3300005456 Ga0070678_100506208 Ga0070678_1005062081 270
441 3300005457 Ga0070662_100012872 Ga0070662_1000128725 270
442 3300005458 Ga0070681_10021049 Ga0070681_100210492 270
443 3300005459 Ga0068867_100106884 Ga0068867_1001068843 270
444 3300005459 Ga0068867_100450462 Ga0068867_1004504622 270
445 3300005467 Ga0070706_100023104 Ga0070706_1000231046 270
446 3300005467 Ga0070706_100378242 Ga0070706_1003782422 270
447 3300005468 Ga0070707_100033375 Ga0070707_1000333755 270
448 3300005468 Ga0070707_100062110 Ga0070707_1000621102 270
449 3300005468 Ga0070707_100183181 Ga0070707_1001831811 270
450 3300005471 Ga0070698_100052910 Ga0070698_1000529102 270
451 3300005471 Ga0070698_100160277 Ga0070698_1001602772 270
452 3300005518 Ga0070699_100052632 Ga0070699_1000526322 270
453 3300005518 Ga0070699_100276536 Ga0070699_1002765362 270
454 3300005530 Ga0070679_100066120 Ga0070679_1000661202 270
455 3300005530 Ga0070679_100089510 Ga0070679_1000895103 270
456 3300005535 Ga0070684_100000323 Ga0070684_1000003238 270
457 3300005535 Ga0070684_100007259 Ga0070684_1000072597 270
458 3300005536 Ga0070697_100027246 Ga0070697_1000272464 270
459 3300005536 Ga0070697_100207715 Ga0070697_1002077152 270
460 3300005539 Ga0068853_100043718 Ga0068853_1000437184 270
461 3300005539 Ga0068853_100290963 Ga0068853_1002909632 270
462 3300005539 Ga0068853_100603366 Ga0068853_1006033661 270
463 3300005543 Ga0070672_100000404 Ga0070672_1000004048 270
464 3300005543 Ga0070672_100006663 Ga0070672_1000066637 270
465 3300005543 Ga0070672_100017030 Ga0070672_1000170305 270
466 3300005544 Ga0070686_100054708 Ga0070686_1000547082 270
467 3300005544 Ga0070686_100523939 Ga0070686_1005239391 270
468 3300005545 Ga0070695_100063711 Ga0070695_1000637113 270
469 3300005545 Ga0070695_100443962 Ga0070695_1004439621 270
470 3300005546 Ga0070696_100031894 Ga0070696_1000318943 270
471 3300005548 Ga0070665_100026495 Ga0070665_1000264953 270
472 3300005548 Ga0070665_100055826 Ga0070665_1000558262 270
473 3300005548 Ga0070665_100060764 Ga0070665_1000607642 270
474 3300005548 Ga0070665_100075373 Ga0070665_1000753733 270
475 3300005549 Ga0070704_100107327 Ga0070704_1001073273 270
476 3300005563 Ga0068855_100083845 Ga0068855_1000838453 270
477 3300005564 Ga0070664_100002496 Ga0070664_1000024962 270
478 3300005564 Ga0070664_100007228 Ga0070664_1000072287 270
479 3300005564 Ga0070664_100053908 Ga0070664_1000539082 270
480 3300005564 Ga0070664_100363563 Ga0070664_1003635631 270
481 3300005577 Ga0068857_100017696 Ga0068857_1000176962 270
482 3300005577 Ga0068857_100393248 Ga0068857_1003932482 270
483 3300005615 Ga0070702_100020189 Ga0070702_1000201892 270
484 3300005615 Ga0070702_100195351 Ga0070702_1001953512 270
485 3300005616 Ga0068852_100366736 Ga0068852_1003667362 270
486 3300005617 Ga0068859_100028633 Ga0068859_1000286334 270
487 3300005617 Ga0068859_100034615 Ga0068859_1000346153 270
488 3300005617 Ga0068859_100061477 Ga0068859_1000614774 270
489 3300005617 Ga0068859_100115968 Ga0068859_1001159683 270
490 3300005617 Ga0068859_100401179 Ga0068859_1004011791 270
491 3300005617 Ga0068859_100698440 Ga0068859_1006984402 270
492 3300005618 Ga0068864_100000001 Ga0068864_10000000159 270
493 3300005618 Ga0068864_100004348 Ga0068864_1000043481 270
494 3300005618 Ga0068864_100008707 Ga0068864_1000087077 270
495 3300005618 Ga0068864_100010686 Ga0068864_1000106867 270
496 3300005618 Ga0068864_100058229 Ga0068864_1000582293 270
497 3300005618 Ga0068864_100114151 Ga0068864_1001141512 270
498 3300005718 Ga0068866_10166863 Ga0068866_101668632 270
499 3300005719 Ga0068861_100089126 Ga0068861_1000891263 270
500 3300005719 Ga0068861_100248715 Ga0068861_1002487151 270
501 3300005834 Ga0068851_10103581 Ga0068851_101035812 270
502 3300005840 Ga0068870_10270863 Ga0068870_102708632 270
503 3300005841 Ga0068863_100006299 Ga0068863_1000062996 270
504 3300005841 Ga0068863_100015396 Ga0068863_1000153965 270
505 3300005841 Ga0068863_100256243 Ga0068863_1002562432 270
506 3300005842 Ga0068858_100000072 Ga0068858_10000007238 270
507 3300005842 Ga0068858_100028403 Ga0068858_1000284033 270
508 3300005842 Ga0068858_100043612 Ga0068858_1000436123 270
509 3300005842 Ga0068858_100161888 Ga0068858_1001618883 270
510 3300005843 Ga0068860_100014916 Ga0068860_1000149162 270
511 3300005843 Ga0068860_100075183 Ga0068860_1000751832 270
512 3300005843 Ga0068860_100306182 Ga0068860_1003061822 270
513 3300005843 Ga0068860_100595079 Ga0068860_1005950792 270
514 3300005844 Ga0068862_100010877 Ga0068862_1000108777 270
515 3300005844 Ga0068862_100023180 Ga0068862_1000231804 270
516 3300005844 Ga0068862_100046468 Ga0068862_1000464681 270
517 3300005844 Ga0068862_100289062 Ga0068862_1002890622 270
518 3300005985 Ga0081539_10000071 Ga0081539_10000071117 270
519 3300006028 Ga0070717_10003798 Ga0070717_100037987 270
520 3300006028 Ga0070717_10007368 Ga0070717_100073682 270
521 3300006028 Ga0070717_10274949 Ga0070717_102749492 270
522 3300006028 Ga0070717_10309652 Ga0070717_103096522 270
523 3300006038 Ga0075365_10010341 Ga0075365_100103416 270
524 3300006038 Ga0075365_10101634 Ga0075365_101016344 270
525 3300006042 Ga0075368_10016609 Ga0075368_100166092 270
526 3300006051 Ga0075364_10056798 Ga0075364_100567984 270
527 3300006051 Ga0075364_10270264 Ga0075364_102702642 270
528 3300006058 Ga0075432_10008373 Ga0075432_100083733 270
529 3300006173 Ga0070716_100055634 Ga0070716_1000556341 270
530 3300006173 Ga0070716_100076310 Ga0070716_1000763101 270
531 3300006178 Ga0075367_10031906 Ga0075367_100319064 270
532 3300006178 Ga0075367_10096849 Ga0075367_100968493 270
533 3300006195 Ga0075366_10020552 Ga0075366_100205524 270
534 3300006237 Ga0097621_100037028 Ga0097621_1000370283 270
535 3300006237 Ga0097621_100049804 Ga0097621_1000498043 270
536 3300006237 Ga0097621_100066492 Ga0097621_1000664923 270
537 3300006237 Ga0097621_100078981 Ga0097621_1000789813 270
538 3300006237 Ga0097621_100283030 Ga0097621_1002830302 270
539 3300006237 Ga0097621_100561450 Ga0097621_1005614502 270
540 3300006353 Ga0075370_10043762 Ga0075370_100437623 270
541 3300006358 Ga0068871_100011210 Ga0068871_1000112105 270
542 3300006358 Ga0068871_100016778 Ga0068871_1000167783 270
543 3300006358 Ga0068871_100023567 Ga0068871_1000235674 270
544 3300006358 Ga0068871_100063614 Ga0068871_1000636143 270
545 3300006358 Ga0068871_100361480 Ga0068871_1003614802 270
546 3300006844 Ga0075428_100078699 Ga0075428_1000786992 270
547 3300006844 Ga0075428_100245934 Ga0075428_1002459342 270
548 3300006844 Ga0075428_100263185 Ga0075428_1002631852 270
549 3300006844 Ga0075428_100569999 Ga0075428_1005699992 270
550 3300006847 Ga0075431_100001237 Ga0075431_10000123714 270
551 3300006847 Ga0075431_100025479 Ga0075431_1000254793 270
552 3300006847 Ga0075431_100188852 Ga0075431_1001888523 270
553 3300006847 Ga0075431_100253268 Ga0075431_1002532682 270
554 3300006852 Ga0075433_10038492 Ga0075433_100384922 270
555 3300006852 Ga0075433_10358030 Ga0075433_103580301 270
556 3300006871 Ga0075434_100010349 Ga0075434_1000103497 270
557 3300006871 Ga0075434_100017091 Ga0075434_1000170916 270
558 3300006871 Ga0075434_100051427 Ga0075434_1000514272 270
559 3300006871 Ga0075434_100331315 Ga0075434_1003313152 270
560 3300006871 Ga0075434_100416757 Ga0075434_1004167571 270
561 3300006871 Ga0075434_100426210 Ga0075434_1004262101 270
562 3300006871 Ga0075434_100650352 Ga0075434_1006503522 270
563 3300006880 Ga0075429_100172421 Ga0075429_1001724212 270
564 3300006881 Ga0068865_100002817 Ga0068865_1000028179 270
565 3300006881 Ga0068865_100327528 Ga0068865_1003275281 270
566 3300006914 Ga0075436_100017691 Ga0075436_1000176913 270
567 3300006914 Ga0075436_100028234 Ga0075436_1000282343 270
568 3300006931 Ga0097620_100028633 Ga0097620_1000286334 270
569 3300006931 Ga0097620_100034617 Ga0097620_1000346174 270
570 3300006931 Ga0097620_100061477 Ga0097620_1000614774 270
571 3300006931 Ga0097620_100115969 Ga0097620_1001159693 270
572 3300006931 Ga0097620_100401159 Ga0097620_1004011591 270
573 3300006931 Ga0097620_100698646 Ga0097620_1006986462 270
574 3300007076 Ga0075435_100007726 Ga0075435_1000077266 270
575 3300007076 Ga0075435_100010295 Ga0075435_1000102957 270
576 3300007076 Ga0075435_100019481 Ga0075435_1000194814 270
577 3300007076 Ga0075435_100048463 Ga0075435_1000484632 270
578 3300007076 Ga0075435_100127798 Ga0075435_1001277982 270
579 3300009093 Ga0105240_10110214 Ga0105240_101102143 270
580 3300009094 Ga0111539_10000021 Ga0111539_10000021140 270
581 3300009094 Ga0111539_10045595 Ga0111539_100455952 270
582 3300009094 Ga0111539_10054202 Ga0111539_100542024 270
583 3300009098 Ga0105245_10000055 Ga0105245_1000005542 270
584 3300009098 Ga0105245_10000148 Ga0105245_1000014847 270
585 3300009098 Ga0105245_10000268 Ga0105245_100002689 270
586 3300009098 Ga0105245_10010876 Ga0105245_100108764 270
587 3300009098 Ga0105245_10265350 Ga0105245_102653501 270
588 3300009147 Ga0114129_10000095 Ga0114129_1000009562 270
589 3300009147 Ga0114129_10035942 Ga0114129_100359422 270
590 3300009147 Ga0114129_10153606 Ga0114129_101536062 270
591 3300009147 Ga0114129_10180838 Ga0114129_101808383 270
592 3300009147 Ga0114129_10511798 Ga0114129_105117982 270
593 3300009148 Ga0105243_10008744 Ga0105243_100087445 270
594 3300009148 Ga0105243_10436195 Ga0105243_104361952 270
595 3300009176 Ga0105242_10007476 Ga0105242_100074767 270
596 3300009176 Ga0105242_10009232 Ga0105242_100092327 270
597 3300009176 Ga0105242_10310344 Ga0105242_103103441 270
598 3300009177 Ga0105248_10040499 Ga0105248_100404992 270
599 3300009177 Ga0105248_10083416 Ga0105248_100834163 270
600 3300009177 Ga0105248_10089051 Ga0105248_100890511 270
601 3300009177 Ga0105248_10133657 Ga0105248_101336573 270
602 3300009545 Ga0105237_10227852 Ga0105237_102278522 270
603 3300009545 Ga0105237_10444306 Ga0105237_104443063 270
604 3300009551 Ga0105238_10000029 Ga0105238_1000002954 270
605 3300009553 Ga0105249_10005943 Ga0105249_100059432 270
606 3300009553 Ga0105249_10033156 Ga0105249_100331562 270
607 3300009553 Ga0105249_10331652 Ga0105249_103316523 270
608 3300010375 Ga0105239_10458384 Ga0105239_104583841 270
609 3300010375 Ga0105239_10663142 Ga0105239_106631421 270
610 3300010375 Ga0105239_10785643 Ga0105239_107856432 270
611 3300011119 Ga0105246_10007633 Ga0105246_100076334 270
612 3300011119 Ga0105246_10045953 Ga0105246_100459531 270
613 3300013100 Ga0157373_10097785 Ga0157373_100977852 270
614 3300013102 Ga0157371_10206266 Ga0157371_102062662 270
615 3300013102 Ga0157371_10226748 Ga0157371_102267481 270
616 3300013296 Ga0157374_10000008 Ga0157374_10000008298 270
617 3300013296 Ga0157374_10011468 Ga0157374_100114687 270
618 3300013296 Ga0157374_10024443 Ga0157374_100244432 270
619 3300013296 Ga0157374_10041257 Ga0157374_100412573 270
620 3300013296 Ga0157374_10192173 Ga0157374_101921732 270
621 3300013297 Ga0157378_10000584 Ga0157378_1000058427 270
622 3300013297 Ga0157378_10015464 Ga0157378_100154642 270
623 3300013297 Ga0157378_10026603 Ga0157378_100266033 270
624 3300013297 Ga0157378_10029725 Ga0157378_100297252 270
625 3300013297 Ga0157378_10033479 Ga0157378_100334794 270
626 3300013297 Ga0157378_10035072 Ga0157378_100350723 270
627 3300013306 Ga0163162_10011632 Ga0163162_100116324 270
628 3300013306 Ga0163162_10015763 Ga0163162_100157637 270
629 3300013306 Ga0163162_10040099 Ga0163162_100400991 270
630 3300013306 Ga0163162_10152061 Ga0163162_101520612 270
631 3300013307 Ga0157372_10096509 Ga0157372_100965093 270
632 3300013307 Ga0157372_10349764 Ga0157372_103497642 270
633 3300013308 Ga0157375_10000028 Ga0157375_1000002888 270
634 3300013308 Ga0157375_10000373 Ga0157375_1000037344 270
635 3300013308 Ga0157375_10012531 Ga0157375_100125317 270
636 3300013308 Ga0157375_10012636 Ga0157375_100126366 270
637 3300013308 Ga0157375_10086942 Ga0157375_100869422 270
638 3300013308 Ga0157375_10254292 Ga0157375_102542922 270
639 3300014325 Ga0163163_10007747 Ga0163163_100077474 270
640 3300014325 Ga0163163_10027634 Ga0163163_100276342 270
641 3300014325 Ga0163163_10027983 Ga0163163_100279833 270
642 3300014325 Ga0163163_10033387 Ga0163163_100333872 270
643 3300014325 Ga0163163_10118003 Ga0163163_101180032 270
644 3300014325 Ga0163163_10225857 Ga0163163_102258572 270
645 3300014326 Ga0157380_10000625 Ga0157380_100006253 270
646 3300014326 Ga0157380_10020175 Ga0157380_100201754 270
647 3300014326 Ga0157380_10626504 Ga0157380_106265042 270
648 3300014326 Ga0157380_10643949 Ga0157380_106439492 270
649 3300014745 Ga0157377_10000012 Ga0157377_10000012185 270
650 3300014745 Ga0157377_10000383 Ga0157377_100003835 270
651 3300014745 Ga0157377_10000656 Ga0157377_1000065610 270
652 3300014745 Ga0157377_10014325 Ga0157377_100143253 270
653 3300014968 Ga0157379_10068283 Ga0157379_100682833 270
654 3300014969 Ga0157376_10000044 Ga0157376_1000004410 270
655 3300014969 Ga0157376_10000051 Ga0157376_1000005163 270
656 3300014969 Ga0157376_10001532 Ga0157376_1000153210 270
657 3300014969 Ga0157376_10009169 Ga0157376_100091696 270
658 3300014969 Ga0157376_10203784 Ga0157376_102037842 270
659 3300014969 Ga0157376_10539304 Ga0157376_105393041 270
660 3300017792 Ga0163161_10340412 Ga0163161_103404121 270
661 3300021358 Ga0213873_10000004 Ga0213873_10000004660 270
662 3300021358 Ga0213873_10008288 Ga0213873_100082882 270
663 3300021384 Ga0213876_10000001 Ga0213876_1000000164 270
664 3300021384 Ga0213876_10000067 Ga0213876_100000677 270
665 3300025315 Ga0207697_10015461 Ga0207697_100154613 270
666 3300025315 Ga0207697_10026004 Ga0207697_100260042 270
667 3300025898 Ga0207692_10014799 Ga0207692_100147994 270
668 3300025898 Ga0207692_10150771 Ga0207692_101507712 270
669 3300025901 Ga0207688_10038019 Ga0207688_100380194 270
670 3300025901 Ga0207688_10041359 Ga0207688_100413592 270
671 3300025903 Ga0207680_10114508 Ga0207680_101145082 270
672 3300025905 Ga0207685_10133402 Ga0207685_101334021 270
673 3300025906 Ga0207699_10007617 Ga0207699_100076177 270
674 3300025906 Ga0207699_10038557 Ga0207699_100385573 270
675 3300025907 Ga0207645_10014401 Ga0207645_100144013 270
676 3300025907 Ga0207645_10185662 Ga0207645_101856622 270
677 3300025908 Ga0207643_10053926 Ga0207643_100539263 270
678 3300025909 Ga0207705_10364294 Ga0207705_103642942 270
679 3300025910 Ga0207684_10018155 Ga0207684_100181556 270
680 3300025912 Ga0207707_10047515 Ga0207707_100475152 270
681 3300025913 Ga0207695_10079052 Ga0207695_100790522 270
682 3300025913 Ga0207695_10401416 Ga0207695_104014161 270
683 3300025915 Ga0207693_10044620 Ga0207693_100446202 270
684 3300025915 Ga0207693_10121085 Ga0207693_101210853 270
685 3300025916 Ga0207663_10034247 Ga0207663_100342472 270
686 3300025916 Ga0207663_10152343 Ga0207663_101523432 270
687 3300025916 Ga0207663_10326981 Ga0207663_103269812 270
688 3300025918 Ga0207662_10011697 Ga0207662_100116973 270
689 3300025918 Ga0207662_10340627 Ga0207662_103406272 270
690 3300025919 Ga0207657_10017689 Ga0207657_100176895 270
691 3300025919 Ga0207657_10094132 Ga0207657_100941322 270
692 3300025920 Ga0207649_10000368 Ga0207649_1000036822 270
693 3300025921 Ga0207652_10319674 Ga0207652_103196742 270
694 3300025922 Ga0207646_10034770 Ga0207646_100347701 270
695 3300025922 Ga0207646_10040676 Ga0207646_100406764 270
696 3300025922 Ga0207646_10086805 Ga0207646_100868054 270
697 3300025923 Ga0207681_10505478 Ga0207681_105054781 270
698 3300025924 Ga0207694_10000002 Ga0207694_10000002123 270
699 3300025924 Ga0207694_10000003 Ga0207694_10000003977 270
700 3300025925 Ga0207650_10000042 Ga0207650_1000004210 270
701 3300025925 Ga0207650_10000096 Ga0207650_1000009621 270
702 3300025925 Ga0207650_10021093 Ga0207650_100210934 270
703 3300025925 Ga0207650_10101155 Ga0207650_101011555 270
704 3300025925 Ga0207650_10180669 Ga0207650_101806693 270
705 3300025925 Ga0207650_10301272 Ga0207650_103012721 270
706 3300025925 Ga0207650_10428142 Ga0207650_104281422 270
707 3300025926 Ga0207659_10000004 Ga0207659_1000000460 270
708 3300025926 Ga0207659_10051333 Ga0207659_100513333 270
709 3300025926 Ga0207659_10106308 Ga0207659_101063083 270
710 3300025927 Ga0207687_10000035 Ga0207687_1000003542 270
711 3300025927 Ga0207687_10000168 Ga0207687_1000016824 270
712 3300025927 Ga0207687_10000464 Ga0207687_100004649 270
713 3300025927 Ga0207687_10016240 Ga0207687_100162403 270
714 3300025928 Ga0207700_10005786 Ga0207700_100057865 270
715 3300025928 Ga0207700_10243953 Ga0207700_102439531 270
716 3300025929 Ga0207664_10001776 Ga0207664_100017764 270
717 3300025929 Ga0207664_10217767 Ga0207664_102177672 270
718 3300025931 Ga0207644_10015351 Ga0207644_100153513 270
719 3300025931 Ga0207644_10015403 Ga0207644_100154034 270
720 3300025931 Ga0207644_10049069 Ga0207644_100490692 270
721 3300025931 Ga0207644_10118265 Ga0207644_101182653 270
722 3300025932 Ga0207690_10117646 Ga0207690_101176462 270
723 3300025933 Ga0207706_10011170 Ga0207706_100111704 270
724 3300025933 Ga0207706_10397579 Ga0207706_103975792 270
725 3300025933 Ga0207706_10600576 Ga0207706_106005762 270
726 3300025934 Ga0207686_10003869 Ga0207686_100038693 270
727 3300025934 Ga0207686_10059590 Ga0207686_100595902 270
728 3300025936 Ga0207670_10006036 Ga0207670_100060366 270
729 3300025936 Ga0207670_10043755 Ga0207670_100437553 270
730 3300025936 Ga0207670_10045863 Ga0207670_100458633 270
731 3300025936 Ga0207670_10116275 Ga0207670_101162752 270
732 3300025937 Ga0207669_10116102 Ga0207669_101161022 270
733 3300025937 Ga0207669_10242330 Ga0207669_102423301 270
734 3300025938 Ga0207704_10004800 Ga0207704_100048005 270
735 3300025938 Ga0207704_10199952 Ga0207704_101999522 270
736 3300025938 Ga0207704_10210470 Ga0207704_102104701 270
737 3300025939 Ga0207665_10012109 Ga0207665_100121093 270
738 3300025939 Ga0207665_10164650 Ga0207665_101646501 270
739 3300025940 Ga0207691_10002082 Ga0207691_100020828 270
740 3300025940 Ga0207691_10003224 Ga0207691_100032243 270
741 3300025940 Ga0207691_10005085 Ga0207691_100050857 270
742 3300025941 Ga0207711_10020961 Ga0207711_100209614 270
743 3300025941 Ga0207711_10105223 Ga0207711_101052232 270
744 3300025942 Ga0207689_10016882 Ga0207689_100168823 270
745 3300025942 Ga0207689_10028224 Ga0207689_100282243 270
746 3300025942 Ga0207689_10199489 Ga0207689_101994892 270
747 3300025942 Ga0207689_10202642 Ga0207689_102026422 270
748 3300025942 Ga0207689_10295027 Ga0207689_102950271 270
749 3300025944 Ga0207661_10000672 Ga0207661_1000067210 270
750 3300025944 Ga0207661_10001945 Ga0207661_100019457 270
751 3300025944 Ga0207661_10199654 Ga0207661_101996542 270
752 3300025945 Ga0207679_10000989 Ga0207679_100009897 270
753 3300025945 Ga0207679_10011505 Ga0207679_100115053 270
754 3300025945 Ga0207679_10063361 Ga0207679_100633612 270
755 3300025945 Ga0207679_10132425 Ga0207679_101324252 270
756 3300025945 Ga0207679_10133214 Ga0207679_101332143 270
757 3300025961 Ga0207712_10182895 Ga0207712_101828952 270
758 3300025961 Ga0207712_10198495 Ga0207712_101984951 270
759 3300025972 Ga0207668_10092308 Ga0207668_100923082 270
760 3300025981 Ga0207640_10014894 Ga0207640_100148944 270
761 3300025986 Ga0207658_10257740 Ga0207658_102577402 270
762 3300025986 Ga0207658_10327839 Ga0207658_103278392 270
763 3300025986 Ga0207658_10683426 Ga0207658_106834261 270
764 3300026023 Ga0207677_10001337 Ga0207677_100013379 270
765 3300026023 Ga0207677_10180448 Ga0207677_101804482 270
766 3300026023 Ga0207677_10308309 Ga0207677_103083092 270
767 3300026035 Ga0207703_10000016 Ga0207703_1000001697 270
768 3300026035 Ga0207703_10101548 Ga0207703_101015482 270
769 3300026035 Ga0207703_10126475 Ga0207703_101264753 270
770 3300026035 Ga0207703_10159156 Ga0207703_101591563 270
771 3300026041 Ga0207639_10000042 Ga0207639_1000004295 270
772 3300026041 Ga0207639_10116652 Ga0207639_101166522 270
773 3300026067 Ga0207678_10009373 Ga0207678_100093732 270
774 3300026067 Ga0207678_10021390 Ga0207678_100213903 270
775 3300026075 Ga0207708_10003095 Ga0207708_100030955 270
776 3300026078 Ga0207702_10041525 Ga0207702_100415252 270
777 3300026088 Ga0207641_10001156 Ga0207641_1000115610 270
778 3300026088 Ga0207641_10261002 Ga0207641_102610022 270
779 3300026088 Ga0207641_10287080 Ga0207641_102870801 270
780 3300026089 Ga0207648_10001445 Ga0207648_1000144520 270
781 3300026095 Ga0207676_10000002 Ga0207676_10000002775 270
782 3300026095 Ga0207676_10001312 Ga0207676_1000131210 270
783 3300026095 Ga0207676_10041537 Ga0207676_100415372 270
784 3300026095 Ga0207676_10061723 Ga0207676_100617232 270
785 3300026095 Ga0207676_10132830 Ga0207676_101328302 270
786 3300026116 Ga0207674_10022320 Ga0207674_100223206 270
787 3300026116 Ga0207674_10323509 Ga0207674_103235092 270
788 3300026118 Ga0207675_100048240 Ga0207675_1000482402 270
789 3300026121 Ga0207683_10003266 Ga0207683_100032664 270
790 3300026121 Ga0207683_10029038 Ga0207683_100290384 270
791 3300027364 Ga0209967_1000723 Ga0209967_10007233 270
792 3300027378 Ga0209981_1000419 Ga0209981_10004194 270
793 3300027395 Ga0209996_1000408 Ga0209996_10004082 270
794 3300027424 Ga0209984_1000281 Ga0209984_10002813 270
795 3300027462 Ga0210000_1000240 Ga0210000_10002404 270
796 3300027471 Ga0209995_1000559 Ga0209995_10005593 270
797 3300027526 Ga0209968_1001231 Ga0209968_10012313 270
798 3300027552 Ga0209982_1001014 Ga0209982_10010142 270
799 3300027614 Ga0209970_1002927 Ga0209970_10029273 270
800 3300027617 Ga0210002_1000456 Ga0210002_10004565 270
801 3300027665 Ga0209983_1000664 Ga0209983_10006644 270
802 3300027682 Ga0209971_1001145 Ga0209971_10011453 270
803 3300027695 Ga0209966_1000697 Ga0209966_10006975 270
804 3300027717 Ga0209998_10000329 Ga0209998_100003299 270
805 3300027876 Ga0209974_10006156 Ga0209974_100061563 270
806 3300027907 Ga0207428_10000014 Ga0207428_10000014235 270
807 3300027907 Ga0207428_10022302 Ga0207428_100223025 270
808 3300027907 Ga0207428_10247048 Ga0207428_102470482 270
809 3300027907 Ga0207428_10380340 Ga0207428_103803401 270
810 3300028379 Ga0268266_10000153 Ga0268266_1000015386 270
811 3300028379 Ga0268266_10006720 Ga0268266_100067203 270
812 3300028379 Ga0268266_10047773 Ga0268266_100477733 270
813 3300028379 Ga0268266_10268721 Ga0268266_102687212 270
814 3300028380 Ga0268265_10006690 Ga0268265_100066902 270
815 3300028380 Ga0268265_10036360 Ga0268265_100363603 270
816 3300028380 Ga0268265_10225836 Ga0268265_102258362 270
817 3300028380 Ga0268265_10293460 Ga0268265_102934602 270
818 3300028380 Ga0268265_10673348 Ga0268265_106733482 270
819 3300028381 Ga0268264_10011082 Ga0268264_100110827 270
820 3300028381 Ga0268264_10123289 Ga0268264_101232893 270
821 3300028381 Ga0268264_10420158 Ga0268264_104201581 270
822 3300028381 Ga0268264_10600621 Ga0268264_106006211 270
823 3300028381 Ga0268264_10862023 Ga0268264_108620231 270
824 3300030521 Ga0307511_10006985 Ga0307511_100069852 270
825 3300031090 Ga0265760_10048931 Ga0265760_100489312 270
826 3300031235 Ga0265330_10003447 Ga0265330_100034473 270
827 3300031238 Ga0265332_10000139 Ga0265332_1000013944 270
828 3300031239 Ga0265328_10003149 Ga0265328_100031493 270
829 3300031250 Ga0265331_10000224 Ga0265331_100002249 270
830 3300031251 Ga0265327_10069309 Ga0265327_100693093 270
831 3300031344 Ga0265316_10000266 Ga0265316_1000026644 270
832 3300031711 Ga0265314_10000743 Ga0265314_100007437 270
833 3300031712 Ga0265342_10010095 Ga0265342_100100955 270
834 3300032133 Ga0316583_10117819 Ga0316583_101178192 270
835 3300035118 Ga0373954_0136394 Ga0373954_0136394_340_1152 270
836 3300035172 Ga0373955_0173250 Ga0373955_0173250_28_840 270
837 3300035691 Ga0373931_0226850 Ga0373931_0226850_152_964 270
838 3300039437 Ga0436365_0703007 Ga0436365_0703007_16966_17778 270
839 3300039437 Ga0436365_0962899 Ga0436365_0962899_87232_88044 270
840 3300039450 Ga0436363_0797270 Ga0436363_0797270_334_1146 270
841 3300039450 Ga0436363_1660411 Ga0436363_1660411_294_1106 270
842 3300039453 Ga0436362_0093143 Ga0436362_0093143_174_986 270
843 3300039453 Ga0436362_0290430 Ga0436362_0290430_34215_35027 270
844 3300039453 Ga0436362_1080070 Ga0436362_1080070_6960_7772 270
845 3300041496 Ga0451839_1391315 Ga0451839_1391315_451_1263 270
846 3300042184 Ga0450908_017695 Ga0450908_017695_324_1136 270
847 3300042439 Ga0439464_0003061 Ga0439464_0003061_310_1122 270
848 3300042439 Ga0439464_0013195 Ga0439464_0013195_882_1694 270
849 3300042461 Ga0439460_0082584 Ga0439460_0082584_11_823 270
850 3300042876 Ga0451577_0117378 Ga0451577_0117378_1328_2140 270
851 3300044683 Ga0466965_0191429 Ga0466965_0191429_76_888 270
852 3300044706 Ga0466964_0166114 Ga0466964_0166114_79_891 270
853 3300044712 Ga0453684_0012582 Ga0453684_0012582_7318_8130 270
854 3300044712 Ga0453684_0013830 Ga0453684_0013830_1485_2297 270
855 3300044712 Ga0453684_0071548 Ga0453684_0071548_1770_2582 270
856 3300044712 Ga0453684_0700050 Ga0453684_0700050_157_969 270
857 3300044719 Ga0466971_0000027 Ga0466971_0000027_30352_31164 270
858 3300044842 Ga0466957_0002787 Ga0466957_0002787_1425_2237 270
859 3300045051 Ga0451576_0195712 Ga0451576_0195712_1281_2093 270
860 3300045051 Ga0451576_0259957 Ga0451576_0259957_194_1006 270
861 3300045051 Ga0451576_0813242 Ga0451576_0813242_123_935 270
862 3300045976 Ga0466967_0043333 Ga0466967_0043333_2356_3168 270
863 3300046462 Ga0495651_0036005 Ga0495651_0036005_2847_3659 270
864 3300046463 Ga0495653_0120513 Ga0495653_0120513_636_1448 270
865 3300046472 Ga0495580_0000846 Ga0495580_0000846_7557_8369 270
866 3300046472 Ga0495580_0142249 Ga0495580_0142249_802_1614 270
867 3300046473 Ga0495582_0000930 Ga0495582_0000930_14496_15308 270
868 3300046473 Ga0495582_0251875 Ga0495582_0251875_17_829 270
869 3300046476 Ga0495662_0002226 Ga0495662_0002226_5629_6441 270
870 3300046476 Ga0495662_0218607 Ga0495662_0218607_62_874 270
871 3300046477 Ga0495664_0053849 Ga0495664_0053849_828_1640 270
872 3300046511 Ga0495608_0233315 Ga0495608_0233315_24_836 270
873 3300046514 Ga0495618_0043471 Ga0495618_0043471_1516_2328 270
874 3300046516 Ga0495628_0008311 Ga0495628_0008311_44_856 270
875 3300046517 Ga0495630_0041419 Ga0495630_0041419_413_1225 270
876 3300046529 Ga0495652_0121564 Ga0495652_0121564_338_1150 270
877 3300046535 Ga0495586_0028557 Ga0495586_0028557_945_1757 270
878 3300046543 Ga0495645_0001895 Ga0495645_0001895_10527_11339 270
879 3300046558 Ga0495633_0202564 Ga0495633_0202564_42_854 270
880 3300046559 Ga0495667_0023218 Ga0495667_0023218_1405_2217 270
881 3300046642 Ga0495634_0142707 Ga0495634_0142707_121_933 270
882 3300046678 Ga0495599_0086881 Ga0495599_0086881_173_985 270
883 3300046679 Ga0495623_0035368 Ga0495623_0035368_1467_2279 270
884 3300046684 Ga0495669_0114628 Ga0495669_0114628_244_1056 270
885 3300047317 Ga0495604_0300875 Ga0495604_0300875_205_1017 270
886 3300047322 Ga0495680_0015803 Ga0495680_0015803_834_1646 270
887 3300047444 Ga0495675_0071358 Ga0495675_0071358_1219_2031 270
888 3300048088 Ga0495602_0040722 Ga0495602_0040722_3088_3900 270
889 3300048904 Ga0496101_0023085 Ga0496101_0023085_1508_2320 270
890 3300048905 Ga0496102_0077079 Ga0496102_0077079_1941_2753 270
891 3300048905 Ga0496102_0150216 Ga0496102_0150216_217_1029 270
892 3300048905 Ga0496102_0236967 Ga0496102_0236967_86_898 270
893 3300048907 Ga0496104_0004299 Ga0496104_0004299_6502_7314 270
894 3300048907 Ga0496104_0157238 Ga0496104_0157238_927_1739 270
895 3300048907 Ga0496104_0386337 Ga0496104_0386337_285_1097 270
896 3300048909 Ga0496106_0232266 Ga0496106_0232266_633_1445 270
897 3300048910 Ga0496107_0192850 Ga0496107_0192850_73_885 270
898 3300048911 Ga0496108_0001670 Ga0496108_0001670_6315_7127 270
899 3300048911 Ga0496108_0011573 Ga0496108_0011573_1835_2647 270
900 3300048912 Ga0496109_0000059 Ga0496109_0000059_10486_11298 270
901 3300048912 Ga0496109_0037614 Ga0496109_0037614_3088_3900 270
902 3300048912 Ga0496109_0100183 Ga0496109_0100183_363_1175 270
903 3300048913 Ga0496110_0048813 Ga0496110_0048813_111_923 270
904 3300048913 Ga0496110_0067434 Ga0496110_0067434_1554_2366 270
905 3300048914 Ga0496111_0028871 Ga0496111_0028871_1338_2150 270
906 3300048915 Ga0496112_0000504 Ga0496112_0000504_15145_15957 270
907 3300048915 Ga0496112_0014024 Ga0496112_0014024_687_1499 270
908 3300048915 Ga0496112_0577263 Ga0496112_0577263_45_857 270
909 3300048916 Ga0496113_0001118 Ga0496113_0001118_11991_12803 270
910 3300048916 Ga0496113_0080682 Ga0496113_0080682_566_1378 270
911 3300048918 Ga0496115_0002416 Ga0496115_0002416_95_907 270
912 3300049569 Ga0501032_0000027 Ga0501032_0000027_96123_96935 270
913 3300049570 Ga0501033_0000002 Ga0501033_0000002_161758_162570 270
914 3300049570 Ga0501033_0000008 Ga0501033_0000008_87649_88461 270
915 3300049573 Ga0501037_0000002 Ga0501037_0000002_140903_141715 270
916 3300049573 Ga0501037_0154617 Ga0501037_0154617_781_1593 270
917 3300049574 Ga0501038_0000801 Ga0501038_0000801_25134_25946 270
918 3300049575 Ga0501039_0070008 Ga0501039_0070008_530_1342 270
919 3300049575 Ga0501039_0471435 Ga0501039_0471435_83_895 270
920 3300049577 Ga0501041_0025890 Ga0501041_0025890_179_991 270
921 3300049578 Ga0501042_0021910 Ga0501042_0021910_1864_2676 270
922 3300049579 Ga0501043_0012458 Ga0501043_0012458_1376_2188 270
923 3300049582 Ga0501048_0039099 Ga0501048_0039099_879_1691 270
924 3300049587 Ga0501071_0054505 Ga0501071_0054505_113_925 270
925 3300049588 Ga0501072_0004986 Ga0501072_0004986_6923_7735 270
926 3300049591 Ga0501075_0055592 Ga0501075_0055592_1810_2622 270
927 3300049593 Ga0501077_0172901 Ga0501077_0172901_60_872 270
928 3300049741 Ga0501079_0042388 Ga0501079_0042388_765_1577 270
929 3300049743 Ga0501081_0107736 Ga0501081_0107736_1077_1889 270
930 3300049743 Ga0501081_0156377 Ga0501081_0156377_380_1192 270
931 3300049822 Ga0501035_0051602 Ga0501035_0051602_1932_2744 270
932 3300049823 Ga0501044_0001568 Ga0501044_0001568_21977_22789 270
933 3300049824 Ga0501045_0018375 Ga0501045_0018375_3112_3924 270
934 3300049824 Ga0501045_0208192 Ga0501045_0208192_591_1403 270
935 3300050491 nmdc:mga00v17_167751_c1 nmdc:mga00v17_167751_c1_136_948 270
936 3300050491 nmdc:mga00v17_19417_c1 nmdc:mga00v17_19417_c1_882_1694 270
937 3300050492 nmdc:mga0yw44_9395_c1 nmdc:mga0yw44_9395_c1_4068_4880 270
938 3300050493 nmdc:mga0k408_4424_c1 nmdc:mga0k408_4424_c1_6361_7173 270
939 3300050496 nmdc:mga07m45_5600_c1 nmdc:mga07m45_5600_c1_918_1730 270
940 3300050507 nmdc:mga05p37_27870_c1 nmdc:mga05p37_27870_c1_5925_6737 270
941 3300050507 nmdc:mga05p37_5248_c1 nmdc:mga05p37_5248_c1_1397_2209 270
942 3300050507 nmdc:mga05p37_645163_c1 nmdc:mga05p37_645163_c1_244_1056 270
943 3300050507 nmdc:mga05p37_7929_c1 nmdc:mga05p37_7929_c1_8679_9491 270
944 3300050508 nmdc:mga09592_94837_c1 nmdc:mga09592_94837_c1_213_1025 270
945 3300050510 nmdc:mga06r32_253175_c1 nmdc:mga06r32_253175_c1_339_1151 270
946 3300050510 nmdc:mga06r32_3603_c1 nmdc:mga06r32_3603_c1_12471_13283 270
947 3300050511 nmdc:mga08y16_123850_c1 nmdc:mga08y16_123850_c1_1697_2509 270
948 3300050511 nmdc:mga08y16_23_c1 nmdc:mga08y16_23_c1_194901_195713 270
949 3300050511 nmdc:mga08y16_26456_c1 nmdc:mga08y16_26456_c1_1348_2160 270
950 3300050511 nmdc:mga08y16_69453_c1 nmdc:mga08y16_69453_c1_2576_3388 270
951 3300050512 nmdc:mga0n895_17787_c1 nmdc:mga0n895_17787_c1_74_886 270
952 3300050512 nmdc:mga0n895_388976_c1 nmdc:mga0n895_388976_c1_555_1367 270
953 3300050512 nmdc:mga0n895_400320_c2 nmdc:mga0n895_400320_c2_147_959 270
954 3300050512 nmdc:mga0n895_65895_c1 nmdc:mga0n895_65895_c1_318_1130 270
955 3300050513 nmdc:mga0rr50_14388_c1 nmdc:mga0rr50_14388_c1_1127_1939 270
956 3300050513 nmdc:mga0rr50_167_c2 nmdc:mga0rr50_167_c2_2117_2929 270
957 3300050513 nmdc:mga0rr50_320162_c1 nmdc:mga0rr50_320162_c1_107_919 270
958 3300050513 nmdc:mga0rr50_339463_c1 nmdc:mga0rr50_339463_c1_119_931 270
959 3300050513 nmdc:mga0rr50_520818_c1 nmdc:mga0rr50_520818_c1_158_970 270
960 3300050513 nmdc:mga0rr50_7803_c1 nmdc:mga0rr50_7803_c1_3001_3813 270
961 3300050514 nmdc:mga08x19_115725_c1 nmdc:mga08x19_115725_c1_880_1692 270
962 3300050514 nmdc:mga08x19_57641_c1 nmdc:mga08x19_57641_c1_1064_1876 270
963 3300050515 nmdc:mga0a205_21835_c1 nmdc:mga0a205_21835_c1_432_1244 270
964 3300050515 nmdc:mga0a205_270381_c1 nmdc:mga0a205_270381_c1_742_1554 270
965 3300050515 nmdc:mga0a205_469705_c1 nmdc:mga0a205_469705_c1_201_1013 270
966 3300050515 nmdc:mga0a205_60997_c1 nmdc:mga0a205_60997_c1_1439_2251 270
967 3300053077 Ga0495601_0144125 Ga0495601_0144125_437_1249 270
968 3300053084 Ga0495595_0168370 Ga0495595_0168370_59_871 270
969 3300053085 Ga0495619_0216901 Ga0495619_0216901_43_855 270
970 3300054114 Ga0501084_0300456 Ga0501084_0300456_191_1003 270
971 3300054114 Ga0501084_0528549 Ga0501084_0528549_90_902 270
972 3300061719 Ga0466962_0000032 Ga0466962_0000032_36751_37563 270
973 3300061734 Ga0530510_0003691 Ga0530510_0003691_6278_7090 270
974 3300049569 Ga0501032_0125309 Ga0501032_0125309_615_1430 271
975 3300005530 Ga0070679_100679455 Ga0070679_1006794551 272
976 3300005618 Ga0068864_100032014 Ga0068864_1000320142 272
977 3300005841 Ga0068863_100347529 Ga0068863_1003475292 272
978 3300025921 Ga0207652_10595904 Ga0207652_105959041 272
979 3300026088 Ga0207641_10450068 Ga0207641_104500682 272
980 3300026095 Ga0207676_10011182 Ga0207676_100111824 272
981 3300026116 Ga0207674_10319374 Ga0207674_103193742 272
982 3300035121 Ga0373960_0005070 Ga0373960_0005070_964_1788 272
983 3300035691 Ga0373931_0071776 Ga0373931_0071776_1029_1853 272
984 3300037471 Ga0395905_0590589 Ga0395905_0590589_67_891 272
985 3300048907 Ga0496104_0638750 Ga0496104_0638750_70_894 272
986 3300048911 Ga0496108_0006367 Ga0496108_0006367_3938_4762 272
987 3300048912 Ga0496109_0044575 Ga0496109_0044575_96_920 272
988 3300048914 Ga0496111_0053860 Ga0496111_0053860_2058_2882 272
989 3300048915 Ga0496112_0000524 Ga0496112_0000524_4978_5802 272
990 3300048916 Ga0496113_0003691 Ga0496113_0003691_8349_9173 272
991 3300002155 JGI24033J26618_1000149 JGI24033J26618_10001494 273
992 3300005329 Ga0070683_100054463 Ga0070683_1000544634 273
993 3300005344 Ga0070661_100000291 Ga0070661_10000029115 273
994 3300005444 Ga0070694_100186069 Ga0070694_1001860692 273
995 3300005456 Ga0070678_100053693 Ga0070678_1000536933 273
996 3300005458 Ga0070681_10174970 Ga0070681_101749704 273
997 3300005535 Ga0070684_100040965 Ga0070684_1000409655 273
998 3300005985 Ga0081539_10001123 Ga0081539_100011233 273
999 3300006846 Ga0075430_100058695 Ga0075430_1000586953 273
1000 3300006880 Ga0075429_100031235 Ga0075429_1000312353 273
1001 3300006914 Ga0075436_100069780 Ga0075436_1000697802 273
1002 3300009093 Ga0105240_10078220 Ga0105240_100782205 273
1003 3300009094 Ga0111539_10026924 Ga0111539_100269243 273
1004 3300009147 Ga0114129_10011206 Ga0114129_100112065 273
1005 3300009553 Ga0105249_10596894 Ga0105249_105968941 273
1006 3300013296 Ga0157374_10052698 Ga0157374_100526985 273
1007 3300013297 Ga0157378_10039658 Ga0157378_100396583 273
1008 3300025912 Ga0207707_10437300 Ga0207707_104373001 273
1009 3300025920 Ga0207649_10000125 Ga0207649_1000012513 273
1010 3300026121 Ga0207683_10172876 Ga0207683_101728762 273
1011 3300027907 Ga0207428_10011414 Ga0207428_100114142 273
1012 3300031344 Ga0265316_10190630 Ga0265316_101906301 273
1013 3300031711 Ga0265314_10145657 Ga0265314_101456571 273
1014 3300031731 Ga0307405_10329179 Ga0307405_103291792 273
1015 3300031995 Ga0307409_100506949 Ga0307409_1005069492 273
1016 3300037466 Ga0395898_0000051 Ga0395898_0000051_69588_70427 273
1017 3300042436 Ga0439435_0024455 Ga0439435_0024455_390_1271 273
1018 3300042439 Ga0439464_0035168 Ga0439464_0035168_501_1382 273
1019 3300042461 Ga0439460_0010392 Ga0439460_0010392_1349_2230 273
1020 3300044842 Ga0466957_0007651 Ga0466957_0007651_691_1530 273
1021 3300048905 Ga0496102_0039382 Ga0496102_0039382_2132_2986 273
1022 3300048906 Ga0496103_0163800 Ga0496103_0163800_440_1264 273
1023 3300048916 Ga0496113_0122054 Ga0496113_0122054_297_1151 273
1024 3300050508 nmdc:mga09592_18276_c1 nmdc:mga09592_18276_c1_2531_3355 273
1025 3300050511 nmdc:mga08y16_148389_c1 nmdc:mga08y16_148389_c1_761_1588 273
1026 3300050511 nmdc:mga08y16_21091_c1 nmdc:mga08y16_21091_c1_5319_6143 273
1027 3300050513 nmdc:mga0rr50_64578_c1 nmdc:mga0rr50_64578_c1_673_1500 273
1028 3300050514 nmdc:mga08x19_30835_c1 nmdc:mga08x19_30835_c1_1248_2075 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

200

0.91

PF02463

SMC_N

RecF/RecN/SMC N terminal domain

41

250

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9235 5 235
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9179 5 235
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.912 5 235
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9045 5 247
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9008 3 235
ID Description Score Start End Superfamily
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9198 4 235 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.918 5 73 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9179 5 234 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9138 4 235 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9112 1 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X7BUJ3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9634 4 253 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7X7BUJ3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9559 4 253 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7L9RRY7-F1-model_v4 Ferric enterobactin transport ATP-binding protein FepC 0.954 4 254 GO:0005524
GO:0016887
AF-A0A090SKW3-F1-model_v4 deleted 0.942 12 265
AF-A0A7C7LRK7-F1-model_v4 Spermidine/putrescine import ATP-binding protein PotA (EC 7.6.2.11) 0.9344 2 235 GO:0005524
GO:0015417
GO:0016887
GO:0043190

Feature Viewer

pLDDT pTM Quality
89.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map