F488555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1028 | 372 | 1018 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300042436|Ga0439435_0024455|Ga0439435_0024455_390_1271 |
| Length | 293 |
| Sequence | MAASMHDLRDVSSADRSERPGEAMLEVERLSKTFNPASPNEVRALQGLSLTIAEGSFVVVVGTNGSGKSSLLNAIAGTFRPDDGRIRLNGVDVTRWPEHRRAALIGRVFQNPFSGTAASMSIAENVVLAARRGQSRGLAWAIRKSMREELRTRVRQLNMGLEDRLDNAIGSLSGGQRQALTLLMATWRQPKLLLLDEHTAALDPKSADQVIVLSEQIVSRSQLTTLMVTHSMQQAVHVGDRVVMMHRGHVLHDFRGAEKRRLRVEDLLARFEALRRADRLDESAAEMLRRQYV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 2 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 3 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 4 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 5 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 6 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 7 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 8 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 9 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 10 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 11 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 244 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 262 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 265 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.5 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 89.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1000149 | 3300002155 | Bacteria | 8986 |
| 2 | Ga0065715_10002119 | 3300005293 | Bacteria | 23084 |
| 3 | Ga0065715_10030856 | 3300005293 | Bacteria | 1367 |
| 4 | Ga0065707_10001658 | 3300005295 | Bacteria | 11490 |
| 5 | Ga0065707_10118864 | 3300005295 | Bacteria | 2131 |
| 6 | Ga0070658_10089977 | 3300005327 | Bacteria | 2528 |
| 7 | Ga0070683_100002845 | 3300005329 | Bacteria | 13852 |
| 8 | Ga0070683_100004548 | 3300005329 | Bacteria | 11446 |
| 9 | Ga0070683_100054463 | 3300005329 | Bacteria | 3709 |
| 10 | Ga0070683_100123270 | 3300005329 | Bacteria | 2449 |
| 11 | Ga0070690_100033965 | 3300005330 | Bacteria | 3195 |
| 12 | Ga0070690_100241362 | 3300005330 | Bacteria | 1274 |
| 13 | Ga0070690_100320693 | 3300005330 | Bacteria | 1116 |
| 14 | Ga0070670_100000820 | 3300005331 | Bacteria | 24241 |
| 15 | Ga0070670_100003875 | 3300005331 | Bacteria | 12479 |
| 16 | Ga0070670_100010463 | 3300005331 | Bacteria | 7916 |
| 17 | Ga0070670_100069892 | 3300005331 | Bacteria | 3014 |
| 18 | Ga0070670_100090414 | 3300005331 | Bacteria | 2631 |
| 19 | Ga0070670_100254825 | 3300005331 | Bacteria | 1529 |
| 20 | Ga0068869_100012999 | 3300005334 | Bacteria | 5523 |
| 21 | Ga0068869_100255203 | 3300005334 | Bacteria | 1402 |
| 22 | Ga0068869_100287621 | 3300005334 | Bacteria | 1323 |
| 23 | Ga0068869_100378361 | 3300005334 | Bacteria | 1160 |
| 24 | Ga0070680_100033895 | 3300005336 | Bacteria | 4118 |
| 25 | Ga0070680_100419531 | 3300005336 | Bacteria | 1141 |
| 26 | Ga0070682_100000004 | 3300005337 | Bacteria | 388780 |
| 27 | Ga0070682_100194608 | 3300005337 | Bacteria | 1426 |
| 28 | Ga0068868_100078134 | 3300005338 | Bacteria | 2649 |
| 29 | Ga0068868_100091353 | 3300005338 | Bacteria | 2453 |
| 30 | Ga0068868_100106402 | 3300005338 | Bacteria | 2275 |
| 31 | Ga0068868_100124236 | 3300005338 | Bacteria | 2107 |
| 32 | Ga0070660_100047624 | 3300005339 | Bacteria | 3290 |
| 33 | Ga0070689_100001924 | 3300005340 | Bacteria | 13432 |
| 34 | Ga0070689_100013571 | 3300005340 | Bacteria | 5900 |
| 35 | Ga0070689_100057944 | 3300005340 | Unclassified | 3008 |
| 36 | Ga0070689_100249136 | 3300005340 | Bacteria | 1465 |
| 37 | Ga0070689_100342164 | 3300005340 | Bacteria | 1253 |
| 38 | Ga0070689_100493901 | 3300005340 | Bacteria | 1047 |
| 39 | Ga0070691_10011278 | 3300005341 | Bacteria | 4078 |
| 40 | Ga0070687_100049508 | 3300005343 | Bacteria | 2166 |
| 41 | Ga0070661_100000291 | 3300005344 | Bacteria | 40590 |
| 42 | Ga0070661_100002867 | 3300005344 | Bacteria | 11845 |
| 43 | Ga0070661_100004118 | 3300005344 | Bacteria | 10026 |
| 44 | Ga0070661_100024937 | 3300005344 | Bacteria | 4293 |
| 45 | Ga0070661_100073714 | 3300005344 | Bacteria | 2513 |
| 46 | Ga0070692_10431632 | 3300005345 | Bacteria | 839 |
| 47 | Ga0070668_100009618 | 3300005347 | Bacteria | 7173 |
| 48 | Ga0070668_100024023 | 3300005347 | Bacteria | 4616 |
| 49 | Ga0070675_100000001 | 3300005354 | Bacteria | 448137 |
| 50 | Ga0070675_100011820 | 3300005354 | Bacteria | 6840 |
| 51 | Ga0070675_100018439 | 3300005354 | Bacteria | 5554 |
| 52 | Ga0070675_100035820 | 3300005354 | Bacteria | 4035 |
| 53 | Ga0070671_100007890 | 3300005355 | Bacteria | 8510 |
| 54 | Ga0070671_100022410 | 3300005355 | Bacteria | 5158 |
| 55 | Ga0070671_100024298 | 3300005355 | Unclassified | 4961 |
| 56 | Ga0070671_100025797 | 3300005355 | Unclassified | 4825 |
| 57 | Ga0070671_100179197 | 3300005355 | Bacteria | 1794 |
| 58 | Ga0070674_100001535 | 3300005356 | Bacteria | 12331 |
| 59 | Ga0070674_100031586 | 3300005356 | Bacteria | 3510 |
| 60 | Ga0070674_100035635 | 3300005356 | Bacteria | 3334 |
| 61 | Ga0070673_100003439 | 3300005364 | Bacteria | 9865 |
| 62 | Ga0070673_100079913 | 3300005364 | Bacteria | 2649 |
| 63 | Ga0070673_100163274 | 3300005364 | Bacteria | 1896 |
| 64 | Ga0070673_100194377 | 3300005364 | Bacteria | 1744 |
| 65 | Ga0070673_100315350 | 3300005364 | Unclassified | 1380 |
| 66 | Ga0070688_100051863 | 3300005365 | Bacteria | 2560 |
| 67 | Ga0070688_100124157 | 3300005365 | Unclassified | 1733 |
| 68 | Ga0070659_100089356 | 3300005366 | Unclassified | 2468 |
| 69 | Ga0070659_100093537 | 3300005366 | Bacteria | 2412 |
| 70 | Ga0070659_100162214 | 3300005366 | Bacteria | 1828 |
| 71 | Ga0070667_100032389 | 3300005367 | Bacteria | 4360 |
| 72 | Ga0070667_100210066 | 3300005367 | Bacteria | 1730 |
| 73 | Ga0070667_100298785 | 3300005367 | Bacteria | 1449 |
| 74 | Ga0070667_100377910 | 3300005367 | Bacteria | 1286 |
| 75 | Ga0070709_10006794 | 3300005434 | Bacteria | 6244 |
| 76 | Ga0070709_10035864 | 3300005434 | Bacteria | 3016 |
| 77 | Ga0070709_10042037 | 3300005434 | Bacteria | 2820 |
| 78 | Ga0070709_10288995 | 3300005434 | Bacteria | 1194 |
| 79 | Ga0070714_100008442 | 3300005435 | Bacteria | 8045 |
| 80 | Ga0070713_100007824 | 3300005436 | Bacteria | 7534 |
| 81 | Ga0070701_10001225 | 3300005438 | Bacteria | 9412 |
| 82 | Ga0070701_10082508 | 3300005438 | Bacteria | 1743 |
| 83 | Ga0070711_100019931 | 3300005439 | Bacteria | 4313 |
| 84 | Ga0070711_100177033 | 3300005439 | Bacteria | 1630 |
| 85 | Ga0070711_100282450 | 3300005439 | Bacteria | 1314 |
| 86 | Ga0070705_100018362 | 3300005440 | Bacteria | 3665 |
| 87 | Ga0070700_100001362 | 3300005441 | Bacteria | 12140 |
| 88 | Ga0070700_100365152 | 3300005441 | Bacteria | 1075 |
| 89 | Ga0070694_100075624 | 3300005444 | Bacteria | 2330 |
| 90 | Ga0070694_100186069 | 3300005444 | Bacteria | 1539 |
| 91 | Ga0070694_100187170 | 3300005444 | Bacteria | 1535 |
| 92 | Ga0070694_100616851 | 3300005444 | Bacteria | 875 |
| 93 | Ga0070708_100013131 | 3300005445 | Bacteria | 6777 |
| 94 | Ga0070708_100019263 | 3300005445 | Bacteria | 5731 |
| 95 | Ga0070663_100001965 | 3300005455 | Bacteria | 11484 |
| 96 | Ga0070663_100069031 | 3300005455 | Bacteria | 2567 |
| 97 | Ga0070663_100174639 | 3300005455 | Bacteria | 1663 |
| 98 | Ga0070678_100002371 | 3300005456 | Bacteria | 10298 |
| 99 | Ga0070678_100053693 | 3300005456 | Bacteria | 2932 |
| 100 | Ga0070678_100506208 | 3300005456 | Bacteria | 1066 |
| 101 | Ga0070662_100012872 | 3300005457 | Bacteria | 5558 |
| 102 | Ga0070662_100089713 | 3300005457 | Bacteria | 2306 |
| 103 | Ga0070662_100166455 | 3300005457 | Bacteria | 1728 |
| 104 | Ga0070662_100467109 | 3300005457 | Bacteria | 1049 |
| 105 | Ga0070681_10001833 | 3300005458 | Bacteria | 19168 |
| 106 | Ga0070681_10021049 | 3300005458 | Bacteria | 6535 |
| 107 | Ga0070681_10174970 | 3300005458 | Bacteria | 2068 |
| 108 | Ga0068867_100106884 | 3300005459 | Bacteria | 2144 |
| 109 | Ga0068867_100114793 | 3300005459 | Bacteria | 2074 |
| 110 | Ga0068867_100450462 | 3300005459 | Bacteria | 1096 |
| 111 | Ga0070706_100023104 | 3300005467 | Bacteria | 5726 |
| 112 | Ga0070706_100378242 | 3300005467 | Bacteria | 1319 |
| 113 | Ga0070707_100033375 | 3300005468 | Bacteria | 4908 |
| 114 | Ga0070707_100062110 | 3300005468 | Bacteria | 3584 |
| 115 | Ga0070707_100183181 | 3300005468 | Bacteria | 2042 |
| 116 | Ga0070707_100407805 | 3300005468 | Bacteria | 1319 |
| 117 | Ga0070698_100023178 | 3300005471 | Bacteria | 6490 |
| 118 | Ga0070698_100052910 | 3300005471 | Bacteria | 4128 |
| 119 | Ga0070698_100099145 | 3300005471 | Bacteria | 2887 |
| 120 | Ga0070698_100129233 | 3300005471 | Bacteria | 2482 |
| 121 | Ga0070698_100160277 | 3300005471 | Bacteria | 2194 |
| 122 | Ga0070698_100164765 | 3300005471 | Bacteria | 2160 |
| 123 | Ga0070699_100052632 | 3300005518 | Bacteria | 3522 |
| 124 | Ga0070699_100276536 | 3300005518 | Bacteria | 1503 |
| 125 | Ga0070679_100005867 | 3300005530 | Bacteria | 11403 |
| 126 | Ga0070679_100066120 | 3300005530 | Bacteria | 3604 |
| 127 | Ga0070679_100089510 | 3300005530 | Unclassified | 3065 |
| 128 | Ga0070679_100679455 | 3300005530 | Bacteria | 972 |
| 129 | Ga0070684_100000323 | 3300005535 | Bacteria | 33038 |
| 130 | Ga0070684_100007259 | 3300005535 | Bacteria | 8614 |
| 131 | Ga0070684_100018965 | 3300005535 | Bacteria | 5681 |
| 132 | Ga0070684_100040965 | 3300005535 | Bacteria | 3991 |
| 133 | Ga0070684_100049281 | 3300005535 | Bacteria | 3655 |
| 134 | Ga0070697_100027246 | 3300005536 | Bacteria | 4570 |
| 135 | Ga0070697_100207715 | 3300005536 | Bacteria | 1666 |
| 136 | Ga0068853_100043718 | 3300005539 | Bacteria | 3832 |
| 137 | Ga0068853_100290963 | 3300005539 | Bacteria | 1508 |
| 138 | Ga0068853_100494428 | 3300005539 | Bacteria | 1154 |
| 139 | Ga0068853_100603366 | 3300005539 | Archaea | 1042 |
| 140 | Ga0070672_100000404 | 3300005543 | Bacteria | 24981 |
| 141 | Ga0070672_100006663 | 3300005543 | Bacteria | 7779 |
| 142 | Ga0070672_100017030 | 3300005543 | Bacteria | 5220 |
| 143 | Ga0070672_100048222 | 3300005543 | Bacteria | 3309 |
| 144 | Ga0070672_100127658 | 3300005543 | Bacteria | 2088 |
| 145 | Ga0070672_100156897 | 3300005543 | Bacteria | 1885 |
| 146 | Ga0070686_100054708 | 3300005544 | Bacteria | 2554 |
| 147 | Ga0070686_100280339 | 3300005544 | Bacteria | 1229 |
| 148 | Ga0070686_100328628 | 3300005544 | Bacteria | 1142 |
| 149 | Ga0070686_100523939 | 3300005544 | Bacteria | 923 |
| 150 | Ga0070695_100063711 | 3300005545 | Bacteria | 2397 |
| 151 | Ga0070695_100105009 | 3300005545 | Unclassified | 1908 |
| 152 | Ga0070695_100443962 | 3300005545 | Bacteria | 993 |
| 153 | Ga0070696_100031894 | 3300005546 | Bacteria | 3613 |
| 154 | Ga0070696_100105744 | 3300005546 | Unclassified | 2022 |
| 155 | Ga0070665_100026495 | 3300005548 | Bacteria | 5837 |
| 156 | Ga0070665_100055826 | 3300005548 | Bacteria | 3960 |
| 157 | Ga0070665_100060764 | 3300005548 | Bacteria | 3788 |
| 158 | Ga0070665_100075373 | 3300005548 | Bacteria | 3380 |
| 159 | Ga0070665_100416494 | 3300005548 | Bacteria | 1352 |
| 160 | Ga0070665_100444477 | 3300005548 | Bacteria | 1306 |
| 161 | Ga0070704_100107327 | 3300005549 | Bacteria | 2118 |
| 162 | Ga0070704_100190714 | 3300005549 | Unclassified | 1647 |
| 163 | Ga0068855_100083845 | 3300005563 | Bacteria | 3692 |
| 164 | Ga0068855_100448432 | 3300005563 | Bacteria | 1408 |
| 165 | Ga0070664_100001560 | 3300005564 | Bacteria | 18306 |
| 166 | Ga0070664_100002496 | 3300005564 | Bacteria | 14830 |
| 167 | Ga0070664_100007228 | 3300005564 | Bacteria | 8958 |
| 168 | Ga0070664_100016193 | 3300005564 | Bacteria | 6110 |
| 169 | Ga0070664_100053908 | 3300005564 | Bacteria | 3410 |
| 170 | Ga0070664_100072646 | 3300005564 | Bacteria | 2951 |
| 171 | Ga0070664_100249761 | 3300005564 | Bacteria | 1594 |
| 172 | Ga0070664_100279260 | 3300005564 | Bacteria | 1506 |
| 173 | Ga0070664_100363563 | 3300005564 | Bacteria | 1318 |
| 174 | Ga0068857_100017696 | 3300005577 | Bacteria | 6250 |
| 175 | Ga0068857_100056596 | 3300005577 | Bacteria | 3480 |
| 176 | Ga0068857_100259523 | 3300005577 | Bacteria | 1594 |
| 177 | Ga0068857_100393248 | 3300005577 | Bacteria | 1289 |
| 178 | Ga0070702_100020189 | 3300005615 | Bacteria | 3486 |
| 179 | Ga0070702_100195351 | 3300005615 | Bacteria | 1335 |
| 180 | Ga0068852_100027709 | 3300005616 | Bacteria | 4622 |
| 181 | Ga0068852_100366736 | 3300005616 | Unclassified | 1410 |
| 182 | Ga0068852_100565516 | 3300005616 | Bacteria | 1138 |
| 183 | Ga0068859_100000017 | 3300005617 | Bacteria | 249478 |
| 184 | Ga0068859_100028633 | 3300005617 | Bacteria | 5586 |
| 185 | Ga0068859_100034615 | 3300005617 | Bacteria | 5068 |
| 186 | Ga0068859_100056009 | 3300005617 | Bacteria | 3967 |
| 187 | Ga0068859_100061477 | 3300005617 | Bacteria | 3784 |
| 188 | Ga0068859_100115968 | 3300005617 | Bacteria | 2743 |
| 189 | Ga0068859_100144462 | 3300005617 | Bacteria | 2454 |
| 190 | Ga0068859_100156809 | 3300005617 | Bacteria | 2354 |
| 191 | Ga0068859_100216018 | 3300005617 | Bacteria | 2005 |
| 192 | Ga0068859_100401179 | 3300005617 | Unclassified | 1467 |
| 193 | Ga0068859_100698440 | 3300005617 | Bacteria | 1105 |
| 194 | Ga0068864_100000001 | 3300005618 | Bacteria | 686767 |
| 195 | Ga0068864_100004348 | 3300005618 | Bacteria | 11627 |
| 196 | Ga0068864_100008707 | 3300005618 | Bacteria | 8370 |
| 197 | Ga0068864_100010686 | 3300005618 | Bacteria | 7587 |
| 198 | Ga0068864_100032014 | 3300005618 | Bacteria | 4465 |
| 199 | Ga0068864_100058229 | 3300005618 | Bacteria | 3339 |
| 200 | Ga0068864_100114151 | 3300005618 | Unclassified | 2408 |
| 201 | Ga0068864_100116214 | 3300005618 | Bacteria | 2387 |
| 202 | Ga0068866_10086309 | 3300005718 | Unclassified | 1698 |
| 203 | Ga0068866_10166863 | 3300005718 | Bacteria | 1289 |
| 204 | Ga0068866_10214392 | 3300005718 | Bacteria | 1158 |
| 205 | Ga0068866_10368872 | 3300005718 | Bacteria | 917 |
| 206 | Ga0068861_100089126 | 3300005719 | Bacteria | 2431 |
| 207 | Ga0068861_100092805 | 3300005719 | Bacteria | 2385 |
| 208 | Ga0068861_100248715 | 3300005719 | Bacteria | 1516 |
| 209 | Ga0068851_10103581 | 3300005834 | Unclassified | 1512 |
| 210 | Ga0068870_10270863 | 3300005840 | Bacteria | 1060 |
| 211 | Ga0068863_100006299 | 3300005841 | Bacteria | 11646 |
| 212 | Ga0068863_100015396 | 3300005841 | Bacteria | 7352 |
| 213 | Ga0068863_100185337 | 3300005841 | Bacteria | 1999 |
| 214 | Ga0068863_100256243 | 3300005841 | Bacteria | 1691 |
| 215 | Ga0068863_100347529 | 3300005841 | Bacteria | 1444 |
| 216 | Ga0068863_100393507 | 3300005841 | Bacteria | 1354 |
| 217 | Ga0068858_100000072 | 3300005842 | Bacteria | 105094 |
| 218 | Ga0068858_100023674 | 3300005842 | Bacteria | 5720 |
| 219 | Ga0068858_100028403 | 3300005842 | Bacteria | 5197 |
| 220 | Ga0068858_100043612 | 3300005842 | Unclassified | 4159 |
| 221 | Ga0068858_100090268 | 3300005842 | Bacteria | 2851 |
| 222 | Ga0068858_100161888 | 3300005842 | Bacteria | 2107 |
| 223 | Ga0068860_100003719 | 3300005843 | Bacteria | 15686 |
| 224 | Ga0068860_100014916 | 3300005843 | Bacteria | 7598 |
| 225 | Ga0068860_100075183 | 3300005843 | Bacteria | 3213 |
| 226 | Ga0068860_100306182 | 3300005843 | Bacteria | 1557 |
| 227 | Ga0068860_100595079 | 3300005843 | Bacteria | 1111 |
| 228 | Ga0068862_100010877 | 3300005844 | Bacteria | 7514 |
| 229 | Ga0068862_100023180 | 3300005844 | Bacteria | 5198 |
| 230 | Ga0068862_100046468 | 3300005844 | Bacteria | 3704 |
| 231 | Ga0068862_100276902 | 3300005844 | Bacteria | 1536 |
| 232 | Ga0068862_100289062 | 3300005844 | Bacteria | 1505 |
| 233 | Ga0068862_100505777 | 3300005844 | Bacteria | 1147 |
| 234 | Ga0081540_1116864 | 3300005983 | Bacteria | 1115 |
| 235 | Ga0081539_10000071 | 3300005985 | Bacteria | 233094 |
| 236 | Ga0081539_10001123 | 3300005985 | Bacteria | 48558 |
| 237 | Ga0070717_10003798 | 3300006028 | Bacteria | 10861 |
| 238 | Ga0070717_10007368 | 3300006028 | Bacteria | 8170 |
| 239 | Ga0070717_10274949 | 3300006028 | Bacteria | 1492 |
| 240 | Ga0070717_10309652 | 3300006028 | Bacteria | 1405 |
| 241 | Ga0075365_10010341 | 3300006038 | Bacteria | 5427 |
| 242 | Ga0075365_10031532 | 3300006038 | Bacteria | 3400 |
| 243 | Ga0075365_10101634 | 3300006038 | Bacteria | 1969 |
| 244 | Ga0075365_10249058 | 3300006038 | Bacteria | 1248 |
| 245 | Ga0075368_10016277 | 3300006042 | Bacteria | 2772 |
| 246 | Ga0075368_10016609 | 3300006042 | Bacteria | 2745 |
| 247 | Ga0075363_100007068 | 3300006048 | Bacteria | 5133 |
| 248 | Ga0075364_10056798 | 3300006051 | Bacteria | 2563 |
| 249 | Ga0075364_10270264 | 3300006051 | Bacteria | 1156 |
| 250 | Ga0075432_10008373 | 3300006058 | Bacteria | 3528 |
| 251 | Ga0070715_10056923 | 3300006163 | Unclassified | 1702 |
| 252 | Ga0070716_100051834 | 3300006173 | Bacteria | 2335 |
| 253 | Ga0070716_100055634 | 3300006173 | Bacteria | 2265 |
| 254 | Ga0070716_100076310 | 3300006173 | Bacteria | 1986 |
| 255 | Ga0070712_100055300 | 3300006175 | Bacteria | 2779 |
| 256 | Ga0070712_100059425 | 3300006175 | Unclassified | 2693 |
| 257 | Ga0070712_100119722 | 3300006175 | Bacteria | 1979 |
| 258 | Ga0075362_10077281 | 3300006177 | Bacteria | 1529 |
| 259 | Ga0075367_10017651 | 3300006178 | Bacteria | 3921 |
| 260 | Ga0075367_10031906 | 3300006178 | Bacteria | 3027 |
| 261 | Ga0075367_10096849 | 3300006178 | Bacteria | 1799 |
| 262 | Ga0075367_10331316 | 3300006178 | Bacteria | 960 |
| 263 | Ga0075369_10110697 | 3300006186 | Bacteria | 1237 |
| 264 | Ga0075366_10018376 | 3300006195 | Bacteria | 4035 |
| 265 | Ga0075366_10020552 | 3300006195 | Bacteria | 3832 |
| 266 | Ga0097621_100028848 | 3300006237 | Bacteria | 4378 |
| 267 | Ga0097621_100037028 | 3300006237 | Bacteria | 3906 |
| 268 | Ga0097621_100049804 | 3300006237 | Bacteria | 3405 |
| 269 | Ga0097621_100066492 | 3300006237 | Bacteria | 2969 |
| 270 | Ga0097621_100078981 | 3300006237 | Bacteria | 2735 |
| 271 | Ga0097621_100283030 | 3300006237 | Bacteria | 1460 |
| 272 | Ga0097621_100561450 | 3300006237 | Bacteria | 1040 |
| 273 | Ga0075370_10043762 | 3300006353 | Bacteria | 2531 |
| 274 | Ga0068871_100011210 | 3300006358 | Bacteria | 6570 |
| 275 | Ga0068871_100013024 | 3300006358 | Bacteria | 6163 |
| 276 | Ga0068871_100016778 | 3300006358 | Bacteria | 5527 |
| 277 | Ga0068871_100023567 | 3300006358 | Bacteria | 4764 |
| 278 | Ga0068871_100025979 | 3300006358 | Bacteria | 4563 |
| 279 | Ga0068871_100063614 | 3300006358 | Unclassified | 3018 |
| 280 | Ga0068871_100361480 | 3300006358 | Bacteria | 1286 |
| 281 | Ga0075428_100006816 | 3300006844 | Bacteria | 12708 |
| 282 | Ga0075428_100038920 | 3300006844 | Bacteria | 5232 |
| 283 | Ga0075428_100078699 | 3300006844 | Bacteria | 3599 |
| 284 | Ga0075428_100245934 | 3300006844 | Unclassified | 1929 |
| 285 | Ga0075428_100263185 | 3300006844 | Bacteria | 1857 |
| 286 | Ga0075428_100569999 | 3300006844 | Bacteria | 1210 |
| 287 | Ga0075428_100687329 | 3300006844 | Bacteria | 1090 |
| 288 | Ga0075430_100035227 | 3300006846 | Bacteria | 4247 |
| 289 | Ga0075430_100058695 | 3300006846 | Bacteria | 3235 |
| 290 | Ga0075430_100090572 | 3300006846 | Bacteria | 2558 |
| 291 | Ga0075431_100001217 | 3300006847 | Bacteria | 23292 |
| 292 | Ga0075431_100001237 | 3300006847 | Bacteria | 23180 |
| 293 | Ga0075431_100025479 | 3300006847 | Bacteria | 6062 |
| 294 | Ga0075431_100188852 | 3300006847 | Unclassified | 2112 |
| 295 | Ga0075431_100218727 | 3300006847 | Bacteria | 1943 |
| 296 | Ga0075431_100253268 | 3300006847 | Unclassified | 1788 |
| 297 | Ga0075433_10005566 | 3300006852 | Bacteria | 9894 |
| 298 | Ga0075433_10038492 | 3300006852 | Bacteria | 4130 |
| 299 | Ga0075433_10091518 | 3300006852 | Bacteria | 2689 |
| 300 | Ga0075433_10358030 | 3300006852 | Bacteria | 1289 |
| 301 | Ga0075434_100010349 | 3300006871 | Bacteria | 8741 |
| 302 | Ga0075434_100017091 | 3300006871 | Bacteria | 6982 |
| 303 | Ga0075434_100017259 | 3300006871 | Bacteria | 6951 |
| 304 | Ga0075434_100051427 | 3300006871 | Unclassified | 4095 |
| 305 | Ga0075434_100162539 | 3300006871 | Bacteria | 2253 |
| 306 | Ga0075434_100234937 | 3300006871 | Bacteria | 1853 |
| 307 | Ga0075434_100331315 | 3300006871 | Bacteria | 1543 |
| 308 | Ga0075434_100416757 | 3300006871 | Bacteria | 1364 |
| 309 | Ga0075434_100426210 | 3300006871 | Bacteria | 1348 |
| 310 | Ga0075434_100650352 | 3300006871 | Bacteria | 1072 |
| 311 | Ga0075429_100002046 | 3300006880 | Bacteria | 16786 |
| 312 | Ga0075429_100031235 | 3300006880 | Bacteria | 4629 |
| 313 | Ga0075429_100172421 | 3300006880 | Bacteria | 1895 |
| 314 | Ga0075429_100222102 | 3300006880 | Bacteria | 1655 |
| 315 | Ga0075429_100301976 | 3300006880 | Bacteria | 1401 |
| 316 | Ga0068865_100002817 | 3300006881 | Bacteria | 10340 |
| 317 | Ga0068865_100062193 | 3300006881 | Unclassified | 2620 |
| 318 | Ga0068865_100080476 | 3300006881 | Bacteria | 2336 |
| 319 | Ga0068865_100087178 | 3300006881 | Bacteria | 2256 |
| 320 | Ga0068865_100327528 | 3300006881 | Bacteria | 1234 |
| 321 | Ga0075436_100017691 | 3300006914 | Unclassified | 4879 |
| 322 | Ga0075436_100028234 | 3300006914 | Bacteria | 3860 |
| 323 | Ga0075436_100069780 | 3300006914 | Bacteria | 2428 |
| 324 | Ga0097620_100000017 | 3300006931 | Bacteria | 249478 |
| 325 | Ga0097620_100028633 | 3300006931 | Bacteria | 5586 |
| 326 | Ga0097620_100034617 | 3300006931 | Bacteria | 5068 |
| 327 | Ga0097620_100056007 | 3300006931 | Bacteria | 3967 |
| 328 | Ga0097620_100061477 | 3300006931 | Bacteria | 3784 |
| 329 | Ga0097620_100115969 | 3300006931 | Bacteria | 2743 |
| 330 | Ga0097620_100144470 | 3300006931 | Bacteria | 2454 |
| 331 | Ga0097620_100156815 | 3300006931 | Bacteria | 2354 |
| 332 | Ga0097620_100216018 | 3300006931 | Bacteria | 2005 |
| 333 | Ga0097620_100401159 | 3300006931 | Unclassified | 1467 |
| 334 | Ga0097620_100698646 | 3300006931 | Bacteria | 1105 |
| 335 | Ga0075435_100007726 | 3300007076 | Bacteria | 7685 |
| 336 | Ga0075435_100010295 | 3300007076 | Bacteria | 6832 |
| 337 | Ga0075435_100019481 | 3300007076 | Bacteria | 5185 |
| 338 | Ga0075435_100048463 | 3300007076 | Bacteria | 3414 |
| 339 | Ga0075435_100127798 | 3300007076 | Unclassified | 2125 |
| 340 | Ga0105240_10078220 | 3300009093 | Bacteria | 4073 |
| 341 | Ga0105240_10110214 | 3300009093 | Bacteria | 3332 |
| 342 | Ga0111539_10000021 | 3300009094 | Bacteria | 246864 |
| 343 | Ga0111539_10020650 | 3300009094 | Bacteria | 8113 |
| 344 | Ga0111539_10026924 | 3300009094 | Bacteria | 7025 |
| 345 | Ga0111539_10045595 | 3300009094 | Bacteria | 5248 |
| 346 | Ga0111539_10054202 | 3300009094 | Unclassified | 4771 |
| 347 | Ga0111539_10099518 | 3300009094 | Bacteria | 3414 |
| 348 | Ga0111539_10445629 | 3300009094 | Bacteria | 1508 |
| 349 | Ga0105245_10000055 | 3300009098 | Bacteria | 124667 |
| 350 | Ga0105245_10000148 | 3300009098 | Bacteria | 66317 |
| 351 | Ga0105245_10000268 | 3300009098 | Bacteria | 49610 |
| 352 | Ga0105245_10009229 | 3300009098 | Bacteria | 8598 |
| 353 | Ga0105245_10010876 | 3300009098 | Bacteria | 7916 |
| 354 | Ga0105245_10051105 | 3300009098 | Bacteria | 3706 |
| 355 | Ga0105245_10074125 | 3300009098 | Bacteria | 3096 |
| 356 | Ga0105245_10265350 | 3300009098 | Bacteria | 1672 |
| 357 | Ga0105247_10235569 | 3300009101 | Bacteria | 1245 |
| 358 | Ga0114129_10000095 | 3300009147 | Bacteria | 85485 |
| 359 | Ga0114129_10011206 | 3300009147 | Bacteria | 12782 |
| 360 | Ga0114129_10021293 | 3300009147 | Bacteria | 9205 |
| 361 | Ga0114129_10035942 | 3300009147 | Bacteria | 6996 |
| 362 | Ga0114129_10153606 | 3300009147 | Bacteria | 3149 |
| 363 | Ga0114129_10180838 | 3300009147 | Bacteria | 2869 |
| 364 | Ga0114129_10284758 | 3300009147 | Bacteria | 2207 |
| 365 | Ga0114129_10399170 | 3300009147 | Bacteria | 1812 |
| 366 | Ga0114129_10511798 | 3300009147 | Bacteria | 1566 |
| 367 | Ga0105243_10008744 | 3300009148 | Bacteria | 7762 |
| 368 | Ga0105243_10055425 | 3300009148 | Bacteria | 3150 |
| 369 | Ga0105243_10101952 | 3300009148 | Bacteria | 2384 |
| 370 | Ga0105243_10436195 | 3300009148 | Bacteria | 1225 |
| 371 | Ga0105243_10462595 | 3300009148 | Bacteria | 1193 |
| 372 | Ga0105241_10126009 | 3300009174 | Bacteria | 2068 |
| 373 | Ga0105242_10003906 | 3300009176 | Bacteria | 11588 |
| 374 | Ga0105242_10007476 | 3300009176 | Bacteria | 8411 |
| 375 | Ga0105242_10009232 | 3300009176 | Bacteria | 7566 |
| 376 | Ga0105242_10079295 | 3300009176 | Bacteria | 2742 |
| 377 | Ga0105242_10174863 | 3300009176 | Bacteria | 1889 |
| 378 | Ga0105242_10310344 | 3300009176 | Bacteria | 1443 |
| 379 | Ga0105248_10040499 | 3300009177 | Bacteria | 5223 |
| 380 | Ga0105248_10083416 | 3300009177 | Bacteria | 3595 |
| 381 | Ga0105248_10089051 | 3300009177 | Unclassified | 3474 |
| 382 | Ga0105248_10121221 | 3300009177 | Bacteria | 2950 |
| 383 | Ga0105248_10133657 | 3300009177 | Bacteria | 2799 |
| 384 | Ga0105248_10490757 | 3300009177 | Bacteria | 1384 |
| 385 | Ga0105237_10227852 | 3300009545 | Bacteria | 1864 |
| 386 | Ga0105237_10444306 | 3300009545 | Bacteria | 1303 |
| 387 | Ga0105238_10000029 | 3300009551 | Bacteria | 182309 |
| 388 | Ga0105249_10005943 | 3300009553 | Bacteria | 10574 |
| 389 | Ga0105249_10033156 | 3300009553 | Unclassified | 4675 |
| 390 | Ga0105249_10224643 | 3300009553 | Bacteria | 1849 |
| 391 | Ga0105249_10259855 | 3300009553 | Bacteria | 1725 |
| 392 | Ga0105249_10331652 | 3300009553 | Bacteria | 1535 |
| 393 | Ga0105249_10596894 | 3300009553 | Bacteria | 1158 |
| 394 | Ga0105239_10028869 | 3300010375 | Bacteria | 6098 |
| 395 | Ga0105239_10081900 | 3300010375 | Bacteria | 3553 |
| 396 | Ga0105239_10458384 | 3300010375 | Bacteria | 1447 |
| 397 | Ga0105239_10542346 | 3300010375 | Bacteria | 1324 |
| 398 | Ga0105239_10663142 | 3300010375 | Bacteria | 1192 |
| 399 | Ga0105239_10785643 | 3300010375 | Bacteria | 1090 |
| 400 | Ga0105246_10007633 | 3300011119 | Bacteria | 6636 |
| 401 | Ga0105246_10045953 | 3300011119 | Unclassified | 2977 |
| 402 | Ga0157373_10097785 | 3300013100 | Unclassified | 2066 |
| 403 | Ga0157373_10165797 | 3300013100 | Bacteria | 1555 |
| 404 | Ga0157371_10206266 | 3300013102 | Bacteria | 1410 |
| 405 | Ga0157371_10226748 | 3300013102 | Bacteria | 1342 |
| 406 | Ga0157369_10000378 | 3300013105 | Bacteria | 58796 |
| 407 | Ga0157374_10000008 | 3300013296 | Bacteria | 588863 |
| 408 | Ga0157374_10011468 | 3300013296 | Bacteria | 7676 |
| 409 | Ga0157374_10024443 | 3300013296 | Bacteria | 5419 |
| 410 | Ga0157374_10041257 | 3300013296 | Bacteria | 4252 |
| 411 | Ga0157374_10052698 | 3300013296 | Bacteria | 3790 |
| 412 | Ga0157374_10192173 | 3300013296 | Bacteria | 1997 |
| 413 | Ga0157378_10000584 | 3300013297 | Bacteria | 34260 |
| 414 | Ga0157378_10008675 | 3300013297 | Bacteria | 8846 |
| 415 | Ga0157378_10012784 | 3300013297 | Bacteria | 7348 |
| 416 | Ga0157378_10015464 | 3300013297 | Bacteria | 6685 |
| 417 | Ga0157378_10026603 | 3300013297 | Bacteria | 5098 |
| 418 | Ga0157378_10029725 | 3300013297 | Bacteria | 4825 |
| 419 | Ga0157378_10033479 | 3300013297 | Bacteria | 4544 |
| 420 | Ga0157378_10035072 | 3300013297 | Bacteria | 4436 |
| 421 | Ga0157378_10039658 | 3300013297 | Bacteria | 4177 |
| 422 | Ga0157378_10077784 | 3300013297 | Bacteria | 2991 |
| 423 | Ga0157378_10142890 | 3300013297 | Bacteria | 2224 |
| 424 | Ga0163162_10011632 | 3300013306 | Bacteria | 8582 |
| 425 | Ga0163162_10015763 | 3300013306 | Bacteria | 7387 |
| 426 | Ga0163162_10040099 | 3300013306 | Bacteria | 4681 |
| 427 | Ga0163162_10152061 | 3300013306 | Bacteria | 2433 |
| 428 | Ga0163162_10162096 | 3300013306 | Bacteria | 2358 |
| 429 | Ga0163162_10312649 | 3300013306 | Bacteria | 1703 |
| 430 | Ga0163162_10394633 | 3300013306 | Bacteria | 1516 |
| 431 | Ga0157372_10096509 | 3300013307 | Bacteria | 3369 |
| 432 | Ga0157372_10349764 | 3300013307 | Bacteria | 1722 |
| 433 | Ga0157372_10496849 | 3300013307 | Bacteria | 1423 |
| 434 | Ga0157375_10000024 | 3300013308 | Bacteria | 231767 |
| 435 | Ga0157375_10000028 | 3300013308 | Bacteria | 218924 |
| 436 | Ga0157375_10000373 | 3300013308 | Bacteria | 40703 |
| 437 | Ga0157375_10012531 | 3300013308 | Bacteria | 7525 |
| 438 | Ga0157375_10012636 | 3300013308 | Bacteria | 7495 |
| 439 | Ga0157375_10086942 | 3300013308 | Bacteria | 3178 |
| 440 | Ga0157375_10176518 | 3300013308 | Bacteria | 2286 |
| 441 | Ga0157375_10254292 | 3300013308 | Bacteria | 1918 |
| 442 | Ga0157375_10763039 | 3300013308 | Bacteria | 1118 |
| 443 | Ga0163163_10007747 | 3300014325 | Bacteria | 9492 |
| 444 | Ga0163163_10027634 | 3300014325 | Bacteria | 5437 |
| 445 | Ga0163163_10027983 | 3300014325 | Bacteria | 5407 |
| 446 | Ga0163163_10033387 | 3300014325 | Bacteria | 4977 |
| 447 | Ga0163163_10118003 | 3300014325 | Bacteria | 2686 |
| 448 | Ga0163163_10225857 | 3300014325 | Unclassified | 1921 |
| 449 | Ga0163163_10275443 | 3300014325 | Unclassified | 1734 |
| 450 | Ga0157380_10000625 | 3300014326 | Bacteria | 21697 |
| 451 | Ga0157380_10020175 | 3300014326 | Bacteria | 4979 |
| 452 | Ga0157380_10149718 | 3300014326 | Bacteria | 2016 |
| 453 | Ga0157380_10295988 | 3300014326 | Bacteria | 1488 |
| 454 | Ga0157380_10626504 | 3300014326 | Unclassified | 1069 |
| 455 | Ga0157380_10643949 | 3300014326 | Bacteria | 1056 |
| 456 | Ga0157377_10000012 | 3300014745 | Bacteria | 274497 |
| 457 | Ga0157377_10000383 | 3300014745 | Bacteria | 19268 |
| 458 | Ga0157377_10000656 | 3300014745 | Bacteria | 14427 |
| 459 | Ga0157377_10014325 | 3300014745 | Bacteria | 4032 |
| 460 | Ga0157379_10063788 | 3300014968 | Bacteria | 3293 |
| 461 | Ga0157379_10068283 | 3300014968 | Unclassified | 3178 |
| 462 | Ga0157376_10000044 | 3300014969 | Bacteria | 110557 |
| 463 | Ga0157376_10000051 | 3300014969 | Bacteria | 102604 |
| 464 | Ga0157376_10001532 | 3300014969 | Bacteria | 15244 |
| 465 | Ga0157376_10009169 | 3300014969 | Bacteria | 7178 |
| 466 | Ga0157376_10203784 | 3300014969 | Unclassified | 1822 |
| 467 | Ga0157376_10539304 | 3300014969 | Bacteria | 1153 |
| 468 | Ga0163161_10059736 | 3300017792 | Bacteria | 2773 |
| 469 | Ga0163161_10340412 | 3300017792 | Unclassified | 1190 |
| 470 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 471 | Ga0213873_10008288 | 3300021358 | Bacteria | 2117 |
| 472 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 473 | Ga0213876_10000067 | 3300021384 | Bacteria | 126770 |
| 474 | Ga0209147_100184 | 3300025229 | Bacteria | 74911 |
| 475 | Ga0209675_1001593 | 3300025291 | Bacteria | 12833 |
| 476 | Ga0207697_10005033 | 3300025315 | Bacteria | 6199 |
| 477 | Ga0207697_10015461 | 3300025315 | Bacteria | 3153 |
| 478 | Ga0207697_10026004 | 3300025315 | Bacteria | 2393 |
| 479 | Ga0207692_10014799 | 3300025898 | Bacteria | 3416 |
| 480 | Ga0207692_10150771 | 3300025898 | Bacteria | 1331 |
| 481 | Ga0207642_10038043 | 3300025899 | Bacteria | 2078 |
| 482 | Ga0207688_10038019 | 3300025901 | Bacteria | 2670 |
| 483 | Ga0207688_10041359 | 3300025901 | Bacteria | 2564 |
| 484 | Ga0207680_10065281 | 3300025903 | Bacteria | 2234 |
| 485 | Ga0207680_10114508 | 3300025903 | Bacteria | 1755 |
| 486 | Ga0207685_10133402 | 3300025905 | Bacteria | 1105 |
| 487 | Ga0207699_10007617 | 3300025906 | Bacteria | 5302 |
| 488 | Ga0207699_10038557 | 3300025906 | Bacteria | 2740 |
| 489 | Ga0207699_10305736 | 3300025906 | Bacteria | 1111 |
| 490 | Ga0207645_10001146 | 3300025907 | Bacteria | 21888 |
| 491 | Ga0207645_10014401 | 3300025907 | Bacteria | 5290 |
| 492 | Ga0207645_10185662 | 3300025907 | Bacteria | 1365 |
| 493 | Ga0207643_10053926 | 3300025908 | Bacteria | 2285 |
| 494 | Ga0207705_10053368 | 3300025909 | Bacteria | 2912 |
| 495 | Ga0207705_10364294 | 3300025909 | Bacteria | 1115 |
| 496 | Ga0207684_10018155 | 3300025910 | Bacteria | 6028 |
| 497 | Ga0207684_10360307 | 3300025910 | Bacteria | 1251 |
| 498 | Ga0207707_10002076 | 3300025912 | Bacteria | 18130 |
| 499 | Ga0207707_10047515 | 3300025912 | Unclassified | 3737 |
| 500 | Ga0207707_10437300 | 3300025912 | Bacteria | 1120 |
| 501 | Ga0207695_10079052 | 3300025913 | Bacteria | 3335 |
| 502 | Ga0207695_10401416 | 3300025913 | Bacteria | 1255 |
| 503 | Ga0207693_10044620 | 3300025915 | Bacteria | 3484 |
| 504 | Ga0207693_10051785 | 3300025915 | Unclassified | 3220 |
| 505 | Ga0207693_10121085 | 3300025915 | Bacteria | 2055 |
| 506 | Ga0207663_10034247 | 3300025916 | Bacteria | 3035 |
| 507 | Ga0207663_10152343 | 3300025916 | Bacteria | 1623 |
| 508 | Ga0207663_10326981 | 3300025916 | Bacteria | 1154 |
| 509 | Ga0207662_10011697 | 3300025918 | Bacteria | 4875 |
| 510 | Ga0207662_10095290 | 3300025918 | Bacteria | 1837 |
| 511 | Ga0207662_10340627 | 3300025918 | Bacteria | 1005 |
| 512 | Ga0207657_10017689 | 3300025919 | Bacteria | 6828 |
| 513 | Ga0207657_10094132 | 3300025919 | Unclassified | 2495 |
| 514 | Ga0207649_10000125 | 3300025920 | Bacteria | 64941 |
| 515 | Ga0207649_10000368 | 3300025920 | Bacteria | 33617 |
| 516 | Ga0207649_10002457 | 3300025920 | Bacteria | 10372 |
| 517 | Ga0207652_10055127 | 3300025921 | Bacteria | 3418 |
| 518 | Ga0207652_10319674 | 3300025921 | Bacteria | 1401 |
| 519 | Ga0207652_10595904 | 3300025921 | Bacteria | 991 |
| 520 | Ga0207646_10034770 | 3300025922 | Bacteria | 4555 |
| 521 | Ga0207646_10040676 | 3300025922 | Unclassified | 4180 |
| 522 | Ga0207646_10086805 | 3300025922 | Bacteria | 2800 |
| 523 | Ga0207681_10345012 | 3300025923 | Bacteria | 1190 |
| 524 | Ga0207681_10505478 | 3300025923 | Bacteria | 990 |
| 525 | Ga0207694_10000002 | 3300025924 | Bacteria | 1165763 |
| 526 | Ga0207694_10000003 | 3300025924 | Bacteria | 1165533 |
| 527 | Ga0207650_10000042 | 3300025925 | Bacteria | 191592 |
| 528 | Ga0207650_10000096 | 3300025925 | Bacteria | 115850 |
| 529 | Ga0207650_10006717 | 3300025925 | Bacteria | 7844 |
| 530 | Ga0207650_10021093 | 3300025925 | Bacteria | 4604 |
| 531 | Ga0207650_10047313 | 3300025925 | Bacteria | 3169 |
| 532 | Ga0207650_10101155 | 3300025925 | Bacteria | 2218 |
| 533 | Ga0207650_10162572 | 3300025925 | Bacteria | 1770 |
| 534 | Ga0207650_10180669 | 3300025925 | Bacteria | 1681 |
| 535 | Ga0207650_10301272 | 3300025925 | Bacteria | 1309 |
| 536 | Ga0207650_10323563 | 3300025925 | Bacteria | 1263 |
| 537 | Ga0207650_10428142 | 3300025925 | Bacteria | 1099 |
| 538 | Ga0207659_10000004 | 3300025926 | Bacteria | 476977 |
| 539 | Ga0207659_10051333 | 3300025926 | Bacteria | 2932 |
| 540 | Ga0207659_10106308 | 3300025926 | Bacteria | 2125 |
| 541 | Ga0207659_10193331 | 3300025926 | Bacteria | 1620 |
| 542 | Ga0207659_10269945 | 3300025926 | Bacteria | 1387 |
| 543 | Ga0207659_10416496 | 3300025926 | Bacteria | 1126 |
| 544 | Ga0207687_10000035 | 3300025927 | Bacteria | 124800 |
| 545 | Ga0207687_10000168 | 3300025927 | Bacteria | 43449 |
| 546 | Ga0207687_10000464 | 3300025927 | Bacteria | 27657 |
| 547 | Ga0207687_10006656 | 3300025927 | Bacteria | 7622 |
| 548 | Ga0207687_10016240 | 3300025927 | Bacteria | 4889 |
| 549 | Ga0207687_10113901 | 3300025927 | Bacteria | 2012 |
| 550 | Ga0207700_10005786 | 3300025928 | Bacteria | 7429 |
| 551 | Ga0207700_10243953 | 3300025928 | Bacteria | 1532 |
| 552 | Ga0207664_10001776 | 3300025929 | Bacteria | 14203 |
| 553 | Ga0207664_10217767 | 3300025929 | Bacteria | 1654 |
| 554 | Ga0207644_10015351 | 3300025931 | Bacteria | 5139 |
| 555 | Ga0207644_10015403 | 3300025931 | Bacteria | 5131 |
| 556 | Ga0207644_10049069 | 3300025931 | Bacteria | 3020 |
| 557 | Ga0207644_10118265 | 3300025931 | Bacteria | 2014 |
| 558 | Ga0207690_10117646 | 3300025932 | Unclassified | 1925 |
| 559 | Ga0207690_10214505 | 3300025932 | Bacteria | 1469 |
| 560 | Ga0207706_10001272 | 3300025933 | Bacteria | 25443 |
| 561 | Ga0207706_10011170 | 3300025933 | Bacteria | 8187 |
| 562 | Ga0207706_10148125 | 3300025933 | Bacteria | 2065 |
| 563 | Ga0207706_10397579 | 3300025933 | Bacteria | 1195 |
| 564 | Ga0207706_10600576 | 3300025933 | Unclassified | 945 |
| 565 | Ga0207686_10003869 | 3300025934 | Bacteria | 8031 |
| 566 | Ga0207686_10018790 | 3300025934 | Bacteria | 3918 |
| 567 | Ga0207686_10059590 | 3300025934 | Bacteria | 2412 |
| 568 | Ga0207686_10236074 | 3300025934 | Bacteria | 1328 |
| 569 | Ga0207709_10129734 | 3300025935 | Bacteria | 1716 |
| 570 | Ga0207709_10415055 | 3300025935 | Bacteria | 1032 |
| 571 | Ga0207670_10006036 | 3300025936 | Bacteria | 6695 |
| 572 | Ga0207670_10043755 | 3300025936 | Unclassified | 2960 |
| 573 | Ga0207670_10045863 | 3300025936 | Bacteria | 2900 |
| 574 | Ga0207670_10116275 | 3300025936 | Bacteria | 1936 |
| 575 | Ga0207669_10116102 | 3300025937 | Bacteria | 1806 |
| 576 | Ga0207669_10137517 | 3300025937 | Bacteria | 1690 |
| 577 | Ga0207669_10242330 | 3300025937 | Bacteria | 1337 |
| 578 | Ga0207704_10004800 | 3300025938 | Bacteria | 6204 |
| 579 | Ga0207704_10169097 | 3300025938 | Bacteria | 1565 |
| 580 | Ga0207704_10199952 | 3300025938 | Bacteria | 1461 |
| 581 | Ga0207704_10210470 | 3300025938 | Bacteria | 1431 |
| 582 | Ga0207704_10267320 | 3300025938 | Bacteria | 1293 |
| 583 | Ga0207665_10012109 | 3300025939 | Bacteria | 5661 |
| 584 | Ga0207665_10014317 | 3300025939 | Bacteria | 5222 |
| 585 | Ga0207665_10164650 | 3300025939 | Bacteria | 1597 |
| 586 | Ga0207691_10002082 | 3300025940 | Bacteria | 19531 |
| 587 | Ga0207691_10003224 | 3300025940 | Bacteria | 15914 |
| 588 | Ga0207691_10005085 | 3300025940 | Bacteria | 12695 |
| 589 | Ga0207691_10016359 | 3300025940 | Bacteria | 7041 |
| 590 | Ga0207711_10020961 | 3300025941 | Bacteria | 5457 |
| 591 | Ga0207711_10105223 | 3300025941 | Bacteria | 2502 |
| 592 | Ga0207689_10016216 | 3300025942 | Bacteria | 6310 |
| 593 | Ga0207689_10016882 | 3300025942 | Bacteria | 6177 |
| 594 | Ga0207689_10028224 | 3300025942 | Bacteria | 4695 |
| 595 | Ga0207689_10199489 | 3300025942 | Bacteria | 1651 |
| 596 | Ga0207689_10202642 | 3300025942 | Bacteria | 1638 |
| 597 | Ga0207689_10295027 | 3300025942 | Bacteria | 1343 |
| 598 | Ga0207689_10423705 | 3300025942 | Bacteria | 1111 |
| 599 | Ga0207661_10000672 | 3300025944 | Bacteria | 22163 |
| 600 | Ga0207661_10001945 | 3300025944 | Bacteria | 14196 |
| 601 | Ga0207661_10010066 | 3300025944 | Bacteria | 6796 |
| 602 | Ga0207661_10023960 | 3300025944 | Bacteria | 4618 |
| 603 | Ga0207661_10120271 | 3300025944 | Bacteria | 2235 |
| 604 | Ga0207661_10199654 | 3300025944 | Bacteria | 1758 |
| 605 | Ga0207679_10000989 | 3300025945 | Bacteria | 18241 |
| 606 | Ga0207679_10003506 | 3300025945 | Bacteria | 9706 |
| 607 | Ga0207679_10011505 | 3300025945 | Bacteria | 5735 |
| 608 | Ga0207679_10058119 | 3300025945 | Bacteria | 2864 |
| 609 | Ga0207679_10063361 | 3300025945 | Bacteria | 2759 |
| 610 | Ga0207679_10070066 | 3300025945 | Bacteria | 2641 |
| 611 | Ga0207679_10086587 | 3300025945 | Bacteria | 2410 |
| 612 | Ga0207679_10132425 | 3300025945 | Unclassified | 2002 |
| 613 | Ga0207679_10133214 | 3300025945 | Bacteria | 1997 |
| 614 | Ga0207667_10419648 | 3300025949 | Bacteria | 1361 |
| 615 | Ga0207651_10126776 | 3300025960 | Bacteria | 1946 |
| 616 | Ga0207712_10182895 | 3300025961 | Bacteria | 1648 |
| 617 | Ga0207712_10198495 | 3300025961 | Bacteria | 1589 |
| 618 | Ga0207668_10092308 | 3300025972 | Bacteria | 2228 |
| 619 | Ga0207668_10271298 | 3300025972 | Bacteria | 1387 |
| 620 | Ga0207640_10014894 | 3300025981 | Bacteria | 4487 |
| 621 | Ga0207640_10537571 | 3300025981 | Bacteria | 980 |
| 622 | Ga0207658_10121517 | 3300025986 | Bacteria | 2083 |
| 623 | Ga0207658_10216305 | 3300025986 | Bacteria | 1609 |
| 624 | Ga0207658_10257740 | 3300025986 | Unclassified | 1485 |
| 625 | Ga0207658_10300341 | 3300025986 | Bacteria | 1383 |
| 626 | Ga0207658_10327839 | 3300025986 | Unclassified | 1327 |
| 627 | Ga0207658_10683426 | 3300025986 | Bacteria | 927 |
| 628 | Ga0207677_10001337 | 3300026023 | Bacteria | 13215 |
| 629 | Ga0207677_10132619 | 3300026023 | Bacteria | 1894 |
| 630 | Ga0207677_10180448 | 3300026023 | Bacteria | 1660 |
| 631 | Ga0207677_10308309 | 3300026023 | Bacteria | 1310 |
| 632 | Ga0207677_10318353 | 3300026023 | Bacteria | 1292 |
| 633 | Ga0207703_10000016 | 3300026035 | Bacteria | 285487 |
| 634 | Ga0207703_10004941 | 3300026035 | Bacteria | 10824 |
| 635 | Ga0207703_10068898 | 3300026035 | Bacteria | 2916 |
| 636 | Ga0207703_10101548 | 3300026035 | Bacteria | 2439 |
| 637 | Ga0207703_10126475 | 3300026035 | Unclassified | 2201 |
| 638 | Ga0207703_10158903 | 3300026035 | Bacteria | 1978 |
| 639 | Ga0207703_10159156 | 3300026035 | Bacteria | 1976 |
| 640 | Ga0207639_10000042 | 3300026041 | Bacteria | 141299 |
| 641 | Ga0207639_10116652 | 3300026041 | Archaea | 2186 |
| 642 | Ga0207639_10125944 | 3300026041 | Bacteria | 2113 |
| 643 | Ga0207639_10251758 | 3300026041 | Unclassified | 1541 |
| 644 | Ga0207639_10690230 | 3300026041 | Bacteria | 947 |
| 645 | Ga0207678_10009373 | 3300026067 | Bacteria | 8616 |
| 646 | Ga0207678_10021390 | 3300026067 | Bacteria | 5672 |
| 647 | Ga0207678_10110233 | 3300026067 | Bacteria | 2348 |
| 648 | Ga0207708_10003095 | 3300026075 | Bacteria | 12245 |
| 649 | Ga0207708_10373485 | 3300026075 | Bacteria | 1174 |
| 650 | Ga0207702_10041525 | 3300026078 | Bacteria | 3857 |
| 651 | Ga0207641_10001156 | 3300026088 | Bacteria | 26503 |
| 652 | Ga0207641_10055117 | 3300026088 | Bacteria | 3376 |
| 653 | Ga0207641_10133252 | 3300026088 | Bacteria | 2234 |
| 654 | Ga0207641_10245408 | 3300026088 | Bacteria | 1670 |
| 655 | Ga0207641_10261002 | 3300026088 | Bacteria | 1622 |
| 656 | Ga0207641_10287080 | 3300026088 | Unclassified | 1550 |
| 657 | Ga0207641_10450068 | 3300026088 | Bacteria | 1244 |
| 658 | Ga0207641_10648626 | 3300026088 | Bacteria | 1037 |
| 659 | Ga0207648_10001445 | 3300026089 | Bacteria | 26161 |
| 660 | Ga0207648_10179390 | 3300026089 | Bacteria | 1874 |
| 661 | Ga0207648_10182747 | 3300026089 | Bacteria | 1856 |
| 662 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 663 | Ga0207676_10001312 | 3300026095 | Bacteria | 18514 |
| 664 | Ga0207676_10011182 | 3300026095 | Bacteria | 6408 |
| 665 | Ga0207676_10040858 | 3300026095 | Bacteria | 3557 |
| 666 | Ga0207676_10041537 | 3300026095 | Bacteria | 3531 |
| 667 | Ga0207676_10061723 | 3300026095 | Unclassified | 2969 |
| 668 | Ga0207676_10103721 | 3300026095 | Bacteria | 2364 |
| 669 | Ga0207676_10132830 | 3300026095 | Bacteria | 2119 |
| 670 | Ga0207676_10189353 | 3300026095 | Bacteria | 1809 |
| 671 | Ga0207676_10288890 | 3300026095 | Bacteria | 1492 |
| 672 | Ga0207676_10662430 | 3300026095 | Bacteria | 1008 |
| 673 | Ga0207674_10000819 | 3300026116 | Bacteria | 40453 |
| 674 | Ga0207674_10022320 | 3300026116 | Bacteria | 6796 |
| 675 | Ga0207674_10319374 | 3300026116 | Bacteria | 1502 |
| 676 | Ga0207674_10323509 | 3300026116 | Bacteria | 1491 |
| 677 | Ga0207675_100002475 | 3300026118 | Bacteria | 18287 |
| 678 | Ga0207675_100048240 | 3300026118 | Bacteria | 3976 |
| 679 | Ga0207683_10003266 | 3300026121 | Bacteria | 14141 |
| 680 | Ga0207683_10029038 | 3300026121 | Bacteria | 4787 |
| 681 | Ga0207683_10035313 | 3300026121 | Bacteria | 4347 |
| 682 | Ga0207683_10108516 | 3300026121 | Bacteria | 2484 |
| 683 | Ga0207683_10172876 | 3300026121 | Bacteria | 1957 |
| 684 | Ga0209967_1000723 | 3300027364 | Bacteria | 4248 |
| 685 | Ga0209981_1000419 | 3300027378 | Bacteria | 5414 |
| 686 | Ga0209996_1000408 | 3300027395 | Bacteria | 5224 |
| 687 | Ga0209984_1000281 | 3300027424 | Bacteria | 5794 |
| 688 | Ga0210000_1000240 | 3300027462 | Bacteria | 7813 |
| 689 | Ga0209995_1000559 | 3300027471 | Bacteria | 5661 |
| 690 | Ga0209968_1001231 | 3300027526 | Bacteria | 3910 |
| 691 | Ga0209982_1001014 | 3300027552 | Bacteria | 3728 |
| 692 | Ga0209970_1002927 | 3300027614 | Bacteria | 2879 |
| 693 | Ga0210002_1000456 | 3300027617 | Bacteria | 5540 |
| 694 | Ga0209983_1000664 | 3300027665 | Bacteria | 7355 |
| 695 | Ga0209971_1001145 | 3300027682 | Bacteria | 6692 |
| 696 | Ga0209966_1000697 | 3300027695 | Bacteria | 7277 |
| 697 | Ga0209966_1008228 | 3300027695 | Unclassified | 1848 |
| 698 | Ga0209998_10000329 | 3300027717 | Bacteria | 14121 |
| 699 | Ga0209998_10003233 | 3300027717 | Unclassified | 3596 |
| 700 | Ga0209813_10007652 | 3300027866 | Bacteria | 2699 |
| 701 | Ga0209974_10006156 | 3300027876 | Bacteria | 4204 |
| 702 | Ga0207428_10000014 | 3300027907 | Bacteria | 345246 |
| 703 | Ga0207428_10009277 | 3300027907 | Bacteria | 8831 |
| 704 | Ga0207428_10011414 | 3300027907 | Bacteria | 7852 |
| 705 | Ga0207428_10022302 | 3300027907 | Bacteria | 5346 |
| 706 | Ga0207428_10247048 | 3300027907 | Bacteria | 1332 |
| 707 | Ga0207428_10380340 | 3300027907 | Bacteria | 1036 |
| 708 | Ga0268266_10000153 | 3300028379 | Bacteria | 131887 |
| 709 | Ga0268266_10006720 | 3300028379 | Bacteria | 10487 |
| 710 | Ga0268266_10047773 | 3300028379 | Bacteria | 3668 |
| 711 | Ga0268266_10268721 | 3300028379 | Bacteria | 1582 |
| 712 | Ga0268265_10006690 | 3300028380 | Bacteria | 7803 |
| 713 | Ga0268265_10026702 | 3300028380 | Bacteria | 4110 |
| 714 | Ga0268265_10036360 | 3300028380 | Bacteria | 3607 |
| 715 | Ga0268265_10225836 | 3300028380 | Bacteria | 1642 |
| 716 | Ga0268265_10293460 | 3300028380 | Bacteria | 1461 |
| 717 | Ga0268265_10673348 | 3300028380 | Bacteria | 997 |
| 718 | Ga0268265_10824549 | 3300028380 | Bacteria | 906 |
| 719 | Ga0268264_10011082 | 3300028381 | Bacteria | 7446 |
| 720 | Ga0268264_10082755 | 3300028381 | Unclassified | 2747 |
| 721 | Ga0268264_10123289 | 3300028381 | Bacteria | 2287 |
| 722 | Ga0268264_10420158 | 3300028381 | Bacteria | 1289 |
| 723 | Ga0268264_10600621 | 3300028381 | Bacteria | 1084 |
| 724 | Ga0268264_10862023 | 3300028381 | Unclassified | 907 |
| 725 | Ga0307511_10006985 | 3300030521 | Bacteria | 11369 |
| 726 | Ga0265760_10048931 | 3300031090 | Bacteria | 1270 |
| 727 | Ga0265330_10003447 | 3300031235 | Bacteria | 8262 |
| 728 | Ga0265332_10000139 | 3300031238 | Bacteria | 59640 |
| 729 | Ga0265328_10003149 | 3300031239 | Bacteria | 7342 |
| 730 | Ga0265325_10082013 | 3300031241 | Bacteria | 1601 |
| 731 | Ga0265339_10089361 | 3300031249 | Bacteria | 1617 |
| 732 | Ga0265331_10000224 | 3300031250 | Bacteria | 68220 |
| 733 | Ga0265327_10069309 | 3300031251 | Bacteria | 1771 |
| 734 | Ga0265316_10000266 | 3300031344 | Bacteria | 59349 |
| 735 | Ga0265316_10190630 | 3300031344 | Bacteria | 1523 |
| 736 | Ga0265316_10358239 | 3300031344 | Bacteria | 1055 |
| 737 | Ga0307408_100233379 | 3300031548 | Bacteria | 1508 |
| 738 | Ga0307408_100339603 | 3300031548 | Bacteria | 1271 |
| 739 | Ga0265314_10000743 | 3300031711 | Bacteria | 39113 |
| 740 | Ga0265314_10145657 | 3300031711 | Bacteria | 1459 |
| 741 | Ga0265342_10010095 | 3300031712 | Bacteria | 6583 |
| 742 | Ga0316576_10099416 | 3300031727 | Bacteria | 2173 |
| 743 | Ga0307405_10137826 | 3300031731 | Bacteria | 1696 |
| 744 | Ga0307405_10329179 | 3300031731 | Bacteria | 1170 |
| 745 | Ga0307413_10044453 | 3300031824 | Bacteria | 2625 |
| 746 | Ga0307410_10000637 | 3300031852 | Bacteria | 14487 |
| 747 | Ga0307406_10050853 | 3300031901 | Bacteria | 2629 |
| 748 | Ga0307407_10012848 | 3300031903 | Bacteria | 4043 |
| 749 | Ga0307412_10005347 | 3300031911 | Bacteria | 7206 |
| 750 | Ga0307409_100015869 | 3300031995 | Bacteria | 4962 |
| 751 | Ga0307409_100190285 | 3300031995 | Bacteria | 1826 |
| 752 | Ga0307409_100506949 | 3300031995 | Bacteria | 1176 |
| 753 | Ga0307416_100002857 | 3300032002 | Bacteria | 10050 |
| 754 | Ga0307414_10131553 | 3300032004 | Bacteria | 1943 |
| 755 | Ga0307411_10058820 | 3300032005 | Bacteria | 2545 |
| 756 | Ga0307415_100011025 | 3300032126 | Bacteria | 5149 |
| 757 | Ga0307415_100024113 | 3300032126 | Bacteria | 3792 |
| 758 | Ga0316583_10117819 | 3300032133 | Bacteria | 926 |
| 759 | Ga0373930_0016333 | 3300034816 | Bacteria | 1403 |
| 760 | Ga0373928_0019135 | 3300035084 | Bacteria | 1426 |
| 761 | Ga0373940_0015791 | 3300035088 | Bacteria | 1862 |
| 762 | Ga0373954_0136394 | 3300035118 | Bacteria | 1196 |
| 763 | Ga0373960_0005070 | 3300035121 | Bacteria | 3035 |
| 764 | Ga0373960_0067418 | 3300035121 | Bacteria | 1099 |
| 765 | Ga0373946_0108141 | 3300035171 | Unclassified | 1255 |
| 766 | Ga0373955_0173250 | 3300035172 | Bacteria | 1278 |
| 767 | Ga0316574_0061256 | 3300035398 | Bacteria | 2363 |
| 768 | Ga0316574_0062635 | 3300035398 | Bacteria | 2338 |
| 769 | Ga0373931_0007641 | 3300035691 | Bacteria | 5098 |
| 770 | Ga0373931_0024310 | 3300035691 | Bacteria | 3068 |
| 771 | Ga0373931_0071776 | 3300035691 | Bacteria | 1892 |
| 772 | Ga0373931_0226850 | 3300035691 | Bacteria | 1127 |
| 773 | Ga0373931_0274999 | 3300035691 | Bacteria | 1032 |
| 774 | Ga0373947_0097197 | 3300035725 | Unclassified | 1845 |
| 775 | Ga0395898_0000051 | 3300037466 | Bacteria | 281872 |
| 776 | Ga0395905_0590589 | 3300037471 | Bacteria | 1012 |
| 777 | Ga0242420_000212 | 3300038996 | Bacteria | 6214 |
| 778 | Ga0436365_0703007 | 3300039437 | Bacteria | 34772 |
| 779 | Ga0436365_0962899 | 3300039437 | Bacteria | 122258 |
| 780 | Ga0436363_0797270 | 3300039450 | Bacteria | 1951 |
| 781 | Ga0436363_1660411 | 3300039450 | Bacteria | 1400 |
| 782 | Ga0436362_0093143 | 3300039453 | Bacteria | 1073 |
| 783 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 784 | Ga0436362_1080070 | 3300039453 | Bacteria | 17855 |
| 785 | Ga0439465_0017433 | 3300041413 | Bacteria | 2242 |
| 786 | Ga0451839_1391315 | 3300041496 | Bacteria | 1615 |
| 787 | Ga0450908_017695 | 3300042184 | Bacteria | 1264 |
| 788 | Ga0439435_0024455 | 3300042436 | Bacteria | 1594 |
| 789 | Ga0439464_0003061 | 3300042439 | Bacteria | 4181 |
| 790 | Ga0439464_0013195 | 3300042439 | Bacteria | 2209 |
| 791 | Ga0439464_0035168 | 3300042439 | Bacteria | 1414 |
| 792 | Ga0439460_0010392 | 3300042461 | Bacteria | 2380 |
| 793 | Ga0439460_0082584 | 3300042461 | Bacteria | 1011 |
| 794 | Ga0451577_0117378 | 3300042876 | Bacteria | 2383 |
| 795 | Ga0453683_0093706 | 3300044673 | Bacteria | 1884 |
| 796 | Ga0466965_0191429 | 3300044683 | Bacteria | 1082 |
| 797 | Ga0466963_0126674 | 3300044694 | Bacteria | 1761 |
| 798 | Ga0466964_0166114 | 3300044706 | Bacteria | 1035 |
| 799 | Ga0453684_0012582 | 3300044712 | Bacteria | 13925 |
| 800 | Ga0453684_0013830 | 3300044712 | Bacteria | 13033 |
| 801 | Ga0453684_0071548 | 3300044712 | Bacteria | 4384 |
| 802 | Ga0453684_0700050 | 3300044712 | Bacteria | 1101 |
| 803 | Ga0466971_0000027 | 3300044719 | Bacteria | 60553 |
| 804 | Ga0466957_0002787 | 3300044842 | Bacteria | 9450 |
| 805 | Ga0466957_0007651 | 3300044842 | Bacteria | 6110 |
| 806 | Ga0451576_0029097 | 3300045051 | Bacteria | 5913 |
| 807 | Ga0451576_0032985 | 3300045051 | Bacteria | 5506 |
| 808 | Ga0451576_0195712 | 3300045051 | Bacteria | 2111 |
| 809 | Ga0451576_0259957 | 3300045051 | Bacteria | 1814 |
| 810 | Ga0451576_0292860 | 3300045051 | Bacteria | 1702 |
| 811 | Ga0451576_0562763 | 3300045051 | Bacteria | 1198 |
| 812 | Ga0451576_0813242 | 3300045051 | Bacteria | 981 |
| 813 | Ga0466967_0043333 | 3300045976 | Bacteria | 3896 |
| 814 | Ga0495592_0470141 | 3300046454 | Bacteria | 785 |
| 815 | Ga0495629_0265996 | 3300046459 | Bacteria | 1178 |
| 816 | Ga0495638_0010324 | 3300046460 | Bacteria | 6494 |
| 817 | Ga0495651_0036005 | 3300046462 | Bacteria | 3852 |
| 818 | Ga0495653_0120513 | 3300046463 | Bacteria | 1871 |
| 819 | Ga0495580_0000846 | 3300046472 | Bacteria | 26530 |
| 820 | Ga0495580_0142249 | 3300046472 | Bacteria | 1663 |
| 821 | Ga0495582_0000930 | 3300046473 | Bacteria | 16319 |
| 822 | Ga0495582_0251875 | 3300046473 | Bacteria | 1013 |
| 823 | Ga0495662_0002226 | 3300046476 | Bacteria | 9789 |
| 824 | Ga0495662_0218607 | 3300046476 | Bacteria | 939 |
| 825 | Ga0495664_0053849 | 3300046477 | Bacteria | 2392 |
| 826 | Ga0495594_0079089 | 3300046499 | Bacteria | 1835 |
| 827 | Ga0495608_0233315 | 3300046511 | Bacteria | 1151 |
| 828 | Ga0495618_0043471 | 3300046514 | Bacteria | 2835 |
| 829 | Ga0495628_0008311 | 3300046516 | Bacteria | 8917 |
| 830 | Ga0495630_0032627 | 3300046517 | Bacteria | 3882 |
| 831 | Ga0495630_0041419 | 3300046517 | Bacteria | 3439 |
| 832 | Ga0495666_0118955 | 3300046526 | Bacteria | 1238 |
| 833 | Ga0495652_0121564 | 3300046529 | Bacteria | 2081 |
| 834 | Ga0495586_0028557 | 3300046535 | Bacteria | 2985 |
| 835 | Ga0495621_0067349 | 3300046539 | Bacteria | 1312 |
| 836 | Ga0495645_0001895 | 3300046543 | Bacteria | 14223 |
| 837 | Ga0495633_0202564 | 3300046558 | Bacteria | 911 |
| 838 | Ga0495667_0023218 | 3300046559 | Bacteria | 4179 |
| 839 | Ga0495634_0142707 | 3300046642 | Bacteria | 1519 |
| 840 | Ga0495599_0086881 | 3300046678 | Bacteria | 1953 |
| 841 | Ga0495623_0035368 | 3300046679 | Bacteria | 3202 |
| 842 | Ga0495658_0270237 | 3300046683 | Bacteria | 1071 |
| 843 | Ga0495669_0114628 | 3300046684 | Unclassified | 1261 |
| 844 | Ga0495604_0300875 | 3300047317 | Bacteria | 1077 |
| 845 | Ga0495674_0104304 | 3300047319 | Unclassified | 2410 |
| 846 | Ga0495680_0015803 | 3300047322 | Bacteria | 6498 |
| 847 | Ga0495675_0071358 | 3300047444 | Bacteria | 2192 |
| 848 | Ga0495593_0216594 | 3300047673 | Bacteria | 961 |
| 849 | Ga0495602_0040722 | 3300048088 | Bacteria | 4255 |
| 850 | Ga0496101_0011136 | 3300048904 | Bacteria | 5960 |
| 851 | Ga0496101_0023085 | 3300048904 | Bacteria | 4292 |
| 852 | Ga0496102_0018879 | 3300048905 | Bacteria | 6066 |
| 853 | Ga0496102_0039382 | 3300048905 | Bacteria | 4271 |
| 854 | Ga0496102_0077079 | 3300048905 | Bacteria | 3068 |
| 855 | Ga0496102_0150216 | 3300048905 | Bacteria | 2189 |
| 856 | Ga0496102_0151165 | 3300048905 | Bacteria | 2182 |
| 857 | Ga0496102_0236967 | 3300048905 | Bacteria | 1721 |
| 858 | Ga0496102_0375297 | 3300048905 | Bacteria | 1338 |
| 859 | Ga0496103_0028010 | 3300048906 | Bacteria | 3418 |
| 860 | Ga0496103_0163800 | 3300048906 | Bacteria | 1427 |
| 861 | Ga0496104_0004299 | 3300048907 | Bacteria | 12382 |
| 862 | Ga0496104_0018651 | 3300048907 | Bacteria | 6333 |
| 863 | Ga0496104_0157238 | 3300048907 | Bacteria | 2181 |
| 864 | Ga0496104_0220399 | 3300048907 | Bacteria | 1809 |
| 865 | Ga0496104_0386337 | 3300048907 | Unclassified | 1312 |
| 866 | Ga0496104_0638750 | 3300048907 | Bacteria | 973 |
| 867 | Ga0496105_0016946 | 3300048908 | Bacteria | 5830 |
| 868 | Ga0496105_0476175 | 3300048908 | Bacteria | 983 |
| 869 | Ga0496106_0066522 | 3300048909 | Unclassified | 2745 |
| 870 | Ga0496106_0232266 | 3300048909 | Unclassified | 1473 |
| 871 | Ga0496106_0256197 | 3300048909 | Bacteria | 1400 |
| 872 | Ga0496107_0192850 | 3300048910 | Bacteria | 1514 |
| 873 | Ga0496108_0001670 | 3300048911 | Bacteria | 17610 |
| 874 | Ga0496108_0006367 | 3300048911 | Bacteria | 9569 |
| 875 | Ga0496108_0011573 | 3300048911 | Bacteria | 7174 |
| 876 | Ga0496108_0043711 | 3300048911 | Bacteria | 3742 |
| 877 | Ga0496108_0123640 | 3300048911 | Bacteria | 2220 |
| 878 | Ga0496109_0000059 | 3300048912 | Bacteria | 118169 |
| 879 | Ga0496109_0037614 | 3300048912 | Bacteria | 4372 |
| 880 | Ga0496109_0044575 | 3300048912 | Bacteria | 4024 |
| 881 | Ga0496109_0062367 | 3300048912 | Bacteria | 3408 |
| 882 | Ga0496109_0100183 | 3300048912 | Bacteria | 2688 |
| 883 | Ga0496109_0100546 | 3300048912 | Bacteria | 2683 |
| 884 | Ga0496110_0048813 | 3300048913 | Unclassified | 3711 |
| 885 | Ga0496110_0067434 | 3300048913 | Bacteria | 3166 |
| 886 | Ga0496110_0256083 | 3300048913 | Bacteria | 1593 |
| 887 | Ga0496110_0406198 | 3300048913 | Bacteria | 1242 |
| 888 | Ga0496111_0028871 | 3300048914 | Unclassified | 3934 |
| 889 | Ga0496111_0053860 | 3300048914 | Bacteria | 2907 |
| 890 | Ga0496111_0161122 | 3300048914 | Bacteria | 1666 |
| 891 | Ga0496111_0254356 | 3300048914 | Bacteria | 1303 |
| 892 | Ga0496112_0000504 | 3300048915 | Bacteria | 26451 |
| 893 | Ga0496112_0000524 | 3300048915 | Bacteria | 26174 |
| 894 | Ga0496112_0002385 | 3300048915 | Bacteria | 15116 |
| 895 | Ga0496112_0014024 | 3300048915 | Bacteria | 7417 |
| 896 | Ga0496112_0577263 | 3300048915 | Bacteria | 1057 |
| 897 | Ga0496113_0001118 | 3300048916 | Bacteria | 14549 |
| 898 | Ga0496113_0003691 | 3300048916 | Bacteria | 9223 |
| 899 | Ga0496113_0080682 | 3300048916 | Bacteria | 2492 |
| 900 | Ga0496113_0083239 | 3300048916 | Bacteria | 2455 |
| 901 | Ga0496113_0122054 | 3300048916 | Bacteria | 2038 |
| 902 | Ga0496113_0342268 | 3300048916 | Bacteria | 1199 |
| 903 | Ga0496114_0002356 | 3300048917 | Bacteria | 14384 |
| 904 | Ga0496114_0054600 | 3300048917 | Bacteria | 3332 |
| 905 | Ga0496115_0002416 | 3300048918 | Bacteria | 13408 |
| 906 | Ga0496115_0133026 | 3300048918 | Bacteria | 2050 |
| 907 | Ga0496126_0407811 | 3300048929 | Bacteria | 1101 |
| 908 | Ga0501031_0001872 | 3300049568 | Bacteria | 13235 |
| 909 | Ga0501032_0000027 | 3300049569 | Bacteria | 136304 |
| 910 | Ga0501032_0125309 | 3300049569 | Bacteria | 1697 |
| 911 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 912 | Ga0501033_0000008 | 3300049570 | Bacteria | 274368 |
| 913 | Ga0501036_0007735 | 3300049572 | Bacteria | 8783 |
| 914 | Ga0501037_0000002 | 3300049573 | Bacteria | 292291 |
| 915 | Ga0501037_0154617 | 3300049573 | Bacteria | 1638 |
| 916 | Ga0501038_0000801 | 3300049574 | Bacteria | 27926 |
| 917 | Ga0501039_0044587 | 3300049575 | Bacteria | 3426 |
| 918 | Ga0501039_0070008 | 3300049575 | Bacteria | 2725 |
| 919 | Ga0501039_0471435 | 3300049575 | Bacteria | 986 |
| 920 | Ga0501040_0007525 | 3300049576 | Bacteria | 7042 |
| 921 | Ga0501041_0025890 | 3300049577 | Bacteria | 3528 |
| 922 | Ga0501042_0021910 | 3300049578 | Bacteria | 4460 |
| 923 | Ga0501043_0003304 | 3300049579 | Bacteria | 13283 |
| 924 | Ga0501043_0012458 | 3300049579 | Bacteria | 6652 |
| 925 | Ga0501048_0039099 | 3300049582 | Bacteria | 3404 |
| 926 | Ga0501070_0000465 | 3300049586 | Bacteria | 36826 |
| 927 | Ga0501071_0054505 | 3300049587 | Bacteria | 2885 |
| 928 | Ga0501072_0004986 | 3300049588 | Bacteria | 10100 |
| 929 | Ga0501075_0055592 | 3300049591 | Bacteria | 2978 |
| 930 | Ga0501077_0172901 | 3300049593 | Bacteria | 1372 |
| 931 | Ga0501079_0042388 | 3300049741 | Bacteria | 3515 |
| 932 | Ga0501080_0394408 | 3300049742 | Bacteria | 1246 |
| 933 | Ga0501081_0107736 | 3300049743 | Bacteria | 1976 |
| 934 | Ga0501081_0156377 | 3300049743 | Bacteria | 1641 |
| 935 | Ga0501035_0000007 | 3300049822 | Bacteria | 359281 |
| 936 | Ga0501035_0051602 | 3300049822 | Bacteria | 3682 |
| 937 | Ga0501044_0001568 | 3300049823 | Bacteria | 26747 |
| 938 | Ga0501044_0221690 | 3300049823 | Bacteria | 1842 |
| 939 | Ga0501045_0018375 | 3300049824 | Bacteria | 4973 |
| 940 | Ga0501045_0208192 | 3300049824 | Bacteria | 1457 |
| 941 | nmdc:mga03683_91956_c1 | 3300050489 | Bacteria | 1324 |
| 942 | nmdc:mga00v17_104421_c1 | 3300050491 | Bacteria | 1792 |
| 943 | nmdc:mga00v17_167751_c1 | 3300050491 | Bacteria | 1415 |
| 944 | nmdc:mga00v17_19417_c1 | 3300050491 | Bacteria | 3880 |
| 945 | nmdc:mga0yw44_9395_c1 | 3300050492 | Bacteria | 4941 |
| 946 | nmdc:mga0k408_4424_c1 | 3300050493 | Bacteria | 7455 |
| 947 | nmdc:mga06z11_27460_c1 | 3300050494 | Bacteria | 2721 |
| 948 | nmdc:mga06z11_61189_c1 | 3300050494 | Bacteria | 1963 |
| 949 | nmdc:mga04h51_28042_c1 | 3300050495 | Bacteria | 1754 |
| 950 | nmdc:mga07m45_148768_c1 | 3300050496 | Bacteria | 1357 |
| 951 | nmdc:mga07m45_5600_c1 | 3300050496 | Bacteria | 6272 |
| 952 | nmdc:mga05p37_188212_c1 | 3300050507 | Bacteria | 2508 |
| 953 | nmdc:mga05p37_27870_c1 | 3300050507 | Bacteria | 6881 |
| 954 | nmdc:mga05p37_31532_c1 | 3300050507 | Bacteria | 6474 |
| 955 | nmdc:mga05p37_437715_c1 | 3300050507 | Bacteria | 1517 |
| 956 | nmdc:mga05p37_5248_c1 | 3300050507 | Bacteria | 15212 |
| 957 | nmdc:mga05p37_645163_c1 | 3300050507 | Bacteria | 1187 |
| 958 | nmdc:mga05p37_7929_c1 | 3300050507 | Bacteria | 12534 |
| 959 | nmdc:mga05p37_82009_c1 | 3300050507 | Bacteria | 3973 |
| 960 | nmdc:mga05p37_824274_c1 | 3300050507 | Bacteria | 1011 |
| 961 | nmdc:mga05p37_984_c1 | 3300050507 | Bacteria | 32420 |
| 962 | nmdc:mga09592_18276_c1 | 3300050508 | Bacteria | 5748 |
| 963 | nmdc:mga09592_857_c1 | 3300050508 | Bacteria | 23716 |
| 964 | nmdc:mga09592_89964_c1 | 3300050508 | Bacteria | 2622 |
| 965 | nmdc:mga09592_94837_c1 | 3300050508 | Bacteria | 2552 |
| 966 | nmdc:mga0qj67_19750_c1 | 3300050509 | Bacteria | 5152 |
| 967 | nmdc:mga0qj67_91286_c1 | 3300050509 | Bacteria | 2448 |
| 968 | nmdc:mga06r32_13422_c1 | 3300050510 | Bacteria | 6372 |
| 969 | nmdc:mga06r32_253175_c1 | 3300050510 | Unclassified | 1749 |
| 970 | nmdc:mga06r32_3603_c1 | 3300050510 | Bacteria | 13819 |
| 971 | nmdc:mga06r32_553_c1 | 3300050510 | Bacteria | 32512 |
| 972 | nmdc:mga08y16_123850_c1 | 3300050511 | Unclassified | 2690 |
| 973 | nmdc:mga08y16_139391_c1 | 3300050511 | Bacteria | 2521 |
| 974 | nmdc:mga08y16_1473_c2 | 3300050511 | Bacteria | 20895 |
| 975 | nmdc:mga08y16_148389_c1 | 3300050511 | Bacteria | 2437 |
| 976 | nmdc:mga08y16_21091_c1 | 3300050511 | Bacteria | 6879 |
| 977 | nmdc:mga08y16_220766_c1 | 3300050511 | Bacteria | 1962 |
| 978 | nmdc:mga08y16_222051_c1 | 3300050511 | Bacteria | 1956 |
| 979 | nmdc:mga08y16_23_c1 | 3300050511 | Bacteria | 246918 |
| 980 | nmdc:mga08y16_26456_c1 | 3300050511 | Bacteria | 6118 |
| 981 | nmdc:mga08y16_69453_c1 | 3300050511 | Bacteria | 3673 |
| 982 | nmdc:mga0n895_106927_c1 | 3300050512 | Bacteria | 2811 |
| 983 | nmdc:mga0n895_167183_c1 | 3300050512 | Bacteria | 2231 |
| 984 | nmdc:mga0n895_16854_c1 | 3300050512 | Bacteria | 6716 |
| 985 | nmdc:mga0n895_17787_c1 | 3300050512 | Bacteria | 6562 |
| 986 | nmdc:mga0n895_243492_c1 | 3300050512 | Bacteria | 1825 |
| 987 | nmdc:mga0n895_388976_c1 | 3300050512 | Bacteria | 1411 |
| 988 | nmdc:mga0n895_400320_c2 | 3300050512 | Bacteria | 1012 |
| 989 | nmdc:mga0n895_65895_c1 | 3300050512 | Unclassified | 3586 |
| 990 | nmdc:mga0rr50_14388_c1 | 3300050513 | Bacteria | 5187 |
| 991 | nmdc:mga0rr50_167_c2 | 3300050513 | Unclassified | 3878 |
| 992 | nmdc:mga0rr50_320162_c1 | 3300050513 | Bacteria | 1300 |
| 993 | nmdc:mga0rr50_339463_c1 | 3300050513 | Bacteria | 1262 |
| 994 | nmdc:mga0rr50_520818_c1 | 3300050513 | Bacteria | 1012 |
| 995 | nmdc:mga0rr50_64578_c1 | 3300050513 | Bacteria | 2769 |
| 996 | nmdc:mga0rr50_7803_c1 | 3300050513 | Bacteria | 6633 |
| 997 | nmdc:mga08x19_115725_c1 | 3300050514 | Bacteria | 1792 |
| 998 | nmdc:mga08x19_30835_c1 | 3300050514 | Bacteria | 3370 |
| 999 | nmdc:mga08x19_57641_c1 | 3300050514 | Bacteria | 2511 |
| 1000 | nmdc:mga0a205_112129_c1 | 3300050515 | Bacteria | 2626 |
| 1001 | nmdc:mga0a205_21835_c1 | 3300050515 | Bacteria | 6054 |
| 1002 | nmdc:mga0a205_257952_c1 | 3300050515 | Bacteria | 1621 |
| 1003 | nmdc:mga0a205_270381_c1 | 3300050515 | Bacteria | 1577 |
| 1004 | nmdc:mga0a205_469705_c1 | 3300050515 | Bacteria | 1117 |
| 1005 | nmdc:mga0a205_60997_c1 | 3300050515 | Bacteria | 3642 |
| 1006 | nmdc:mga0a205_89653_c1 | 3300050515 | Bacteria | 2972 |
| 1007 | nmdc:mga0a205_9887_c1 | 3300050515 | Bacteria | 8749 |
| 1008 | Ga0495601_0144125 | 3300053077 | Bacteria | 1554 |
| 1009 | Ga0495595_0168370 | 3300053084 | Bacteria | 1084 |
| 1010 | Ga0495619_0216901 | 3300053085 | Bacteria | 1325 |
| 1011 | Ga0500641_0018512 | 3300053096 | Bacteria | 2621 |
| 1012 | Ga0500568_0125893 | 3300053139 | Bacteria | 954 |
| 1013 | Ga0500634_0019126 | 3300053161 | Bacteria | 3686 |
| 1014 | Ga0500636_0065300 | 3300053177 | Bacteria | 2118 |
| 1015 | Ga0501084_0300456 | 3300054114 | Bacteria | 1356 |
| 1016 | Ga0501084_0528549 | 3300054114 | Bacteria | 997 |
| 1017 | Ga0466962_0000032 | 3300061719 | Bacteria | 67996 |
| 1018 | Ga0530510_0003691 | 3300061734 | Bacteria | 10532 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046454 | Ga0495592_0470141 | Ga0495592_0470141_10_645 | 211 |
| 2 | 3300049742 | Ga0501080_0394408 | Ga0501080_0394408_269_925 | 218 |
| 3 | 3300050508 | nmdc:mga09592_89964_c1 | nmdc:mga09592_89964_c1_23_745 | 219 |
| 4 | 3300005617 | Ga0068859_100056009 | Ga0068859_1000560092 | 231 |
| 5 | 3300006931 | Ga0097620_100056007 | Ga0097620_1000560072 | 231 |
| 6 | 3300005471 | Ga0070698_100164765 | Ga0070698_1001647652 | 234 |
| 7 | 3300005842 | Ga0068858_100023674 | Ga0068858_1000236744 | 235 |
| 8 | 3300014968 | Ga0157379_10063788 | Ga0157379_100637883 | 235 |
| 9 | 3300025925 | Ga0207650_10162572 | Ga0207650_101625722 | 235 |
| 10 | 3300026035 | Ga0207703_10004941 | Ga0207703_100049417 | 235 |
| 11 | 3300026095 | Ga0207676_10662430 | Ga0207676_106624302 | 235 |
| 12 | 3300031995 | Ga0307409_100190285 | Ga0307409_1001902852 | 237 |
| 13 | 3300049568 | Ga0501031_0001872 | Ga0501031_0001872_12204_13019 | 237 |
| 14 | 3300049572 | Ga0501036_0007735 | Ga0501036_0007735_3630_4445 | 237 |
| 15 | 3300049575 | Ga0501039_0044587 | Ga0501039_0044587_1979_2794 | 237 |
| 16 | 3300049579 | Ga0501043_0003304 | Ga0501043_0003304_12160_12975 | 237 |
| 17 | 3300049586 | Ga0501070_0000465 | Ga0501070_0000465_19537_20352 | 237 |
| 18 | 3300049822 | Ga0501035_0000007 | Ga0501035_0000007_236448_237263 | 237 |
| 19 | 3300046460 | Ga0495638_0010324 | Ga0495638_0010324_828_1622 | 238 |
| 20 | 3300050496 | nmdc:mga07m45_148768_c1 | nmdc:mga07m45_148768_c1_418_1212 | 239 |
| 21 | 3300009147 | Ga0114129_10399170 | Ga0114129_103991702 | 241 |
| 22 | 3300050507 | nmdc:mga05p37_188212_c1 | nmdc:mga05p37_188212_c1_1007_1819 | 241 |
| 23 | 3300050515 | nmdc:mga0a205_257952_c1 | nmdc:mga0a205_257952_c1_153_965 | 241 |
| 24 | 3300009553 | Ga0105249_10259855 | Ga0105249_102598552 | 242 |
| 25 | 3300046526 | Ga0495666_0118955 | Ga0495666_0118955_498_1226 | 242 |
| 26 | 3300050507 | nmdc:mga05p37_824274_c1 | nmdc:mga05p37_824274_c1_31_843 | 242 |
| 27 | 3300048905 | Ga0496102_0018879 | Ga0496102_0018879_873_1685 | 243 |
| 28 | 3300048916 | Ga0496113_0083239 | Ga0496113_0083239_345_1157 | 243 |
| 29 | 3300005336 | Ga0070680_100419531 | Ga0070680_1004195311 | 244 |
| 30 | 3300006880 | Ga0075429_100301976 | Ga0075429_1003019762 | 244 |
| 31 | 3300009094 | Ga0111539_10445629 | Ga0111539_104456292 | 244 |
| 32 | 3300050507 | nmdc:mga05p37_437715_c1 | nmdc:mga05p37_437715_c1_183_995 | 244 |
| 33 | 3300050511 | nmdc:mga08y16_222051_c1 | nmdc:mga08y16_222051_c1_176_988 | 244 |
| 34 | 3300050515 | nmdc:mga0a205_112129_c1 | nmdc:mga0a205_112129_c1_1353_2165 | 244 |
| 35 | 3300031727 | Ga0316576_10099416 | Ga0316576_100994162 | 245 |
| 36 | 3300045051 | Ga0451576_0562763 | Ga0451576_0562763_27_767 | 245 |
| 37 | 3300006880 | Ga0075429_100222102 | Ga0075429_1002221022 | 247 |
| 38 | 3300005340 | Ga0070689_100342164 | Ga0070689_1003421641 | 248 |
| 39 | 3300005343 | Ga0070687_100049508 | Ga0070687_1000495082 | 248 |
| 40 | 3300025918 | Ga0207662_10095290 | Ga0207662_100952901 | 248 |
| 41 | 3300053139 | Ga0500568_0125893 | Ga0500568_0125893_31_777 | 248 |
| 42 | 3300006871 | Ga0075434_100162539 | Ga0075434_1001625392 | 249 |
| 43 | 3300009098 | Ga0105245_10074125 | Ga0105245_100741252 | 249 |
| 44 | 3300009176 | Ga0105242_10174863 | Ga0105242_101748632 | 249 |
| 45 | 3300025927 | Ga0207687_10113901 | Ga0207687_101139012 | 249 |
| 46 | 3300045051 | Ga0451576_0029097 | Ga0451576_0029097_4977_5726 | 249 |
| 47 | 3300050512 | nmdc:mga0n895_106927_c1 | nmdc:mga0n895_106927_c1_1084_1896 | 249 |
| 48 | 3300013306 | Ga0163162_10162096 | Ga0163162_101620963 | 250 |
| 49 | 3300014325 | Ga0163163_10275443 | Ga0163163_102754432 | 250 |
| 50 | 3300014326 | Ga0157380_10295988 | Ga0157380_102959882 | 250 |
| 51 | 3300026035 | Ga0207703_10158903 | Ga0207703_101589032 | 250 |
| 52 | 3300053161 | Ga0500634_0019126 | Ga0500634_0019126_2611_3387 | 250 |
| 53 | 3300005367 | Ga0070667_100377910 | Ga0070667_1003779102 | 251 |
| 54 | 3300005441 | Ga0070700_100365152 | Ga0070700_1003651521 | 251 |
| 55 | 3300005617 | Ga0068859_100144462 | Ga0068859_1001444623 | 251 |
| 56 | 3300005841 | Ga0068863_100185337 | Ga0068863_1001853372 | 251 |
| 57 | 3300006931 | Ga0097620_100144470 | Ga0097620_1001444703 | 251 |
| 58 | 3300009094 | Ga0111539_10099518 | Ga0111539_100995183 | 251 |
| 59 | 3300009101 | Ga0105247_10235569 | Ga0105247_102355692 | 251 |
| 60 | 3300025986 | Ga0207658_10300341 | Ga0207658_103003412 | 251 |
| 61 | 3300026075 | Ga0207708_10373485 | Ga0207708_103734851 | 251 |
| 62 | 3300048907 | Ga0496104_0018651 | Ga0496104_0018651_1620_2432 | 251 |
| 63 | 3300048908 | Ga0496105_0016946 | Ga0496105_0016946_2456_3268 | 251 |
| 64 | 3300048917 | Ga0496114_0002356 | Ga0496114_0002356_2173_2985 | 251 |
| 65 | 3300048918 | Ga0496115_0133026 | Ga0496115_0133026_1090_1902 | 251 |
| 66 | 3300050511 | nmdc:mga08y16_220766_c1 | nmdc:mga08y16_220766_c1_205_1017 | 251 |
| 67 | 3300053096 | Ga0500641_0018512 | Ga0500641_0018512_344_1138 | 251 |
| 68 | 3300005330 | Ga0070690_100320693 | Ga0070690_1003206931 | 252 |
| 69 | 3300005434 | Ga0070709_10035864 | Ga0070709_100358642 | 252 |
| 70 | 3300005544 | Ga0070686_100328628 | Ga0070686_1003286282 | 252 |
| 71 | 3300005545 | Ga0070695_100105009 | Ga0070695_1001050092 | 252 |
| 72 | 3300005546 | Ga0070696_100105744 | Ga0070696_1001057443 | 252 |
| 73 | 3300005549 | Ga0070704_100190714 | Ga0070704_1001907142 | 252 |
| 74 | 3300005563 | Ga0068855_100448432 | Ga0068855_1004484322 | 252 |
| 75 | 3300005616 | Ga0068852_100565516 | Ga0068852_1005655162 | 252 |
| 76 | 3300005617 | Ga0068859_100156809 | Ga0068859_1001568093 | 252 |
| 77 | 3300005718 | Ga0068866_10086309 | Ga0068866_100863092 | 252 |
| 78 | 3300005718 | Ga0068866_10214392 | Ga0068866_102143922 | 252 |
| 79 | 3300005843 | Ga0068860_100003719 | Ga0068860_1000037193 | 252 |
| 80 | 3300006163 | Ga0070715_10056923 | Ga0070715_100569232 | 252 |
| 81 | 3300006173 | Ga0070716_100051834 | Ga0070716_1000518341 | 252 |
| 82 | 3300006175 | Ga0070712_100059425 | Ga0070712_1000594252 | 252 |
| 83 | 3300006358 | Ga0068871_100025979 | Ga0068871_1000259792 | 252 |
| 84 | 3300006881 | Ga0068865_100062193 | Ga0068865_1000621932 | 252 |
| 85 | 3300006881 | Ga0068865_100087178 | Ga0068865_1000871784 | 252 |
| 86 | 3300006931 | Ga0097620_100156815 | Ga0097620_1001568153 | 252 |
| 87 | 3300009098 | Ga0105245_10051105 | Ga0105245_100511053 | 252 |
| 88 | 3300009148 | Ga0105243_10101952 | Ga0105243_101019522 | 252 |
| 89 | 3300010375 | Ga0105239_10028869 | Ga0105239_100288692 | 252 |
| 90 | 3300013297 | Ga0157378_10008675 | Ga0157378_100086756 | 252 |
| 91 | 3300013306 | Ga0163162_10312649 | Ga0163162_103126492 | 252 |
| 92 | 3300017792 | Ga0163161_10059736 | Ga0163161_100597364 | 252 |
| 93 | 3300025915 | Ga0207693_10051785 | Ga0207693_100517853 | 252 |
| 94 | 3300025935 | Ga0207709_10129734 | Ga0207709_101297342 | 252 |
| 95 | 3300025938 | Ga0207704_10267320 | Ga0207704_102673202 | 252 |
| 96 | 3300025939 | Ga0207665_10014317 | Ga0207665_100143171 | 252 |
| 97 | 3300026023 | Ga0207677_10318353 | Ga0207677_103183532 | 252 |
| 98 | 3300026041 | Ga0207639_10251758 | Ga0207639_102517582 | 252 |
| 99 | 3300026088 | Ga0207641_10055117 | Ga0207641_100551172 | 252 |
| 100 | 3300028381 | Ga0268264_10082755 | Ga0268264_100827553 | 252 |
| 101 | 3300048905 | Ga0496102_0375297 | Ga0496102_0375297_199_1011 | 252 |
| 102 | 3300048906 | Ga0496103_0028010 | Ga0496103_0028010_595_1407 | 252 |
| 103 | 3300048909 | Ga0496106_0066522 | Ga0496106_0066522_868_1680 | 252 |
| 104 | 3300048911 | Ga0496108_0043711 | Ga0496108_0043711_1809_2621 | 252 |
| 105 | 3300048912 | Ga0496109_0100546 | Ga0496109_0100546_935_1747 | 252 |
| 106 | 3300048914 | Ga0496111_0161122 | Ga0496111_0161122_286_1098 | 252 |
| 107 | 3300005367 | Ga0070667_100210066 | Ga0070667_1002100662 | 253 |
| 108 | 3300005844 | Ga0068862_100505777 | Ga0068862_1005057772 | 253 |
| 109 | 3300009174 | Ga0105241_10126009 | Ga0105241_101260091 | 253 |
| 110 | 3300025972 | Ga0207668_10271298 | Ga0207668_102712981 | 253 |
| 111 | 3300026089 | Ga0207648_10179390 | Ga0207648_101793902 | 253 |
| 112 | 3300026095 | Ga0207676_10103721 | Ga0207676_101037212 | 253 |
| 113 | 3300035121 | Ga0373960_0067418 | Ga0373960_0067418_218_1030 | 253 |
| 114 | 3300035691 | Ga0373931_0007641 | Ga0373931_0007641_652_1464 | 253 |
| 115 | 3300005434 | Ga0070709_10288995 | Ga0070709_102889952 | 254 |
| 116 | 3300013100 | Ga0157373_10165797 | Ga0157373_101657972 | 254 |
| 117 | 3300025906 | Ga0207699_10305736 | Ga0207699_103057361 | 254 |
| 118 | 3300031344 | Ga0265316_10358239 | Ga0265316_103582392 | 254 |
| 119 | 3300005327 | Ga0070658_10089977 | Ga0070658_100899772 | 255 |
| 120 | 3300005544 | Ga0070686_100280339 | Ga0070686_1002803391 | 255 |
| 121 | 3300013308 | Ga0157375_10000024 | Ga0157375_10000024202 | 255 |
| 122 | 3300025909 | Ga0207705_10053368 | Ga0207705_100533682 | 255 |
| 123 | 3300025935 | Ga0207709_10415055 | Ga0207709_104150551 | 255 |
| 124 | 3300035691 | Ga0373931_0274999 | Ga0373931_0274999_145_1014 | 255 |
| 125 | 3300034816 | Ga0373930_0016333 | Ga0373930_0016333_516_1328 | 256 |
| 126 | 3300035084 | Ga0373928_0019135 | Ga0373928_0019135_276_1088 | 256 |
| 127 | 3300035088 | Ga0373940_0015791 | Ga0373940_0015791_117_929 | 256 |
| 128 | 3300035691 | Ga0373931_0024310 | Ga0373931_0024310_326_1138 | 256 |
| 129 | 3300038996 | Ga0242420_000212 | Ga0242420_000212_2891_3703 | 256 |
| 130 | 3300046539 | Ga0495621_0067349 | Ga0495621_0067349_385_1197 | 257 |
| 131 | 3300049823 | Ga0501044_0221690 | Ga0501044_0221690_697_1515 | 257 |
| 132 | 3300005330 | Ga0070690_100033965 | Ga0070690_1000339653 | 258 |
| 133 | 3300005345 | Ga0070692_10431632 | Ga0070692_104316321 | 258 |
| 134 | 3300005444 | Ga0070694_100616851 | Ga0070694_1006168511 | 258 |
| 135 | 3300005457 | Ga0070662_100467109 | Ga0070662_1004671091 | 258 |
| 136 | 3300005471 | Ga0070698_100023178 | Ga0070698_1000231786 | 258 |
| 137 | 3300005548 | Ga0070665_100416494 | Ga0070665_1004164943 | 258 |
| 138 | 3300005618 | Ga0068864_100116214 | Ga0068864_1001162143 | 258 |
| 139 | 3300005842 | Ga0068858_100090268 | Ga0068858_1000902682 | 258 |
| 140 | 3300005844 | Ga0068862_100276902 | Ga0068862_1002769022 | 258 |
| 141 | 3300005983 | Ga0081540_1116864 | Ga0081540_11168642 | 258 |
| 142 | 3300006038 | Ga0075365_10249058 | Ga0075365_102490582 | 258 |
| 143 | 3300006042 | Ga0075368_10016277 | Ga0075368_100162772 | 258 |
| 144 | 3300006048 | Ga0075363_100007068 | Ga0075363_1000070684 | 258 |
| 145 | 3300006175 | Ga0070712_100055300 | Ga0070712_1000553002 | 258 |
| 146 | 3300006177 | Ga0075362_10077281 | Ga0075362_100772812 | 258 |
| 147 | 3300006178 | Ga0075367_10331316 | Ga0075367_103313161 | 258 |
| 148 | 3300006186 | Ga0075369_10110697 | Ga0075369_101106972 | 258 |
| 149 | 3300006237 | Ga0097621_100028848 | Ga0097621_1000288485 | 258 |
| 150 | 3300006358 | Ga0068871_100013024 | Ga0068871_1000130244 | 258 |
| 151 | 3300006844 | Ga0075428_100006816 | Ga0075428_1000068162 | 258 |
| 152 | 3300006844 | Ga0075428_100687329 | Ga0075428_1006873292 | 258 |
| 153 | 3300006846 | Ga0075430_100035227 | Ga0075430_1000352272 | 258 |
| 154 | 3300006847 | Ga0075431_100001217 | Ga0075431_1000012177 | 258 |
| 155 | 3300006880 | Ga0075429_100002046 | Ga0075429_1000020469 | 258 |
| 156 | 3300009094 | Ga0111539_10020650 | Ga0111539_100206507 | 258 |
| 157 | 3300009098 | Ga0105245_10009229 | Ga0105245_100092295 | 258 |
| 158 | 3300009147 | Ga0114129_10021293 | Ga0114129_100212937 | 258 |
| 159 | 3300009147 | Ga0114129_10284758 | Ga0114129_102847582 | 258 |
| 160 | 3300009148 | Ga0105243_10055425 | Ga0105243_100554254 | 258 |
| 161 | 3300009176 | Ga0105242_10079295 | Ga0105242_100792952 | 258 |
| 162 | 3300009177 | Ga0105248_10121221 | Ga0105248_101212213 | 258 |
| 163 | 3300010375 | Ga0105239_10542346 | Ga0105239_105423462 | 258 |
| 164 | 3300013297 | Ga0157378_10077784 | Ga0157378_100777843 | 258 |
| 165 | 3300025927 | Ga0207687_10006656 | Ga0207687_100066564 | 258 |
| 166 | 3300025934 | Ga0207686_10236074 | Ga0207686_102360742 | 258 |
| 167 | 3300025986 | Ga0207658_10216305 | Ga0207658_102163051 | 258 |
| 168 | 3300026035 | Ga0207703_10068898 | Ga0207703_100688982 | 258 |
| 169 | 3300026041 | Ga0207639_10125944 | Ga0207639_101259442 | 258 |
| 170 | 3300026095 | Ga0207676_10189353 | Ga0207676_101893532 | 258 |
| 171 | 3300026121 | Ga0207683_10108516 | Ga0207683_101085163 | 258 |
| 172 | 3300027866 | Ga0209813_10007652 | Ga0209813_100076522 | 258 |
| 173 | 3300027907 | Ga0207428_10009277 | Ga0207428_100092777 | 258 |
| 174 | 3300028380 | Ga0268265_10824549 | Ga0268265_108245491 | 258 |
| 175 | 3300035171 | Ga0373946_0108141 | Ga0373946_0108141_41_817 | 258 |
| 176 | 3300035725 | Ga0373947_0097197 | Ga0373947_0097197_906_1682 | 258 |
| 177 | 3300046517 | Ga0495630_0032627 | Ga0495630_0032627_965_1741 | 258 |
| 178 | 3300047319 | Ga0495674_0104304 | Ga0495674_0104304_435_1211 | 258 |
| 179 | 3300050489 | nmdc:mga03683_91956_c1 | nmdc:mga03683_91956_c1_223_999 | 258 |
| 180 | 3300050491 | nmdc:mga00v17_104421_c1 | nmdc:mga00v17_104421_c1_47_823 | 258 |
| 181 | 3300050494 | nmdc:mga06z11_27460_c1 | nmdc:mga06z11_27460_c1_504_1280 | 258 |
| 182 | 3300050495 | nmdc:mga04h51_28042_c1 | nmdc:mga04h51_28042_c1_503_1279 | 258 |
| 183 | 3300050507 | nmdc:mga05p37_984_c1 | nmdc:mga05p37_984_c1_25064_25840 | 258 |
| 184 | 3300050508 | nmdc:mga09592_857_c1 | nmdc:mga09592_857_c1_16422_17198 | 258 |
| 185 | 3300050509 | nmdc:mga0qj67_19750_c1 | nmdc:mga0qj67_19750_c1_559_1335 | 258 |
| 186 | 3300050510 | nmdc:mga06r32_553_c1 | nmdc:mga06r32_553_c1_6682_7458 | 258 |
| 187 | 3300050511 | nmdc:mga08y16_1473_c2 | nmdc:mga08y16_1473_c2_659_1435 | 258 |
| 188 | 3300025291 | Ga0209675_1001593 | Ga0209675_10015933 | 259 |
| 189 | 3300031548 | Ga0307408_100233379 | Ga0307408_1002333792 | 259 |
| 190 | 3300031731 | Ga0307405_10137826 | Ga0307405_101378261 | 259 |
| 191 | 3300031824 | Ga0307413_10044453 | Ga0307413_100444531 | 259 |
| 192 | 3300031852 | Ga0307410_10000637 | Ga0307410_100006376 | 259 |
| 193 | 3300031901 | Ga0307406_10050853 | Ga0307406_100508531 | 259 |
| 194 | 3300031903 | Ga0307407_10012848 | Ga0307407_100128483 | 259 |
| 195 | 3300031911 | Ga0307412_10005347 | Ga0307412_100053475 | 259 |
| 196 | 3300031995 | Ga0307409_100015869 | Ga0307409_1000158692 | 259 |
| 197 | 3300032002 | Ga0307416_100002857 | Ga0307416_10000285710 | 259 |
| 198 | 3300032004 | Ga0307414_10131553 | Ga0307414_101315532 | 259 |
| 199 | 3300032005 | Ga0307411_10058820 | Ga0307411_100588201 | 259 |
| 200 | 3300032126 | Ga0307415_100011025 | Ga0307415_1000110253 | 259 |
| 201 | 3300049576 | Ga0501040_0007525 | Ga0501040_0007525_3019_3798 | 259 |
| 202 | 3300053177 | Ga0500636_0065300 | Ga0500636_0065300_974_1753 | 259 |
| 203 | 3300005355 | Ga0070671_100007890 | Ga0070671_1000078903 | 260 |
| 204 | 3300005367 | Ga0070667_100032389 | Ga0070667_1000323892 | 260 |
| 205 | 3300005468 | Ga0070707_100407805 | Ga0070707_1004078052 | 260 |
| 206 | 3300005539 | Ga0068853_100494428 | Ga0068853_1004944282 | 260 |
| 207 | 3300005543 | Ga0070672_100048222 | Ga0070672_1000482223 | 260 |
| 208 | 3300009177 | Ga0105248_10490757 | Ga0105248_104907572 | 260 |
| 209 | 3300013308 | Ga0157375_10176518 | Ga0157375_101765182 | 260 |
| 210 | 3300025986 | Ga0207658_10121517 | Ga0207658_101215172 | 260 |
| 211 | 3300027695 | Ga0209966_1008228 | Ga0209966_10082282 | 260 |
| 212 | 3300027717 | Ga0209998_10003233 | Ga0209998_100032332 | 260 |
| 213 | 3300045051 | Ga0451576_0032985 | Ga0451576_0032985_4492_5304 | 260 |
| 214 | iso_pu_bacteria | 2765235802 | 2765468898 | 260 |
| 215 | iso_pu_bacteria | 2767802442 | 2770199710 | 260 |
| 216 | iso_pu_bacteria | 2775506902 | 2776267706 | 260 |
| 217 | iso_pu_bacteria | 2839993093 | 2839997395 | 260 |
| 218 | iso_pu_bacteria | 2840764183 | 2840770187 | 260 |
| 219 | iso_pu_bacteria | 2904578770 | 2904583761 | 260 |
| 220 | iso_pu_bacteria | 2919119836 | 2919124330 | 260 |
| 221 | iso_pu_bacteria | 3002141150 | 3002146378 | 260 |
| 222 | 3300032126 | Ga0307415_100024113 | Ga0307415_1000241132 | 261 |
| 223 | iso_pu_bacteria | 2744054657 | 2745166600 | 261 |
| 224 | iso_pu_bacteria | 2816332336 | 2817619035 | 261 |
| 225 | 3300005617 | Ga0068859_100000017 | Ga0068859_100000017130 | 262 |
| 226 | 3300005718 | Ga0068866_10368872 | Ga0068866_103688721 | 262 |
| 227 | 3300006847 | Ga0075431_100218727 | Ga0075431_1002187272 | 262 |
| 228 | 3300006931 | Ga0097620_100000017 | Ga0097620_100000017130 | 262 |
| 229 | 3300025981 | Ga0207640_10537571 | Ga0207640_105375712 | 262 |
| 230 | 3300026088 | Ga0207641_10648626 | Ga0207641_106486261 | 262 |
| 231 | 3300026121 | Ga0207683_10035313 | Ga0207683_100353134 | 262 |
| 232 | 3300045051 | Ga0451576_0292860 | Ga0451576_0292860_169_981 | 262 |
| 233 | 3300046459 | Ga0495629_0265996 | Ga0495629_0265996_71_883 | 262 |
| 234 | 3300048909 | Ga0496106_0256197 | Ga0496106_0256197_72_884 | 262 |
| 235 | 3300005331 | Ga0070670_100090414 | Ga0070670_1000904143 | 263 |
| 236 | 3300005445 | Ga0070708_100013131 | Ga0070708_1000131314 | 263 |
| 237 | 3300005457 | Ga0070662_100166455 | Ga0070662_1001664552 | 263 |
| 238 | 3300005535 | Ga0070684_100049281 | Ga0070684_1000492813 | 263 |
| 239 | 3300005564 | Ga0070664_100279260 | Ga0070664_1002792602 | 263 |
| 240 | 3300005617 | Ga0068859_100216018 | Ga0068859_1002160181 | 263 |
| 241 | 3300006038 | Ga0075365_10031532 | Ga0075365_100315322 | 263 |
| 242 | 3300006931 | Ga0097620_100216018 | Ga0097620_1002160183 | 263 |
| 243 | 3300025925 | Ga0207650_10323563 | Ga0207650_103235632 | 263 |
| 244 | 3300025933 | Ga0207706_10148125 | Ga0207706_101481252 | 263 |
| 245 | 3300025945 | Ga0207679_10086587 | Ga0207679_100865871 | 263 |
| 246 | 3300026041 | Ga0207639_10690230 | Ga0207639_106902302 | 263 |
| 247 | 3300041413 | Ga0439465_0017433 | Ga0439465_0017433_1197_1991 | 263 |
| 248 | 3300044673 | Ga0453683_0093706 | Ga0453683_0093706_141_935 | 263 |
| 249 | 3300046683 | Ga0495658_0270237 | Ga0495658_0270237_35_865 | 263 |
| 250 | 3300047673 | Ga0495593_0216594 | Ga0495593_0216594_30_860 | 263 |
| 251 | 3300048905 | Ga0496102_0151165 | Ga0496102_0151165_12_806 | 263 |
| 252 | 3300050511 | nmdc:mga08y16_139391_c1 | nmdc:mga08y16_139391_c1_579_1370 | 263 |
| 253 | 3300006178 | Ga0075367_10017651 | Ga0075367_100176513 | 264 |
| 254 | 3300006195 | Ga0075366_10018376 | Ga0075366_100183764 | 264 |
| 255 | 3300031241 | Ga0265325_10082013 | Ga0265325_100820132 | 264 |
| 256 | 3300031249 | Ga0265339_10089361 | Ga0265339_100893612 | 264 |
| 257 | 3300031548 | Ga0307408_100339603 | Ga0307408_1003396031 | 264 |
| 258 | 3300048929 | Ga0496126_0407811 | Ga0496126_0407811_99_893 | 264 |
| 259 | 3300050494 | nmdc:mga06z11_61189_c1 | nmdc:mga06z11_61189_c1_988_1782 | 264 |
| 260 | 3300005471 | Ga0070698_100099145 | Ga0070698_1000991452 | 265 |
| 261 | 3300006846 | Ga0075430_100090572 | Ga0075430_1000905722 | 265 |
| 262 | 3300013105 | Ga0157369_10000378 | Ga0157369_100003782 | 265 |
| 263 | 3300025229 | Ga0209147_100184 | Ga0209147_10018457 | 265 |
| 264 | 3300025910 | Ga0207684_10360307 | Ga0207684_103603072 | 265 |
| 265 | 3300044694 | Ga0466963_0126674 | Ga0466963_0126674_930_1727 | 265 |
| 266 | 3300050507 | nmdc:mga05p37_31532_c1 | nmdc:mga05p37_31532_c1_1732_2544 | 265 |
| 267 | 3300050509 | nmdc:mga0qj67_91286_c1 | nmdc:mga0qj67_91286_c1_960_1772 | 265 |
| 268 | 3300050510 | nmdc:mga06r32_13422_c1 | nmdc:mga06r32_13422_c1_5511_6323 | 265 |
| 269 | 3300005329 | Ga0070683_100004548 | Ga0070683_1000045484 | 267 |
| 270 | 3300005331 | Ga0070670_100010463 | Ga0070670_1000104632 | 267 |
| 271 | 3300005334 | Ga0068869_100012999 | Ga0068869_1000129993 | 267 |
| 272 | 3300005334 | Ga0068869_100378361 | Ga0068869_1003783612 | 267 |
| 273 | 3300005337 | Ga0070682_100194608 | Ga0070682_1001946082 | 267 |
| 274 | 3300005344 | Ga0070661_100004118 | Ga0070661_1000041182 | 267 |
| 275 | 3300005344 | Ga0070661_100024937 | Ga0070661_1000249374 | 267 |
| 276 | 3300005347 | Ga0070668_100009618 | Ga0070668_1000096183 | 267 |
| 277 | 3300005354 | Ga0070675_100011820 | Ga0070675_1000118205 | 267 |
| 278 | 3300005354 | Ga0070675_100035820 | Ga0070675_1000358203 | 267 |
| 279 | 3300005364 | Ga0070673_100079913 | Ga0070673_1000799133 | 267 |
| 280 | 3300005364 | Ga0070673_100163274 | Ga0070673_1001632741 | 267 |
| 281 | 3300005366 | Ga0070659_100093537 | Ga0070659_1000935372 | 267 |
| 282 | 3300005444 | Ga0070694_100187170 | Ga0070694_1001871701 | 267 |
| 283 | 3300005455 | Ga0070663_100174639 | Ga0070663_1001746392 | 267 |
| 284 | 3300005457 | Ga0070662_100089713 | Ga0070662_1000897131 | 267 |
| 285 | 3300005458 | Ga0070681_10001833 | Ga0070681_1000183313 | 267 |
| 286 | 3300005459 | Ga0068867_100114793 | Ga0068867_1001147932 | 267 |
| 287 | 3300005471 | Ga0070698_100129233 | Ga0070698_1001292334 | 267 |
| 288 | 3300005530 | Ga0070679_100005867 | Ga0070679_1000058677 | 267 |
| 289 | 3300005535 | Ga0070684_100018965 | Ga0070684_1000189654 | 267 |
| 290 | 3300005543 | Ga0070672_100127658 | Ga0070672_1001276582 | 267 |
| 291 | 3300005543 | Ga0070672_100156897 | Ga0070672_1001568972 | 267 |
| 292 | 3300005548 | Ga0070665_100444477 | Ga0070665_1004444772 | 267 |
| 293 | 3300005564 | Ga0070664_100001560 | Ga0070664_10000156012 | 267 |
| 294 | 3300005564 | Ga0070664_100016193 | Ga0070664_1000161932 | 267 |
| 295 | 3300005564 | Ga0070664_100249761 | Ga0070664_1002497612 | 267 |
| 296 | 3300005577 | Ga0068857_100056596 | Ga0068857_1000565962 | 267 |
| 297 | 3300005577 | Ga0068857_100259523 | Ga0068857_1002595232 | 267 |
| 298 | 3300005616 | Ga0068852_100027709 | Ga0068852_1000277092 | 267 |
| 299 | 3300005719 | Ga0068861_100092805 | Ga0068861_1000928052 | 267 |
| 300 | 3300005841 | Ga0068863_100393507 | Ga0068863_1003935072 | 267 |
| 301 | 3300006844 | Ga0075428_100038920 | Ga0075428_1000389202 | 267 |
| 302 | 3300006852 | Ga0075433_10091518 | Ga0075433_100915182 | 267 |
| 303 | 3300006871 | Ga0075434_100017259 | Ga0075434_1000172593 | 267 |
| 304 | 3300006871 | Ga0075434_100234937 | Ga0075434_1002349372 | 267 |
| 305 | 3300006881 | Ga0068865_100080476 | Ga0068865_1000804761 | 267 |
| 306 | 3300009148 | Ga0105243_10462595 | Ga0105243_104625951 | 267 |
| 307 | 3300009176 | Ga0105242_10003906 | Ga0105242_100039063 | 267 |
| 308 | 3300009553 | Ga0105249_10224643 | Ga0105249_102246432 | 267 |
| 309 | 3300010375 | Ga0105239_10081900 | Ga0105239_100819002 | 267 |
| 310 | 3300013297 | Ga0157378_10012784 | Ga0157378_100127842 | 267 |
| 311 | 3300013297 | Ga0157378_10142890 | Ga0157378_101428903 | 267 |
| 312 | 3300013306 | Ga0163162_10394633 | Ga0163162_103946331 | 267 |
| 313 | 3300013307 | Ga0157372_10496849 | Ga0157372_104968492 | 267 |
| 314 | 3300013308 | Ga0157375_10763039 | Ga0157375_107630391 | 267 |
| 315 | 3300014326 | Ga0157380_10149718 | Ga0157380_101497182 | 267 |
| 316 | 3300025315 | Ga0207697_10005033 | Ga0207697_100050335 | 267 |
| 317 | 3300025899 | Ga0207642_10038043 | Ga0207642_100380431 | 267 |
| 318 | 3300025903 | Ga0207680_10065281 | Ga0207680_100652812 | 267 |
| 319 | 3300025907 | Ga0207645_10001146 | Ga0207645_1000114616 | 267 |
| 320 | 3300025912 | Ga0207707_10002076 | Ga0207707_100020769 | 267 |
| 321 | 3300025920 | Ga0207649_10002457 | Ga0207649_100024572 | 267 |
| 322 | 3300025921 | Ga0207652_10055127 | Ga0207652_100551272 | 267 |
| 323 | 3300025923 | Ga0207681_10345012 | Ga0207681_103450122 | 267 |
| 324 | 3300025925 | Ga0207650_10006717 | Ga0207650_100067175 | 267 |
| 325 | 3300025925 | Ga0207650_10047313 | Ga0207650_100473132 | 267 |
| 326 | 3300025926 | Ga0207659_10193331 | Ga0207659_101933312 | 267 |
| 327 | 3300025926 | Ga0207659_10269945 | Ga0207659_102699451 | 267 |
| 328 | 3300025926 | Ga0207659_10416496 | Ga0207659_104164962 | 267 |
| 329 | 3300025932 | Ga0207690_10214505 | Ga0207690_102145052 | 267 |
| 330 | 3300025933 | Ga0207706_10001272 | Ga0207706_100012725 | 267 |
| 331 | 3300025934 | Ga0207686_10018790 | Ga0207686_100187902 | 267 |
| 332 | 3300025937 | Ga0207669_10137517 | Ga0207669_101375172 | 267 |
| 333 | 3300025938 | Ga0207704_10169097 | Ga0207704_101690972 | 267 |
| 334 | 3300025940 | Ga0207691_10016359 | Ga0207691_100163592 | 267 |
| 335 | 3300025942 | Ga0207689_10016216 | Ga0207689_100162162 | 267 |
| 336 | 3300025942 | Ga0207689_10423705 | Ga0207689_104237052 | 267 |
| 337 | 3300025944 | Ga0207661_10010066 | Ga0207661_100100663 | 267 |
| 338 | 3300025944 | Ga0207661_10023960 | Ga0207661_100239602 | 267 |
| 339 | 3300025944 | Ga0207661_10120271 | Ga0207661_101202712 | 267 |
| 340 | 3300025945 | Ga0207679_10003506 | Ga0207679_100035065 | 267 |
| 341 | 3300025945 | Ga0207679_10070066 | Ga0207679_100700662 | 267 |
| 342 | 3300025949 | Ga0207667_10419648 | Ga0207667_104196482 | 267 |
| 343 | 3300025960 | Ga0207651_10126776 | Ga0207651_101267762 | 267 |
| 344 | 3300026023 | Ga0207677_10132619 | Ga0207677_101326192 | 267 |
| 345 | 3300026067 | Ga0207678_10110233 | Ga0207678_101102331 | 267 |
| 346 | 3300026088 | Ga0207641_10133252 | Ga0207641_101332522 | 267 |
| 347 | 3300026088 | Ga0207641_10245408 | Ga0207641_102454081 | 267 |
| 348 | 3300026089 | Ga0207648_10182747 | Ga0207648_101827472 | 267 |
| 349 | 3300026095 | Ga0207676_10040858 | Ga0207676_100408584 | 267 |
| 350 | 3300026116 | Ga0207674_10000819 | Ga0207674_1000081915 | 267 |
| 351 | 3300026118 | Ga0207675_100002475 | Ga0207675_1000024751 | 267 |
| 352 | 3300028380 | Ga0268265_10026702 | Ga0268265_100267023 | 267 |
| 353 | 3300035398 | Ga0316574_0061256 | Ga0316574_0061256_225_1034 | 267 |
| 354 | 3300035398 | Ga0316574_0062635 | Ga0316574_0062635_1394_2203 | 267 |
| 355 | 3300046499 | Ga0495594_0079089 | Ga0495594_0079089_886_1698 | 267 |
| 356 | 3300050507 | nmdc:mga05p37_82009_c1 | nmdc:mga05p37_82009_c1_1418_2227 | 267 |
| 357 | 3300050512 | nmdc:mga0n895_167183_c1 | nmdc:mga0n895_167183_c1_914_1723 | 267 |
| 358 | 3300050512 | nmdc:mga0n895_16854_c1 | nmdc:mga0n895_16854_c1_4234_5046 | 267 |
| 359 | 3300050515 | nmdc:mga0a205_89653_c1 | nmdc:mga0a205_89653_c1_816_1625 | 267 |
| 360 | 3300005331 | Ga0070670_100254825 | Ga0070670_1002548252 | 268 |
| 361 | 3300005564 | Ga0070664_100072646 | Ga0070664_1000726462 | 268 |
| 362 | 3300006175 | Ga0070712_100119722 | Ga0070712_1001197222 | 268 |
| 363 | 3300025945 | Ga0207679_10058119 | Ga0207679_100581192 | 268 |
| 364 | 3300006852 | Ga0075433_10005566 | Ga0075433_100055665 | 269 |
| 365 | 3300026095 | Ga0207676_10288890 | Ga0207676_102888902 | 269 |
| 366 | 3300048904 | Ga0496101_0011136 | Ga0496101_0011136_4859_5671 | 269 |
| 367 | 3300048907 | Ga0496104_0220399 | Ga0496104_0220399_939_1751 | 269 |
| 368 | 3300048908 | Ga0496105_0476175 | Ga0496105_0476175_56_868 | 269 |
| 369 | 3300048911 | Ga0496108_0123640 | Ga0496108_0123640_44_856 | 269 |
| 370 | 3300048912 | Ga0496109_0062367 | Ga0496109_0062367_2575_3387 | 269 |
| 371 | 3300048913 | Ga0496110_0256083 | Ga0496110_0256083_97_909 | 269 |
| 372 | 3300048913 | Ga0496110_0406198 | Ga0496110_0406198_179_991 | 269 |
| 373 | 3300048914 | Ga0496111_0254356 | Ga0496111_0254356_188_1000 | 269 |
| 374 | 3300048915 | Ga0496112_0002385 | Ga0496112_0002385_90_902 | 269 |
| 375 | 3300048916 | Ga0496113_0342268 | Ga0496113_0342268_220_1032 | 269 |
| 376 | 3300048917 | Ga0496114_0054600 | Ga0496114_0054600_1159_1971 | 269 |
| 377 | 3300050512 | nmdc:mga0n895_243492_c1 | nmdc:mga0n895_243492_c1_250_1062 | 269 |
| 378 | 3300050515 | nmdc:mga0a205_9887_c1 | nmdc:mga0a205_9887_c1_4077_4889 | 269 |
| 379 | 3300005293 | Ga0065715_10002119 | Ga0065715_100021194 | 270 |
| 380 | 3300005293 | Ga0065715_10030856 | Ga0065715_100308562 | 270 |
| 381 | 3300005295 | Ga0065707_10001658 | Ga0065707_100016581 | 270 |
| 382 | 3300005295 | Ga0065707_10118864 | Ga0065707_101188642 | 270 |
| 383 | 3300005329 | Ga0070683_100002845 | Ga0070683_1000028459 | 270 |
| 384 | 3300005329 | Ga0070683_100123270 | Ga0070683_1001232702 | 270 |
| 385 | 3300005330 | Ga0070690_100241362 | Ga0070690_1002413622 | 270 |
| 386 | 3300005331 | Ga0070670_100000820 | Ga0070670_1000008209 | 270 |
| 387 | 3300005331 | Ga0070670_100003875 | Ga0070670_1000038758 | 270 |
| 388 | 3300005331 | Ga0070670_100069892 | Ga0070670_1000698923 | 270 |
| 389 | 3300005334 | Ga0068869_100255203 | Ga0068869_1002552031 | 270 |
| 390 | 3300005334 | Ga0068869_100287621 | Ga0068869_1002876211 | 270 |
| 391 | 3300005336 | Ga0070680_100033895 | Ga0070680_1000338953 | 270 |
| 392 | 3300005337 | Ga0070682_100000004 | Ga0070682_100000004303 | 270 |
| 393 | 3300005338 | Ga0068868_100078134 | Ga0068868_1000781342 | 270 |
| 394 | 3300005338 | Ga0068868_100091353 | Ga0068868_1000913532 | 270 |
| 395 | 3300005338 | Ga0068868_100106402 | Ga0068868_1001064023 | 270 |
| 396 | 3300005338 | Ga0068868_100124236 | Ga0068868_1001242362 | 270 |
| 397 | 3300005339 | Ga0070660_100047624 | Ga0070660_1000476242 | 270 |
| 398 | 3300005340 | Ga0070689_100001924 | Ga0070689_1000019246 | 270 |
| 399 | 3300005340 | Ga0070689_100013571 | Ga0070689_1000135714 | 270 |
| 400 | 3300005340 | Ga0070689_100057944 | Ga0070689_1000579441 | 270 |
| 401 | 3300005340 | Ga0070689_100249136 | Ga0070689_1002491362 | 270 |
| 402 | 3300005340 | Ga0070689_100493901 | Ga0070689_1004939012 | 270 |
| 403 | 3300005341 | Ga0070691_10011278 | Ga0070691_100112782 | 270 |
| 404 | 3300005344 | Ga0070661_100002867 | Ga0070661_1000028675 | 270 |
| 405 | 3300005344 | Ga0070661_100073714 | Ga0070661_1000737143 | 270 |
| 406 | 3300005347 | Ga0070668_100024023 | Ga0070668_1000240233 | 270 |
| 407 | 3300005354 | Ga0070675_100000001 | Ga0070675_10000000161 | 270 |
| 408 | 3300005354 | Ga0070675_100018439 | Ga0070675_1000184393 | 270 |
| 409 | 3300005355 | Ga0070671_100022410 | Ga0070671_1000224105 | 270 |
| 410 | 3300005355 | Ga0070671_100024298 | Ga0070671_1000242985 | 270 |
| 411 | 3300005355 | Ga0070671_100025797 | Ga0070671_1000257974 | 270 |
| 412 | 3300005355 | Ga0070671_100179197 | Ga0070671_1001791973 | 270 |
| 413 | 3300005356 | Ga0070674_100001535 | Ga0070674_10000153511 | 270 |
| 414 | 3300005356 | Ga0070674_100031586 | Ga0070674_1000315862 | 270 |
| 415 | 3300005356 | Ga0070674_100035635 | Ga0070674_1000356353 | 270 |
| 416 | 3300005364 | Ga0070673_100003439 | Ga0070673_1000034394 | 270 |
| 417 | 3300005364 | Ga0070673_100194377 | Ga0070673_1001943772 | 270 |
| 418 | 3300005364 | Ga0070673_100315350 | Ga0070673_1003153502 | 270 |
| 419 | 3300005365 | Ga0070688_100051863 | Ga0070688_1000518632 | 270 |
| 420 | 3300005365 | Ga0070688_100124157 | Ga0070688_1001241573 | 270 |
| 421 | 3300005366 | Ga0070659_100089356 | Ga0070659_1000893562 | 270 |
| 422 | 3300005366 | Ga0070659_100162214 | Ga0070659_1001622142 | 270 |
| 423 | 3300005367 | Ga0070667_100298785 | Ga0070667_1002987852 | 270 |
| 424 | 3300005434 | Ga0070709_10006794 | Ga0070709_100067945 | 270 |
| 425 | 3300005434 | Ga0070709_10042037 | Ga0070709_100420372 | 270 |
| 426 | 3300005435 | Ga0070714_100008442 | Ga0070714_1000084422 | 270 |
| 427 | 3300005436 | Ga0070713_100007824 | Ga0070713_1000078245 | 270 |
| 428 | 3300005438 | Ga0070701_10001225 | Ga0070701_100012254 | 270 |
| 429 | 3300005438 | Ga0070701_10082508 | Ga0070701_100825082 | 270 |
| 430 | 3300005439 | Ga0070711_100019931 | Ga0070711_1000199316 | 270 |
| 431 | 3300005439 | Ga0070711_100177033 | Ga0070711_1001770331 | 270 |
| 432 | 3300005439 | Ga0070711_100282450 | Ga0070711_1002824501 | 270 |
| 433 | 3300005440 | Ga0070705_100018362 | Ga0070705_1000183623 | 270 |
| 434 | 3300005441 | Ga0070700_100001362 | Ga0070700_10000136211 | 270 |
| 435 | 3300005444 | Ga0070694_100075624 | Ga0070694_1000756242 | 270 |
| 436 | 3300005445 | Ga0070708_100019263 | Ga0070708_1000192636 | 270 |
| 437 | 3300005455 | Ga0070663_100001965 | Ga0070663_1000019654 | 270 |
| 438 | 3300005455 | Ga0070663_100069031 | Ga0070663_1000690313 | 270 |
| 439 | 3300005456 | Ga0070678_100002371 | Ga0070678_1000023714 | 270 |
| 440 | 3300005456 | Ga0070678_100506208 | Ga0070678_1005062081 | 270 |
| 441 | 3300005457 | Ga0070662_100012872 | Ga0070662_1000128725 | 270 |
| 442 | 3300005458 | Ga0070681_10021049 | Ga0070681_100210492 | 270 |
| 443 | 3300005459 | Ga0068867_100106884 | Ga0068867_1001068843 | 270 |
| 444 | 3300005459 | Ga0068867_100450462 | Ga0068867_1004504622 | 270 |
| 445 | 3300005467 | Ga0070706_100023104 | Ga0070706_1000231046 | 270 |
| 446 | 3300005467 | Ga0070706_100378242 | Ga0070706_1003782422 | 270 |
| 447 | 3300005468 | Ga0070707_100033375 | Ga0070707_1000333755 | 270 |
| 448 | 3300005468 | Ga0070707_100062110 | Ga0070707_1000621102 | 270 |
| 449 | 3300005468 | Ga0070707_100183181 | Ga0070707_1001831811 | 270 |
| 450 | 3300005471 | Ga0070698_100052910 | Ga0070698_1000529102 | 270 |
| 451 | 3300005471 | Ga0070698_100160277 | Ga0070698_1001602772 | 270 |
| 452 | 3300005518 | Ga0070699_100052632 | Ga0070699_1000526322 | 270 |
| 453 | 3300005518 | Ga0070699_100276536 | Ga0070699_1002765362 | 270 |
| 454 | 3300005530 | Ga0070679_100066120 | Ga0070679_1000661202 | 270 |
| 455 | 3300005530 | Ga0070679_100089510 | Ga0070679_1000895103 | 270 |
| 456 | 3300005535 | Ga0070684_100000323 | Ga0070684_1000003238 | 270 |
| 457 | 3300005535 | Ga0070684_100007259 | Ga0070684_1000072597 | 270 |
| 458 | 3300005536 | Ga0070697_100027246 | Ga0070697_1000272464 | 270 |
| 459 | 3300005536 | Ga0070697_100207715 | Ga0070697_1002077152 | 270 |
| 460 | 3300005539 | Ga0068853_100043718 | Ga0068853_1000437184 | 270 |
| 461 | 3300005539 | Ga0068853_100290963 | Ga0068853_1002909632 | 270 |
| 462 | 3300005539 | Ga0068853_100603366 | Ga0068853_1006033661 | 270 |
| 463 | 3300005543 | Ga0070672_100000404 | Ga0070672_1000004048 | 270 |
| 464 | 3300005543 | Ga0070672_100006663 | Ga0070672_1000066637 | 270 |
| 465 | 3300005543 | Ga0070672_100017030 | Ga0070672_1000170305 | 270 |
| 466 | 3300005544 | Ga0070686_100054708 | Ga0070686_1000547082 | 270 |
| 467 | 3300005544 | Ga0070686_100523939 | Ga0070686_1005239391 | 270 |
| 468 | 3300005545 | Ga0070695_100063711 | Ga0070695_1000637113 | 270 |
| 469 | 3300005545 | Ga0070695_100443962 | Ga0070695_1004439621 | 270 |
| 470 | 3300005546 | Ga0070696_100031894 | Ga0070696_1000318943 | 270 |
| 471 | 3300005548 | Ga0070665_100026495 | Ga0070665_1000264953 | 270 |
| 472 | 3300005548 | Ga0070665_100055826 | Ga0070665_1000558262 | 270 |
| 473 | 3300005548 | Ga0070665_100060764 | Ga0070665_1000607642 | 270 |
| 474 | 3300005548 | Ga0070665_100075373 | Ga0070665_1000753733 | 270 |
| 475 | 3300005549 | Ga0070704_100107327 | Ga0070704_1001073273 | 270 |
| 476 | 3300005563 | Ga0068855_100083845 | Ga0068855_1000838453 | 270 |
| 477 | 3300005564 | Ga0070664_100002496 | Ga0070664_1000024962 | 270 |
| 478 | 3300005564 | Ga0070664_100007228 | Ga0070664_1000072287 | 270 |
| 479 | 3300005564 | Ga0070664_100053908 | Ga0070664_1000539082 | 270 |
| 480 | 3300005564 | Ga0070664_100363563 | Ga0070664_1003635631 | 270 |
| 481 | 3300005577 | Ga0068857_100017696 | Ga0068857_1000176962 | 270 |
| 482 | 3300005577 | Ga0068857_100393248 | Ga0068857_1003932482 | 270 |
| 483 | 3300005615 | Ga0070702_100020189 | Ga0070702_1000201892 | 270 |
| 484 | 3300005615 | Ga0070702_100195351 | Ga0070702_1001953512 | 270 |
| 485 | 3300005616 | Ga0068852_100366736 | Ga0068852_1003667362 | 270 |
| 486 | 3300005617 | Ga0068859_100028633 | Ga0068859_1000286334 | 270 |
| 487 | 3300005617 | Ga0068859_100034615 | Ga0068859_1000346153 | 270 |
| 488 | 3300005617 | Ga0068859_100061477 | Ga0068859_1000614774 | 270 |
| 489 | 3300005617 | Ga0068859_100115968 | Ga0068859_1001159683 | 270 |
| 490 | 3300005617 | Ga0068859_100401179 | Ga0068859_1004011791 | 270 |
| 491 | 3300005617 | Ga0068859_100698440 | Ga0068859_1006984402 | 270 |
| 492 | 3300005618 | Ga0068864_100000001 | Ga0068864_10000000159 | 270 |
| 493 | 3300005618 | Ga0068864_100004348 | Ga0068864_1000043481 | 270 |
| 494 | 3300005618 | Ga0068864_100008707 | Ga0068864_1000087077 | 270 |
| 495 | 3300005618 | Ga0068864_100010686 | Ga0068864_1000106867 | 270 |
| 496 | 3300005618 | Ga0068864_100058229 | Ga0068864_1000582293 | 270 |
| 497 | 3300005618 | Ga0068864_100114151 | Ga0068864_1001141512 | 270 |
| 498 | 3300005718 | Ga0068866_10166863 | Ga0068866_101668632 | 270 |
| 499 | 3300005719 | Ga0068861_100089126 | Ga0068861_1000891263 | 270 |
| 500 | 3300005719 | Ga0068861_100248715 | Ga0068861_1002487151 | 270 |
| 501 | 3300005834 | Ga0068851_10103581 | Ga0068851_101035812 | 270 |
| 502 | 3300005840 | Ga0068870_10270863 | Ga0068870_102708632 | 270 |
| 503 | 3300005841 | Ga0068863_100006299 | Ga0068863_1000062996 | 270 |
| 504 | 3300005841 | Ga0068863_100015396 | Ga0068863_1000153965 | 270 |
| 505 | 3300005841 | Ga0068863_100256243 | Ga0068863_1002562432 | 270 |
| 506 | 3300005842 | Ga0068858_100000072 | Ga0068858_10000007238 | 270 |
| 507 | 3300005842 | Ga0068858_100028403 | Ga0068858_1000284033 | 270 |
| 508 | 3300005842 | Ga0068858_100043612 | Ga0068858_1000436123 | 270 |
| 509 | 3300005842 | Ga0068858_100161888 | Ga0068858_1001618883 | 270 |
| 510 | 3300005843 | Ga0068860_100014916 | Ga0068860_1000149162 | 270 |
| 511 | 3300005843 | Ga0068860_100075183 | Ga0068860_1000751832 | 270 |
| 512 | 3300005843 | Ga0068860_100306182 | Ga0068860_1003061822 | 270 |
| 513 | 3300005843 | Ga0068860_100595079 | Ga0068860_1005950792 | 270 |
| 514 | 3300005844 | Ga0068862_100010877 | Ga0068862_1000108777 | 270 |
| 515 | 3300005844 | Ga0068862_100023180 | Ga0068862_1000231804 | 270 |
| 516 | 3300005844 | Ga0068862_100046468 | Ga0068862_1000464681 | 270 |
| 517 | 3300005844 | Ga0068862_100289062 | Ga0068862_1002890622 | 270 |
| 518 | 3300005985 | Ga0081539_10000071 | Ga0081539_10000071117 | 270 |
| 519 | 3300006028 | Ga0070717_10003798 | Ga0070717_100037987 | 270 |
| 520 | 3300006028 | Ga0070717_10007368 | Ga0070717_100073682 | 270 |
| 521 | 3300006028 | Ga0070717_10274949 | Ga0070717_102749492 | 270 |
| 522 | 3300006028 | Ga0070717_10309652 | Ga0070717_103096522 | 270 |
| 523 | 3300006038 | Ga0075365_10010341 | Ga0075365_100103416 | 270 |
| 524 | 3300006038 | Ga0075365_10101634 | Ga0075365_101016344 | 270 |
| 525 | 3300006042 | Ga0075368_10016609 | Ga0075368_100166092 | 270 |
| 526 | 3300006051 | Ga0075364_10056798 | Ga0075364_100567984 | 270 |
| 527 | 3300006051 | Ga0075364_10270264 | Ga0075364_102702642 | 270 |
| 528 | 3300006058 | Ga0075432_10008373 | Ga0075432_100083733 | 270 |
| 529 | 3300006173 | Ga0070716_100055634 | Ga0070716_1000556341 | 270 |
| 530 | 3300006173 | Ga0070716_100076310 | Ga0070716_1000763101 | 270 |
| 531 | 3300006178 | Ga0075367_10031906 | Ga0075367_100319064 | 270 |
| 532 | 3300006178 | Ga0075367_10096849 | Ga0075367_100968493 | 270 |
| 533 | 3300006195 | Ga0075366_10020552 | Ga0075366_100205524 | 270 |
| 534 | 3300006237 | Ga0097621_100037028 | Ga0097621_1000370283 | 270 |
| 535 | 3300006237 | Ga0097621_100049804 | Ga0097621_1000498043 | 270 |
| 536 | 3300006237 | Ga0097621_100066492 | Ga0097621_1000664923 | 270 |
| 537 | 3300006237 | Ga0097621_100078981 | Ga0097621_1000789813 | 270 |
| 538 | 3300006237 | Ga0097621_100283030 | Ga0097621_1002830302 | 270 |
| 539 | 3300006237 | Ga0097621_100561450 | Ga0097621_1005614502 | 270 |
| 540 | 3300006353 | Ga0075370_10043762 | Ga0075370_100437623 | 270 |
| 541 | 3300006358 | Ga0068871_100011210 | Ga0068871_1000112105 | 270 |
| 542 | 3300006358 | Ga0068871_100016778 | Ga0068871_1000167783 | 270 |
| 543 | 3300006358 | Ga0068871_100023567 | Ga0068871_1000235674 | 270 |
| 544 | 3300006358 | Ga0068871_100063614 | Ga0068871_1000636143 | 270 |
| 545 | 3300006358 | Ga0068871_100361480 | Ga0068871_1003614802 | 270 |
| 546 | 3300006844 | Ga0075428_100078699 | Ga0075428_1000786992 | 270 |
| 547 | 3300006844 | Ga0075428_100245934 | Ga0075428_1002459342 | 270 |
| 548 | 3300006844 | Ga0075428_100263185 | Ga0075428_1002631852 | 270 |
| 549 | 3300006844 | Ga0075428_100569999 | Ga0075428_1005699992 | 270 |
| 550 | 3300006847 | Ga0075431_100001237 | Ga0075431_10000123714 | 270 |
| 551 | 3300006847 | Ga0075431_100025479 | Ga0075431_1000254793 | 270 |
| 552 | 3300006847 | Ga0075431_100188852 | Ga0075431_1001888523 | 270 |
| 553 | 3300006847 | Ga0075431_100253268 | Ga0075431_1002532682 | 270 |
| 554 | 3300006852 | Ga0075433_10038492 | Ga0075433_100384922 | 270 |
| 555 | 3300006852 | Ga0075433_10358030 | Ga0075433_103580301 | 270 |
| 556 | 3300006871 | Ga0075434_100010349 | Ga0075434_1000103497 | 270 |
| 557 | 3300006871 | Ga0075434_100017091 | Ga0075434_1000170916 | 270 |
| 558 | 3300006871 | Ga0075434_100051427 | Ga0075434_1000514272 | 270 |
| 559 | 3300006871 | Ga0075434_100331315 | Ga0075434_1003313152 | 270 |
| 560 | 3300006871 | Ga0075434_100416757 | Ga0075434_1004167571 | 270 |
| 561 | 3300006871 | Ga0075434_100426210 | Ga0075434_1004262101 | 270 |
| 562 | 3300006871 | Ga0075434_100650352 | Ga0075434_1006503522 | 270 |
| 563 | 3300006880 | Ga0075429_100172421 | Ga0075429_1001724212 | 270 |
| 564 | 3300006881 | Ga0068865_100002817 | Ga0068865_1000028179 | 270 |
| 565 | 3300006881 | Ga0068865_100327528 | Ga0068865_1003275281 | 270 |
| 566 | 3300006914 | Ga0075436_100017691 | Ga0075436_1000176913 | 270 |
| 567 | 3300006914 | Ga0075436_100028234 | Ga0075436_1000282343 | 270 |
| 568 | 3300006931 | Ga0097620_100028633 | Ga0097620_1000286334 | 270 |
| 569 | 3300006931 | Ga0097620_100034617 | Ga0097620_1000346174 | 270 |
| 570 | 3300006931 | Ga0097620_100061477 | Ga0097620_1000614774 | 270 |
| 571 | 3300006931 | Ga0097620_100115969 | Ga0097620_1001159693 | 270 |
| 572 | 3300006931 | Ga0097620_100401159 | Ga0097620_1004011591 | 270 |
| 573 | 3300006931 | Ga0097620_100698646 | Ga0097620_1006986462 | 270 |
| 574 | 3300007076 | Ga0075435_100007726 | Ga0075435_1000077266 | 270 |
| 575 | 3300007076 | Ga0075435_100010295 | Ga0075435_1000102957 | 270 |
| 576 | 3300007076 | Ga0075435_100019481 | Ga0075435_1000194814 | 270 |
| 577 | 3300007076 | Ga0075435_100048463 | Ga0075435_1000484632 | 270 |
| 578 | 3300007076 | Ga0075435_100127798 | Ga0075435_1001277982 | 270 |
| 579 | 3300009093 | Ga0105240_10110214 | Ga0105240_101102143 | 270 |
| 580 | 3300009094 | Ga0111539_10000021 | Ga0111539_10000021140 | 270 |
| 581 | 3300009094 | Ga0111539_10045595 | Ga0111539_100455952 | 270 |
| 582 | 3300009094 | Ga0111539_10054202 | Ga0111539_100542024 | 270 |
| 583 | 3300009098 | Ga0105245_10000055 | Ga0105245_1000005542 | 270 |
| 584 | 3300009098 | Ga0105245_10000148 | Ga0105245_1000014847 | 270 |
| 585 | 3300009098 | Ga0105245_10000268 | Ga0105245_100002689 | 270 |
| 586 | 3300009098 | Ga0105245_10010876 | Ga0105245_100108764 | 270 |
| 587 | 3300009098 | Ga0105245_10265350 | Ga0105245_102653501 | 270 |
| 588 | 3300009147 | Ga0114129_10000095 | Ga0114129_1000009562 | 270 |
| 589 | 3300009147 | Ga0114129_10035942 | Ga0114129_100359422 | 270 |
| 590 | 3300009147 | Ga0114129_10153606 | Ga0114129_101536062 | 270 |
| 591 | 3300009147 | Ga0114129_10180838 | Ga0114129_101808383 | 270 |
| 592 | 3300009147 | Ga0114129_10511798 | Ga0114129_105117982 | 270 |
| 593 | 3300009148 | Ga0105243_10008744 | Ga0105243_100087445 | 270 |
| 594 | 3300009148 | Ga0105243_10436195 | Ga0105243_104361952 | 270 |
| 595 | 3300009176 | Ga0105242_10007476 | Ga0105242_100074767 | 270 |
| 596 | 3300009176 | Ga0105242_10009232 | Ga0105242_100092327 | 270 |
| 597 | 3300009176 | Ga0105242_10310344 | Ga0105242_103103441 | 270 |
| 598 | 3300009177 | Ga0105248_10040499 | Ga0105248_100404992 | 270 |
| 599 | 3300009177 | Ga0105248_10083416 | Ga0105248_100834163 | 270 |
| 600 | 3300009177 | Ga0105248_10089051 | Ga0105248_100890511 | 270 |
| 601 | 3300009177 | Ga0105248_10133657 | Ga0105248_101336573 | 270 |
| 602 | 3300009545 | Ga0105237_10227852 | Ga0105237_102278522 | 270 |
| 603 | 3300009545 | Ga0105237_10444306 | Ga0105237_104443063 | 270 |
| 604 | 3300009551 | Ga0105238_10000029 | Ga0105238_1000002954 | 270 |
| 605 | 3300009553 | Ga0105249_10005943 | Ga0105249_100059432 | 270 |
| 606 | 3300009553 | Ga0105249_10033156 | Ga0105249_100331562 | 270 |
| 607 | 3300009553 | Ga0105249_10331652 | Ga0105249_103316523 | 270 |
| 608 | 3300010375 | Ga0105239_10458384 | Ga0105239_104583841 | 270 |
| 609 | 3300010375 | Ga0105239_10663142 | Ga0105239_106631421 | 270 |
| 610 | 3300010375 | Ga0105239_10785643 | Ga0105239_107856432 | 270 |
| 611 | 3300011119 | Ga0105246_10007633 | Ga0105246_100076334 | 270 |
| 612 | 3300011119 | Ga0105246_10045953 | Ga0105246_100459531 | 270 |
| 613 | 3300013100 | Ga0157373_10097785 | Ga0157373_100977852 | 270 |
| 614 | 3300013102 | Ga0157371_10206266 | Ga0157371_102062662 | 270 |
| 615 | 3300013102 | Ga0157371_10226748 | Ga0157371_102267481 | 270 |
| 616 | 3300013296 | Ga0157374_10000008 | Ga0157374_10000008298 | 270 |
| 617 | 3300013296 | Ga0157374_10011468 | Ga0157374_100114687 | 270 |
| 618 | 3300013296 | Ga0157374_10024443 | Ga0157374_100244432 | 270 |
| 619 | 3300013296 | Ga0157374_10041257 | Ga0157374_100412573 | 270 |
| 620 | 3300013296 | Ga0157374_10192173 | Ga0157374_101921732 | 270 |
| 621 | 3300013297 | Ga0157378_10000584 | Ga0157378_1000058427 | 270 |
| 622 | 3300013297 | Ga0157378_10015464 | Ga0157378_100154642 | 270 |
| 623 | 3300013297 | Ga0157378_10026603 | Ga0157378_100266033 | 270 |
| 624 | 3300013297 | Ga0157378_10029725 | Ga0157378_100297252 | 270 |
| 625 | 3300013297 | Ga0157378_10033479 | Ga0157378_100334794 | 270 |
| 626 | 3300013297 | Ga0157378_10035072 | Ga0157378_100350723 | 270 |
| 627 | 3300013306 | Ga0163162_10011632 | Ga0163162_100116324 | 270 |
| 628 | 3300013306 | Ga0163162_10015763 | Ga0163162_100157637 | 270 |
| 629 | 3300013306 | Ga0163162_10040099 | Ga0163162_100400991 | 270 |
| 630 | 3300013306 | Ga0163162_10152061 | Ga0163162_101520612 | 270 |
| 631 | 3300013307 | Ga0157372_10096509 | Ga0157372_100965093 | 270 |
| 632 | 3300013307 | Ga0157372_10349764 | Ga0157372_103497642 | 270 |
| 633 | 3300013308 | Ga0157375_10000028 | Ga0157375_1000002888 | 270 |
| 634 | 3300013308 | Ga0157375_10000373 | Ga0157375_1000037344 | 270 |
| 635 | 3300013308 | Ga0157375_10012531 | Ga0157375_100125317 | 270 |
| 636 | 3300013308 | Ga0157375_10012636 | Ga0157375_100126366 | 270 |
| 637 | 3300013308 | Ga0157375_10086942 | Ga0157375_100869422 | 270 |
| 638 | 3300013308 | Ga0157375_10254292 | Ga0157375_102542922 | 270 |
| 639 | 3300014325 | Ga0163163_10007747 | Ga0163163_100077474 | 270 |
| 640 | 3300014325 | Ga0163163_10027634 | Ga0163163_100276342 | 270 |
| 641 | 3300014325 | Ga0163163_10027983 | Ga0163163_100279833 | 270 |
| 642 | 3300014325 | Ga0163163_10033387 | Ga0163163_100333872 | 270 |
| 643 | 3300014325 | Ga0163163_10118003 | Ga0163163_101180032 | 270 |
| 644 | 3300014325 | Ga0163163_10225857 | Ga0163163_102258572 | 270 |
| 645 | 3300014326 | Ga0157380_10000625 | Ga0157380_100006253 | 270 |
| 646 | 3300014326 | Ga0157380_10020175 | Ga0157380_100201754 | 270 |
| 647 | 3300014326 | Ga0157380_10626504 | Ga0157380_106265042 | 270 |
| 648 | 3300014326 | Ga0157380_10643949 | Ga0157380_106439492 | 270 |
| 649 | 3300014745 | Ga0157377_10000012 | Ga0157377_10000012185 | 270 |
| 650 | 3300014745 | Ga0157377_10000383 | Ga0157377_100003835 | 270 |
| 651 | 3300014745 | Ga0157377_10000656 | Ga0157377_1000065610 | 270 |
| 652 | 3300014745 | Ga0157377_10014325 | Ga0157377_100143253 | 270 |
| 653 | 3300014968 | Ga0157379_10068283 | Ga0157379_100682833 | 270 |
| 654 | 3300014969 | Ga0157376_10000044 | Ga0157376_1000004410 | 270 |
| 655 | 3300014969 | Ga0157376_10000051 | Ga0157376_1000005163 | 270 |
| 656 | 3300014969 | Ga0157376_10001532 | Ga0157376_1000153210 | 270 |
| 657 | 3300014969 | Ga0157376_10009169 | Ga0157376_100091696 | 270 |
| 658 | 3300014969 | Ga0157376_10203784 | Ga0157376_102037842 | 270 |
| 659 | 3300014969 | Ga0157376_10539304 | Ga0157376_105393041 | 270 |
| 660 | 3300017792 | Ga0163161_10340412 | Ga0163161_103404121 | 270 |
| 661 | 3300021358 | Ga0213873_10000004 | Ga0213873_10000004660 | 270 |
| 662 | 3300021358 | Ga0213873_10008288 | Ga0213873_100082882 | 270 |
| 663 | 3300021384 | Ga0213876_10000001 | Ga0213876_1000000164 | 270 |
| 664 | 3300021384 | Ga0213876_10000067 | Ga0213876_100000677 | 270 |
| 665 | 3300025315 | Ga0207697_10015461 | Ga0207697_100154613 | 270 |
| 666 | 3300025315 | Ga0207697_10026004 | Ga0207697_100260042 | 270 |
| 667 | 3300025898 | Ga0207692_10014799 | Ga0207692_100147994 | 270 |
| 668 | 3300025898 | Ga0207692_10150771 | Ga0207692_101507712 | 270 |
| 669 | 3300025901 | Ga0207688_10038019 | Ga0207688_100380194 | 270 |
| 670 | 3300025901 | Ga0207688_10041359 | Ga0207688_100413592 | 270 |
| 671 | 3300025903 | Ga0207680_10114508 | Ga0207680_101145082 | 270 |
| 672 | 3300025905 | Ga0207685_10133402 | Ga0207685_101334021 | 270 |
| 673 | 3300025906 | Ga0207699_10007617 | Ga0207699_100076177 | 270 |
| 674 | 3300025906 | Ga0207699_10038557 | Ga0207699_100385573 | 270 |
| 675 | 3300025907 | Ga0207645_10014401 | Ga0207645_100144013 | 270 |
| 676 | 3300025907 | Ga0207645_10185662 | Ga0207645_101856622 | 270 |
| 677 | 3300025908 | Ga0207643_10053926 | Ga0207643_100539263 | 270 |
| 678 | 3300025909 | Ga0207705_10364294 | Ga0207705_103642942 | 270 |
| 679 | 3300025910 | Ga0207684_10018155 | Ga0207684_100181556 | 270 |
| 680 | 3300025912 | Ga0207707_10047515 | Ga0207707_100475152 | 270 |
| 681 | 3300025913 | Ga0207695_10079052 | Ga0207695_100790522 | 270 |
| 682 | 3300025913 | Ga0207695_10401416 | Ga0207695_104014161 | 270 |
| 683 | 3300025915 | Ga0207693_10044620 | Ga0207693_100446202 | 270 |
| 684 | 3300025915 | Ga0207693_10121085 | Ga0207693_101210853 | 270 |
| 685 | 3300025916 | Ga0207663_10034247 | Ga0207663_100342472 | 270 |
| 686 | 3300025916 | Ga0207663_10152343 | Ga0207663_101523432 | 270 |
| 687 | 3300025916 | Ga0207663_10326981 | Ga0207663_103269812 | 270 |
| 688 | 3300025918 | Ga0207662_10011697 | Ga0207662_100116973 | 270 |
| 689 | 3300025918 | Ga0207662_10340627 | Ga0207662_103406272 | 270 |
| 690 | 3300025919 | Ga0207657_10017689 | Ga0207657_100176895 | 270 |
| 691 | 3300025919 | Ga0207657_10094132 | Ga0207657_100941322 | 270 |
| 692 | 3300025920 | Ga0207649_10000368 | Ga0207649_1000036822 | 270 |
| 693 | 3300025921 | Ga0207652_10319674 | Ga0207652_103196742 | 270 |
| 694 | 3300025922 | Ga0207646_10034770 | Ga0207646_100347701 | 270 |
| 695 | 3300025922 | Ga0207646_10040676 | Ga0207646_100406764 | 270 |
| 696 | 3300025922 | Ga0207646_10086805 | Ga0207646_100868054 | 270 |
| 697 | 3300025923 | Ga0207681_10505478 | Ga0207681_105054781 | 270 |
| 698 | 3300025924 | Ga0207694_10000002 | Ga0207694_10000002123 | 270 |
| 699 | 3300025924 | Ga0207694_10000003 | Ga0207694_10000003977 | 270 |
| 700 | 3300025925 | Ga0207650_10000042 | Ga0207650_1000004210 | 270 |
| 701 | 3300025925 | Ga0207650_10000096 | Ga0207650_1000009621 | 270 |
| 702 | 3300025925 | Ga0207650_10021093 | Ga0207650_100210934 | 270 |
| 703 | 3300025925 | Ga0207650_10101155 | Ga0207650_101011555 | 270 |
| 704 | 3300025925 | Ga0207650_10180669 | Ga0207650_101806693 | 270 |
| 705 | 3300025925 | Ga0207650_10301272 | Ga0207650_103012721 | 270 |
| 706 | 3300025925 | Ga0207650_10428142 | Ga0207650_104281422 | 270 |
| 707 | 3300025926 | Ga0207659_10000004 | Ga0207659_1000000460 | 270 |
| 708 | 3300025926 | Ga0207659_10051333 | Ga0207659_100513333 | 270 |
| 709 | 3300025926 | Ga0207659_10106308 | Ga0207659_101063083 | 270 |
| 710 | 3300025927 | Ga0207687_10000035 | Ga0207687_1000003542 | 270 |
| 711 | 3300025927 | Ga0207687_10000168 | Ga0207687_1000016824 | 270 |
| 712 | 3300025927 | Ga0207687_10000464 | Ga0207687_100004649 | 270 |
| 713 | 3300025927 | Ga0207687_10016240 | Ga0207687_100162403 | 270 |
| 714 | 3300025928 | Ga0207700_10005786 | Ga0207700_100057865 | 270 |
| 715 | 3300025928 | Ga0207700_10243953 | Ga0207700_102439531 | 270 |
| 716 | 3300025929 | Ga0207664_10001776 | Ga0207664_100017764 | 270 |
| 717 | 3300025929 | Ga0207664_10217767 | Ga0207664_102177672 | 270 |
| 718 | 3300025931 | Ga0207644_10015351 | Ga0207644_100153513 | 270 |
| 719 | 3300025931 | Ga0207644_10015403 | Ga0207644_100154034 | 270 |
| 720 | 3300025931 | Ga0207644_10049069 | Ga0207644_100490692 | 270 |
| 721 | 3300025931 | Ga0207644_10118265 | Ga0207644_101182653 | 270 |
| 722 | 3300025932 | Ga0207690_10117646 | Ga0207690_101176462 | 270 |
| 723 | 3300025933 | Ga0207706_10011170 | Ga0207706_100111704 | 270 |
| 724 | 3300025933 | Ga0207706_10397579 | Ga0207706_103975792 | 270 |
| 725 | 3300025933 | Ga0207706_10600576 | Ga0207706_106005762 | 270 |
| 726 | 3300025934 | Ga0207686_10003869 | Ga0207686_100038693 | 270 |
| 727 | 3300025934 | Ga0207686_10059590 | Ga0207686_100595902 | 270 |
| 728 | 3300025936 | Ga0207670_10006036 | Ga0207670_100060366 | 270 |
| 729 | 3300025936 | Ga0207670_10043755 | Ga0207670_100437553 | 270 |
| 730 | 3300025936 | Ga0207670_10045863 | Ga0207670_100458633 | 270 |
| 731 | 3300025936 | Ga0207670_10116275 | Ga0207670_101162752 | 270 |
| 732 | 3300025937 | Ga0207669_10116102 | Ga0207669_101161022 | 270 |
| 733 | 3300025937 | Ga0207669_10242330 | Ga0207669_102423301 | 270 |
| 734 | 3300025938 | Ga0207704_10004800 | Ga0207704_100048005 | 270 |
| 735 | 3300025938 | Ga0207704_10199952 | Ga0207704_101999522 | 270 |
| 736 | 3300025938 | Ga0207704_10210470 | Ga0207704_102104701 | 270 |
| 737 | 3300025939 | Ga0207665_10012109 | Ga0207665_100121093 | 270 |
| 738 | 3300025939 | Ga0207665_10164650 | Ga0207665_101646501 | 270 |
| 739 | 3300025940 | Ga0207691_10002082 | Ga0207691_100020828 | 270 |
| 740 | 3300025940 | Ga0207691_10003224 | Ga0207691_100032243 | 270 |
| 741 | 3300025940 | Ga0207691_10005085 | Ga0207691_100050857 | 270 |
| 742 | 3300025941 | Ga0207711_10020961 | Ga0207711_100209614 | 270 |
| 743 | 3300025941 | Ga0207711_10105223 | Ga0207711_101052232 | 270 |
| 744 | 3300025942 | Ga0207689_10016882 | Ga0207689_100168823 | 270 |
| 745 | 3300025942 | Ga0207689_10028224 | Ga0207689_100282243 | 270 |
| 746 | 3300025942 | Ga0207689_10199489 | Ga0207689_101994892 | 270 |
| 747 | 3300025942 | Ga0207689_10202642 | Ga0207689_102026422 | 270 |
| 748 | 3300025942 | Ga0207689_10295027 | Ga0207689_102950271 | 270 |
| 749 | 3300025944 | Ga0207661_10000672 | Ga0207661_1000067210 | 270 |
| 750 | 3300025944 | Ga0207661_10001945 | Ga0207661_100019457 | 270 |
| 751 | 3300025944 | Ga0207661_10199654 | Ga0207661_101996542 | 270 |
| 752 | 3300025945 | Ga0207679_10000989 | Ga0207679_100009897 | 270 |
| 753 | 3300025945 | Ga0207679_10011505 | Ga0207679_100115053 | 270 |
| 754 | 3300025945 | Ga0207679_10063361 | Ga0207679_100633612 | 270 |
| 755 | 3300025945 | Ga0207679_10132425 | Ga0207679_101324252 | 270 |
| 756 | 3300025945 | Ga0207679_10133214 | Ga0207679_101332143 | 270 |
| 757 | 3300025961 | Ga0207712_10182895 | Ga0207712_101828952 | 270 |
| 758 | 3300025961 | Ga0207712_10198495 | Ga0207712_101984951 | 270 |
| 759 | 3300025972 | Ga0207668_10092308 | Ga0207668_100923082 | 270 |
| 760 | 3300025981 | Ga0207640_10014894 | Ga0207640_100148944 | 270 |
| 761 | 3300025986 | Ga0207658_10257740 | Ga0207658_102577402 | 270 |
| 762 | 3300025986 | Ga0207658_10327839 | Ga0207658_103278392 | 270 |
| 763 | 3300025986 | Ga0207658_10683426 | Ga0207658_106834261 | 270 |
| 764 | 3300026023 | Ga0207677_10001337 | Ga0207677_100013379 | 270 |
| 765 | 3300026023 | Ga0207677_10180448 | Ga0207677_101804482 | 270 |
| 766 | 3300026023 | Ga0207677_10308309 | Ga0207677_103083092 | 270 |
| 767 | 3300026035 | Ga0207703_10000016 | Ga0207703_1000001697 | 270 |
| 768 | 3300026035 | Ga0207703_10101548 | Ga0207703_101015482 | 270 |
| 769 | 3300026035 | Ga0207703_10126475 | Ga0207703_101264753 | 270 |
| 770 | 3300026035 | Ga0207703_10159156 | Ga0207703_101591563 | 270 |
| 771 | 3300026041 | Ga0207639_10000042 | Ga0207639_1000004295 | 270 |
| 772 | 3300026041 | Ga0207639_10116652 | Ga0207639_101166522 | 270 |
| 773 | 3300026067 | Ga0207678_10009373 | Ga0207678_100093732 | 270 |
| 774 | 3300026067 | Ga0207678_10021390 | Ga0207678_100213903 | 270 |
| 775 | 3300026075 | Ga0207708_10003095 | Ga0207708_100030955 | 270 |
| 776 | 3300026078 | Ga0207702_10041525 | Ga0207702_100415252 | 270 |
| 777 | 3300026088 | Ga0207641_10001156 | Ga0207641_1000115610 | 270 |
| 778 | 3300026088 | Ga0207641_10261002 | Ga0207641_102610022 | 270 |
| 779 | 3300026088 | Ga0207641_10287080 | Ga0207641_102870801 | 270 |
| 780 | 3300026089 | Ga0207648_10001445 | Ga0207648_1000144520 | 270 |
| 781 | 3300026095 | Ga0207676_10000002 | Ga0207676_10000002775 | 270 |
| 782 | 3300026095 | Ga0207676_10001312 | Ga0207676_1000131210 | 270 |
| 783 | 3300026095 | Ga0207676_10041537 | Ga0207676_100415372 | 270 |
| 784 | 3300026095 | Ga0207676_10061723 | Ga0207676_100617232 | 270 |
| 785 | 3300026095 | Ga0207676_10132830 | Ga0207676_101328302 | 270 |
| 786 | 3300026116 | Ga0207674_10022320 | Ga0207674_100223206 | 270 |
| 787 | 3300026116 | Ga0207674_10323509 | Ga0207674_103235092 | 270 |
| 788 | 3300026118 | Ga0207675_100048240 | Ga0207675_1000482402 | 270 |
| 789 | 3300026121 | Ga0207683_10003266 | Ga0207683_100032664 | 270 |
| 790 | 3300026121 | Ga0207683_10029038 | Ga0207683_100290384 | 270 |
| 791 | 3300027364 | Ga0209967_1000723 | Ga0209967_10007233 | 270 |
| 792 | 3300027378 | Ga0209981_1000419 | Ga0209981_10004194 | 270 |
| 793 | 3300027395 | Ga0209996_1000408 | Ga0209996_10004082 | 270 |
| 794 | 3300027424 | Ga0209984_1000281 | Ga0209984_10002813 | 270 |
| 795 | 3300027462 | Ga0210000_1000240 | Ga0210000_10002404 | 270 |
| 796 | 3300027471 | Ga0209995_1000559 | Ga0209995_10005593 | 270 |
| 797 | 3300027526 | Ga0209968_1001231 | Ga0209968_10012313 | 270 |
| 798 | 3300027552 | Ga0209982_1001014 | Ga0209982_10010142 | 270 |
| 799 | 3300027614 | Ga0209970_1002927 | Ga0209970_10029273 | 270 |
| 800 | 3300027617 | Ga0210002_1000456 | Ga0210002_10004565 | 270 |
| 801 | 3300027665 | Ga0209983_1000664 | Ga0209983_10006644 | 270 |
| 802 | 3300027682 | Ga0209971_1001145 | Ga0209971_10011453 | 270 |
| 803 | 3300027695 | Ga0209966_1000697 | Ga0209966_10006975 | 270 |
| 804 | 3300027717 | Ga0209998_10000329 | Ga0209998_100003299 | 270 |
| 805 | 3300027876 | Ga0209974_10006156 | Ga0209974_100061563 | 270 |
| 806 | 3300027907 | Ga0207428_10000014 | Ga0207428_10000014235 | 270 |
| 807 | 3300027907 | Ga0207428_10022302 | Ga0207428_100223025 | 270 |
| 808 | 3300027907 | Ga0207428_10247048 | Ga0207428_102470482 | 270 |
| 809 | 3300027907 | Ga0207428_10380340 | Ga0207428_103803401 | 270 |
| 810 | 3300028379 | Ga0268266_10000153 | Ga0268266_1000015386 | 270 |
| 811 | 3300028379 | Ga0268266_10006720 | Ga0268266_100067203 | 270 |
| 812 | 3300028379 | Ga0268266_10047773 | Ga0268266_100477733 | 270 |
| 813 | 3300028379 | Ga0268266_10268721 | Ga0268266_102687212 | 270 |
| 814 | 3300028380 | Ga0268265_10006690 | Ga0268265_100066902 | 270 |
| 815 | 3300028380 | Ga0268265_10036360 | Ga0268265_100363603 | 270 |
| 816 | 3300028380 | Ga0268265_10225836 | Ga0268265_102258362 | 270 |
| 817 | 3300028380 | Ga0268265_10293460 | Ga0268265_102934602 | 270 |
| 818 | 3300028380 | Ga0268265_10673348 | Ga0268265_106733482 | 270 |
| 819 | 3300028381 | Ga0268264_10011082 | Ga0268264_100110827 | 270 |
| 820 | 3300028381 | Ga0268264_10123289 | Ga0268264_101232893 | 270 |
| 821 | 3300028381 | Ga0268264_10420158 | Ga0268264_104201581 | 270 |
| 822 | 3300028381 | Ga0268264_10600621 | Ga0268264_106006211 | 270 |
| 823 | 3300028381 | Ga0268264_10862023 | Ga0268264_108620231 | 270 |
| 824 | 3300030521 | Ga0307511_10006985 | Ga0307511_100069852 | 270 |
| 825 | 3300031090 | Ga0265760_10048931 | Ga0265760_100489312 | 270 |
| 826 | 3300031235 | Ga0265330_10003447 | Ga0265330_100034473 | 270 |
| 827 | 3300031238 | Ga0265332_10000139 | Ga0265332_1000013944 | 270 |
| 828 | 3300031239 | Ga0265328_10003149 | Ga0265328_100031493 | 270 |
| 829 | 3300031250 | Ga0265331_10000224 | Ga0265331_100002249 | 270 |
| 830 | 3300031251 | Ga0265327_10069309 | Ga0265327_100693093 | 270 |
| 831 | 3300031344 | Ga0265316_10000266 | Ga0265316_1000026644 | 270 |
| 832 | 3300031711 | Ga0265314_10000743 | Ga0265314_100007437 | 270 |
| 833 | 3300031712 | Ga0265342_10010095 | Ga0265342_100100955 | 270 |
| 834 | 3300032133 | Ga0316583_10117819 | Ga0316583_101178192 | 270 |
| 835 | 3300035118 | Ga0373954_0136394 | Ga0373954_0136394_340_1152 | 270 |
| 836 | 3300035172 | Ga0373955_0173250 | Ga0373955_0173250_28_840 | 270 |
| 837 | 3300035691 | Ga0373931_0226850 | Ga0373931_0226850_152_964 | 270 |
| 838 | 3300039437 | Ga0436365_0703007 | Ga0436365_0703007_16966_17778 | 270 |
| 839 | 3300039437 | Ga0436365_0962899 | Ga0436365_0962899_87232_88044 | 270 |
| 840 | 3300039450 | Ga0436363_0797270 | Ga0436363_0797270_334_1146 | 270 |
| 841 | 3300039450 | Ga0436363_1660411 | Ga0436363_1660411_294_1106 | 270 |
| 842 | 3300039453 | Ga0436362_0093143 | Ga0436362_0093143_174_986 | 270 |
| 843 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_34215_35027 | 270 |
| 844 | 3300039453 | Ga0436362_1080070 | Ga0436362_1080070_6960_7772 | 270 |
| 845 | 3300041496 | Ga0451839_1391315 | Ga0451839_1391315_451_1263 | 270 |
| 846 | 3300042184 | Ga0450908_017695 | Ga0450908_017695_324_1136 | 270 |
| 847 | 3300042439 | Ga0439464_0003061 | Ga0439464_0003061_310_1122 | 270 |
| 848 | 3300042439 | Ga0439464_0013195 | Ga0439464_0013195_882_1694 | 270 |
| 849 | 3300042461 | Ga0439460_0082584 | Ga0439460_0082584_11_823 | 270 |
| 850 | 3300042876 | Ga0451577_0117378 | Ga0451577_0117378_1328_2140 | 270 |
| 851 | 3300044683 | Ga0466965_0191429 | Ga0466965_0191429_76_888 | 270 |
| 852 | 3300044706 | Ga0466964_0166114 | Ga0466964_0166114_79_891 | 270 |
| 853 | 3300044712 | Ga0453684_0012582 | Ga0453684_0012582_7318_8130 | 270 |
| 854 | 3300044712 | Ga0453684_0013830 | Ga0453684_0013830_1485_2297 | 270 |
| 855 | 3300044712 | Ga0453684_0071548 | Ga0453684_0071548_1770_2582 | 270 |
| 856 | 3300044712 | Ga0453684_0700050 | Ga0453684_0700050_157_969 | 270 |
| 857 | 3300044719 | Ga0466971_0000027 | Ga0466971_0000027_30352_31164 | 270 |
| 858 | 3300044842 | Ga0466957_0002787 | Ga0466957_0002787_1425_2237 | 270 |
| 859 | 3300045051 | Ga0451576_0195712 | Ga0451576_0195712_1281_2093 | 270 |
| 860 | 3300045051 | Ga0451576_0259957 | Ga0451576_0259957_194_1006 | 270 |
| 861 | 3300045051 | Ga0451576_0813242 | Ga0451576_0813242_123_935 | 270 |
| 862 | 3300045976 | Ga0466967_0043333 | Ga0466967_0043333_2356_3168 | 270 |
| 863 | 3300046462 | Ga0495651_0036005 | Ga0495651_0036005_2847_3659 | 270 |
| 864 | 3300046463 | Ga0495653_0120513 | Ga0495653_0120513_636_1448 | 270 |
| 865 | 3300046472 | Ga0495580_0000846 | Ga0495580_0000846_7557_8369 | 270 |
| 866 | 3300046472 | Ga0495580_0142249 | Ga0495580_0142249_802_1614 | 270 |
| 867 | 3300046473 | Ga0495582_0000930 | Ga0495582_0000930_14496_15308 | 270 |
| 868 | 3300046473 | Ga0495582_0251875 | Ga0495582_0251875_17_829 | 270 |
| 869 | 3300046476 | Ga0495662_0002226 | Ga0495662_0002226_5629_6441 | 270 |
| 870 | 3300046476 | Ga0495662_0218607 | Ga0495662_0218607_62_874 | 270 |
| 871 | 3300046477 | Ga0495664_0053849 | Ga0495664_0053849_828_1640 | 270 |
| 872 | 3300046511 | Ga0495608_0233315 | Ga0495608_0233315_24_836 | 270 |
| 873 | 3300046514 | Ga0495618_0043471 | Ga0495618_0043471_1516_2328 | 270 |
| 874 | 3300046516 | Ga0495628_0008311 | Ga0495628_0008311_44_856 | 270 |
| 875 | 3300046517 | Ga0495630_0041419 | Ga0495630_0041419_413_1225 | 270 |
| 876 | 3300046529 | Ga0495652_0121564 | Ga0495652_0121564_338_1150 | 270 |
| 877 | 3300046535 | Ga0495586_0028557 | Ga0495586_0028557_945_1757 | 270 |
| 878 | 3300046543 | Ga0495645_0001895 | Ga0495645_0001895_10527_11339 | 270 |
| 879 | 3300046558 | Ga0495633_0202564 | Ga0495633_0202564_42_854 | 270 |
| 880 | 3300046559 | Ga0495667_0023218 | Ga0495667_0023218_1405_2217 | 270 |
| 881 | 3300046642 | Ga0495634_0142707 | Ga0495634_0142707_121_933 | 270 |
| 882 | 3300046678 | Ga0495599_0086881 | Ga0495599_0086881_173_985 | 270 |
| 883 | 3300046679 | Ga0495623_0035368 | Ga0495623_0035368_1467_2279 | 270 |
| 884 | 3300046684 | Ga0495669_0114628 | Ga0495669_0114628_244_1056 | 270 |
| 885 | 3300047317 | Ga0495604_0300875 | Ga0495604_0300875_205_1017 | 270 |
| 886 | 3300047322 | Ga0495680_0015803 | Ga0495680_0015803_834_1646 | 270 |
| 887 | 3300047444 | Ga0495675_0071358 | Ga0495675_0071358_1219_2031 | 270 |
| 888 | 3300048088 | Ga0495602_0040722 | Ga0495602_0040722_3088_3900 | 270 |
| 889 | 3300048904 | Ga0496101_0023085 | Ga0496101_0023085_1508_2320 | 270 |
| 890 | 3300048905 | Ga0496102_0077079 | Ga0496102_0077079_1941_2753 | 270 |
| 891 | 3300048905 | Ga0496102_0150216 | Ga0496102_0150216_217_1029 | 270 |
| 892 | 3300048905 | Ga0496102_0236967 | Ga0496102_0236967_86_898 | 270 |
| 893 | 3300048907 | Ga0496104_0004299 | Ga0496104_0004299_6502_7314 | 270 |
| 894 | 3300048907 | Ga0496104_0157238 | Ga0496104_0157238_927_1739 | 270 |
| 895 | 3300048907 | Ga0496104_0386337 | Ga0496104_0386337_285_1097 | 270 |
| 896 | 3300048909 | Ga0496106_0232266 | Ga0496106_0232266_633_1445 | 270 |
| 897 | 3300048910 | Ga0496107_0192850 | Ga0496107_0192850_73_885 | 270 |
| 898 | 3300048911 | Ga0496108_0001670 | Ga0496108_0001670_6315_7127 | 270 |
| 899 | 3300048911 | Ga0496108_0011573 | Ga0496108_0011573_1835_2647 | 270 |
| 900 | 3300048912 | Ga0496109_0000059 | Ga0496109_0000059_10486_11298 | 270 |
| 901 | 3300048912 | Ga0496109_0037614 | Ga0496109_0037614_3088_3900 | 270 |
| 902 | 3300048912 | Ga0496109_0100183 | Ga0496109_0100183_363_1175 | 270 |
| 903 | 3300048913 | Ga0496110_0048813 | Ga0496110_0048813_111_923 | 270 |
| 904 | 3300048913 | Ga0496110_0067434 | Ga0496110_0067434_1554_2366 | 270 |
| 905 | 3300048914 | Ga0496111_0028871 | Ga0496111_0028871_1338_2150 | 270 |
| 906 | 3300048915 | Ga0496112_0000504 | Ga0496112_0000504_15145_15957 | 270 |
| 907 | 3300048915 | Ga0496112_0014024 | Ga0496112_0014024_687_1499 | 270 |
| 908 | 3300048915 | Ga0496112_0577263 | Ga0496112_0577263_45_857 | 270 |
| 909 | 3300048916 | Ga0496113_0001118 | Ga0496113_0001118_11991_12803 | 270 |
| 910 | 3300048916 | Ga0496113_0080682 | Ga0496113_0080682_566_1378 | 270 |
| 911 | 3300048918 | Ga0496115_0002416 | Ga0496115_0002416_95_907 | 270 |
| 912 | 3300049569 | Ga0501032_0000027 | Ga0501032_0000027_96123_96935 | 270 |
| 913 | 3300049570 | Ga0501033_0000002 | Ga0501033_0000002_161758_162570 | 270 |
| 914 | 3300049570 | Ga0501033_0000008 | Ga0501033_0000008_87649_88461 | 270 |
| 915 | 3300049573 | Ga0501037_0000002 | Ga0501037_0000002_140903_141715 | 270 |
| 916 | 3300049573 | Ga0501037_0154617 | Ga0501037_0154617_781_1593 | 270 |
| 917 | 3300049574 | Ga0501038_0000801 | Ga0501038_0000801_25134_25946 | 270 |
| 918 | 3300049575 | Ga0501039_0070008 | Ga0501039_0070008_530_1342 | 270 |
| 919 | 3300049575 | Ga0501039_0471435 | Ga0501039_0471435_83_895 | 270 |
| 920 | 3300049577 | Ga0501041_0025890 | Ga0501041_0025890_179_991 | 270 |
| 921 | 3300049578 | Ga0501042_0021910 | Ga0501042_0021910_1864_2676 | 270 |
| 922 | 3300049579 | Ga0501043_0012458 | Ga0501043_0012458_1376_2188 | 270 |
| 923 | 3300049582 | Ga0501048_0039099 | Ga0501048_0039099_879_1691 | 270 |
| 924 | 3300049587 | Ga0501071_0054505 | Ga0501071_0054505_113_925 | 270 |
| 925 | 3300049588 | Ga0501072_0004986 | Ga0501072_0004986_6923_7735 | 270 |
| 926 | 3300049591 | Ga0501075_0055592 | Ga0501075_0055592_1810_2622 | 270 |
| 927 | 3300049593 | Ga0501077_0172901 | Ga0501077_0172901_60_872 | 270 |
| 928 | 3300049741 | Ga0501079_0042388 | Ga0501079_0042388_765_1577 | 270 |
| 929 | 3300049743 | Ga0501081_0107736 | Ga0501081_0107736_1077_1889 | 270 |
| 930 | 3300049743 | Ga0501081_0156377 | Ga0501081_0156377_380_1192 | 270 |
| 931 | 3300049822 | Ga0501035_0051602 | Ga0501035_0051602_1932_2744 | 270 |
| 932 | 3300049823 | Ga0501044_0001568 | Ga0501044_0001568_21977_22789 | 270 |
| 933 | 3300049824 | Ga0501045_0018375 | Ga0501045_0018375_3112_3924 | 270 |
| 934 | 3300049824 | Ga0501045_0208192 | Ga0501045_0208192_591_1403 | 270 |
| 935 | 3300050491 | nmdc:mga00v17_167751_c1 | nmdc:mga00v17_167751_c1_136_948 | 270 |
| 936 | 3300050491 | nmdc:mga00v17_19417_c1 | nmdc:mga00v17_19417_c1_882_1694 | 270 |
| 937 | 3300050492 | nmdc:mga0yw44_9395_c1 | nmdc:mga0yw44_9395_c1_4068_4880 | 270 |
| 938 | 3300050493 | nmdc:mga0k408_4424_c1 | nmdc:mga0k408_4424_c1_6361_7173 | 270 |
| 939 | 3300050496 | nmdc:mga07m45_5600_c1 | nmdc:mga07m45_5600_c1_918_1730 | 270 |
| 940 | 3300050507 | nmdc:mga05p37_27870_c1 | nmdc:mga05p37_27870_c1_5925_6737 | 270 |
| 941 | 3300050507 | nmdc:mga05p37_5248_c1 | nmdc:mga05p37_5248_c1_1397_2209 | 270 |
| 942 | 3300050507 | nmdc:mga05p37_645163_c1 | nmdc:mga05p37_645163_c1_244_1056 | 270 |
| 943 | 3300050507 | nmdc:mga05p37_7929_c1 | nmdc:mga05p37_7929_c1_8679_9491 | 270 |
| 944 | 3300050508 | nmdc:mga09592_94837_c1 | nmdc:mga09592_94837_c1_213_1025 | 270 |
| 945 | 3300050510 | nmdc:mga06r32_253175_c1 | nmdc:mga06r32_253175_c1_339_1151 | 270 |
| 946 | 3300050510 | nmdc:mga06r32_3603_c1 | nmdc:mga06r32_3603_c1_12471_13283 | 270 |
| 947 | 3300050511 | nmdc:mga08y16_123850_c1 | nmdc:mga08y16_123850_c1_1697_2509 | 270 |
| 948 | 3300050511 | nmdc:mga08y16_23_c1 | nmdc:mga08y16_23_c1_194901_195713 | 270 |
| 949 | 3300050511 | nmdc:mga08y16_26456_c1 | nmdc:mga08y16_26456_c1_1348_2160 | 270 |
| 950 | 3300050511 | nmdc:mga08y16_69453_c1 | nmdc:mga08y16_69453_c1_2576_3388 | 270 |
| 951 | 3300050512 | nmdc:mga0n895_17787_c1 | nmdc:mga0n895_17787_c1_74_886 | 270 |
| 952 | 3300050512 | nmdc:mga0n895_388976_c1 | nmdc:mga0n895_388976_c1_555_1367 | 270 |
| 953 | 3300050512 | nmdc:mga0n895_400320_c2 | nmdc:mga0n895_400320_c2_147_959 | 270 |
| 954 | 3300050512 | nmdc:mga0n895_65895_c1 | nmdc:mga0n895_65895_c1_318_1130 | 270 |
| 955 | 3300050513 | nmdc:mga0rr50_14388_c1 | nmdc:mga0rr50_14388_c1_1127_1939 | 270 |
| 956 | 3300050513 | nmdc:mga0rr50_167_c2 | nmdc:mga0rr50_167_c2_2117_2929 | 270 |
| 957 | 3300050513 | nmdc:mga0rr50_320162_c1 | nmdc:mga0rr50_320162_c1_107_919 | 270 |
| 958 | 3300050513 | nmdc:mga0rr50_339463_c1 | nmdc:mga0rr50_339463_c1_119_931 | 270 |
| 959 | 3300050513 | nmdc:mga0rr50_520818_c1 | nmdc:mga0rr50_520818_c1_158_970 | 270 |
| 960 | 3300050513 | nmdc:mga0rr50_7803_c1 | nmdc:mga0rr50_7803_c1_3001_3813 | 270 |
| 961 | 3300050514 | nmdc:mga08x19_115725_c1 | nmdc:mga08x19_115725_c1_880_1692 | 270 |
| 962 | 3300050514 | nmdc:mga08x19_57641_c1 | nmdc:mga08x19_57641_c1_1064_1876 | 270 |
| 963 | 3300050515 | nmdc:mga0a205_21835_c1 | nmdc:mga0a205_21835_c1_432_1244 | 270 |
| 964 | 3300050515 | nmdc:mga0a205_270381_c1 | nmdc:mga0a205_270381_c1_742_1554 | 270 |
| 965 | 3300050515 | nmdc:mga0a205_469705_c1 | nmdc:mga0a205_469705_c1_201_1013 | 270 |
| 966 | 3300050515 | nmdc:mga0a205_60997_c1 | nmdc:mga0a205_60997_c1_1439_2251 | 270 |
| 967 | 3300053077 | Ga0495601_0144125 | Ga0495601_0144125_437_1249 | 270 |
| 968 | 3300053084 | Ga0495595_0168370 | Ga0495595_0168370_59_871 | 270 |
| 969 | 3300053085 | Ga0495619_0216901 | Ga0495619_0216901_43_855 | 270 |
| 970 | 3300054114 | Ga0501084_0300456 | Ga0501084_0300456_191_1003 | 270 |
| 971 | 3300054114 | Ga0501084_0528549 | Ga0501084_0528549_90_902 | 270 |
| 972 | 3300061719 | Ga0466962_0000032 | Ga0466962_0000032_36751_37563 | 270 |
| 973 | 3300061734 | Ga0530510_0003691 | Ga0530510_0003691_6278_7090 | 270 |
| 974 | 3300049569 | Ga0501032_0125309 | Ga0501032_0125309_615_1430 | 271 |
| 975 | 3300005530 | Ga0070679_100679455 | Ga0070679_1006794551 | 272 |
| 976 | 3300005618 | Ga0068864_100032014 | Ga0068864_1000320142 | 272 |
| 977 | 3300005841 | Ga0068863_100347529 | Ga0068863_1003475292 | 272 |
| 978 | 3300025921 | Ga0207652_10595904 | Ga0207652_105959041 | 272 |
| 979 | 3300026088 | Ga0207641_10450068 | Ga0207641_104500682 | 272 |
| 980 | 3300026095 | Ga0207676_10011182 | Ga0207676_100111824 | 272 |
| 981 | 3300026116 | Ga0207674_10319374 | Ga0207674_103193742 | 272 |
| 982 | 3300035121 | Ga0373960_0005070 | Ga0373960_0005070_964_1788 | 272 |
| 983 | 3300035691 | Ga0373931_0071776 | Ga0373931_0071776_1029_1853 | 272 |
| 984 | 3300037471 | Ga0395905_0590589 | Ga0395905_0590589_67_891 | 272 |
| 985 | 3300048907 | Ga0496104_0638750 | Ga0496104_0638750_70_894 | 272 |
| 986 | 3300048911 | Ga0496108_0006367 | Ga0496108_0006367_3938_4762 | 272 |
| 987 | 3300048912 | Ga0496109_0044575 | Ga0496109_0044575_96_920 | 272 |
| 988 | 3300048914 | Ga0496111_0053860 | Ga0496111_0053860_2058_2882 | 272 |
| 989 | 3300048915 | Ga0496112_0000524 | Ga0496112_0000524_4978_5802 | 272 |
| 990 | 3300048916 | Ga0496113_0003691 | Ga0496113_0003691_8349_9173 | 272 |
| 991 | 3300002155 | JGI24033J26618_1000149 | JGI24033J26618_10001494 | 273 |
| 992 | 3300005329 | Ga0070683_100054463 | Ga0070683_1000544634 | 273 |
| 993 | 3300005344 | Ga0070661_100000291 | Ga0070661_10000029115 | 273 |
| 994 | 3300005444 | Ga0070694_100186069 | Ga0070694_1001860692 | 273 |
| 995 | 3300005456 | Ga0070678_100053693 | Ga0070678_1000536933 | 273 |
| 996 | 3300005458 | Ga0070681_10174970 | Ga0070681_101749704 | 273 |
| 997 | 3300005535 | Ga0070684_100040965 | Ga0070684_1000409655 | 273 |
| 998 | 3300005985 | Ga0081539_10001123 | Ga0081539_100011233 | 273 |
| 999 | 3300006846 | Ga0075430_100058695 | Ga0075430_1000586953 | 273 |
| 1000 | 3300006880 | Ga0075429_100031235 | Ga0075429_1000312353 | 273 |
| 1001 | 3300006914 | Ga0075436_100069780 | Ga0075436_1000697802 | 273 |
| 1002 | 3300009093 | Ga0105240_10078220 | Ga0105240_100782205 | 273 |
| 1003 | 3300009094 | Ga0111539_10026924 | Ga0111539_100269243 | 273 |
| 1004 | 3300009147 | Ga0114129_10011206 | Ga0114129_100112065 | 273 |
| 1005 | 3300009553 | Ga0105249_10596894 | Ga0105249_105968941 | 273 |
| 1006 | 3300013296 | Ga0157374_10052698 | Ga0157374_100526985 | 273 |
| 1007 | 3300013297 | Ga0157378_10039658 | Ga0157378_100396583 | 273 |
| 1008 | 3300025912 | Ga0207707_10437300 | Ga0207707_104373001 | 273 |
| 1009 | 3300025920 | Ga0207649_10000125 | Ga0207649_1000012513 | 273 |
| 1010 | 3300026121 | Ga0207683_10172876 | Ga0207683_101728762 | 273 |
| 1011 | 3300027907 | Ga0207428_10011414 | Ga0207428_100114142 | 273 |
| 1012 | 3300031344 | Ga0265316_10190630 | Ga0265316_101906301 | 273 |
| 1013 | 3300031711 | Ga0265314_10145657 | Ga0265314_101456571 | 273 |
| 1014 | 3300031731 | Ga0307405_10329179 | Ga0307405_103291792 | 273 |
| 1015 | 3300031995 | Ga0307409_100506949 | Ga0307409_1005069492 | 273 |
| 1016 | 3300037466 | Ga0395898_0000051 | Ga0395898_0000051_69588_70427 | 273 |
| 1017 | 3300042436 | Ga0439435_0024455 | Ga0439435_0024455_390_1271 | 273 |
| 1018 | 3300042439 | Ga0439464_0035168 | Ga0439464_0035168_501_1382 | 273 |
| 1019 | 3300042461 | Ga0439460_0010392 | Ga0439460_0010392_1349_2230 | 273 |
| 1020 | 3300044842 | Ga0466957_0007651 | Ga0466957_0007651_691_1530 | 273 |
| 1021 | 3300048905 | Ga0496102_0039382 | Ga0496102_0039382_2132_2986 | 273 |
| 1022 | 3300048906 | Ga0496103_0163800 | Ga0496103_0163800_440_1264 | 273 |
| 1023 | 3300048916 | Ga0496113_0122054 | Ga0496113_0122054_297_1151 | 273 |
| 1024 | 3300050508 | nmdc:mga09592_18276_c1 | nmdc:mga09592_18276_c1_2531_3355 | 273 |
| 1025 | 3300050511 | nmdc:mga08y16_148389_c1 | nmdc:mga08y16_148389_c1_761_1588 | 273 |
| 1026 | 3300050511 | nmdc:mga08y16_21091_c1 | nmdc:mga08y16_21091_c1_5319_6143 | 273 |
| 1027 | 3300050513 | nmdc:mga0rr50_64578_c1 | nmdc:mga0rr50_64578_c1_673_1500 | 273 |
| 1028 | 3300050514 | nmdc:mga08x19_30835_c1 | nmdc:mga08x19_30835_c1_1248_2075 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9235 | 5 | 235 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9179 | 5 | 235 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.912 | 5 | 235 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9045 | 5 | 247 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9008 | 3 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9198 | 4 | 235 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.918 | 5 | 73 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9179 | 5 | 234 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9138 | 4 | 235 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9112 | 1 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7BUJ3-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9634 | 4 | 253 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7X7BUJ3-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9559 | 4 | 253 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7L9RRY7-F1-model_v4 | Ferric enterobactin transport ATP-binding protein FepC | 0.954 | 4 | 254 |
GO:0005524
GO:0016887 |
| AF-A0A090SKW3-F1-model_v4 | deleted | 0.942 | 12 | 265 |
|
| AF-A0A7C7LRK7-F1-model_v4 | Spermidine/putrescine import ATP-binding protein PotA (EC 7.6.2.11) | 0.9344 | 2 | 235 |
GO:0005524
GO:0015417 GO:0016887 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar