F488533

General Info

Members Datasets Scaffolds Average Seq Length
1027 493 952 201

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10067720|Ga0099795_100677202
Length 228
Sequence VFFPLPANTRERGKTMPEISSLMRRAVAAALTLSVLASSVLASVGWAQQPPPVRIRGTIESVDGAMLMIKSREGTDMKVRVTDNVAVFGVAKTEMSEIKPGSYIGVSAMPEPDGTQKALAVHIFPETQRGAAEGFRPWDLRPNSTMTNATVAETVKGTDGQNILVKYKDGEKKVVVPPDTPIVTFVAGDKSELKPGAKIIIFGAVKKDDGTLEANRVNVGRDGITPPM

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
14 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
15 2791355199
16 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
17 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
18 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
19 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
20 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
21 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
22 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
23 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
24 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
25 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
26 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
27 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
28 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
29 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
30 2904699407
31 2906610324
32 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
33 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
34 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
35 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
36 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
37 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
38 2922425934
39 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
40 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
41 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
42 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
43 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
44 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
45 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
46 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
47 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
48 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
49 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
50 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
51 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
52 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
53 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
54 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
55 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
56 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
57 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
58 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
59 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
60 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
64 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
65 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
66 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
67 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
68 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
69 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
79 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
101 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
102 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
103 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
104 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
119 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
125 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
126 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
127 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
128 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
129 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
141 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
142 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
143 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
144 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
157 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
162 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
165 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
166 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
171 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
172 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
175 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
176 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
194 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
195 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
196 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
265 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
271 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
272 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
273 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
274 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
277 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
278 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
287 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
288 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
291 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
292 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
293 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
294 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
295 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
296 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
297 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
298 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
299 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
300 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
301 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
302 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
303 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
305 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
307 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
308 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
309 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
310 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
311 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
312 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
313 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
314 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
315 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
316 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
317 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
318 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
320 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
321 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
322 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
323 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
328 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
329 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
330 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
331 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
332 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
333 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
334 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
335 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
336 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
337 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
338 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
349 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
350 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
365 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
368 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
378 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
384 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
385 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
386 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
387 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
388 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
389 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
390 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
391 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
395 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
405 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
406 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
410 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
411 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
412 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
413 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
414 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
415 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
416 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
417 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
420 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
421 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
422 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
423 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
424 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
425 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
432 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
433 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
445 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
449 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
450 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
451 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
452 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
453 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
454 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
458 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
459 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
462 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
463 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
464 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
467 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
468 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
469 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
472 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
473 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
476 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
477 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
478 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
479 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
480 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
481 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
486 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
487 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
488 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
489 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
490 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
491 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
492 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
493 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.2
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 6.23
Rhizoplane 8.47
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100531 3300001430 Bacteria 2004
2 JGI24739J22299_10000871 3300001989 Bacteria 11154
3 JGI24737J22298_10010529 3300001990 Bacteria 3050
4 JGI24750J21931_1009691 3300002070 Bacteria 1244
5 JGI24748J21848_1006767 3300002074 Bacteria 1338
6 JGI24738J21930_10002474 3300002075 Bacteria 4827
7 JGI24744J21845_10007283 3300002077 Bacteria 2286
8 JGI24744J21845_10007868 3300002077 Bacteria 2201
9 JGI24034J26672_10006652 3300002239 Bacteria 1669
10 JGI24742J22300_10003578 3300002244 Bacteria 2525
11 JGI25406J46586_10000064 3300003203 Bacteria 49110
12 JGI25404J52841_10033318 3300003659 Bacteria 1098
13 JGI25404J52841_10078960 3300003659 Bacteria 687
14 Ga0058859_11740492 3300004798 Bacteria 739
15 Ga0065715_10174306 3300005293 Bacteria 1523
16 Ga0065715_10565648 3300005293 Bacteria 730
17 Ga0070658_10710365 3300005327 Bacteria 873
18 Ga0070676_10020837 3300005328 Bacteria 3665
19 Ga0070683_100041896 3300005329 Bacteria 4215
20 Ga0070690_100226054 3300005330 Bacteria 1313
21 Ga0070690_100230852 3300005330 Bacteria 1301
22 Ga0070670_100077132 3300005331 Bacteria 2863
23 Ga0070670_100183096 3300005331 Bacteria 1819
24 Ga0068869_100021302 3300005334 Bacteria 4458
25 Ga0068869_100082663 3300005334 Bacteria 2400
26 Ga0070680_100003647 3300005336 Bacteria 11501
27 Ga0070680_100029856 3300005336 Bacteria 4377
28 Ga0070680_100121614 3300005336 Bacteria 2180
29 Ga0070680_100205891 3300005336 Bacteria 1659
30 Ga0070680_100226621 3300005336 Bacteria 1578
31 Ga0070682_100007969 3300005337 Bacteria 5962
32 Ga0068868_100138279 3300005338 Bacteria 1998
33 Ga0068868_100408198 3300005338 Bacteria 1173
34 Ga0070660_100034303 3300005339 Bacteria 3833
35 Ga0070660_100375198 3300005339 Bacteria 1174
36 Ga0070689_100031062 3300005340 Bacteria 4058
37 Ga0070689_100121015 3300005340 Bacteria 2091
38 Ga0070689_100208226 3300005340 Unclassified 1600
39 Ga0070689_100327516 3300005340 Bacteria 1281
40 Ga0070691_10004859 3300005341 Bacteria 6121
41 Ga0070687_100049605 3300005343 Bacteria 2164
42 Ga0070687_100052564 3300005343 Bacteria 2115
43 Ga0070661_100009866 3300005344 Bacteria 6624
44 Ga0070692_10045412 3300005345 Bacteria 2266
45 Ga0070692_10260157 3300005345 Bacteria 1043
46 Ga0070668_100013726 3300005347 Bacteria 6051
47 Ga0070668_100036445 3300005347 Bacteria 3754
48 Ga0070668_100067131 3300005347 Bacteria 2785
49 Ga0070668_100672016 3300005347 Bacteria 911
50 Ga0070669_100014406 3300005353 Bacteria 5628
51 Ga0070669_100035084 3300005353 Bacteria 3633
52 Ga0070669_100093037 3300005353 Bacteria 2264
53 Ga0070669_100434671 3300005353 Bacteria 1079
54 Ga0070675_100018170 3300005354 Bacteria 5596
55 Ga0070675_100732289 3300005354 Bacteria 902
56 Ga0070671_100034258 3300005355 Bacteria 4203
57 Ga0070671_100296361 3300005355 Bacteria 1377
58 Ga0070671_100441341 3300005355 Bacteria 1116
59 Ga0070674_100005693 3300005356 Bacteria 7227
60 Ga0070674_100047397 3300005356 Bacteria 2944
61 Ga0070673_100015849 3300005364 Bacteria 5308
62 Ga0070688_100037805 3300005365 Bacteria 2943
63 Ga0070688_100348498 3300005365 Bacteria 1084
64 Ga0070688_100381848 3300005365 Bacteria 1039
65 Ga0070659_100076576 3300005366 Bacteria 2667
66 Ga0070659_100079331 3300005366 Bacteria 2620
67 Ga0070659_100161364 3300005366 Bacteria 1833
68 Ga0070659_100374802 3300005366 Bacteria 1198
69 Ga0070659_100445386 3300005366 Bacteria 1098
70 Ga0070667_100024258 3300005367 Bacteria 5037
71 Ga0070667_100032997 3300005367 Bacteria 4322
72 Ga0070667_100731541 3300005367 Bacteria 916
73 Ga0070703_10003201 3300005406 Bacteria 4676
74 Ga0070713_100003057 3300005436 Bacteria 10992
75 Ga0070713_100347891 3300005436 Unclassified 1375
76 Ga0070710_10106609 3300005437 Bacteria 1677
77 Ga0070701_10004348 3300005438 Bacteria 5724
78 Ga0070711_100077792 3300005439 Bacteria 2355
79 Ga0070711_100591894 3300005439 Bacteria 924
80 Ga0070705_100023373 3300005440 Bacteria 3318
81 Ga0070705_100126002 3300005440 Bacteria 1662
82 Ga0070705_100215842 3300005440 Unclassified 1325
83 Ga0070700_100039431 3300005441 Bacteria 2885
84 Ga0070694_100019693 3300005444 Bacteria 4294
85 Ga0070694_100109804 3300005444 Bacteria 1963
86 Ga0070708_100209630 3300005445 Bacteria 1826
87 Ga0070708_100521341 3300005445 Bacteria 1121
88 Ga0070708_100767105 3300005445 Bacteria 907
89 Ga0070663_100027341 3300005455 Bacteria 3873
90 Ga0070663_100059872 3300005455 Bacteria 2737
91 Ga0070663_100082344 3300005455 Bacteria 2367
92 Ga0070663_100679161 3300005455 Bacteria 873
93 Ga0070678_100052290 3300005456 Bacteria 2965
94 Ga0070678_100086184 3300005456 Bacteria 2395
95 Ga0070662_100033312 3300005457 Bacteria 3626
96 Ga0070662_100071711 3300005457 Bacteria 2555
97 Ga0070662_100120688 3300005457 Bacteria 2009
98 Ga0070681_10032947 3300005458 Bacteria 5201
99 Ga0070681_10475268 3300005458 Bacteria 1162
100 Ga0068867_100021271 3300005459 Bacteria 4629
101 Ga0068867_100128077 3300005459 Bacteria 1969
102 Ga0070685_10048441 3300005466 Bacteria 2447
103 Ga0070706_100624318 3300005467 Bacteria 1001
104 Ga0070684_100022473 3300005535 Bacteria 5261
105 Ga0070684_100254112 3300005535 Bacteria 1606
106 Ga0070697_100173177 3300005536 Bacteria 1827
107 Ga0068853_100002207 3300005539 Bacteria 14542
108 Ga0068853_100003634 3300005539 Bacteria 11828
109 Ga0068853_100060238 3300005539 Bacteria 3279
110 Ga0068853_100061086 3300005539 Bacteria 3259
111 Ga0068853_100426138 3300005539 Bacteria 1245
112 Ga0070672_100006742 3300005543 Bacteria 7744
113 Ga0070686_100035110 3300005544 Bacteria 3094
114 Ga0070695_100027274 3300005545 Bacteria 3537
115 Ga0070696_100027513 3300005546 Bacteria 3875
116 Ga0070693_100024374 3300005547 Bacteria 3244
117 Ga0070665_100009777 3300005548 Bacteria 9699
118 Ga0070665_100063185 3300005548 Bacteria 3712
119 Ga0070665_100237840 3300005548 Bacteria 1822
120 Ga0070665_100360172 3300005548 Bacteria 1460
121 Ga0070665_100579006 3300005548 Bacteria 1135
122 Ga0070665_101072015 3300005548 Bacteria 817
123 Ga0070704_100025802 3300005549 Bacteria 3873
124 Ga0070704_100208955 3300005549 Bacteria 1580
125 Ga0068855_100018412 3300005563 Bacteria 8391
126 Ga0068855_100099837 3300005563 Bacteria 3343
127 Ga0068855_100121549 3300005563 Bacteria 2988
128 Ga0070664_100069419 3300005564 Bacteria 3015
129 Ga0070664_100118200 3300005564 Bacteria 2319
130 Ga0068857_100038621 3300005577 Bacteria 4228
131 Ga0068857_100124799 3300005577 Bacteria 2319
132 Ga0068854_100016856 3300005578 Bacteria 4878
133 Ga0068854_100246521 3300005578 Bacteria 1425
134 Ga0068856_100074006 3300005614 Bacteria 3372
135 Ga0070702_100058574 3300005615 Bacteria 2232
136 Ga0070702_100091658 3300005615 Unclassified 1844
137 Ga0070702_100108151 3300005615 Bacteria 1718
138 Ga0068852_100024735 3300005616 Bacteria 4858
139 Ga0068852_100028928 3300005616 Bacteria 4543
140 Ga0068852_100135745 3300005616 Bacteria 2271
141 Ga0068852_100321492 3300005616 Bacteria 1503
142 Ga0068852_100597485 3300005616 Bacteria 1107
143 Ga0068859_100035913 3300005617 Bacteria 4973
144 Ga0068859_100096333 3300005617 Bacteria 3012
145 Ga0068859_100279653 3300005617 Bacteria 1761
146 Ga0068864_100026533 3300005618 Bacteria 4885
147 Ga0068864_100459111 3300005618 Bacteria 1219
148 Ga0068866_10100091 3300005718 Bacteria 1597
149 Ga0068866_10195582 3300005718 Unclassified 1204
150 Ga0068861_100019676 3300005719 Bacteria 4823
151 Ga0068861_100042474 3300005719 Bacteria 3407
152 Ga0068861_100048184 3300005719 Bacteria 3220
153 Ga0068861_100111473 3300005719 Bacteria 2192
154 Ga0068861_100214160 3300005719 Bacteria 1624
155 Ga0068851_10206447 3300005834 Bacteria 1099
156 Ga0068870_10026852 3300005840 Bacteria 2874
157 Ga0068863_100006825 3300005841 Bacteria 11196
158 Ga0068863_100142125 3300005841 Bacteria 2294
159 Ga0068858_100057433 3300005842 Bacteria 3597
160 Ga0068858_100079901 3300005842 Bacteria 3038
161 Ga0068858_100484718 3300005842 Bacteria 1194
162 Ga0068858_100806662 3300005842 Unclassified 916
163 Ga0068860_100002033 3300005843 Bacteria 21319
164 Ga0068860_100018432 3300005843 Bacteria 6790
165 Ga0068860_100040901 3300005843 Bacteria 4429
166 Ga0068860_100158101 3300005843 Bacteria 2184
167 Ga0068860_100192601 3300005843 Bacteria 1973
168 Ga0068860_101373457 3300005843 Bacteria 728
169 Ga0068862_100010222 3300005844 Bacteria 7743
170 Ga0068862_100028055 3300005844 Bacteria 4741
171 Ga0068862_100083389 3300005844 Bacteria 2775
172 Ga0068862_100342269 3300005844 Bacteria 1385
173 Ga0081455_10000200 3300005937 Bacteria 76013
174 Ga0081455_10033922 3300005937 Bacteria 4579
175 Ga0081455_10051904 3300005937 Bacteria 3515
176 Ga0081455_10091058 3300005937 Bacteria 2471
177 Ga0081455_10114395 3300005937 Bacteria 2138
178 Ga0081538_10011493 3300005981 Bacteria 7167
179 Ga0081540_1002062 3300005983 Bacteria 16766
180 Ga0081540_1004242 3300005983 Bacteria 11009
181 Ga0081540_1012946 3300005983 Bacteria 5450
182 Ga0081540_1021026 3300005983 Bacteria 3904
183 Ga0081540_1070985 3300005983 Bacteria 1611
184 Ga0081539_10000099 3300005985 Bacteria 201018
185 Ga0070717_10003779 3300006028 Bacteria 10878
186 Ga0070717_10004793 3300006028 Bacteria 9837
187 Ga0070717_10082660 3300006028 Bacteria 2699
188 Ga0075365_10012654 3300006038 Bacteria 5020
189 Ga0075368_10010256 3300006042 Bacteria 3384
190 Ga0075368_10197072 3300006042 Bacteria 852
191 Ga0075363_100005067 3300006048 Bacteria 5827
192 Ga0075363_100011785 3300006048 Bacteria 4195
193 Ga0075363_100223399 3300006048 Bacteria 1080
194 Ga0075363_100476049 3300006048 Bacteria 740
195 Ga0075364_10115711 3300006051 Bacteria 1792
196 Ga0075364_10263586 3300006051 Bacteria 1171
197 Ga0070716_100235027 3300006173 Bacteria 1240
198 Ga0070712_100062605 3300006175 Bacteria 2631
199 Ga0070712_100233934 3300006175 Bacteria 1461
200 Ga0075367_10013887 3300006178 Bacteria 4344
201 Ga0075367_10021083 3300006178 Bacteria 3638
202 Ga0075366_10027167 3300006195 Bacteria 3357
203 Ga0075366_10225549 3300006195 Bacteria 1141
204 Ga0075366_10284461 3300006195 Bacteria 1011
205 Ga0097621_100007897 3300006237 Bacteria 7631
206 Ga0097621_100053560 3300006237 Bacteria 3289
207 Ga0097621_100302683 3300006237 Bacteria 1412
208 Ga0075370_10003183 3300006353 Bacteria 7771
209 Ga0075370_10104230 3300006353 Bacteria 1643
210 Ga0075370_10401972 3300006353 Bacteria 822
211 Ga0068871_100029425 3300006358 Bacteria 4314
212 Ga0075428_100300564 3300006844 Bacteria 1725
213 Ga0075433_10025119 3300006852 Bacteria 5036
214 Ga0075433_10201324 3300006852 Bacteria 1770
215 Ga0075434_100008091 3300006871 Bacteria 9750
216 Ga0075434_100021009 3300006871 Bacteria 6341
217 Ga0068865_100001544 3300006881 Bacteria 13429
218 Ga0068865_100216332 3300006881 Bacteria 1496
219 Ga0097620_100035916 3300006931 Bacteria 4973
220 Ga0097620_100096333 3300006931 Bacteria 3012
221 Ga0097620_100279657 3300006931 Bacteria 1761
222 Ga0075435_100603384 3300007076 Unclassified 952
223 Ga0099795_10033214 3300007788 Bacteria 1790
224 Ga0099795_10067720 3300007788 Bacteria 1340
225 Ga0099795_10235779 3300007788 Bacteria 784
226 Ga0105244_10185079 3300009036 Bacteria 987
227 Ga0105250_10043606 3300009092 Bacteria 1798
228 Ga0105250_10122793 3300009092 Bacteria 1069
229 Ga0105240_10012128 3300009093 Bacteria 11932
230 Ga0105240_10140846 3300009093 Bacteria 2884
231 Ga0111539_10001808 3300009094 Bacteria 28479
232 Ga0111539_10057213 3300009094 Bacteria 4631
233 Ga0111539_10739166 3300009094 Bacteria 1145
234 Ga0105245_10014034 3300009098 Bacteria 6976
235 Ga0105245_10060262 3300009098 Bacteria 3418
236 Ga0105245_10514256 3300009098 Bacteria 1215
237 Ga0105247_10087187 3300009101 Bacteria 1976
238 Ga0105247_10143497 3300009101 Bacteria 1567
239 Ga0105247_10167620 3300009101 Bacteria 1458
240 Ga0105243_10139000 3300009148 Bacteria 2070
241 Ga0105243_10162608 3300009148 Bacteria 1926
242 Ga0105243_10241861 3300009148 Bacteria 1607
243 Ga0105241_10031108 3300009174 Bacteria 3994
244 Ga0105241_10272783 3300009174 Bacteria 1442
245 Ga0105241_10649305 3300009174 Bacteria 958
246 Ga0105242_10153900 3300009176 Unclassified 2007
247 Ga0105242_10204421 3300009176 Bacteria 1756
248 Ga0105248_10005933 3300009177 Bacteria 13426
249 Ga0105248_10011779 3300009177 Bacteria 9647
250 Ga0105248_10029891 3300009177 Bacteria 6080
251 Ga0105248_10034176 3300009177 Bacteria 5684
252 Ga0105237_10004719 3300009545 Bacteria 15684
253 Ga0105237_10007432 3300009545 Bacteria 11993
254 Ga0105237_10070348 3300009545 Bacteria 3495
255 Ga0105237_10599999 3300009545 Bacteria 1108
256 Ga0105238_10003421 3300009551 Bacteria 15825
257 Ga0105238_10436192 3300009551 Bacteria 1306
258 Ga0105238_10935501 3300009551 Bacteria 886
259 Ga0105249_10014723 3300009553 Bacteria 6914
260 Ga0105249_10019871 3300009553 Bacteria 5999
261 Ga0105249_10528641 3300009553 Bacteria 1228
262 Ga0099796_10022143 3300010159 Bacteria 1968
263 Ga0099796_10055610 3300010159 Bacteria 1387
264 Ga0099796_10130836 3300010159 Bacteria 973
265 Ga0105239_10023212 3300010375 Bacteria 6836
266 Ga0105239_10053470 3300010375 Bacteria 4430
267 Ga0105239_10102667 3300010375 Bacteria 3164
268 Ga0105239_10783691 3300010375 Bacteria 1092
269 Ga0105239_10797822 3300010375 Bacteria 1082
270 Ga0105239_11371603 3300010375 Bacteria 816
271 Ga0105246_10032205 3300011119 Bacteria 3475
272 Ga0105246_10079330 3300011119 Bacteria 2334
273 Ga0105246_10597510 3300011119 Bacteria 953
274 Ga0157373_10024897 3300013100 Bacteria 4334
275 Ga0157373_10298226 3300013100 Unclassified 1144
276 Ga0157370_10101962 3300013104 Bacteria 2688
277 Ga0157369_10065365 3300013105 Bacteria 3914
278 Ga0157369_10315863 3300013105 Bacteria 1624
279 Ga0157374_10411201 3300013296 Bacteria 1351
280 Ga0157378_10031566 3300013297 Bacteria 4679
281 Ga0157378_10086387 3300013297 Bacteria 2844
282 Ga0157378_10104776 3300013297 Bacteria 2586
283 Ga0157378_10258421 3300013297 Unclassified 1670
284 Ga0163162_10022234 3300013306 Bacteria 6250
285 Ga0163162_10053512 3300013306 Bacteria 4057
286 Ga0163162_10602920 3300013306 Bacteria 1224
287 Ga0157372_10016582 3300013307 Bacteria 7904
288 Ga0157372_10186079 3300013307 Bacteria 2405
289 Ga0157375_10084799 3300013308 Bacteria 3217
290 Ga0157375_10261478 3300013308 Bacteria 1892
291 Ga0157375_10298866 3300013308 Bacteria 1773
292 Ga0163163_10016805 3300014325 Bacteria 6811
293 Ga0163163_10226212 3300014325 Unclassified 1920
294 Ga0157380_10100984 3300014326 Bacteria 2403
295 Ga0157377_10013798 3300014745 Bacteria 4096
296 Ga0157379_10089794 3300014968 Bacteria 2756
297 Ga0157379_10153801 3300014968 Bacteria 2075
298 Ga0157379_10848577 3300014968 Bacteria 864
299 Ga0157376_10006128 3300014969 Bacteria 8466
300 Ga0157376_10135746 3300014969 Bacteria 2201
301 Ga0157376_10217613 3300014969 Unclassified 1767
302 Ga0163161_10006229 3300017792 Bacteria 8265
303 Ga0163161_10675526 3300017792 Bacteria 858
304 Ga0213876_10340105 3300021384 Bacteria 798
305 Ga0213875_10034248 3300021388 Bacteria 2398
306 Ga0209233_1005084 3300025261 Bacteria 4400
307 Ga0207666_1000311 3300025271 Bacteria 6768
308 Ga0207673_1003304 3300025290 Bacteria 1880
309 Ga0209758_1001737 3300025297 Bacteria 24275
310 Ga0209758_1003580 3300025297 Bacteria 13909
311 Ga0207697_10006626 3300025315 Bacteria 5222
312 Ga0207653_10002805 3300025885 Bacteria 5539
313 Ga0207682_10000009 3300025893 Bacteria 86366
314 Ga0207682_10014469 3300025893 Bacteria 3074
315 Ga0207692_10092310 3300025898 Bacteria 1645
316 Ga0207642_10044313 3300025899 Bacteria 1968
317 Ga0207710_10002730 3300025900 Bacteria 8088
318 Ga0207688_10000892 3300025901 Bacteria 15087
319 Ga0207688_10094545 3300025901 Bacteria 1719
320 Ga0207647_10002160 3300025904 Bacteria 15015
321 Ga0207685_10406230 3300025905 Bacteria 699
322 Ga0207645_10000999 3300025907 Bacteria 23365
323 Ga0207645_10194083 3300025907 Bacteria 1335
324 Ga0207643_10006739 3300025908 Bacteria 6161
325 Ga0207705_10522401 3300025909 Bacteria 922
326 Ga0207705_10596831 3300025909 Bacteria 859
327 Ga0207654_10236456 3300025911 Bacteria 1219
328 Ga0207654_10401528 3300025911 Bacteria 953
329 Ga0207707_10002224 3300025912 Bacteria 17529
330 Ga0207707_10020542 3300025912 Bacteria 5767
331 Ga0207695_10046019 3300025913 Bacteria 4626
332 Ga0207671_10035416 3300025914 Bacteria 3705
333 Ga0207671_10064994 3300025914 Bacteria 2713
334 Ga0207671_10077969 3300025914 Bacteria 2481
335 Ga0207671_10180264 3300025914 Bacteria 1644
336 Ga0207693_10018708 3300025915 Bacteria 5514
337 Ga0207693_10205162 3300025915 Bacteria 1550
338 Ga0207693_10227981 3300025915 Bacteria 1463
339 Ga0207663_10132464 3300025916 Bacteria 1724
340 Ga0207663_10599911 3300025916 Bacteria 865
341 Ga0207660_10001283 3300025917 Bacteria 16867
342 Ga0207660_10010206 3300025917 Bacteria 6087
343 Ga0207660_10294273 3300025917 Bacteria 1291
344 Ga0207662_10000025 3300025918 Bacteria 70078
345 Ga0207662_10037874 3300025918 Bacteria 2825
346 Ga0207657_10005246 3300025919 Bacteria 13576
347 Ga0207657_10018108 3300025919 Bacteria 6739
348 Ga0207657_10044766 3300025919 Bacteria 3889
349 Ga0207657_10546461 3300025919 Bacteria 906
350 Ga0207649_10002186 3300025920 Bacteria 11047
351 Ga0207652_10004348 3300025921 Bacteria 11546
352 Ga0207652_10035191 3300025921 Bacteria 4225
353 Ga0207681_10007074 3300025923 Bacteria 6881
354 Ga0207681_10068564 3300025923 Bacteria 2464
355 Ga0207681_10248997 3300025923 Bacteria 1386
356 Ga0207694_10075578 3300025924 Bacteria 2637
357 Ga0207694_10082962 3300025924 Bacteria 2520
358 Ga0207694_10318994 3300025924 Bacteria 1282
359 Ga0207650_10190498 3300025925 Bacteria 1638
360 Ga0207650_10388174 3300025925 Bacteria 1154
361 Ga0207650_10669745 3300025925 Bacteria 875
362 Ga0207659_10030381 3300025926 Bacteria 3691
363 Ga0207659_10262721 3300025926 Bacteria 1405
364 Ga0207687_10001197 3300025927 Bacteria 17741
365 Ga0207687_10002549 3300025927 Bacteria 12372
366 Ga0207700_10055969 3300025928 Bacteria 2967
367 Ga0207700_10092879 3300025928 Bacteria 2387
368 Ga0207700_10144687 3300025928 Bacteria 1958
369 Ga0207700_10469555 3300025928 Bacteria 1111
370 Ga0207664_10152833 3300025929 Bacteria 1962
371 Ga0207664_10375743 3300025929 Bacteria 1261
372 Ga0207664_10828401 3300025929 Bacteria 832
373 Ga0207644_10036076 3300025931 Bacteria 3469
374 Ga0207644_10066815 3300025931 Bacteria 2619
375 Ga0207644_10365892 3300025931 Bacteria 1174
376 Ga0207690_10011755 3300025932 Bacteria 5236
377 Ga0207690_10310657 3300025932 Bacteria 1236
378 Ga0207706_10005363 3300025933 Bacteria 11952
379 Ga0207706_10040844 3300025933 Bacteria 4112
380 Ga0207706_10103304 3300025933 Bacteria 2507
381 Ga0207686_10001310 3300025934 Bacteria 14258
382 Ga0207686_10274618 3300025934 Bacteria 1241
383 Ga0207709_10006190 3300025935 Bacteria 6736
384 Ga0207709_10012682 3300025935 Bacteria 4646
385 Ga0207709_10688635 3300025935 Bacteria 817
386 Ga0207670_10013997 3300025936 Bacteria 4749
387 Ga0207670_10118723 3300025936 Bacteria 1919
388 Ga0207670_10194202 3300025936 Unclassified 1538
389 Ga0207670_10406048 3300025936 Bacteria 1090
390 Ga0207669_10001324 3300025937 Bacteria 10540
391 Ga0207669_10157264 3300025937 Bacteria 1600
392 Ga0207669_10659658 3300025937 Bacteria 856
393 Ga0207704_10003457 3300025938 Bacteria 7181
394 Ga0207665_10198325 3300025939 Bacteria 1461
395 Ga0207691_10002604 3300025940 Bacteria 17616
396 Ga0207691_10159553 3300025940 Bacteria 1979
397 Ga0207711_10031474 3300025941 Bacteria 4479
398 Ga0207711_10073623 3300025941 Bacteria 2969
399 Ga0207711_10101876 3300025941 Bacteria 2541
400 Ga0207711_10218792 3300025941 Bacteria 1741
401 Ga0207689_10001156 3300025942 Bacteria 25400
402 Ga0207689_10038650 3300025942 Bacteria 3952
403 Ga0207689_10049010 3300025942 Bacteria 3485
404 Ga0207689_10087744 3300025942 Bacteria 2555
405 Ga0207661_10007789 3300025944 Bacteria 7627
406 Ga0207679_10004160 3300025945 Bacteria 8991
407 Ga0207667_10012980 3300025949 Bacteria 9561
408 Ga0207667_10077987 3300025949 Bacteria 3434
409 Ga0207667_10095327 3300025949 Bacteria 3072
410 Ga0207667_10310444 3300025949 Bacteria 1611
411 Ga0207667_10507823 3300025949 Bacteria 1222
412 Ga0207667_10961565 3300025949 Bacteria 843
413 Ga0207651_10087185 3300025960 Bacteria 2271
414 Ga0207651_10328099 3300025960 Bacteria 1281
415 Ga0207712_10000579 3300025961 Bacteria 29666
416 Ga0207712_10252552 3300025961 Bacteria 1426
417 Ga0207668_10001403 3300025972 Bacteria 14194
418 Ga0207668_10005581 3300025972 Bacteria 7417
419 Ga0207668_10032114 3300025972 Bacteria 3465
420 Ga0207668_10033457 3300025972 Bacteria 3405
421 Ga0207668_10079730 3300025972 Bacteria 2369
422 Ga0207668_10481642 3300025972 Bacteria 1064
423 Ga0207640_10003644 3300025981 Bacteria 8306
424 Ga0207658_10113485 3300025986 Bacteria 2147
425 Ga0207658_10359771 3300025986 Bacteria 1269
426 Ga0207658_10372366 3300025986 Bacteria 1249
427 Ga0207658_10608626 3300025986 Unclassified 982
428 Ga0207658_10639432 3300025986 Bacteria 958
429 Ga0207703_10014416 3300026035 Bacteria 6164
430 Ga0207703_10032293 3300026035 Bacteria 4143
431 Ga0207639_10001866 3300026041 Bacteria 14170
432 Ga0207639_10117459 3300026041 Bacteria 2180
433 Ga0207639_10128563 3300026041 Bacteria 2094
434 Ga0207639_10547058 3300026041 Bacteria 1062
435 Ga0207678_10027315 3300026067 Bacteria 4977
436 Ga0207678_10033660 3300026067 Bacteria 4464
437 Ga0207678_10042596 3300026067 Bacteria 3932
438 Ga0207678_10048901 3300026067 Bacteria 3654
439 Ga0207678_10062786 3300026067 Bacteria 3193
440 Ga0207678_10080462 3300026067 Bacteria 2789
441 Ga0207678_10080882 3300026067 Bacteria 2781
442 Ga0207678_10222167 3300026067 Bacteria 1617
443 Ga0207708_10020931 3300026075 Bacteria 4935
444 Ga0207708_10023687 3300026075 Bacteria 4641
445 Ga0207708_10050635 3300026075 Bacteria 3162
446 Ga0207708_10480363 3300026075 Bacteria 1039
447 Ga0207702_10010946 3300026078 Bacteria 7566
448 Ga0207702_10257067 3300026078 Bacteria 1643
449 Ga0207702_10359494 3300026078 Bacteria 1395
450 Ga0207641_10006404 3300026088 Bacteria 9923
451 Ga0207641_10171571 3300026088 Bacteria 1980
452 Ga0207641_10315377 3300026088 Unclassified 1481
453 Ga0207648_10004627 3300026089 Bacteria 14090
454 Ga0207648_10046915 3300026089 Bacteria 3787
455 Ga0207648_10807228 3300026089 Bacteria 874
456 Ga0207676_10030863 3300026095 Bacteria 4026
457 Ga0207676_10282270 3300026095 Bacteria 1508
458 Ga0207674_10094104 3300026116 Bacteria 2983
459 Ga0207674_10112597 3300026116 Bacteria 2695
460 Ga0207674_10530319 3300026116 Bacteria 1137
461 Ga0207675_100003859 3300026118 Bacteria 14570
462 Ga0207683_10000850 3300026121 Bacteria 28050
463 Ga0207683_10051919 3300026121 Bacteria 3592
464 Ga0207683_10075790 3300026121 Bacteria 2978
465 Ga0207683_10176198 3300026121 Bacteria 1938
466 Ga0207698_10087412 3300026142 Bacteria 2539
467 Ga0207698_10089661 3300026142 Bacteria 2512
468 Ga0207698_10636350 3300026142 Bacteria 1055
469 Ga0209984_1018261 3300027424 Bacteria 947
470 Ga0210002_1003557 3300027617 Bacteria 2298
471 Ga0209998_10002588 3300027717 Bacteria 4111
472 Ga0209813_10105597 3300027866 Bacteria 964
473 Ga0209974_10003747 3300027876 Bacteria 5444
474 Ga0207428_10000164 3300027907 Bacteria 91968
475 Ga0207428_10459443 3300027907 Bacteria 928
476 Ga0268266_10012217 3300028379 Bacteria 7429
477 Ga0268266_10013853 3300028379 Bacteria 6942
478 Ga0268266_10164400 3300028379 Bacteria 2009
479 Ga0268266_10227310 3300028379 Bacteria 1717
480 Ga0268266_10363782 3300028379 Bacteria 1361
481 Ga0268266_10559329 3300028379 Bacteria 1096
482 Ga0268265_10004025 3300028380 Bacteria 10352
483 Ga0268265_10022554 3300028380 Bacteria 4425
484 Ga0268265_10079812 3300028380 Bacteria 2578
485 Ga0268264_10000174 3300028381 Bacteria 137254
486 Ga0268264_10049152 3300028381 Bacteria 3508
487 Ga0268264_10102694 3300028381 Bacteria 2488
488 Ga0268264_10158236 3300028381 Bacteria 2038
489 Ga0268264_10756675 3300028381 Bacteria 968
490 Ga0265334_10031226 3300028573 Bacteria 2130
491 Ga0307517_10000859 3300028786 Bacteria 51881
492 Ga0307511_10032093 3300030521 Bacteria 4676
493 Ga0307512_10244813 3300030522 Bacteria 902
494 Ga0265330_10052577 3300031235 Bacteria 1784
495 Ga0265332_10029296 3300031238 Bacteria 2407
496 Ga0265325_10000019 3300031241 Bacteria 125265
497 Ga0265339_10303624 3300031249 Bacteria 760
498 Ga0265331_10110613 3300031250 Bacteria 1260
499 Ga0307513_10377142 3300031456 Bacteria 1159
500 Ga0307509_10006398 3300031507 Bacteria 15864
501 Ga0307509_10082116 3300031507 Bacteria 3325
502 Ga0307408_100180430 3300031548 Bacteria 1693
503 Ga0307408_100715716 3300031548 Bacteria 901
504 Ga0265313_10067069 3300031595 Bacteria 1661
505 Ga0265313_10117892 3300031595 Bacteria 1161
506 Ga0307508_10494422 3300031616 Bacteria 817
507 Ga0307516_10059646 3300031730 Bacteria 3710
508 Ga0307516_10060402 3300031730 Bacteria 3683
509 Ga0307405_10595972 3300031731 Bacteria 901
510 Ga0307405_11002876 3300031731 Bacteria 712
511 Ga0307413_10038231 3300031824 Bacteria 2780
512 Ga0307413_10491927 3300031824 Bacteria 983
513 Ga0307407_10258970 3300031903 Bacteria 1196
514 Ga0307409_100021933 3300031995 Bacteria 4391
515 Ga0307416_100558321 3300032002 Bacteria 1219
516 Ga0307415_100004684 3300032126 Bacteria 7153
517 Ga0307507_10028588 3300033179 Bacteria 5937
518 Ga0307510_10019115 3300033180 Bacteria 8037
519 Ga0307510_10201911 3300033180 Bacteria 1522
520 Ga0315911_1000040 3300033442 Bacteria 50766
521 Ga0316215_1000931 3300033544 Bacteria 2860
522 Ga0373930_0002256 3300034816 Bacteria 2972
523 Ga0373948_0001906 3300034817 Bacteria 2989
524 Ga0373950_0013019 3300034818 Bacteria 1382
525 Ga0373959_0008747 3300034820 Bacteria 1731
526 Ga0373926_0054548 3300035083 Bacteria 1448
527 Ga0373926_0083666 3300035083 Bacteria 1182
528 Ga0373929_0006845 3300035085 Bacteria 2070
529 Ga0373929_0007992 3300035085 Bacteria 1945
530 Ga0373951_0029322 3300035091 Bacteria 1292
531 Ga0373952_0000933 3300035092 Bacteria 5313
532 Ga0373923_0003867 3300035111 Bacteria 4879
533 Ga0373923_0021124 3300035111 Bacteria 2538
534 Ga0373923_0027670 3300035111 Bacteria 2263
535 Ga0373932_0003751 3300035112 Bacteria 3626
536 Ga0373936_0006062 3300035113 Bacteria 4555
537 Ga0373936_0179144 3300035113 Bacteria 929
538 Ga0373939_0003090 3300035114 Bacteria 3908
539 Ga0373941_0013201 3300035115 Bacteria 2178
540 Ga0373953_0012482 3300035117 Bacteria 3010
541 Ga0373953_0018244 3300035117 Plasmid 2594
542 Ga0373953_0066408 3300035117 Bacteria 1482
543 Ga0373954_0000213 3300035118 Bacteria 21171
544 Ga0373954_0001219 3300035118 Bacteria 10343
545 Ga0373954_0008152 3300035118 Bacteria 4590
546 Ga0373954_0015754 3300035118 Bacteria 3381
547 Ga0373954_0349097 3300035118 Bacteria 731
548 Ga0373956_0004720 3300035119 Bacteria 5448
549 Ga0373956_0112176 3300035119 Bacteria 1270
550 Ga0373957_0003464 3300035120 Bacteria 4665
551 Ga0373957_0182082 3300035120 Bacteria 871
552 Ga0373960_0006476 3300035121 Bacteria 2749
553 Ga0373943_0005037 3300035170 Bacteria 5958
554 Ga0373943_0066209 3300035170 Bacteria 1819
555 Ga0373943_0255544 3300035170 Bacteria 985
556 Ga0373955_0002049 3300035172 Bacteria 8671
557 Ga0373955_0012895 3300035172 Plasmid 4029
558 Ga0373955_0241240 3300035172 Bacteria 1082
559 Ga0373955_0503749 3300035172 Bacteria 739
560 Ga0373942_0027318 3300035207 Bacteria 1484
561 Ga0373961_0036817 3300035241 Bacteria 1395
562 Ga0373962_0009071 3300035242 Bacteria 2457
563 Ga0373924_0007721 3300035410 Bacteria 3888
564 Ga0373924_0014698 3300035410 Bacteria 2961
565 Ga0373931_0002611 3300035691 Bacteria 8014
566 Ga0373931_0004766 3300035691 Bacteria 6220
567 Ga0373935_0000942 3300035692 Bacteria 15748
568 Ga0373935_0057406 3300035692 Unclassified 2483
569 Ga0373927_0000528 3300035695 Bacteria 29016
570 Ga0373927_0007183 3300035695 Bacteria 7558
571 Ga0373927_0064676 3300035695 Bacteria 2366
572 Ga0373927_0089359 3300035695 Bacteria 2000
573 Ga0373927_0202177 3300035695 Bacteria 1304
574 Ga0373927_0327937 3300035695 Bacteria 1008
575 Ga0373933_0010853 3300035724 Bacteria 4999
576 Ga0373933_0034817 3300035724 Plasmid 2937
577 Ga0373933_0112377 3300035724 Bacteria 1700
578 Ga0373933_0340671 3300035724 Bacteria 973
579 Ga0373947_0000455 3300035725 Bacteria 23308
580 Ga0373947_0035994 3300035725 Bacteria 2933
581 Ga0373947_0039442 3300035725 Bacteria 2810
582 Ga0373947_0091001 3300035725 Bacteria 1903
583 Ga0373947_0183995 3300035725 Bacteria 1361
584 Ga0373947_0376258 3300035725 Bacteria 955
585 Ga0373937_0004613 3300036401 Bacteria 11701
586 Ga0373937_0008188 3300036401 Bacteria 9080
587 Ga0373937_0015336 3300036401 Bacteria 6776
588 Ga0373937_0185926 3300036401 Bacteria 1951
589 Ga0373937_0485225 3300036401 Bacteria 1174
590 Ga0372808_023218 3300036459 Bacteria 891
591 Ga0373925_0003563 3300037068 Bacteria 12000
592 Ga0373925_0023694 3300037068 Bacteria 4479
593 Ga0373925_0034269 3300037068 Bacteria 3741
594 Ga0373925_0081325 3300037068 Bacteria 2463
595 Ga0373925_0085487 3300037068 Unclassified 2405
596 Ga0373925_0154434 3300037068 Bacteria 1804
597 Ga0373925_0301832 3300037068 Bacteria 1293
598 Ga0373925_0466402 3300037068 Bacteria 1035
599 Ga0395905_0077529 3300037471 Bacteria 3114
600 Ga0436364_0157539 3300037853 Bacteria 2550
601 Ga0436364_0476354 3300037853 Bacteria 863
602 Ga0436364_1289063 3300037853 Bacteria 1174
603 Ga0395901_0067053 3300038443 Bacteria 3738
604 Ga0436365_1698837 3300039437 Bacteria 869
605 Ga0436363_1437817 3300039450 Bacteria 1546
606 Ga0439465_0132882 3300041413 Bacteria 879
607 Ga0451791_0240992 3300041451 Bacteria 1064
608 Ga0451791_0284711 3300041451 Bacteria 886
609 Ga0451791_0441720 3300041451 Bacteria 774
610 Ga0451793_1400233 3300041452 Bacteria 729
611 Ga0451807_0428279 3300041486 Bacteria 994
612 Ga0451837_1412964 3300041494 Bacteria 1276
613 Ga0451853_0921849 3300041512 Bacteria 811
614 Ga0451853_4011993 3300041512 Bacteria 1075
615 Ga0466968_0247024 3300044735 Bacteria 847
616 Ga0495617_085353 3300046452 Bacteria 1033
617 Ga0495617_165209 3300046452 Bacteria 700
618 Ga0495592_0005277 3300046454 Bacteria 9521
619 Ga0495592_0021465 3300046454 Bacteria 4910
620 Ga0495592_0032569 3300046454 Bacteria 3932
621 Ga0495592_0218026 3300046454 Bacteria 1277
622 Ga0495592_0341783 3300046454 Bacteria 962
623 Ga0495603_0000239 3300046455 Bacteria 28578
624 Ga0495603_0009322 3300046455 Bacteria 5935
625 Ga0495603_0058945 3300046455 Bacteria 2269
626 Ga0495590_0068691 3300046457 Bacteria 1242
627 Ga0495629_0000457 3300046459 Bacteria 34088
628 Ga0495629_0007972 3300046459 Bacteria 7791
629 Ga0495629_0225537 3300046459 Bacteria 1292
630 Ga0495638_0021622 3300046460 Bacteria 4236
631 Ga0495638_0076101 3300046460 Bacteria 2045
632 Ga0495641_0002157 3300046461 Bacteria 15774
633 Ga0495641_0094341 3300046461 Bacteria 1337
634 Ga0495641_0209869 3300046461 Bacteria 873
635 Ga0495651_0014000 3300046462 Bacteria 6203
636 Ga0495651_0037984 3300046462 Bacteria 3749
637 Ga0495651_0054995 3300046462 Bacteria 3058
638 Ga0495651_0363524 3300046462 Bacteria 953
639 Ga0495653_0004257 3300046463 Bacteria 11596
640 Ga0495653_0009797 3300046463 Bacteria 7835
641 Ga0495653_0021824 3300046463 Bacteria 5182
642 Ga0495653_0155003 3300046463 Bacteria 1596
643 Ga0495650_0051594 3300046471 Bacteria 1694
644 Ga0495580_0002960 3300046472 Bacteria 14585
645 Ga0495580_0198659 3300046472 Bacteria 1382
646 Ga0495582_0000077 3300046473 Bacteria 49112
647 Ga0495639_0000101 3300046475 Bacteria 42348
648 Ga0495639_0095966 3300046475 Bacteria 1396
649 Ga0495639_0179661 3300046475 Unclassified 1030
650 Ga0495662_0012510 3300046476 Bacteria 4140
651 Ga0495662_0033507 3300046476 Bacteria 2481
652 Ga0495664_0005157 3300046477 Bacteria 7169
653 Ga0495664_0038052 3300046477 Plasmid 2839
654 Ga0495664_0041464 3300046477 Bacteria 2724
655 Ga0495664_0432353 3300046477 Bacteria 789
656 Ga0495664_0530360 3300046477 Bacteria 702
657 Ga0495584_0046170 3300046491 Bacteria 2197
658 Ga0495584_0108892 3300046491 Bacteria 1401
659 Ga0495585_0031320 3300046492 Bacteria 3019
660 Ga0495594_0000083 3300046499 Bacteria 42703
661 Ga0495594_0186100 3300046499 Bacteria 1182
662 Ga0495606_0000357 3300046507 Bacteria 78015
663 Ga0495606_0313024 3300046507 Bacteria 846
664 Ga0495608_0000911 3300046511 Bacteria 20725
665 Ga0495608_0004649 3300046511 Bacteria 9811
666 Ga0495616_0335648 3300046513 Bacteria 632
667 Ga0495618_0003586 3300046514 Bacteria 9613
668 Ga0495618_0014258 3300046514 Bacteria 4840
669 Ga0495628_0023578 3300046516 Bacteria 5049
670 Ga0495628_0046394 3300046516 Bacteria 3451
671 Ga0495628_0055320 3300046516 Plasmid 3125
672 Ga0495628_0062832 3300046516 Bacteria 2910
673 Ga0495630_0074877 3300046517 Bacteria 2551
674 Ga0495630_0079394 3300046517 Unclassified 2475
675 Ga0495630_0167276 3300046517 Bacteria 1674
676 Ga0495630_0268244 3300046517 Bacteria 1304
677 Ga0495632_0015464 3300046519 Bacteria 4277
678 Ga0495644_0046783 3300046523 Bacteria 1626
679 Ga0495666_0037457 3300046526 Bacteria 2359
680 Ga0495652_0021917 3300046529 Bacteria 5680
681 Ga0495652_0046433 3300046529 Bacteria 3729
682 Ga0495652_0046645 3300046529 Bacteria 3719
683 Ga0495652_0145338 3300046529 Unclassified 1859
684 Ga0495665_0000055 3300046531 Bacteria 45208
685 Ga0495640_0011661 3300046533 Bacteria 6748
686 Ga0495640_0051741 3300046533 Bacteria 2822
687 Ga0495640_0053786 3300046533 Plasmid 2759
688 Ga0495640_0169903 3300046533 Bacteria 1393
689 Ga0495640_0486452 3300046533 Bacteria 752
690 Ga0495586_0026013 3300046535 Bacteria 3131
691 Ga0495586_0590969 3300046535 Bacteria 641
692 Ga0495587_0005897 3300046536 Bacteria 7984
693 Ga0495587_0011562 3300046536 Bacteria 5588
694 Ga0495587_0015897 3300046536 Bacteria 4687
695 Ga0495587_0165550 3300046536 Bacteria 1257
696 Ga0495598_0005561 3300046537 Bacteria 2802
697 Ga0495597_0148045 3300046542 Bacteria 965
698 Ga0495645_0031846 3300046543 Bacteria 3844
699 Ga0495645_0042847 3300046543 Bacteria 3300
700 Ga0495645_0061920 3300046543 Bacteria 2711
701 Ga0495645_0331495 3300046543 Bacteria 985
702 Ga0495622_0002233 3300046557 Bacteria 9422
703 Ga0495622_0128327 3300046557 Bacteria 1155
704 Ga0495622_0162331 3300046557 Bacteria 1007
705 Ga0495633_0094045 3300046558 Bacteria 1393
706 Ga0495667_0013782 3300046559 Bacteria 5460
707 Ga0495667_0021423 3300046559 Bacteria 4361
708 Ga0495667_0023279 3300046559 Bacteria 4173
709 Ga0495667_0048600 3300046559 Bacteria 2801
710 Ga0495667_0093406 3300046559 Bacteria 1948
711 Ga0495656_0008262 3300046615 Bacteria 3711
712 Ga0495656_0308414 3300046615 Bacteria 813
713 Ga0495668_0114332 3300046616 Bacteria 1476
714 Ga0495634_0001036 3300046642 Bacteria 26033
715 Ga0495611_0063779 3300046648 Bacteria 1677
716 Ga0495625_0592842 3300046660 Bacteria 666
717 Ga0495635_0000815 3300046663 Bacteria 20434
718 Ga0495635_0004810 3300046663 Bacteria 9387
719 Ga0495635_0011194 3300046663 Bacteria 6289
720 Ga0495635_0029736 3300046663 Bacteria 3799
721 Ga0495635_0053819 3300046663 Bacteria 2772
722 Ga0495659_0004501 3300046664 Bacteria 4388
723 Ga0495588_0005058 3300046674 Bacteria 5855
724 Ga0495588_0005077 3300046674 Bacteria 5848
725 Ga0495657_0003079 3300046675 Bacteria 13781
726 Ga0495657_0034720 3300046675 Bacteria 3500
727 Ga0495657_0068646 3300046675 Bacteria 2322
728 Ga0495599_0001945 3300046678 Bacteria 11972
729 Ga0495599_0097068 3300046678 Bacteria 1837
730 Ga0495599_0156310 3300046678 Bacteria 1411
731 Ga0495623_0001015 3300046679 Bacteria 18970
732 Ga0495623_0020870 3300046679 Bacteria 4233
733 Ga0495623_0077150 3300046679 Bacteria 2066
734 Ga0495646_0001642 3300046680 Bacteria 13342
735 Ga0495646_0014188 3300046680 Bacteria 5065
736 Ga0495646_0113094 3300046680 Bacteria 1544
737 Ga0495646_0189630 3300046680 Bacteria 1124
738 Ga0495647_0067226 3300046681 Bacteria 1427
739 Ga0495658_0001572 3300046683 Bacteria 11910
740 Ga0495669_0002048 3300046684 Bacteria 8266
741 Ga0495613_0003480 3300046689 Bacteria 11777
742 Ga0495613_0078788 3300046689 Unclassified 2396
743 Ga0495613_0092005 3300046689 Bacteria 2196
744 Ga0495613_0168523 3300046689 Bacteria 1555
745 Ga0495613_0660189 3300046689 Bacteria 691
746 Ga0495624_0000235 3300046690 Bacteria 43165
747 Ga0495624_0050807 3300046690 Plasmid 2625
748 Ga0495624_0179546 3300046690 Bacteria 1290
749 Ga0495670_0192981 3300046691 Bacteria 1077
750 Ga0495671_0061334 3300046692 Bacteria 1855
751 Ga0495589_0184650 3300046794 Bacteria 988
752 Ga0495600_0012719 3300046809 Bacteria 5268
753 Ga0495600_0015287 3300046809 Bacteria 4851
754 Ga0495600_0245824 3300046809 Bacteria 1139
755 Ga0495600_0339237 3300046809 Bacteria 942
756 Ga0495600_0344774 3300046809 Bacteria 934
757 Ga0495600_0574508 3300046809 Bacteria 687
758 Ga0495581_0000041 3300047315 Bacteria 46518
759 Ga0495581_0196067 3300047315 Bacteria 1181
760 Ga0495604_0007221 3300047317 Bacteria 8800
761 Ga0495604_0272830 3300047317 Bacteria 1145
762 Ga0495674_0028002 3300047319 Bacteria 5145
763 Ga0495674_0036100 3300047319 Bacteria 4451
764 Ga0495674_0602898 3300047319 Bacteria 870
765 Ga0495676_0018550 3300047321 Bacteria 6135
766 Ga0495680_0017765 3300047322 Bacteria 6056
767 Ga0495680_0028245 3300047322 Bacteria 4600
768 Ga0495680_0154374 3300047322 Bacteria 1671
769 Ga0495680_0414882 3300047322 Bacteria 927
770 Ga0495675_0025398 3300047444 Bacteria 3777
771 Ga0495675_0048080 3300047444 Bacteria 2713
772 Ga0495677_0151369 3300047445 Bacteria 893
773 Ga0495679_093047 3300047446 Bacteria 844
774 Ga0495673_0025589 3300047469 Bacteria 2830
775 Ga0495684_0001399 3300047471 Bacteria 19329
776 Ga0495684_0028335 3300047471 Bacteria 4301
777 Ga0495684_0405869 3300047471 Bacteria 955
778 Ga0495686_0224071 3300047472 Bacteria 1068
779 Ga0495593_0000024 3300047673 Bacteria 65718
780 Ga0495593_0004938 3300047673 Bacteria 7905
781 Ga0495593_0019588 3300047673 Bacteria 3793
782 Ga0495602_0019419 3300048088 Bacteria 6748
783 Ga0495602_0035012 3300048088 Bacteria 4687
784 Ga0495602_0067291 3300048088 Bacteria 3082
785 Ga0495626_0219016 3300048091 Bacteria 774
786 Ga0496100_0032123 3300048903 Bacteria 3270
787 Ga0496100_0084124 3300048903 Bacteria 2156
788 Ga0496100_0301201 3300048903 Bacteria 1200
789 Ga0496100_0552808 3300048903 Bacteria 891
790 Ga0496101_0002275 3300048904 Bacteria 11728
791 Ga0496101_0017665 3300048904 Bacteria 4839
792 Ga0496101_0257139 3300048904 Unclassified 1361
793 Ga0496101_0290603 3300048904 Bacteria 1279
794 Ga0496101_0475822 3300048904 Unclassified 986
795 Ga0496102_0015668 3300048905 Bacteria 6604
796 Ga0496102_0022366 3300048905 Bacteria 5601
797 Ga0496102_0076164 3300048905 Bacteria 3085
798 Ga0496102_0286670 3300048905 Bacteria 1552
799 Ga0496102_0414593 3300048905 Bacteria 1265
800 Ga0496103_0019772 3300048906 Bacteria 4042
801 Ga0496103_0026671 3300048906 Bacteria 3498
802 Ga0496103_0413174 3300048906 Bacteria 866
803 Ga0496104_0047895 3300048907 Bacteria 4029
804 Ga0496104_0088890 3300048907 Bacteria 2951
805 Ga0496104_0121736 3300048907 Bacteria 2505
806 Ga0496104_0135420 3300048907 Bacteria 2366
807 Ga0496104_0249235 3300048907 Unclassified 1689
808 Ga0496104_0353360 3300048907 Bacteria 1382
809 Ga0496105_0012396 3300048908 Bacteria 6749
810 Ga0496105_0292958 3300048908 Unclassified 1310
811 Ga0496105_0827525 3300048908 Bacteria 702
812 Ga0496106_0003446 3300048909 Bacteria 11782
813 Ga0496106_0039727 3300048909 Bacteria 3524
814 Ga0496106_0058706 3300048909 Bacteria 2913
815 Ga0496106_0103687 3300048909 Unclassified 2208
816 Ga0496106_0147996 3300048909 Bacteria 1851
817 Ga0496106_0149447 3300048909 Bacteria 1842
818 Ga0496106_0267929 3300048909 Bacteria 1367
819 Ga0496106_0299272 3300048909 Bacteria 1290
820 Ga0496107_0000509 3300048910 Bacteria 21565
821 Ga0496107_0021914 3300048910 Bacteria 4514
822 Ga0496107_0055248 3300048910 Bacteria 2868
823 Ga0496107_0159541 3300048910 Bacteria 1671
824 Ga0496107_0184967 3300048910 Unclassified 1547
825 Ga0496107_0210648 3300048910 Bacteria 1445
826 Ga0496107_0397163 3300048910 Unclassified 1025
827 Ga0496108_0031275 3300048911 Bacteria 4415
828 Ga0496108_0043219 3300048911 Bacteria 3764
829 Ga0496108_0150590 3300048911 Bacteria 2007
830 Ga0496109_0026994 3300048912 Bacteria 5122
831 Ga0496109_0063752 3300048912 Bacteria 3371
832 Ga0496109_0170543 3300048912 Bacteria 2041
833 Ga0496109_0207049 3300048912 Bacteria 1844
834 Ga0496109_0241523 3300048912 Bacteria 1700
835 Ga0496109_0273602 3300048912 Bacteria 1591
836 Ga0496109_0995085 3300048912 Bacteria 776
837 Ga0496110_0033752 3300048913 Bacteria 4429
838 Ga0496110_0130718 3300048913 Bacteria 2267
839 Ga0496110_0313674 3300048913 Bacteria 1428
840 Ga0496110_0703311 3300048913 Bacteria 912
841 Ga0496110_0799685 3300048913 Bacteria 847
842 Ga0496110_0920507 3300048913 Bacteria 781
843 Ga0496111_0024753 3300048914 Bacteria 4233
844 Ga0496111_0039292 3300048914 Bacteria 3392
845 Ga0496111_0233770 3300048914 Bacteria 1365
846 Ga0496111_0348952 3300048914 Bacteria 1095
847 Ga0496111_0510088 3300048914 Bacteria 885
848 Ga0496112_0012715 3300048915 Bacteria 7740
849 Ga0496112_0048594 3300048915 Bacteria 4159
850 Ga0496112_0086667 3300048915 Bacteria 3098
851 Ga0496112_0252685 3300048915 Unclassified 1714
852 Ga0496112_0284141 3300048915 Bacteria 1601
853 Ga0496113_0002503 3300048916 Bacteria 10701
854 Ga0496113_0008294 3300048916 Bacteria 6760
855 Ga0496113_0056499 3300048916 Bacteria 2947
856 Ga0496113_0057698 3300048916 Bacteria 2919
857 Ga0496113_0533929 3300048916 Bacteria 941
858 Ga0496114_0009294 3300048917 Bacteria 7801
859 Ga0496114_0048418 3300048917 Bacteria 3536
860 Ga0496114_0079135 3300048917 Bacteria 2774
861 Ga0496114_0401699 3300048917 Bacteria 1213
862 Ga0496115_0045511 3300048918 Bacteria 3504
863 Ga0496115_0059345 3300048918 Bacteria 3081
864 Ga0496115_0106674 3300048918 Unclassified 2300
865 Ga0496115_0133773 3300048918 Bacteria 2044
866 Ga0496115_0266420 3300048918 Bacteria 1408
867 Ga0496117_0238499 3300048920 Bacteria 1000
868 Ga0496119_0047619 3300048922 Bacteria 2666
869 Ga0496121_0000927 3300048924 Bacteria 53016
870 Ga0496121_0095423 3300048924 Bacteria 2311
871 Ga0496121_0151137 3300048924 Bacteria 1708
872 Ga0496121_0203641 3300048924 Bacteria 1408
873 Ga0496124_0233805 3300048927 Bacteria 1372
874 Ga0496126_0060792 3300048929 Bacteria 3396
875 Ga0496126_0082014 3300048929 Bacteria 2850
876 Ga0496126_0378771 3300048929 Bacteria 1152
877 Ga0496126_0570173 3300048929 Bacteria 896
878 Ga0496126_0726628 3300048929 Bacteria 769
879 Ga0501032_0139342 3300049569 Bacteria 1598
880 Ga0501043_0280819 3300049579 Bacteria 1276
881 Ga0501046_0060334 3300049580 Bacteria 2968
882 Ga0501047_0014411 3300049581 Bacteria 7517
883 Ga0501067_0039577 3300049583 Bacteria 2618
884 Ga0501070_0006598 3300049586 Bacteria 9876
885 Ga0501044_0005514 3300049823 Bacteria 14047
886 Ga0501044_0209640 3300049823 Unclassified 1903
887 nmdc:mga00v17_297583_c1 3300050491 Bacteria 1048
888 nmdc:mga0yw44_13282_c1 3300050492 Bacteria 4330
889 nmdc:mga0yw44_168291_c1 3300050492 Bacteria 1438
890 nmdc:mga0yw44_211928_c1 3300050492 Bacteria 1282
891 nmdc:mga0yw44_285890_c1 3300050492 Bacteria 1103
892 nmdc:mga0k408_292622_c1 3300050493 Bacteria 972
893 nmdc:mga06z11_151224_c1 3300050494 Bacteria 1320
894 nmdc:mga06z11_45147_c1 3300050494 Bacteria 1399
895 nmdc:mga06z11_84370_c1 3300050494 Bacteria 1712
896 nmdc:mga04h51_9301_c1 3300050495 Bacteria 2658
897 nmdc:mga07m45_8848_c1 3300050496 Bacteria 5195
898 nmdc:mga07m45_94518_c1 3300050496 Bacteria 1714
899 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
900 nmdc:mga08y16_191984_c1 3300050511 Bacteria 2118
901 nmdc:mga08y16_366135_c1 3300050511 Bacteria 1479
902 nmdc:mga0n895_121255_c1 3300050512 Bacteria 2636
903 nmdc:mga0n895_216385_c1 3300050512 Unclassified 1945
904 nmdc:mga0n895_37633_c1 3300050512 Bacteria 4682
905 nmdc:mga0rr50_537400_c1 3300050513 Bacteria 995
906 nmdc:mga08x19_396636_c1 3300050514 Bacteria 967
907 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
908 nmdc:mga0a205_206208_c1 3300050515 Bacteria 1855
909 nmdc:mga0sz30_114689_c1 3300050516 Bacteria 1182
910 Ga0495601_0009169 3300053077 Bacteria 5846
911 Ga0495601_0141831 3300053077 Unclassified 1567
912 Ga0495601_0173060 3300053077 Bacteria 1411
913 Ga0495601_0249003 3300053077 Bacteria 1160
914 Ga0495601_0250303 3300053077 Bacteria 1157
915 Ga0495612_0193999 3300053078 Bacteria 894
916 Ga0500635_0001974 3300053080 Bacteria 5009
917 Ga0500635_0031249 3300053080 Bacteria 1722
918 Ga0495595_0000554 3300053084 Bacteria 14279
919 Ga0495595_0000637 3300053084 Bacteria 13319
920 Ga0495619_0001080 3300053085 Bacteria 17897
921 Ga0495619_0425381 3300053085 Bacteria 916
922 Ga0500578_0445488 3300053086 Bacteria 738
923 Ga0500647_0195221 3300053091 Bacteria 921
924 Ga0500583_0009184 3300053092 Bacteria 3598
925 Ga0500583_0051691 3300053092 Bacteria 1910
926 Ga0500641_0005024 3300053096 Bacteria 4691
927 Ga0500641_0024967 3300053096 Bacteria 2309
928 Ga0500641_0133006 3300053096 Bacteria 1073
929 Ga0500648_100720 3300053097 Bacteria 1607
930 Ga0500595_001951 3300053119 Bacteria 10615
931 Ga0500595_026055 3300053119 Bacteria 2020
932 Ga0500658_0145563 3300053134 Bacteria 1065
933 Ga0500658_0147074 3300053134 Bacteria 1060
934 Ga0500559_0015190 3300053136 Bacteria 3253
935 Ga0500568_0006709 3300053139 Bacteria 5754
936 Ga0500568_0096636 3300053139 Bacteria 1111
937 Ga0500573_0008543 3300053140 Bacteria 5644
938 Ga0500588_0013956 3300053146 Bacteria 2025
939 Ga0500588_0129991 3300053146 Bacteria 896
940 Ga0500589_021876 3300053147 Bacteria 2937
941 Ga0500589_042286 3300053147 Bacteria 2125
942 Ga0500590_093943 3300053148 Bacteria 1452
943 Ga0500603_000226 3300053150 Bacteria 14827
944 Ga0500622_0248361 3300053156 Bacteria 782
945 Ga0500634_0075126 3300053161 Bacteria 1758
946 Ga0500634_0091011 3300053161 Bacteria 1548
947 Ga0500639_048715 3300053163 Bacteria 2212
948 Ga0500636_0013138 3300053177 Bacteria 4858
949 Ga0500637_0003349 3300053178 Bacteria 7387
950 Ga0500637_0165132 3300053178 Bacteria 1274
951 Ga0500645_012764 3300053730 Bacteria 2712
952 Ga0500596_003281 3300053735 Bacteria 3099

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100062605 Ga0070712_1000626053 167
2 3300006028 Ga0070717_10082660 Ga0070717_100826603 172
3 3300021388 Ga0213875_10034248 Ga0213875_100342483 173
4 3300037853 Ga0436364_0157539 Ga0436364_0157539_489_1115 173
5 3300048929 Ga0496126_0378771 Ga0496126_0378771_416_1045 173
6 3300009098 Ga0105245_10014034 Ga0105245_100140346 174
7 3300009101 Ga0105247_10167620 Ga0105247_101676202 174
8 3300009174 Ga0105241_10649305 Ga0105241_106493052 174
9 3300009177 Ga0105248_10029891 Ga0105248_100298915 174
10 3300011119 Ga0105246_10032205 Ga0105246_100322052 174
11 3300025911 Ga0207654_10401528 Ga0207654_104015282 174
12 3300048909 Ga0496106_0299272 Ga0496106_0299272_156_755 174
13 3300048910 Ga0496107_0159541 Ga0496107_0159541_271_870 174
14 3300048912 Ga0496109_0207049 Ga0496109_0207049_502_1101 174
15 3300050492 nmdc:mga0yw44_285890_c1 nmdc:mga0yw44_285890_c1_184_783 174
16 3300050494 nmdc:mga06z11_84370_c1 nmdc:mga06z11_84370_c1_843_1442 174
17 3300050514 nmdc:mga08x19_396636_c1 nmdc:mga08x19_396636_c1_318_917 174
18 3300033442 Ga0315911_1000040 Ga0315911_10000408 175
19 3300048929 Ga0496126_0726628 Ga0496126_0726628_96_704 175
20 3300005339 Ga0070660_100034303 Ga0070660_1000343033 177
21 3300005340 Ga0070689_100327516 Ga0070689_1003275161 177
22 3300005347 Ga0070668_100036445 Ga0070668_1000364452 177
23 3300005366 Ga0070659_100079331 Ga0070659_1000793313 177
24 3300005367 Ga0070667_100731541 Ga0070667_1007315411 177
25 3300005539 Ga0068853_100060238 Ga0068853_1000602384 177
26 3300005548 Ga0070665_100579006 Ga0070665_1005790062 177
27 3300005563 Ga0068855_100099837 Ga0068855_1000998372 177
28 3300005577 Ga0068857_100124799 Ga0068857_1001247993 177
29 3300005578 Ga0068854_100246521 Ga0068854_1002465212 177
30 3300005719 Ga0068861_100111473 Ga0068861_1001114732 177
31 3300005842 Ga0068858_100079901 Ga0068858_1000799013 177
32 3300005843 Ga0068860_100192601 Ga0068860_1001926012 177
33 3300006048 Ga0075363_100005067 Ga0075363_1000050673 177
34 3300006178 Ga0075367_10021083 Ga0075367_100210832 177
35 3300006195 Ga0075366_10027167 Ga0075366_100271674 177
36 3300006237 Ga0097621_100053560 Ga0097621_1000535605 177
37 3300025901 Ga0207688_10094545 Ga0207688_100945451 177
38 3300025907 Ga0207645_10194083 Ga0207645_101940831 177
39 3300025914 Ga0207671_10077969 Ga0207671_100779692 177
40 3300025919 Ga0207657_10044766 Ga0207657_100447663 177
41 3300025925 Ga0207650_10669745 Ga0207650_106697451 177
42 3300025927 Ga0207687_10002549 Ga0207687_1000254911 177
43 3300025931 Ga0207644_10066815 Ga0207644_100668151 177
44 3300025932 Ga0207690_10310657 Ga0207690_103106572 177
45 3300025936 Ga0207670_10406048 Ga0207670_104060482 177
46 3300025941 Ga0207711_10218792 Ga0207711_102187922 177
47 3300025942 Ga0207689_10049010 Ga0207689_100490102 177
48 3300025972 Ga0207668_10005581 Ga0207668_100055815 177
49 3300025986 Ga0207658_10639432 Ga0207658_106394322 177
50 3300026035 Ga0207703_10032293 Ga0207703_100322935 177
51 3300026041 Ga0207639_10117459 Ga0207639_101174592 177
52 3300026067 Ga0207678_10033660 Ga0207678_100336602 177
53 3300026078 Ga0207702_10359494 Ga0207702_103594942 177
54 3300026088 Ga0207641_10171571 Ga0207641_101715712 177
55 3300026116 Ga0207674_10094104 Ga0207674_100941043 177
56 3300026121 Ga0207683_10075790 Ga0207683_100757902 177
57 3300028379 Ga0268266_10164400 Ga0268266_101644002 177
58 3300048903 Ga0496100_0552808 Ga0496100_0552808_161_787 177
59 3300048914 Ga0496111_0233770 Ga0496111_0233770_500_1126 177
60 3300048916 Ga0496113_0057698 Ga0496113_0057698_230_856 177
61 3300048909 Ga0496106_0267929 Ga0496106_0267929_74_694 178
62 3300048917 Ga0496114_0079135 Ga0496114_0079135_1438_2004 178
63 3300035117 Ga0373953_0066408 Ga0373953_0066408_911_1468 180
64 3300035172 Ga0373955_0503749 Ga0373955_0503749_70_627 180
65 3300046459 Ga0495629_0225537 Ga0495629_0225537_706_1281 180
66 3300046535 Ga0495586_0590969 Ga0495586_0590969_15_572 180
67 3300048918 Ga0496115_0266420 Ga0496115_0266420_329_901 180
68 3300025261 Ga0209233_1005084 Ga0209233_10050843 181
69 3300041451 Ga0451791_0441720 Ga0451791_0441720_26_619 182
70 3300006173 Ga0070716_100235027 Ga0070716_1002350272 183
71 3300013297 Ga0157378_10086387 Ga0157378_100863872 183
72 3300013306 Ga0163162_10602920 Ga0163162_106029201 183
73 3300035118 Ga0373954_0349097 Ga0373954_0349097_105_683 183
74 3300048910 Ga0496107_0210648 Ga0496107_0210648_396_1022 183
75 3300005440 Ga0070705_100215842 Ga0070705_1002158422 184
76 3300005615 Ga0070702_100091658 Ga0070702_1000916583 184
77 3300005841 Ga0068863_100142125 Ga0068863_1001421252 184
78 3300005983 Ga0081540_1012946 Ga0081540_10129464 184
79 3300014969 Ga0157376_10135746 Ga0157376_101357462 184
80 3300026088 Ga0207641_10315377 Ga0207641_103153771 184
81 3300035111 Ga0373923_0003867 Ga0373923_0003867_2370_2975 184
82 3300035117 Ga0373953_0012482 Ga0373953_0012482_1914_2519 184
83 3300035118 Ga0373954_0008152 Ga0373954_0008152_2931_3536 184
84 3300035119 Ga0373956_0004720 Ga0373956_0004720_2111_2716 184
85 3300035172 Ga0373955_0002049 Ga0373955_0002049_1893_2498 184
86 3300035410 Ga0373924_0014698 Ga0373924_0014698_369_974 184
87 3300035724 Ga0373933_0010853 Ga0373933_0010853_2078_2683 184
88 3300036401 Ga0373937_0008188 Ga0373937_0008188_3748_4353 184
89 3300046454 Ga0495592_0021465 Ga0495592_0021465_1452_2057 184
90 3300046459 Ga0495629_0007972 Ga0495629_0007972_6543_7148 184
91 3300046462 Ga0495651_0054995 Ga0495651_0054995_1055_1660 184
92 3300046463 Ga0495653_0009797 Ga0495653_0009797_1912_2517 184
93 3300046511 Ga0495608_0004649 Ga0495608_0004649_2098_2703 184
94 3300046516 Ga0495628_0046394 Ga0495628_0046394_2446_3051 184
95 3300046529 Ga0495652_0046433 Ga0495652_0046433_1942_2547 184
96 3300046533 Ga0495640_0011661 Ga0495640_0011661_2004_2609 184
97 3300046536 Ga0495587_0015897 Ga0495587_0015897_2317_2922 184
98 3300046543 Ga0495645_0061920 Ga0495645_0061920_347_952 184
99 3300046559 Ga0495667_0021423 Ga0495667_0021423_2574_3179 184
100 3300046663 Ga0495635_0004810 Ga0495635_0004810_7236_7841 184
101 3300046675 Ga0495657_0003079 Ga0495657_0003079_9191_9796 184
102 3300046678 Ga0495599_0001945 Ga0495599_0001945_2173_2778 184
103 3300046679 Ga0495623_0020870 Ga0495623_0020870_2574_3179 184
104 3300046680 Ga0495646_0001642 Ga0495646_0001642_1415_2020 184
105 3300046689 Ga0495613_0092005 Ga0495613_0092005_119_724 184
106 3300046809 Ga0495600_0012719 Ga0495600_0012719_1055_1660 184
107 3300047317 Ga0495604_0007221 Ga0495604_0007221_5191_5796 184
108 3300047319 Ga0495674_0028002 Ga0495674_0028002_2478_3083 184
109 3300047322 Ga0495680_0017765 Ga0495680_0017765_2446_3051 184
110 3300047444 Ga0495675_0048080 Ga0495675_0048080_167_772 184
111 3300047471 Ga0495684_0001399 Ga0495684_0001399_6543_7148 184
112 3300047673 Ga0495593_0004938 Ga0495593_0004938_2572_3177 184
113 3300048088 Ga0495602_0035012 Ga0495602_0035012_2317_2922 184
114 3300048903 Ga0496100_0084124 Ga0496100_0084124_459_1061 184
115 3300048904 Ga0496101_0475822 Ga0496101_0475822_44_646 184
116 3300048907 Ga0496104_0249235 Ga0496104_0249235_54_656 184
117 3300048907 Ga0496104_0353360 Ga0496104_0353360_98_700 184
118 3300048908 Ga0496105_0827525 Ga0496105_0827525_47_649 184
119 3300048909 Ga0496106_0103687 Ga0496106_0103687_1145_1747 184
120 3300048918 Ga0496115_0106674 Ga0496115_0106674_1428_2030 184
121 3300049569 Ga0501032_0139342 Ga0501032_0139342_612_1217 184
122 3300049579 Ga0501043_0280819 Ga0501043_0280819_234_839 184
123 3300049580 Ga0501046_0060334 Ga0501046_0060334_2029_2634 184
124 3300049581 Ga0501047_0014411 Ga0501047_0014411_4783_5388 184
125 3300049586 Ga0501070_0006598 Ga0501070_0006598_6185_6790 184
126 3300049823 Ga0501044_0005514 Ga0501044_0005514_440_1045 184
127 3300049823 Ga0501044_0209640 Ga0501044_0209640_265_870 184
128 3300053077 Ga0495601_0009169 Ga0495601_0009169_1783_2388 184
129 3300053084 Ga0495595_0000637 Ga0495595_0000637_10426_11031 184
130 3300053085 Ga0495619_0001080 Ga0495619_0001080_5319_5924 184
131 3300005336 Ga0070680_100226621 Ga0070680_1002266212 185
132 3300006852 Ga0075433_10201324 Ga0075433_102013242 185
133 3300006871 Ga0075434_100021009 Ga0075434_1000210093 185
134 3300025949 Ga0207667_10961565 Ga0207667_109615651 185
135 3300035725 Ga0373947_0183995 Ga0373947_0183995_447_1034 185
136 3300037068 Ga0373925_0034269 Ga0373925_0034269_395_982 185
137 3300037068 Ga0373925_0154434 Ga0373925_0154434_1145_1732 185
138 3300046472 Ga0495580_0198659 Ga0495580_0198659_583_1170 185
139 3300046516 Ga0495628_0023578 Ga0495628_0023578_4435_5037 185
140 3300046529 Ga0495652_0046645 Ga0495652_0046645_2164_2751 185
141 3300046543 Ga0495645_0031846 Ga0495645_0031846_1285_1872 185
142 3300046681 Ga0495647_0067226 Ga0495647_0067226_174_761 185
143 3300046689 Ga0495613_0168523 Ga0495613_0168523_535_1122 185
144 3300046690 Ga0495624_0179546 Ga0495624_0179546_415_1002 185
145 3300046809 Ga0495600_0245824 Ga0495600_0245824_526_1113 185
146 3300047315 Ga0495581_0196067 Ga0495581_0196067_98_685 185
147 3300047471 Ga0495684_0405869 Ga0495684_0405869_94_681 185
148 3300048915 Ga0496112_0252685 Ga0496112_0252685_721_1329 185
149 3300050511 nmdc:mga08y16_191984_c1 nmdc:mga08y16_191984_c1_1376_1978 185
150 3300050512 nmdc:mga0n895_121255_c1 nmdc:mga0n895_121255_c1_1872_2474 185
151 3300050515 nmdc:mga0a205_206208_c1 nmdc:mga0a205_206208_c1_713_1315 185
152 3300005336 Ga0070680_100205891 Ga0070680_1002058912 186
153 3300005339 Ga0070660_100375198 Ga0070660_1003751981 186
154 3300005445 Ga0070708_100767105 Ga0070708_1007671052 186
155 3300005455 Ga0070663_100679161 Ga0070663_1006791611 186
156 3300005458 Ga0070681_10475268 Ga0070681_104752681 186
157 3300005937 Ga0081455_10051904 Ga0081455_100519042 186
158 3300005983 Ga0081540_1070985 Ga0081540_10709853 186
159 3300009176 Ga0105242_10204421 Ga0105242_102044212 186
160 3300010159 Ga0099796_10055610 Ga0099796_100556102 186
161 3300010375 Ga0105239_10053470 Ga0105239_100534702 186
162 3300010375 Ga0105239_10783691 Ga0105239_107836911 186
163 3300013104 Ga0157370_10101962 Ga0157370_101019622 186
164 3300014968 Ga0157379_10848577 Ga0157379_108485771 186
165 3300025917 Ga0207660_10294273 Ga0207660_102942732 186
166 3300025919 Ga0207657_10546461 Ga0207657_105464611 186
167 3300025949 Ga0207667_10095327 Ga0207667_100953274 186
168 3300031548 Ga0307408_100180430 Ga0307408_1001804302 186
169 3300035083 Ga0373926_0054548 Ga0373926_0054548_95_697 186
170 3300035118 Ga0373954_0000213 Ga0373954_0000213_13345_13947 186
171 3300035118 Ga0373954_0015754 Ga0373954_0015754_1618_2226 186
172 3300035119 Ga0373956_0112176 Ga0373956_0112176_170_796 186
173 3300035120 Ga0373957_0182082 Ga0373957_0182082_63_671 186
174 3300035172 Ga0373955_0241240 Ga0373955_0241240_373_999 186
175 3300035695 Ga0373927_0089359 Ga0373927_0089359_1218_1826 186
176 3300035724 Ga0373933_0340671 Ga0373933_0340671_238_864 186
177 3300035725 Ga0373947_0035994 Ga0373947_0035994_138_746 186
178 3300036401 Ga0373937_0004613 Ga0373937_0004613_6547_7173 186
179 3300037068 Ga0373925_0466402 Ga0373925_0466402_316_930 186
180 3300037471 Ga0395905_0077529 Ga0395905_0077529_1424_2035 186
181 3300037853 Ga0436364_0476354 Ga0436364_0476354_184_792 186
182 3300038443 Ga0395901_0067053 Ga0395901_0067053_1786_2397 186
183 3300039437 Ga0436365_1698837 Ga0436365_1698837_234_845 186
184 3300039450 Ga0436363_1437817 Ga0436363_1437817_152_775 186
185 3300041451 Ga0451791_0284711 Ga0451791_0284711_21_620 186
186 3300041512 Ga0451853_0921849 Ga0451853_0921849_87_686 186
187 3300044735 Ga0466968_0247024 Ga0466968_0247024_134_748 186
188 3300046452 Ga0495617_085353 Ga0495617_085353_358_957 186
189 3300046454 Ga0495592_0218026 Ga0495592_0218026_197_805 186
190 3300046460 Ga0495638_0021622 Ga0495638_0021622_3485_4084 186
191 3300046460 Ga0495638_0076101 Ga0495638_0076101_56_661 186
192 3300046462 Ga0495651_0037984 Ga0495651_0037984_278_886 186
193 3300046463 Ga0495653_0021824 Ga0495653_0021824_261_848 186
194 3300046463 Ga0495653_0155003 Ga0495653_0155003_952_1560 186
195 3300046476 Ga0495662_0033507 Ga0495662_0033507_1578_2165 186
196 3300046477 Ga0495664_0005157 Ga0495664_0005157_2150_2737 186
197 3300046477 Ga0495664_0432353 Ga0495664_0432353_110_724 186
198 3300046477 Ga0495664_0530360 Ga0495664_0530360_64_672 186
199 3300046491 Ga0495584_0108892 Ga0495584_0108892_755_1354 186
200 3300046507 Ga0495606_0313024 Ga0495606_0313024_17_616 186
201 3300046513 Ga0495616_0335648 Ga0495616_0335648_20_619 186
202 3300046514 Ga0495618_0014258 Ga0495618_0014258_2334_2942 186
203 3300046533 Ga0495640_0051741 Ga0495640_0051741_2208_2795 186
204 3300046533 Ga0495640_0169903 Ga0495640_0169903_528_1136 186
205 3300046533 Ga0495640_0486452 Ga0495640_0486452_71_685 186
206 3300046536 Ga0495587_0005897 Ga0495587_0005897_6045_6653 186
207 3300046558 Ga0495633_0094045 Ga0495633_0094045_450_1049 186
208 3300046615 Ga0495656_0308414 Ga0495656_0308414_115_717 186
209 3300046648 Ga0495611_0063779 Ga0495611_0063779_59_658 186
210 3300046663 Ga0495635_0029736 Ga0495635_0029736_2942_3550 186
211 3300046663 Ga0495635_0053819 Ga0495635_0053819_2158_2745 186
212 3300046675 Ga0495657_0068646 Ga0495657_0068646_65_673 186
213 3300046678 Ga0495599_0156310 Ga0495599_0156310_564_1151 186
214 3300046679 Ga0495623_0077150 Ga0495623_0077150_1395_2003 186
215 3300046680 Ga0495646_0113094 Ga0495646_0113094_250_837 186
216 3300046689 Ga0495613_0660189 Ga0495613_0660189_36_644 186
217 3300046809 Ga0495600_0339237 Ga0495600_0339237_129_737 186
218 3300046809 Ga0495600_0344774 Ga0495600_0344774_278_892 186
219 3300046809 Ga0495600_0574508 Ga0495600_0574508_41_655 186
220 3300047317 Ga0495604_0272830 Ga0495604_0272830_43_630 186
221 3300047322 Ga0495680_0154374 Ga0495680_0154374_1018_1626 186
222 3300047471 Ga0495684_0028335 Ga0495684_0028335_358_945 186
223 3300047472 Ga0495686_0224071 Ga0495686_0224071_372_971 186
224 3300048088 Ga0495602_0067291 Ga0495602_0067291_2389_2997 186
225 3300048904 Ga0496101_0290603 Ga0496101_0290603_12_611 186
226 3300048914 Ga0496111_0510088 Ga0496111_0510088_212_811 186
227 3300048924 Ga0496121_0095423 Ga0496121_0095423_320_919 186
228 3300048924 Ga0496121_0151137 Ga0496121_0151137_231_830 186
229 3300048929 Ga0496126_0060792 Ga0496126_0060792_1822_2421 186
230 3300048929 Ga0496126_0570173 Ga0496126_0570173_237_851 186
231 3300050492 nmdc:mga0yw44_168291_c1 nmdc:mga0yw44_168291_c1_140_739 186
232 3300050495 nmdc:mga04h51_9301_c1 nmdc:mga04h51_9301_c1_27_626 186
233 3300050496 nmdc:mga07m45_94518_c1 nmdc:mga07m45_94518_c1_433_1032 186
234 3300050511 nmdc:mga08y16_366135_c1 nmdc:mga08y16_366135_c1_727_1326 186
235 3300053077 Ga0495601_0173060 Ga0495601_0173060_579_1187 186
236 3300053077 Ga0495601_0249003 Ga0495601_0249003_217_819 186
237 3300053078 Ga0495612_0193999 Ga0495612_0193999_11_598 186
238 3300053086 Ga0500578_0445488 Ga0500578_0445488_58_663 186
239 3300053091 Ga0500647_0195221 Ga0500647_0195221_259_873 186
240 3300053092 Ga0500583_0009184 Ga0500583_0009184_2246_2845 186
241 3300053092 Ga0500583_0051691 Ga0500583_0051691_33_632 186
242 3300053096 Ga0500641_0005024 Ga0500641_0005024_2577_3176 186
243 3300053096 Ga0500641_0024967 Ga0500641_0024967_103_702 186
244 3300053097 Ga0500648_100720 Ga0500648_100720_238_852 186
245 3300053119 Ga0500595_001951 Ga0500595_001951_1078_1677 186
246 3300053134 Ga0500658_0145563 Ga0500658_0145563_106_705 186
247 3300053134 Ga0500658_0147074 Ga0500658_0147074_120_719 186
248 3300053136 Ga0500559_0015190 Ga0500559_0015190_1019_1633 186
249 3300053139 Ga0500568_0006709 Ga0500568_0006709_4340_4948 186
250 3300053140 Ga0500573_0008543 Ga0500573_0008543_529_1143 186
251 3300053146 Ga0500588_0129991 Ga0500588_0129991_60_665 186
252 3300053147 Ga0500589_042286 Ga0500589_042286_1424_2023 186
253 3300053156 Ga0500622_0248361 Ga0500622_0248361_136_753 186
254 3300053161 Ga0500634_0075126 Ga0500634_0075126_413_1012 186
255 3300053161 Ga0500634_0091011 Ga0500634_0091011_713_1312 186
256 3300053177 Ga0500636_0013138 Ga0500636_0013138_3300_3914 186
257 3300053735 Ga0500596_003281 Ga0500596_003281_1676_2290 186
258 iso_pu_bacteria 2507262055 2507511875 186
259 iso_pu_bacteria 2508501009 2508545539 186
260 iso_pu_bacteria 2508501042 2508694357 186
261 iso_pu_bacteria 2513237096 2513659240 186
262 iso_pu_bacteria 2513237101 2513696314 186
263 iso_pu_bacteria 2513237137 2513859039 186
264 iso_pu_bacteria 2513237141 2513887727 186
265 iso_pu_bacteria 2513237145 2513921880 186
266 iso_pu_bacteria 2515154112 2515624712 186
267 iso_pu_bacteria 2517572143 2517895961 186
268 iso_pu_bacteria 2667528175 2671122755 186
269 iso_pu_bacteria 2721755755 2723842810 186
270 iso_pu_bacteria 2728368998 2728752344 186
271 iso_pu_bacteria 2791355197 2793069609 186
272 iso_pu_bacteria 2791355199 2793080288 186
273 iso_pu_bacteria 2874590934 2874592255 186
274 iso_pu_bacteria 2874604998 2874606516 186
275 iso_pu_bacteria 2874645413 2874647371 186
276 iso_pu_bacteria 2876771140 2876774782 186
277 iso_pu_bacteria 2876808645 2876809827 186
278 iso_pu_bacteria 2876818435 2876819735 186
279 iso_pu_bacteria 2879074833 2879079350 186
280 iso_pu_bacteria 2879110137 2879113774 186
281 iso_pu_bacteria 2879127579 2879129084 186
282 iso_pu_bacteria 2879142872 2879144761 186
283 iso_pu_bacteria 2885374607 2885382988 186
284 iso_pu_bacteria 2889033259 2889033863 186
285 iso_pu_bacteria 2903748898 2903756065 186
286 iso_pu_bacteria 2904690495 2904699113 186
287 iso_pu_bacteria 2904699407 2904707116 186
288 iso_pu_bacteria 2906610324 2906615569 186
289 iso_pu_bacteria 2906635258 2906642017 186
290 iso_pu_bacteria 2906660503 2906665003 186
291 iso_pu_bacteria 2908739725 2908745610 186
292 iso_pu_bacteria 2908756301 2908763682 186
293 iso_pu_bacteria 2922361189 2922367285 186
294 iso_pu_bacteria 2922386360 2922390011 186
295 iso_pu_bacteria 2922425934 2922432436 186
296 iso_pu_bacteria 2935630451 2935630750 186
297 iso_pu_bacteria 2935648319 2935650478 186
298 iso_pu_bacteria 2935656913 2935662920 186
299 iso_pu_bacteria 2935908558 2935911235 186
300 iso_pu_bacteria 2935916978 2935920767 186
301 iso_pu_bacteria 2935926038 2935928264 186
302 iso_pu_bacteria 2935934488 2935937909 186
303 iso_pu_bacteria 2935942939 2935945191 186
304 iso_pu_bacteria 2935951376 2935954303 186
305 iso_pu_bacteria 2935967501 2935971429 186
306 iso_pu_bacteria 2935975950 2935982049 186
307 iso_pu_bacteria 2935984226 2935990612 186
308 iso_pu_bacteria 2936011229 2936017166 186
309 iso_pu_bacteria 2936019824 2936026699 186
310 iso_pu_bacteria 2936028420 2936035442 186
311 iso_pu_bacteria 2936046547 2936053591 186
312 iso_pu_bacteria 2936055302 2936062669 186
313 iso_pu_bacteria 2941507105 2941507402 186
314 iso_pu_bacteria 2941515067 2941515829 186
315 iso_pu_bacteria 2941523033 2941523463 186
316 iso_pu_bacteria 3005474847 3005476602 186
317 iso_pu_bacteria 8006933436 8006934884 186
318 iso_pu_bacteria 8006964411 8006966127 186
319 iso_pu_bacteria 8006973647 8006974852 186
320 iso_pu_bacteria 8006984368 8006989710 186
321 iso_pu_bacteria 8006994254 8006998097 186
322 iso_pu_bacteria 8019555841 8019563775 186
323 iso_pu_bacteria 8019565922 8019573840 186
324 iso_pu_bacteria 8019619141 8019624152 186
325 iso_pu_bacteria 8019629233 8019637875 186
326 iso_pu_bacteria 8019638758 8019641749 186
327 iso_pu_bacteria 8019659431 8019665804 186
328 iso_pu_bacteria 8019668869 8019675330 186
329 iso_pu_bacteria 8019678201 8019680775 186
330 iso_pu_bacteria 8019687851 8019694993 186
331 iso_pu_bacteria 8056673599 8056675121 186
332 iso_pu_bacteria 8056689827 8056696202 186
333 3300005439 Ga0070711_100077792 Ga0070711_1000777922 187
334 3300031241 Ga0265325_10000019 Ga0265325_1000001958 187
335 3300031595 Ga0265313_10067069 Ga0265313_100670692 187
336 3300035170 Ga0373943_0066209 Ga0373943_0066209_325_942 187
337 3300035695 Ga0373927_0007183 Ga0373927_0007183_4354_4959 187
338 3300035695 Ga0373927_0064676 Ga0373927_0064676_17_622 187
339 3300037068 Ga0373925_0023694 Ga0373925_0023694_1483_2088 187
340 3300046517 Ga0495630_0074877 Ga0495630_0074877_1575_2180 187
341 3300048907 Ga0496104_0047895 Ga0496104_0047895_1915_2538 187
342 3300005353 Ga0070669_100434671 Ga0070669_1004346712 188
343 3300005355 Ga0070671_100441341 Ga0070671_1004413412 188
344 3300005437 Ga0070710_10106609 Ga0070710_101066092 188
345 3300005439 Ga0070711_100591894 Ga0070711_1005918941 188
346 3300006881 Ga0068865_100216332 Ga0068865_1002163323 188
347 3300009148 Ga0105243_10162608 Ga0105243_101626082 188
348 3300009551 Ga0105238_10935501 Ga0105238_109355011 188
349 3300025898 Ga0207692_10092310 Ga0207692_100923102 188
350 3300025915 Ga0207693_10018708 Ga0207693_100187085 188
351 3300025916 Ga0207663_10132464 Ga0207663_101324642 188
352 3300025931 Ga0207644_10365892 Ga0207644_103658921 188
353 3300025935 Ga0207709_10688635 Ga0207709_106886352 188
354 3300025939 Ga0207665_10198325 Ga0207665_101983252 188
355 3300025961 Ga0207712_10252552 Ga0207712_102525522 188
356 3300028573 Ga0265334_10031226 Ga0265334_100312262 188
357 3300031235 Ga0265330_10052577 Ga0265330_100525772 188
358 3300031238 Ga0265332_10029296 Ga0265332_100292962 188
359 3300031249 Ga0265339_10303624 Ga0265339_103036241 188
360 3300031250 Ga0265331_10110613 Ga0265331_101106132 188
361 3300031595 Ga0265313_10117892 Ga0265313_101178921 188
362 3300036459 Ga0372808_023218 Ga0372808_023218_96_728 188
363 3300046454 Ga0495592_0341783 Ga0495592_0341783_194_820 188
364 3300046536 Ga0495587_0165550 Ga0495587_0165550_360_986 188
365 3300048903 Ga0496100_0032123 Ga0496100_0032123_1060_1686 188
366 3300048904 Ga0496101_0017665 Ga0496101_0017665_3853_4479 188
367 3300048909 Ga0496106_0149447 Ga0496106_0149447_368_994 188
368 3300048918 Ga0496115_0045511 Ga0496115_0045511_270_896 188
369 3300053077 Ga0495601_0250303 Ga0495601_0250303_344_970 188
370 3300001430 JGI24032J14994_100531 JGI24032J14994_1005311 189
371 3300001989 JGI24739J22299_10000871 JGI24739J22299_1000087112 189
372 3300001990 JGI24737J22298_10010529 JGI24737J22298_100105293 189
373 3300002070 JGI24750J21931_1009691 JGI24750J21931_10096911 189
374 3300002074 JGI24748J21848_1006767 JGI24748J21848_10067671 189
375 3300002075 JGI24738J21930_10002474 JGI24738J21930_100024742 189
376 3300002077 JGI24744J21845_10007283 JGI24744J21845_100072832 189
377 3300002077 JGI24744J21845_10007868 JGI24744J21845_100078682 189
378 3300002239 JGI24034J26672_10006652 JGI24034J26672_100066522 189
379 3300002244 JGI24742J22300_10003578 JGI24742J22300_100035782 189
380 3300003203 JGI25406J46586_10000064 JGI25406J46586_1000006437 189
381 3300003659 JGI25404J52841_10033318 JGI25404J52841_100333182 189
382 3300003659 JGI25404J52841_10078960 JGI25404J52841_100789601 189
383 3300004798 Ga0058859_11740492 Ga0058859_117404921 189
384 3300005293 Ga0065715_10174306 Ga0065715_101743061 189
385 3300005293 Ga0065715_10565648 Ga0065715_105656481 189
386 3300005327 Ga0070658_10710365 Ga0070658_107103651 189
387 3300005328 Ga0070676_10020837 Ga0070676_100208373 189
388 3300005329 Ga0070683_100041896 Ga0070683_1000418962 189
389 3300005330 Ga0070690_100226054 Ga0070690_1002260542 189
390 3300005330 Ga0070690_100230852 Ga0070690_1002308522 189
391 3300005331 Ga0070670_100077132 Ga0070670_1000771322 189
392 3300005331 Ga0070670_100183096 Ga0070670_1001830962 189
393 3300005334 Ga0068869_100021302 Ga0068869_1000213022 189
394 3300005334 Ga0068869_100082663 Ga0068869_1000826631 189
395 3300005336 Ga0070680_100003647 Ga0070680_10000364711 189
396 3300005336 Ga0070680_100029856 Ga0070680_1000298562 189
397 3300005336 Ga0070680_100121614 Ga0070680_1001216142 189
398 3300005337 Ga0070682_100007969 Ga0070682_1000079697 189
399 3300005338 Ga0068868_100138279 Ga0068868_1001382793 189
400 3300005338 Ga0068868_100408198 Ga0068868_1004081981 189
401 3300005340 Ga0070689_100031062 Ga0070689_1000310622 189
402 3300005340 Ga0070689_100121015 Ga0070689_1001210152 189
403 3300005340 Ga0070689_100208226 Ga0070689_1002082262 189
404 3300005341 Ga0070691_10004859 Ga0070691_100048594 189
405 3300005343 Ga0070687_100049605 Ga0070687_1000496053 189
406 3300005343 Ga0070687_100052564 Ga0070687_1000525642 189
407 3300005344 Ga0070661_100009866 Ga0070661_1000098662 189
408 3300005345 Ga0070692_10045412 Ga0070692_100454123 189
409 3300005345 Ga0070692_10260157 Ga0070692_102601571 189
410 3300005347 Ga0070668_100013726 Ga0070668_1000137265 189
411 3300005347 Ga0070668_100067131 Ga0070668_1000671312 189
412 3300005347 Ga0070668_100672016 Ga0070668_1006720161 189
413 3300005353 Ga0070669_100014406 Ga0070669_1000144062 189
414 3300005353 Ga0070669_100035084 Ga0070669_1000350842 189
415 3300005353 Ga0070669_100093037 Ga0070669_1000930372 189
416 3300005354 Ga0070675_100018170 Ga0070675_1000181702 189
417 3300005354 Ga0070675_100732289 Ga0070675_1007322891 189
418 3300005355 Ga0070671_100034258 Ga0070671_1000342585 189
419 3300005355 Ga0070671_100296361 Ga0070671_1002963612 189
420 3300005356 Ga0070674_100005693 Ga0070674_1000056938 189
421 3300005356 Ga0070674_100047397 Ga0070674_1000473972 189
422 3300005364 Ga0070673_100015849 Ga0070673_1000158493 189
423 3300005365 Ga0070688_100037805 Ga0070688_1000378052 189
424 3300005365 Ga0070688_100348498 Ga0070688_1003484982 189
425 3300005365 Ga0070688_100381848 Ga0070688_1003818481 189
426 3300005366 Ga0070659_100076576 Ga0070659_1000765762 189
427 3300005366 Ga0070659_100161364 Ga0070659_1001613642 189
428 3300005366 Ga0070659_100374802 Ga0070659_1003748021 189
429 3300005366 Ga0070659_100445386 Ga0070659_1004453861 189
430 3300005367 Ga0070667_100024258 Ga0070667_1000242582 189
431 3300005367 Ga0070667_100032997 Ga0070667_1000329977 189
432 3300005406 Ga0070703_10003201 Ga0070703_100032012 189
433 3300005436 Ga0070713_100003057 Ga0070713_1000030574 189
434 3300005436 Ga0070713_100347891 Ga0070713_1003478911 189
435 3300005438 Ga0070701_10004348 Ga0070701_100043485 189
436 3300005440 Ga0070705_100023373 Ga0070705_1000233734 189
437 3300005440 Ga0070705_100126002 Ga0070705_1001260023 189
438 3300005441 Ga0070700_100039431 Ga0070700_1000394312 189
439 3300005444 Ga0070694_100019693 Ga0070694_1000196932 189
440 3300005444 Ga0070694_100109804 Ga0070694_1001098042 189
441 3300005445 Ga0070708_100209630 Ga0070708_1002096302 189
442 3300005445 Ga0070708_100521341 Ga0070708_1005213412 189
443 3300005455 Ga0070663_100027341 Ga0070663_1000273412 189
444 3300005455 Ga0070663_100059872 Ga0070663_1000598722 189
445 3300005455 Ga0070663_100082344 Ga0070663_1000823442 189
446 3300005456 Ga0070678_100052290 Ga0070678_1000522902 189
447 3300005456 Ga0070678_100086184 Ga0070678_1000861843 189
448 3300005457 Ga0070662_100033312 Ga0070662_1000333122 189
449 3300005457 Ga0070662_100071711 Ga0070662_1000717112 189
450 3300005457 Ga0070662_100120688 Ga0070662_1001206883 189
451 3300005458 Ga0070681_10032947 Ga0070681_100329472 189
452 3300005459 Ga0068867_100021271 Ga0068867_1000212715 189
453 3300005459 Ga0068867_100128077 Ga0068867_1001280772 189
454 3300005466 Ga0070685_10048441 Ga0070685_100484412 189
455 3300005467 Ga0070706_100624318 Ga0070706_1006243181 189
456 3300005535 Ga0070684_100022473 Ga0070684_1000224732 189
457 3300005535 Ga0070684_100254112 Ga0070684_1002541121 189
458 3300005536 Ga0070697_100173177 Ga0070697_1001731772 189
459 3300005539 Ga0068853_100002207 Ga0068853_1000022077 189
460 3300005539 Ga0068853_100003634 Ga0068853_10000363411 189
461 3300005539 Ga0068853_100061086 Ga0068853_1000610862 189
462 3300005539 Ga0068853_100426138 Ga0068853_1004261382 189
463 3300005543 Ga0070672_100006742 Ga0070672_1000067428 189
464 3300005544 Ga0070686_100035110 Ga0070686_1000351102 189
465 3300005545 Ga0070695_100027274 Ga0070695_1000272742 189
466 3300005546 Ga0070696_100027513 Ga0070696_1000275132 189
467 3300005547 Ga0070693_100024374 Ga0070693_1000243743 189
468 3300005548 Ga0070665_100009777 Ga0070665_1000097777 189
469 3300005548 Ga0070665_100063185 Ga0070665_1000631854 189
470 3300005548 Ga0070665_100237840 Ga0070665_1002378402 189
471 3300005548 Ga0070665_100360172 Ga0070665_1003601721 189
472 3300005548 Ga0070665_101072015 Ga0070665_1010720152 189
473 3300005549 Ga0070704_100025802 Ga0070704_1000258023 189
474 3300005549 Ga0070704_100208955 Ga0070704_1002089552 189
475 3300005563 Ga0068855_100018412 Ga0068855_1000184122 189
476 3300005563 Ga0068855_100121549 Ga0068855_1001215492 189
477 3300005564 Ga0070664_100069419 Ga0070664_1000694192 189
478 3300005564 Ga0070664_100118200 Ga0070664_1001182003 189
479 3300005577 Ga0068857_100038621 Ga0068857_1000386212 189
480 3300005578 Ga0068854_100016856 Ga0068854_1000168564 189
481 3300005614 Ga0068856_100074006 Ga0068856_1000740062 189
482 3300005615 Ga0070702_100058574 Ga0070702_1000585742 189
483 3300005615 Ga0070702_100108151 Ga0070702_1001081512 189
484 3300005616 Ga0068852_100024735 Ga0068852_1000247354 189
485 3300005616 Ga0068852_100028928 Ga0068852_1000289282 189
486 3300005616 Ga0068852_100135745 Ga0068852_1001357453 189
487 3300005616 Ga0068852_100321492 Ga0068852_1003214922 189
488 3300005616 Ga0068852_100597485 Ga0068852_1005974851 189
489 3300005617 Ga0068859_100035913 Ga0068859_1000359132 189
490 3300005617 Ga0068859_100096333 Ga0068859_1000963332 189
491 3300005617 Ga0068859_100279653 Ga0068859_1002796531 189
492 3300005618 Ga0068864_100026533 Ga0068864_1000265334 189
493 3300005618 Ga0068864_100459111 Ga0068864_1004591112 189
494 3300005718 Ga0068866_10100091 Ga0068866_101000912 189
495 3300005718 Ga0068866_10195582 Ga0068866_101955822 189
496 3300005719 Ga0068861_100019676 Ga0068861_1000196762 189
497 3300005719 Ga0068861_100042474 Ga0068861_1000424744 189
498 3300005719 Ga0068861_100048184 Ga0068861_1000481842 189
499 3300005719 Ga0068861_100214160 Ga0068861_1002141602 189
500 3300005834 Ga0068851_10206447 Ga0068851_102064472 189
501 3300005840 Ga0068870_10026852 Ga0068870_100268522 189
502 3300005841 Ga0068863_100006825 Ga0068863_1000068252 189
503 3300005842 Ga0068858_100057433 Ga0068858_1000574332 189
504 3300005842 Ga0068858_100484718 Ga0068858_1004847182 189
505 3300005842 Ga0068858_100806662 Ga0068858_1008066622 189
506 3300005843 Ga0068860_100002033 Ga0068860_1000020333 189
507 3300005843 Ga0068860_100018432 Ga0068860_1000184326 189
508 3300005843 Ga0068860_100040901 Ga0068860_1000409018 189
509 3300005843 Ga0068860_100158101 Ga0068860_1001581013 189
510 3300005843 Ga0068860_101373457 Ga0068860_1013734571 189
511 3300005844 Ga0068862_100010222 Ga0068862_1000102222 189
512 3300005844 Ga0068862_100028055 Ga0068862_1000280554 189
513 3300005844 Ga0068862_100083389 Ga0068862_1000833894 189
514 3300005844 Ga0068862_100342269 Ga0068862_1003422692 189
515 3300005937 Ga0081455_10000200 Ga0081455_1000020055 189
516 3300005937 Ga0081455_10033922 Ga0081455_100339224 189
517 3300005937 Ga0081455_10091058 Ga0081455_100910583 189
518 3300005937 Ga0081455_10114395 Ga0081455_101143951 189
519 3300005981 Ga0081538_10011493 Ga0081538_100114931 189
520 3300005983 Ga0081540_1002062 Ga0081540_100206210 189
521 3300005983 Ga0081540_1004242 Ga0081540_100424211 189
522 3300005983 Ga0081540_1021026 Ga0081540_10210264 189
523 3300005985 Ga0081539_10000099 Ga0081539_1000009999 189
524 3300006028 Ga0070717_10003779 Ga0070717_100037799 189
525 3300006028 Ga0070717_10004793 Ga0070717_100047939 189
526 3300006038 Ga0075365_10012654 Ga0075365_100126546 189
527 3300006042 Ga0075368_10010256 Ga0075368_100102562 189
528 3300006042 Ga0075368_10197072 Ga0075368_101970721 189
529 3300006048 Ga0075363_100011785 Ga0075363_1000117852 189
530 3300006048 Ga0075363_100223399 Ga0075363_1002233991 189
531 3300006048 Ga0075363_100476049 Ga0075363_1004760491 189
532 3300006051 Ga0075364_10115711 Ga0075364_101157112 189
533 3300006051 Ga0075364_10263586 Ga0075364_102635862 189
534 3300006175 Ga0070712_100233934 Ga0070712_1002339341 189
535 3300006178 Ga0075367_10013887 Ga0075367_100138873 189
536 3300006195 Ga0075366_10225549 Ga0075366_102255492 189
537 3300006195 Ga0075366_10284461 Ga0075366_102844611 189
538 3300006237 Ga0097621_100007897 Ga0097621_1000078976 189
539 3300006237 Ga0097621_100302683 Ga0097621_1003026832 189
540 3300006353 Ga0075370_10003183 Ga0075370_100031834 189
541 3300006353 Ga0075370_10104230 Ga0075370_101042302 189
542 3300006353 Ga0075370_10401972 Ga0075370_104019721 189
543 3300006358 Ga0068871_100029425 Ga0068871_1000294252 189
544 3300006844 Ga0075428_100300564 Ga0075428_1003005641 189
545 3300006852 Ga0075433_10025119 Ga0075433_100251196 189
546 3300006871 Ga0075434_100008091 Ga0075434_1000080912 189
547 3300006881 Ga0068865_100001544 Ga0068865_10000154413 189
548 3300006931 Ga0097620_100035916 Ga0097620_1000359162 189
549 3300006931 Ga0097620_100096333 Ga0097620_1000963332 189
550 3300006931 Ga0097620_100279657 Ga0097620_1002796571 189
551 3300007076 Ga0075435_100603384 Ga0075435_1006033841 189
552 3300007788 Ga0099795_10033214 Ga0099795_100332142 189
553 3300007788 Ga0099795_10067720 Ga0099795_100677202 189
554 3300007788 Ga0099795_10235779 Ga0099795_102357791 189
555 3300009036 Ga0105244_10185079 Ga0105244_101850791 189
556 3300009092 Ga0105250_10043606 Ga0105250_100436062 189
557 3300009092 Ga0105250_10122793 Ga0105250_101227931 189
558 3300009093 Ga0105240_10012128 Ga0105240_100121284 189
559 3300009093 Ga0105240_10140846 Ga0105240_101408462 189
560 3300009094 Ga0111539_10001808 Ga0111539_100018082 189
561 3300009094 Ga0111539_10057213 Ga0111539_100572134 189
562 3300009094 Ga0111539_10739166 Ga0111539_107391662 189
563 3300009098 Ga0105245_10060262 Ga0105245_100602622 189
564 3300009098 Ga0105245_10514256 Ga0105245_105142562 189
565 3300009101 Ga0105247_10087187 Ga0105247_100871873 189
566 3300009101 Ga0105247_10143497 Ga0105247_101434972 189
567 3300009148 Ga0105243_10139000 Ga0105243_101390003 189
568 3300009148 Ga0105243_10241861 Ga0105243_102418612 189
569 3300009174 Ga0105241_10031108 Ga0105241_100311084 189
570 3300009174 Ga0105241_10272783 Ga0105241_102727831 189
571 3300009176 Ga0105242_10153900 Ga0105242_101539002 189
572 3300009177 Ga0105248_10005933 Ga0105248_100059333 189
573 3300009177 Ga0105248_10011779 Ga0105248_100117795 189
574 3300009177 Ga0105248_10034176 Ga0105248_100341762 189
575 3300009545 Ga0105237_10004719 Ga0105237_1000471914 189
576 3300009545 Ga0105237_10007432 Ga0105237_100074322 189
577 3300009545 Ga0105237_10070348 Ga0105237_100703481 189
578 3300009545 Ga0105237_10599999 Ga0105237_105999992 189
579 3300009551 Ga0105238_10003421 Ga0105238_100034215 189
580 3300009551 Ga0105238_10436192 Ga0105238_104361922 189
581 3300009553 Ga0105249_10014723 Ga0105249_100147231 189
582 3300009553 Ga0105249_10019871 Ga0105249_100198712 189
583 3300009553 Ga0105249_10528641 Ga0105249_105286412 189
584 3300010159 Ga0099796_10022143 Ga0099796_100221432 189
585 3300010159 Ga0099796_10130836 Ga0099796_101308361 189
586 3300010375 Ga0105239_10023212 Ga0105239_100232123 189
587 3300010375 Ga0105239_10102667 Ga0105239_101026672 189
588 3300010375 Ga0105239_10797822 Ga0105239_107978222 189
589 3300010375 Ga0105239_11371603 Ga0105239_113716032 189
590 3300011119 Ga0105246_10079330 Ga0105246_100793302 189
591 3300011119 Ga0105246_10597510 Ga0105246_105975102 189
592 3300013100 Ga0157373_10024897 Ga0157373_100248975 189
593 3300013100 Ga0157373_10298226 Ga0157373_102982262 189
594 3300013105 Ga0157369_10065365 Ga0157369_100653655 189
595 3300013105 Ga0157369_10315863 Ga0157369_103158632 189
596 3300013296 Ga0157374_10411201 Ga0157374_104112012 189
597 3300013297 Ga0157378_10031566 Ga0157378_100315662 189
598 3300013297 Ga0157378_10104776 Ga0157378_101047763 189
599 3300013297 Ga0157378_10258421 Ga0157378_102584212 189
600 3300013306 Ga0163162_10022234 Ga0163162_100222347 189
601 3300013306 Ga0163162_10053512 Ga0163162_100535122 189
602 3300013307 Ga0157372_10016582 Ga0157372_100165823 189
603 3300013307 Ga0157372_10186079 Ga0157372_101860792 189
604 3300013308 Ga0157375_10084799 Ga0157375_100847993 189
605 3300013308 Ga0157375_10261478 Ga0157375_102614782 189
606 3300013308 Ga0157375_10298866 Ga0157375_102988663 189
607 3300014325 Ga0163163_10016805 Ga0163163_100168052 189
608 3300014325 Ga0163163_10226212 Ga0163163_102262122 189
609 3300014326 Ga0157380_10100984 Ga0157380_101009842 189
610 3300014745 Ga0157377_10013798 Ga0157377_100137982 189
611 3300014968 Ga0157379_10089794 Ga0157379_100897942 189
612 3300014968 Ga0157379_10153801 Ga0157379_101538012 189
613 3300014969 Ga0157376_10006128 Ga0157376_100061286 189
614 3300014969 Ga0157376_10217613 Ga0157376_102176132 189
615 3300017792 Ga0163161_10006229 Ga0163161_100062292 189
616 3300017792 Ga0163161_10675526 Ga0163161_106755262 189
617 3300021384 Ga0213876_10340105 Ga0213876_103401051 189
618 3300025271 Ga0207666_1000311 Ga0207666_10003112 189
619 3300025290 Ga0207673_1003304 Ga0207673_10033042 189
620 3300025297 Ga0209758_1001737 Ga0209758_100173716 189
621 3300025297 Ga0209758_1003580 Ga0209758_10035804 189
622 3300025315 Ga0207697_10006626 Ga0207697_100066262 189
623 3300025885 Ga0207653_10002805 Ga0207653_100028056 189
624 3300025893 Ga0207682_10000009 Ga0207682_1000000968 189
625 3300025893 Ga0207682_10014469 Ga0207682_100144694 189
626 3300025899 Ga0207642_10044313 Ga0207642_100443132 189
627 3300025900 Ga0207710_10002730 Ga0207710_100027305 189
628 3300025901 Ga0207688_10000892 Ga0207688_1000089215 189
629 3300025904 Ga0207647_10002160 Ga0207647_1000216015 189
630 3300025905 Ga0207685_10406230 Ga0207685_104062301 189
631 3300025907 Ga0207645_10000999 Ga0207645_1000099921 189
632 3300025908 Ga0207643_10006739 Ga0207643_100067393 189
633 3300025909 Ga0207705_10522401 Ga0207705_105224011 189
634 3300025909 Ga0207705_10596831 Ga0207705_105968311 189
635 3300025911 Ga0207654_10236456 Ga0207654_102364561 189
636 3300025912 Ga0207707_10002224 Ga0207707_1000222417 189
637 3300025912 Ga0207707_10020542 Ga0207707_100205427 189
638 3300025913 Ga0207695_10046019 Ga0207695_100460193 189
639 3300025914 Ga0207671_10035416 Ga0207671_100354164 189
640 3300025914 Ga0207671_10064994 Ga0207671_100649943 189
641 3300025914 Ga0207671_10180264 Ga0207671_101802641 189
642 3300025915 Ga0207693_10205162 Ga0207693_102051622 189
643 3300025915 Ga0207693_10227981 Ga0207693_102279811 189
644 3300025916 Ga0207663_10599911 Ga0207663_105999111 189
645 3300025917 Ga0207660_10001283 Ga0207660_100012832 189
646 3300025917 Ga0207660_10010206 Ga0207660_100102065 189
647 3300025918 Ga0207662_10000025 Ga0207662_1000002567 189
648 3300025918 Ga0207662_10037874 Ga0207662_100378743 189
649 3300025919 Ga0207657_10005246 Ga0207657_100052468 189
650 3300025919 Ga0207657_10018108 Ga0207657_100181082 189
651 3300025920 Ga0207649_10002186 Ga0207649_100021865 189
652 3300025921 Ga0207652_10004348 Ga0207652_100043488 189
653 3300025921 Ga0207652_10035191 Ga0207652_100351912 189
654 3300025923 Ga0207681_10007074 Ga0207681_100070742 189
655 3300025923 Ga0207681_10068564 Ga0207681_100685643 189
656 3300025923 Ga0207681_10248997 Ga0207681_102489972 189
657 3300025924 Ga0207694_10075578 Ga0207694_100755783 189
658 3300025924 Ga0207694_10082962 Ga0207694_100829621 189
659 3300025924 Ga0207694_10318994 Ga0207694_103189942 189
660 3300025925 Ga0207650_10190498 Ga0207650_101904982 189
661 3300025925 Ga0207650_10388174 Ga0207650_103881741 189
662 3300025926 Ga0207659_10030381 Ga0207659_100303813 189
663 3300025926 Ga0207659_10262721 Ga0207659_102627212 189
664 3300025927 Ga0207687_10001197 Ga0207687_1000119714 189
665 3300025928 Ga0207700_10055969 Ga0207700_100559692 189
666 3300025928 Ga0207700_10092879 Ga0207700_100928792 189
667 3300025928 Ga0207700_10144687 Ga0207700_101446873 189
668 3300025928 Ga0207700_10469555 Ga0207700_104695552 189
669 3300025929 Ga0207664_10152833 Ga0207664_101528331 189
670 3300025929 Ga0207664_10375743 Ga0207664_103757431 189
671 3300025929 Ga0207664_10828401 Ga0207664_108284011 189
672 3300025931 Ga0207644_10036076 Ga0207644_100360764 189
673 3300025932 Ga0207690_10011755 Ga0207690_100117552 189
674 3300025933 Ga0207706_10005363 Ga0207706_1000536312 189
675 3300025933 Ga0207706_10040844 Ga0207706_100408442 189
676 3300025933 Ga0207706_10103304 Ga0207706_101033042 189
677 3300025934 Ga0207686_10001310 Ga0207686_100013103 189
678 3300025934 Ga0207686_10274618 Ga0207686_102746182 189
679 3300025935 Ga0207709_10006190 Ga0207709_100061904 189
680 3300025935 Ga0207709_10012682 Ga0207709_100126824 189
681 3300025936 Ga0207670_10013997 Ga0207670_100139972 189
682 3300025936 Ga0207670_10118723 Ga0207670_101187232 189
683 3300025936 Ga0207670_10194202 Ga0207670_101942022 189
684 3300025937 Ga0207669_10001324 Ga0207669_1000132411 189
685 3300025937 Ga0207669_10157264 Ga0207669_101572642 189
686 3300025937 Ga0207669_10659658 Ga0207669_106596581 189
687 3300025938 Ga0207704_10003457 Ga0207704_100034572 189
688 3300025940 Ga0207691_10002604 Ga0207691_100026042 189
689 3300025940 Ga0207691_10159553 Ga0207691_101595532 189
690 3300025941 Ga0207711_10031474 Ga0207711_100314743 189
691 3300025941 Ga0207711_10073623 Ga0207711_100736232 189
692 3300025941 Ga0207711_10101876 Ga0207711_101018761 189
693 3300025942 Ga0207689_10001156 Ga0207689_1000115624 189
694 3300025942 Ga0207689_10038650 Ga0207689_100386502 189
695 3300025942 Ga0207689_10087744 Ga0207689_100877442 189
696 3300025944 Ga0207661_10007789 Ga0207661_100077893 189
697 3300025945 Ga0207679_10004160 Ga0207679_100041603 189
698 3300025949 Ga0207667_10012980 Ga0207667_100129808 189
699 3300025949 Ga0207667_10077987 Ga0207667_100779874 189
700 3300025949 Ga0207667_10310444 Ga0207667_103104443 189
701 3300025949 Ga0207667_10507823 Ga0207667_105078232 189
702 3300025960 Ga0207651_10087185 Ga0207651_100871852 189
703 3300025960 Ga0207651_10328099 Ga0207651_103280992 189
704 3300025961 Ga0207712_10000579 Ga0207712_100005792 189
705 3300025972 Ga0207668_10001403 Ga0207668_100014039 189
706 3300025972 Ga0207668_10032114 Ga0207668_100321143 189
707 3300025972 Ga0207668_10033457 Ga0207668_100334573 189
708 3300025972 Ga0207668_10079730 Ga0207668_100797303 189
709 3300025972 Ga0207668_10481642 Ga0207668_104816422 189
710 3300025981 Ga0207640_10003644 Ga0207640_100036442 189
711 3300025986 Ga0207658_10113485 Ga0207658_101134852 189
712 3300025986 Ga0207658_10359771 Ga0207658_103597712 189
713 3300025986 Ga0207658_10372366 Ga0207658_103723662 189
714 3300025986 Ga0207658_10608626 Ga0207658_106086261 189
715 3300026035 Ga0207703_10014416 Ga0207703_100144162 189
716 3300026041 Ga0207639_10001866 Ga0207639_1000186613 189
717 3300026041 Ga0207639_10128563 Ga0207639_101285632 189
718 3300026041 Ga0207639_10547058 Ga0207639_105470581 189
719 3300026067 Ga0207678_10027315 Ga0207678_100273154 189
720 3300026067 Ga0207678_10042596 Ga0207678_100425962 189
721 3300026067 Ga0207678_10048901 Ga0207678_100489014 189
722 3300026067 Ga0207678_10062786 Ga0207678_100627862 189
723 3300026067 Ga0207678_10080462 Ga0207678_100804623 189
724 3300026067 Ga0207678_10080882 Ga0207678_100808823 189
725 3300026067 Ga0207678_10222167 Ga0207678_102221672 189
726 3300026075 Ga0207708_10020931 Ga0207708_100209313 189
727 3300026075 Ga0207708_10023687 Ga0207708_100236872 189
728 3300026075 Ga0207708_10050635 Ga0207708_100506352 189
729 3300026075 Ga0207708_10480363 Ga0207708_104803631 189
730 3300026078 Ga0207702_10010946 Ga0207702_100109465 189
731 3300026078 Ga0207702_10257067 Ga0207702_102570672 189
732 3300026088 Ga0207641_10006404 Ga0207641_100064046 189
733 3300026089 Ga0207648_10004627 Ga0207648_1000462714 189
734 3300026089 Ga0207648_10046915 Ga0207648_100469154 189
735 3300026089 Ga0207648_10807228 Ga0207648_108072281 189
736 3300026095 Ga0207676_10030863 Ga0207676_100308632 189
737 3300026095 Ga0207676_10282270 Ga0207676_102822702 189
738 3300026116 Ga0207674_10112597 Ga0207674_101125972 189
739 3300026116 Ga0207674_10530319 Ga0207674_105303192 189
740 3300026118 Ga0207675_100003859 Ga0207675_10000385915 189
741 3300026121 Ga0207683_10000850 Ga0207683_100008502 189
742 3300026121 Ga0207683_10051919 Ga0207683_100519194 189
743 3300026121 Ga0207683_10176198 Ga0207683_101761983 189
744 3300026142 Ga0207698_10087412 Ga0207698_100874123 189
745 3300026142 Ga0207698_10089661 Ga0207698_100896613 189
746 3300026142 Ga0207698_10636350 Ga0207698_106363502 189
747 3300027424 Ga0209984_1018261 Ga0209984_10182612 189
748 3300027617 Ga0210002_1003557 Ga0210002_10035572 189
749 3300027717 Ga0209998_10002588 Ga0209998_100025885 189
750 3300027866 Ga0209813_10105597 Ga0209813_101055971 189
751 3300027876 Ga0209974_10003747 Ga0209974_100037477 189
752 3300027907 Ga0207428_10000164 Ga0207428_1000016443 189
753 3300027907 Ga0207428_10459443 Ga0207428_104594432 189
754 3300028379 Ga0268266_10012217 Ga0268266_100122174 189
755 3300028379 Ga0268266_10013853 Ga0268266_100138531 189
756 3300028379 Ga0268266_10227310 Ga0268266_102273102 189
757 3300028379 Ga0268266_10363782 Ga0268266_103637822 189
758 3300028379 Ga0268266_10559329 Ga0268266_105593291 189
759 3300028380 Ga0268265_10004025 Ga0268265_100040257 189
760 3300028380 Ga0268265_10022554 Ga0268265_100225544 189
761 3300028380 Ga0268265_10079812 Ga0268265_100798121 189
762 3300028381 Ga0268264_10000174 Ga0268264_1000017490 189
763 3300028381 Ga0268264_10049152 Ga0268264_100491523 189
764 3300028381 Ga0268264_10102694 Ga0268264_101026942 189
765 3300028381 Ga0268264_10158236 Ga0268264_101582362 189
766 3300028381 Ga0268264_10756675 Ga0268264_107566751 189
767 3300028786 Ga0307517_10000859 Ga0307517_100008592 189
768 3300030521 Ga0307511_10032093 Ga0307511_100320935 189
769 3300030522 Ga0307512_10244813 Ga0307512_102448131 189
770 3300031456 Ga0307513_10377142 Ga0307513_103771421 189
771 3300031507 Ga0307509_10006398 Ga0307509_100063983 189
772 3300031507 Ga0307509_10082116 Ga0307509_100821163 189
773 3300031548 Ga0307408_100715716 Ga0307408_1007157161 189
774 3300031616 Ga0307508_10494422 Ga0307508_104944221 189
775 3300031730 Ga0307516_10059646 Ga0307516_100596465 189
776 3300031730 Ga0307516_10060402 Ga0307516_100604024 189
777 3300031731 Ga0307405_10595972 Ga0307405_105959721 189
778 3300031731 Ga0307405_11002876 Ga0307405_110028761 189
779 3300031824 Ga0307413_10038231 Ga0307413_100382313 189
780 3300031824 Ga0307413_10491927 Ga0307413_104919271 189
781 3300031903 Ga0307407_10258970 Ga0307407_102589701 189
782 3300031995 Ga0307409_100021933 Ga0307409_1000219336 189
783 3300032002 Ga0307416_100558321 Ga0307416_1005583211 189
784 3300032126 Ga0307415_100004684 Ga0307415_1000046842 189
785 3300033179 Ga0307507_10028588 Ga0307507_100285887 189
786 3300033180 Ga0307510_10019115 Ga0307510_100191151 189
787 3300033180 Ga0307510_10201911 Ga0307510_102019111 189
788 3300033544 Ga0316215_1000931 Ga0316215_10009313 189
789 3300034816 Ga0373930_0002256 Ga0373930_0002256_1119_1721 189
790 3300034817 Ga0373948_0001906 Ga0373948_0001906_1284_1886 189
791 3300034818 Ga0373950_0013019 Ga0373950_0013019_673_1290 189
792 3300034820 Ga0373959_0008747 Ga0373959_0008747_610_1212 189
793 3300035083 Ga0373926_0083666 Ga0373926_0083666_435_1064 189
794 3300035085 Ga0373929_0006845 Ga0373929_0006845_1285_1887 189
795 3300035085 Ga0373929_0007992 Ga0373929_0007992_88_705 189
796 3300035091 Ga0373951_0029322 Ga0373951_0029322_199_801 189
797 3300035092 Ga0373952_0000933 Ga0373952_0000933_1159_1761 189
798 3300035111 Ga0373923_0021124 Ga0373923_0021124_272_901 189
799 3300035111 Ga0373923_0027670 Ga0373923_0027670_788_1417 189
800 3300035112 Ga0373932_0003751 Ga0373932_0003751_2449_3051 189
801 3300035113 Ga0373936_0006062 Ga0373936_0006062_650_1279 189
802 3300035113 Ga0373936_0179144 Ga0373936_0179144_166_792 189
803 3300035114 Ga0373939_0003090 Ga0373939_0003090_2449_3051 189
804 3300035115 Ga0373941_0013201 Ga0373941_0013201_215_817 189
805 3300035117 Ga0373953_0018244 Ga0373953_0018244_211_816 189
806 3300035118 Ga0373954_0001219 Ga0373954_0001219_4464_5069 189
807 3300035120 Ga0373957_0003464 Ga0373957_0003464_2202_2807 189
808 3300035121 Ga0373960_0006476 Ga0373960_0006476_936_1538 189
809 3300035170 Ga0373943_0005037 Ga0373943_0005037_340_969 189
810 3300035170 Ga0373943_0255544 Ga0373943_0255544_244_873 189
811 3300035172 Ga0373955_0012895 Ga0373955_0012895_436_1041 189
812 3300035207 Ga0373942_0027318 Ga0373942_0027318_658_1260 189
813 3300035241 Ga0373961_0036817 Ga0373961_0036817_239_841 189
814 3300035242 Ga0373962_0009071 Ga0373962_0009071_459_1061 189
815 3300035410 Ga0373924_0007721 Ga0373924_0007721_207_836 189
816 3300035691 Ga0373931_0002611 Ga0373931_0002611_300_902 189
817 3300035691 Ga0373931_0004766 Ga0373931_0004766_5275_5892 189
818 3300035692 Ga0373935_0000942 Ga0373935_0000942_11834_12463 189
819 3300035692 Ga0373935_0057406 Ga0373935_0057406_1598_2203 189
820 3300035695 Ga0373927_0000528 Ga0373927_0000528_1883_2512 189
821 3300035695 Ga0373927_0202177 Ga0373927_0202177_211_840 189
822 3300035695 Ga0373927_0327937 Ga0373927_0327937_237_854 189
823 3300035724 Ga0373933_0034817 Ga0373933_0034817_696_1301 189
824 3300035724 Ga0373933_0112377 Ga0373933_0112377_310_939 189
825 3300035725 Ga0373947_0000455 Ga0373947_0000455_16031_16660 189
826 3300035725 Ga0373947_0039442 Ga0373947_0039442_820_1449 189
827 3300035725 Ga0373947_0091001 Ga0373947_0091001_863_1468 189
828 3300035725 Ga0373947_0376258 Ga0373947_0376258_240_866 189
829 3300036401 Ga0373937_0015336 Ga0373937_0015336_784_1389 189
830 3300036401 Ga0373937_0185926 Ga0373937_0185926_243_914 189
831 3300036401 Ga0373937_0485225 Ga0373937_0485225_516_1133 189
832 3300037068 Ga0373925_0003563 Ga0373925_0003563_9968_10597 189
833 3300037068 Ga0373925_0081325 Ga0373925_0081325_1438_2067 189
834 3300037068 Ga0373925_0085487 Ga0373925_0085487_1363_1968 189
835 3300037068 Ga0373925_0301832 Ga0373925_0301832_199_825 189
836 3300037853 Ga0436364_1289063 Ga0436364_1289063_497_1123 189
837 3300041413 Ga0439465_0132882 Ga0439465_0132882_87_713 189
838 3300041451 Ga0451791_0240992 Ga0451791_0240992_88_711 189
839 3300041452 Ga0451793_1400233 Ga0451793_1400233_28_666 189
840 3300041486 Ga0451807_0428279 Ga0451807_0428279_288_914 189
841 3300041494 Ga0451837_1412964 Ga0451837_1412964_293_919 189
842 3300041512 Ga0451853_4011993 Ga0451853_4011993_58_681 189
843 3300046452 Ga0495617_165209 Ga0495617_165209_60_686 189
844 3300046454 Ga0495592_0005277 Ga0495592_0005277_8229_8834 189
845 3300046454 Ga0495592_0032569 Ga0495592_0032569_2016_2645 189
846 3300046455 Ga0495603_0000239 Ga0495603_0000239_14528_15157 189
847 3300046455 Ga0495603_0009322 Ga0495603_0009322_5144_5770 189
848 3300046455 Ga0495603_0058945 Ga0495603_0058945_83_709 189
849 3300046457 Ga0495590_0068691 Ga0495590_0068691_126_752 189
850 3300046459 Ga0495629_0000457 Ga0495629_0000457_11945_12574 189
851 3300046461 Ga0495641_0002157 Ga0495641_0002157_9720_10349 189
852 3300046461 Ga0495641_0094341 Ga0495641_0094341_478_1104 189
853 3300046461 Ga0495641_0209869 Ga0495641_0209869_176_805 189
854 3300046462 Ga0495651_0014000 Ga0495651_0014000_2445_3050 189
855 3300046462 Ga0495651_0363524 Ga0495651_0363524_51_680 189
856 3300046463 Ga0495653_0004257 Ga0495653_0004257_8763_9368 189
857 3300046471 Ga0495650_0051594 Ga0495650_0051594_601_1227 189
858 3300046472 Ga0495580_0002960 Ga0495580_0002960_103_732 189
859 3300046473 Ga0495582_0000077 Ga0495582_0000077_33456_34085 189
860 3300046475 Ga0495639_0000101 Ga0495639_0000101_16369_16998 189
861 3300046475 Ga0495639_0095966 Ga0495639_0095966_288_905 189
862 3300046475 Ga0495639_0179661 Ga0495639_0179661_43_648 189
863 3300046476 Ga0495662_0012510 Ga0495662_0012510_434_1063 189
864 3300046477 Ga0495664_0038052 Ga0495664_0038052_363_968 189
865 3300046477 Ga0495664_0041464 Ga0495664_0041464_141_770 189
866 3300046491 Ga0495584_0046170 Ga0495584_0046170_1127_1753 189
867 3300046492 Ga0495585_0031320 Ga0495585_0031320_1990_2616 189
868 3300046499 Ga0495594_0000083 Ga0495594_0000083_1118_1747 189
869 3300046499 Ga0495594_0186100 Ga0495594_0186100_49_675 189
870 3300046507 Ga0495606_0000357 Ga0495606_0000357_18235_18861 189
871 3300046511 Ga0495608_0000911 Ga0495608_0000911_11090_11695 189
872 3300046514 Ga0495618_0003586 Ga0495618_0003586_2160_2765 189
873 3300046516 Ga0495628_0055320 Ga0495628_0055320_1037_1642 189
874 3300046516 Ga0495628_0062832 Ga0495628_0062832_1986_2615 189
875 3300046517 Ga0495630_0079394 Ga0495630_0079394_1461_2066 189
876 3300046517 Ga0495630_0167276 Ga0495630_0167276_499_1128 189
877 3300046517 Ga0495630_0268244 Ga0495630_0268244_444_1115 189
878 3300046519 Ga0495632_0015464 Ga0495632_0015464_3180_3806 189
879 3300046523 Ga0495644_0046783 Ga0495644_0046783_512_1189 189
880 3300046526 Ga0495666_0037457 Ga0495666_0037457_77_706 189
881 3300046529 Ga0495652_0021917 Ga0495652_0021917_2654_3283 189
882 3300046529 Ga0495652_0145338 Ga0495652_0145338_567_1172 189
883 3300046531 Ga0495665_0000055 Ga0495665_0000055_27942_28571 189
884 3300046533 Ga0495640_0053786 Ga0495640_0053786_1717_2322 189
885 3300046535 Ga0495586_0026013 Ga0495586_0026013_1297_1902 189
886 3300046536 Ga0495587_0011562 Ga0495587_0011562_567_1172 189
887 3300046537 Ga0495598_0005561 Ga0495598_0005561_1849_2475 189
888 3300046542 Ga0495597_0148045 Ga0495597_0148045_160_786 189
889 3300046543 Ga0495645_0042847 Ga0495645_0042847_2327_2932 189
890 3300046543 Ga0495645_0331495 Ga0495645_0331495_169_798 189
891 3300046557 Ga0495622_0002233 Ga0495622_0002233_3568_4197 189
892 3300046557 Ga0495622_0128327 Ga0495622_0128327_515_1144 189
893 3300046557 Ga0495622_0162331 Ga0495622_0162331_366_992 189
894 3300046559 Ga0495667_0013782 Ga0495667_0013782_4289_4894 189
895 3300046559 Ga0495667_0023279 Ga0495667_0023279_1901_2572 189
896 3300046559 Ga0495667_0048600 Ga0495667_0048600_1816_2445 189
897 3300046559 Ga0495667_0093406 Ga0495667_0093406_1053_1682 189
898 3300046615 Ga0495656_0008262 Ga0495656_0008262_1632_2258 189
899 3300046616 Ga0495668_0114332 Ga0495668_0114332_99_776 189
900 3300046642 Ga0495634_0001036 Ga0495634_0001036_526_1155 189
901 3300046660 Ga0495625_0592842 Ga0495625_0592842_31_654 189
902 3300046663 Ga0495635_0000815 Ga0495635_0000815_18409_19038 189
903 3300046663 Ga0495635_0011194 Ga0495635_0011194_882_1487 189
904 3300046664 Ga0495659_0004501 Ga0495659_0004501_2830_3456 189
905 3300046674 Ga0495588_0005058 Ga0495588_0005058_2094_2723 189
906 3300046674 Ga0495588_0005077 Ga0495588_0005077_4954_5580 189
907 3300046675 Ga0495657_0034720 Ga0495657_0034720_2805_3410 189
908 3300046678 Ga0495599_0097068 Ga0495599_0097068_956_1627 189
909 3300046679 Ga0495623_0001015 Ga0495623_0001015_17103_17708 189
910 3300046680 Ga0495646_0014188 Ga0495646_0014188_2403_3008 189
911 3300046680 Ga0495646_0189630 Ga0495646_0189630_352_981 189
912 3300046683 Ga0495658_0001572 Ga0495658_0001572_10064_10693 189
913 3300046684 Ga0495669_0002048 Ga0495669_0002048_6229_6906 189
914 3300046689 Ga0495613_0003480 Ga0495613_0003480_1424_2053 189
915 3300046689 Ga0495613_0078788 Ga0495613_0078788_155_760 189
916 3300046690 Ga0495624_0000235 Ga0495624_0000235_12480_13109 189
917 3300046690 Ga0495624_0050807 Ga0495624_0050807_333_938 189
918 3300046691 Ga0495670_0192981 Ga0495670_0192981_197_823 189
919 3300046692 Ga0495671_0061334 Ga0495671_0061334_1152_1778 189
920 3300046794 Ga0495589_0184650 Ga0495589_0184650_333_959 189
921 3300046809 Ga0495600_0015287 Ga0495600_0015287_1263_1868 189
922 3300047315 Ga0495581_0000041 Ga0495581_0000041_20403_21032 189
923 3300047319 Ga0495674_0036100 Ga0495674_0036100_2363_2968 189
924 3300047319 Ga0495674_0602898 Ga0495674_0602898_208_825 189
925 3300047321 Ga0495676_0018550 Ga0495676_0018550_2557_3186 189
926 3300047322 Ga0495680_0028245 Ga0495680_0028245_1264_1869 189
927 3300047322 Ga0495680_0414882 Ga0495680_0414882_23_652 189
928 3300047444 Ga0495675_0025398 Ga0495675_0025398_2230_2835 189
929 3300047445 Ga0495677_0151369 Ga0495677_0151369_106_732 189
930 3300047446 Ga0495679_093047 Ga0495679_093047_28_654 189
931 3300047469 Ga0495673_0025589 Ga0495673_0025589_1882_2511 189
932 3300047673 Ga0495593_0000024 Ga0495593_0000024_22745_23374 189
933 3300047673 Ga0495593_0019588 Ga0495593_0019588_1784_2389 189
934 3300048088 Ga0495602_0019419 Ga0495602_0019419_5456_6061 189
935 3300048091 Ga0495626_0219016 Ga0495626_0219016_70_696 189
936 3300048903 Ga0496100_0301201 Ga0496100_0301201_245_871 189
937 3300048904 Ga0496101_0002275 Ga0496101_0002275_1507_2109 189
938 3300048904 Ga0496101_0257139 Ga0496101_0257139_529_1134 189
939 3300048905 Ga0496102_0015668 Ga0496102_0015668_4004_4621 189
940 3300048905 Ga0496102_0022366 Ga0496102_0022366_267_869 189
941 3300048905 Ga0496102_0076164 Ga0496102_0076164_1256_1861 189
942 3300048905 Ga0496102_0286670 Ga0496102_0286670_738_1367 189
943 3300048905 Ga0496102_0414593 Ga0496102_0414593_575_1201 189
944 3300048906 Ga0496103_0019772 Ga0496103_0019772_2016_2618 189
945 3300048906 Ga0496103_0026671 Ga0496103_0026671_2643_3260 189
946 3300048906 Ga0496103_0413174 Ga0496103_0413174_39_665 189
947 3300048907 Ga0496104_0088890 Ga0496104_0088890_1634_2239 189
948 3300048907 Ga0496104_0121736 Ga0496104_0121736_1686_2288 189
949 3300048907 Ga0496104_0135420 Ga0496104_0135420_964_1581 189
950 3300048908 Ga0496105_0012396 Ga0496105_0012396_3726_4343 189
951 3300048908 Ga0496105_0292958 Ga0496105_0292958_679_1284 189
952 3300048909 Ga0496106_0003446 Ga0496106_0003446_5357_5959 189
953 3300048909 Ga0496106_0039727 Ga0496106_0039727_1862_2479 189
954 3300048909 Ga0496106_0058706 Ga0496106_0058706_1837_2514 189
955 3300048909 Ga0496106_0147996 Ga0496106_0147996_637_1239 189
956 3300048910 Ga0496107_0000509 Ga0496107_0000509_14022_14624 189
957 3300048910 Ga0496107_0021914 Ga0496107_0021914_1934_2551 189
958 3300048910 Ga0496107_0055248 Ga0496107_0055248_1416_2093 189
959 3300048910 Ga0496107_0184967 Ga0496107_0184967_220_822 189
960 3300048910 Ga0496107_0397163 Ga0496107_0397163_29_634 189
961 3300048911 Ga0496108_0031275 Ga0496108_0031275_3664_4266 189
962 3300048911 Ga0496108_0043219 Ga0496108_0043219_1274_1891 189
963 3300048911 Ga0496108_0150590 Ga0496108_0150590_1112_1714 189
964 3300048912 Ga0496109_0026994 Ga0496109_0026994_3700_4302 189
965 3300048912 Ga0496109_0063752 Ga0496109_0063752_2065_2682 189
966 3300048912 Ga0496109_0170543 Ga0496109_0170543_839_1441 189
967 3300048912 Ga0496109_0241523 Ga0496109_0241523_112_741 189
968 3300048912 Ga0496109_0273602 Ga0496109_0273602_256_879 189
969 3300048912 Ga0496109_0995085 Ga0496109_0995085_77_703 189
970 3300048913 Ga0496110_0033752 Ga0496110_0033752_1113_1715 189
971 3300048913 Ga0496110_0130718 Ga0496110_0130718_1545_2147 189
972 3300048913 Ga0496110_0313674 Ga0496110_0313674_585_1214 189
973 3300048913 Ga0496110_0703311 Ga0496110_0703311_96_722 189
974 3300048913 Ga0496110_0799685 Ga0496110_0799685_13_630 189
975 3300048913 Ga0496110_0920507 Ga0496110_0920507_122_748 189
976 3300048914 Ga0496111_0024753 Ga0496111_0024753_1176_1793 189
977 3300048914 Ga0496111_0039292 Ga0496111_0039292_1137_1739 189
978 3300048914 Ga0496111_0348952 Ga0496111_0348952_447_1073 189
979 3300048915 Ga0496112_0012715 Ga0496112_0012715_747_1364 189
980 3300048915 Ga0496112_0048594 Ga0496112_0048594_715_1317 189
981 3300048915 Ga0496112_0086667 Ga0496112_0086667_1917_2546 189
982 3300048915 Ga0496112_0284141 Ga0496112_0284141_165_794 189
983 3300048916 Ga0496113_0002503 Ga0496113_0002503_8600_9217 189
984 3300048916 Ga0496113_0008294 Ga0496113_0008294_1443_2045 189
985 3300048916 Ga0496113_0056499 Ga0496113_0056499_997_1635 189
986 3300048916 Ga0496113_0533929 Ga0496113_0533929_297_923 189
987 3300048917 Ga0496114_0009294 Ga0496114_0009294_4345_4962 189
988 3300048917 Ga0496114_0048418 Ga0496114_0048418_1527_2204 189
989 3300048917 Ga0496114_0401699 Ga0496114_0401699_212_814 189
990 3300048918 Ga0496115_0059345 Ga0496115_0059345_2352_2978 189
991 3300048918 Ga0496115_0133773 Ga0496115_0133773_373_975 189
992 3300048920 Ga0496117_0238499 Ga0496117_0238499_356_988 189
993 3300048922 Ga0496119_0047619 Ga0496119_0047619_1032_1655 189
994 3300048924 Ga0496121_0000927 Ga0496121_0000927_50214_50840 189
995 3300048924 Ga0496121_0203641 Ga0496121_0203641_213_839 189
996 3300048927 Ga0496124_0233805 Ga0496124_0233805_124_747 189
997 3300048929 Ga0496126_0082014 Ga0496126_0082014_1742_2374 189
998 3300049583 Ga0501067_0039577 Ga0501067_0039577_1653_2279 189
999 3300050491 nmdc:mga00v17_297583_c1 nmdc:mga00v17_297583_c1_412_1029 189
1000 3300050492 nmdc:mga0yw44_13282_c1 nmdc:mga0yw44_13282_c1_533_1159 189
1001 3300050492 nmdc:mga0yw44_211928_c1 nmdc:mga0yw44_211928_c1_310_936 189
1002 3300050493 nmdc:mga0k408_292622_c1 nmdc:mga0k408_292622_c1_318_944 189
1003 3300050494 nmdc:mga06z11_151224_c1 nmdc:mga06z11_151224_c1_411_1037 189
1004 3300050494 nmdc:mga06z11_45147_c1 nmdc:mga06z11_45147_c1_34_636 189
1005 3300050496 nmdc:mga07m45_8848_c1 nmdc:mga07m45_8848_c1_157_783 189
1006 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_54078_54680 189
1007 3300050512 nmdc:mga0n895_216385_c1 nmdc:mga0n895_216385_c1_308_910 189
1008 3300050512 nmdc:mga0n895_37633_c1 nmdc:mga0n895_37633_c1_3407_4009 189
1009 3300050513 nmdc:mga0rr50_537400_c1 nmdc:mga0rr50_537400_c1_252_854 189
1010 3300050515 nmdc:mga0a205_1049_c1 nmdc:mga0a205_1049_c1_13914_14516 189
1011 3300050516 nmdc:mga0sz30_114689_c1 nmdc:mga0sz30_114689_c1_159_785 189
1012 3300053077 Ga0495601_0141831 Ga0495601_0141831_466_1071 189
1013 3300053080 Ga0500635_0001974 Ga0500635_0001974_687_1316 189
1014 3300053080 Ga0500635_0031249 Ga0500635_0031249_342_971 189
1015 3300053084 Ga0495595_0000554 Ga0495595_0000554_6533_7138 189
1016 3300053085 Ga0495619_0425381 Ga0495619_0425381_67_696 189
1017 3300053096 Ga0500641_0133006 Ga0500641_0133006_264_890 189
1018 3300053119 Ga0500595_026055 Ga0500595_026055_286_915 189
1019 3300053139 Ga0500568_0096636 Ga0500568_0096636_437_1066 189
1020 3300053146 Ga0500588_0013956 Ga0500588_0013956_660_1286 189
1021 3300053147 Ga0500589_021876 Ga0500589_021876_2177_2806 189
1022 3300053148 Ga0500590_093943 Ga0500590_093943_425_1054 189
1023 3300053150 Ga0500603_000226 Ga0500603_000226_10140_10769 189
1024 3300053163 Ga0500639_048715 Ga0500639_048715_1476_2105 189
1025 3300053178 Ga0500637_0003349 Ga0500637_0003349_1436_2065 189
1026 3300053178 Ga0500637_0165132 Ga0500637_0165132_181_810 189
1027 3300053730 Ga0500645_012764 Ga0500645_012764_2061_2687 189

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eug-assembly1.cif.gz_n ytm1 associated nascent 60s ribosome state 3 0.8696 113 139
8eui-assembly1.cif.gz_n ytm1 associated nascent 60s ribosome (-fkbp39) state 3 0.8689 113 139
8ev3-assembly1.cif.gz_n ytm1 associated 60s nascent ribosome (-fkbp39) state 1b 0.862 113 141
8etg-assembly1.cif.gz_n fkbp39 associated 60s nascent ribosome state 3 0.8451 113 141
8fku-assembly1.cif.gz_SM human nucleolar pre-60s ribosomal subunit (state c2) 0.8448 113 139
ID Description Score Start End Superfamily
af_Q8IBZ4_29_132_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8355 12 44 2.40.50.140
af_A0A1D6MPP2_1_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8338 12 42 2.40.50.140
af_M9PDL2_134_240_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7685 12 48 2.40.50.140
5xyiE03 Mainly Beta;Roll;SH3 type barrels.; 0.7563 110 137 2.30.30.30
af_Q8I262_123_205_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7468 14 42 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2P9H572-F1-model_v4 DUF5666 domain-containing protein 0.9584 15 188
AF-A0A2S5TVB9-F1-model_v4 deleted 0.947 16 189
AF-A0A2P9H572-F1-model_v4 DUF5666 domain-containing protein 0.9426 15 188
AF-L2EHC2-F1-model_v4 deleted 0.9382 6 188
AF-A0A537QAT7-F1-model_v4 DUF5666 domain-containing protein 0.937 12 188

Feature Viewer

pLDDT pTM Quality
92.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map