F488533
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 493 | 952 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10067720|Ga0099795_100677202 |
| Length | 228 |
| Sequence | VFFPLPANTRERGKTMPEISSLMRRAVAAALTLSVLASSVLASVGWAQQPPPVRIRGTIESVDGAMLMIKSREGTDMKVRVTDNVAVFGVAKTEMSEIKPGSYIGVSAMPEPDGTQKALAVHIFPETQRGAAEGFRPWDLRPNSTMTNATVAETVKGTDGQNILVKYKDGEKKVVVPPDTPIVTFVAGDKSELKPGAKIIIFGAVKKDDGTLEANRVNVGRDGITPPM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 12 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 13 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 14 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 15 | 2791355199 | |||
| 16 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 17 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 18 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 19 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 20 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 21 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 22 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 23 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 24 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 25 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 26 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 27 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 28 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 29 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 30 | 2904699407 | |||
| 31 | 2906610324 | |||
| 32 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 33 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 34 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 35 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 36 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 37 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 38 | 2922425934 | |||
| 39 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 40 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 41 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 42 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 43 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 44 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 45 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 46 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 47 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 48 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 49 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 50 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 51 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 52 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 53 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 54 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 55 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 56 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 57 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 58 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 59 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 60 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 61 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 64 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 65 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 66 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 67 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 68 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 69 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 72 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 79 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 124 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 126 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 127 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 128 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 130 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 131 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 132 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 133 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 134 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 135 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 136 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 137 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 138 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 139 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 140 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 141 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 142 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 143 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 144 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 146 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 147 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 148 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 149 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 152 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 153 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 155 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 156 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 157 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 158 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 159 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 162 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 163 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 194 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 195 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 271 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 272 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 273 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 274 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 277 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 283 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 284 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 285 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 287 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 288 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 289 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 290 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 291 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 292 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 293 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 294 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 295 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 296 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 297 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 300 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 301 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 303 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 307 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 309 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 312 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 313 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 314 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 315 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 318 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 319 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 320 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 321 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 322 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 323 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 324 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 328 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 329 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 330 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 331 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 332 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 333 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 334 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 335 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 336 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 337 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 338 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 339 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 415 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 416 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 417 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 420 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 423 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 432 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 433 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 458 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 459 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 460 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 462 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 463 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 465 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 466 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 467 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 468 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 469 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 472 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 476 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 477 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 478 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 479 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 480 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 481 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 482 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 483 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 484 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 485 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 486 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 487 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 488 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 489 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 490 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 491 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 492 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 493 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 0.2 |
| Isolates | 6.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.52 |
| Nodule | 6.23 |
| Rhizoplane | 8.47 |
| Rhizosphere | 74.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_100531 | 3300001430 | Bacteria | 2004 |
| 2 | JGI24739J22299_10000871 | 3300001989 | Bacteria | 11154 |
| 3 | JGI24737J22298_10010529 | 3300001990 | Bacteria | 3050 |
| 4 | JGI24750J21931_1009691 | 3300002070 | Bacteria | 1244 |
| 5 | JGI24748J21848_1006767 | 3300002074 | Bacteria | 1338 |
| 6 | JGI24738J21930_10002474 | 3300002075 | Bacteria | 4827 |
| 7 | JGI24744J21845_10007283 | 3300002077 | Bacteria | 2286 |
| 8 | JGI24744J21845_10007868 | 3300002077 | Bacteria | 2201 |
| 9 | JGI24034J26672_10006652 | 3300002239 | Bacteria | 1669 |
| 10 | JGI24742J22300_10003578 | 3300002244 | Bacteria | 2525 |
| 11 | JGI25406J46586_10000064 | 3300003203 | Bacteria | 49110 |
| 12 | JGI25404J52841_10033318 | 3300003659 | Bacteria | 1098 |
| 13 | JGI25404J52841_10078960 | 3300003659 | Bacteria | 687 |
| 14 | Ga0058859_11740492 | 3300004798 | Bacteria | 739 |
| 15 | Ga0065715_10174306 | 3300005293 | Bacteria | 1523 |
| 16 | Ga0065715_10565648 | 3300005293 | Bacteria | 730 |
| 17 | Ga0070658_10710365 | 3300005327 | Bacteria | 873 |
| 18 | Ga0070676_10020837 | 3300005328 | Bacteria | 3665 |
| 19 | Ga0070683_100041896 | 3300005329 | Bacteria | 4215 |
| 20 | Ga0070690_100226054 | 3300005330 | Bacteria | 1313 |
| 21 | Ga0070690_100230852 | 3300005330 | Bacteria | 1301 |
| 22 | Ga0070670_100077132 | 3300005331 | Bacteria | 2863 |
| 23 | Ga0070670_100183096 | 3300005331 | Bacteria | 1819 |
| 24 | Ga0068869_100021302 | 3300005334 | Bacteria | 4458 |
| 25 | Ga0068869_100082663 | 3300005334 | Bacteria | 2400 |
| 26 | Ga0070680_100003647 | 3300005336 | Bacteria | 11501 |
| 27 | Ga0070680_100029856 | 3300005336 | Bacteria | 4377 |
| 28 | Ga0070680_100121614 | 3300005336 | Bacteria | 2180 |
| 29 | Ga0070680_100205891 | 3300005336 | Bacteria | 1659 |
| 30 | Ga0070680_100226621 | 3300005336 | Bacteria | 1578 |
| 31 | Ga0070682_100007969 | 3300005337 | Bacteria | 5962 |
| 32 | Ga0068868_100138279 | 3300005338 | Bacteria | 1998 |
| 33 | Ga0068868_100408198 | 3300005338 | Bacteria | 1173 |
| 34 | Ga0070660_100034303 | 3300005339 | Bacteria | 3833 |
| 35 | Ga0070660_100375198 | 3300005339 | Bacteria | 1174 |
| 36 | Ga0070689_100031062 | 3300005340 | Bacteria | 4058 |
| 37 | Ga0070689_100121015 | 3300005340 | Bacteria | 2091 |
| 38 | Ga0070689_100208226 | 3300005340 | Unclassified | 1600 |
| 39 | Ga0070689_100327516 | 3300005340 | Bacteria | 1281 |
| 40 | Ga0070691_10004859 | 3300005341 | Bacteria | 6121 |
| 41 | Ga0070687_100049605 | 3300005343 | Bacteria | 2164 |
| 42 | Ga0070687_100052564 | 3300005343 | Bacteria | 2115 |
| 43 | Ga0070661_100009866 | 3300005344 | Bacteria | 6624 |
| 44 | Ga0070692_10045412 | 3300005345 | Bacteria | 2266 |
| 45 | Ga0070692_10260157 | 3300005345 | Bacteria | 1043 |
| 46 | Ga0070668_100013726 | 3300005347 | Bacteria | 6051 |
| 47 | Ga0070668_100036445 | 3300005347 | Bacteria | 3754 |
| 48 | Ga0070668_100067131 | 3300005347 | Bacteria | 2785 |
| 49 | Ga0070668_100672016 | 3300005347 | Bacteria | 911 |
| 50 | Ga0070669_100014406 | 3300005353 | Bacteria | 5628 |
| 51 | Ga0070669_100035084 | 3300005353 | Bacteria | 3633 |
| 52 | Ga0070669_100093037 | 3300005353 | Bacteria | 2264 |
| 53 | Ga0070669_100434671 | 3300005353 | Bacteria | 1079 |
| 54 | Ga0070675_100018170 | 3300005354 | Bacteria | 5596 |
| 55 | Ga0070675_100732289 | 3300005354 | Bacteria | 902 |
| 56 | Ga0070671_100034258 | 3300005355 | Bacteria | 4203 |
| 57 | Ga0070671_100296361 | 3300005355 | Bacteria | 1377 |
| 58 | Ga0070671_100441341 | 3300005355 | Bacteria | 1116 |
| 59 | Ga0070674_100005693 | 3300005356 | Bacteria | 7227 |
| 60 | Ga0070674_100047397 | 3300005356 | Bacteria | 2944 |
| 61 | Ga0070673_100015849 | 3300005364 | Bacteria | 5308 |
| 62 | Ga0070688_100037805 | 3300005365 | Bacteria | 2943 |
| 63 | Ga0070688_100348498 | 3300005365 | Bacteria | 1084 |
| 64 | Ga0070688_100381848 | 3300005365 | Bacteria | 1039 |
| 65 | Ga0070659_100076576 | 3300005366 | Bacteria | 2667 |
| 66 | Ga0070659_100079331 | 3300005366 | Bacteria | 2620 |
| 67 | Ga0070659_100161364 | 3300005366 | Bacteria | 1833 |
| 68 | Ga0070659_100374802 | 3300005366 | Bacteria | 1198 |
| 69 | Ga0070659_100445386 | 3300005366 | Bacteria | 1098 |
| 70 | Ga0070667_100024258 | 3300005367 | Bacteria | 5037 |
| 71 | Ga0070667_100032997 | 3300005367 | Bacteria | 4322 |
| 72 | Ga0070667_100731541 | 3300005367 | Bacteria | 916 |
| 73 | Ga0070703_10003201 | 3300005406 | Bacteria | 4676 |
| 74 | Ga0070713_100003057 | 3300005436 | Bacteria | 10992 |
| 75 | Ga0070713_100347891 | 3300005436 | Unclassified | 1375 |
| 76 | Ga0070710_10106609 | 3300005437 | Bacteria | 1677 |
| 77 | Ga0070701_10004348 | 3300005438 | Bacteria | 5724 |
| 78 | Ga0070711_100077792 | 3300005439 | Bacteria | 2355 |
| 79 | Ga0070711_100591894 | 3300005439 | Bacteria | 924 |
| 80 | Ga0070705_100023373 | 3300005440 | Bacteria | 3318 |
| 81 | Ga0070705_100126002 | 3300005440 | Bacteria | 1662 |
| 82 | Ga0070705_100215842 | 3300005440 | Unclassified | 1325 |
| 83 | Ga0070700_100039431 | 3300005441 | Bacteria | 2885 |
| 84 | Ga0070694_100019693 | 3300005444 | Bacteria | 4294 |
| 85 | Ga0070694_100109804 | 3300005444 | Bacteria | 1963 |
| 86 | Ga0070708_100209630 | 3300005445 | Bacteria | 1826 |
| 87 | Ga0070708_100521341 | 3300005445 | Bacteria | 1121 |
| 88 | Ga0070708_100767105 | 3300005445 | Bacteria | 907 |
| 89 | Ga0070663_100027341 | 3300005455 | Bacteria | 3873 |
| 90 | Ga0070663_100059872 | 3300005455 | Bacteria | 2737 |
| 91 | Ga0070663_100082344 | 3300005455 | Bacteria | 2367 |
| 92 | Ga0070663_100679161 | 3300005455 | Bacteria | 873 |
| 93 | Ga0070678_100052290 | 3300005456 | Bacteria | 2965 |
| 94 | Ga0070678_100086184 | 3300005456 | Bacteria | 2395 |
| 95 | Ga0070662_100033312 | 3300005457 | Bacteria | 3626 |
| 96 | Ga0070662_100071711 | 3300005457 | Bacteria | 2555 |
| 97 | Ga0070662_100120688 | 3300005457 | Bacteria | 2009 |
| 98 | Ga0070681_10032947 | 3300005458 | Bacteria | 5201 |
| 99 | Ga0070681_10475268 | 3300005458 | Bacteria | 1162 |
| 100 | Ga0068867_100021271 | 3300005459 | Bacteria | 4629 |
| 101 | Ga0068867_100128077 | 3300005459 | Bacteria | 1969 |
| 102 | Ga0070685_10048441 | 3300005466 | Bacteria | 2447 |
| 103 | Ga0070706_100624318 | 3300005467 | Bacteria | 1001 |
| 104 | Ga0070684_100022473 | 3300005535 | Bacteria | 5261 |
| 105 | Ga0070684_100254112 | 3300005535 | Bacteria | 1606 |
| 106 | Ga0070697_100173177 | 3300005536 | Bacteria | 1827 |
| 107 | Ga0068853_100002207 | 3300005539 | Bacteria | 14542 |
| 108 | Ga0068853_100003634 | 3300005539 | Bacteria | 11828 |
| 109 | Ga0068853_100060238 | 3300005539 | Bacteria | 3279 |
| 110 | Ga0068853_100061086 | 3300005539 | Bacteria | 3259 |
| 111 | Ga0068853_100426138 | 3300005539 | Bacteria | 1245 |
| 112 | Ga0070672_100006742 | 3300005543 | Bacteria | 7744 |
| 113 | Ga0070686_100035110 | 3300005544 | Bacteria | 3094 |
| 114 | Ga0070695_100027274 | 3300005545 | Bacteria | 3537 |
| 115 | Ga0070696_100027513 | 3300005546 | Bacteria | 3875 |
| 116 | Ga0070693_100024374 | 3300005547 | Bacteria | 3244 |
| 117 | Ga0070665_100009777 | 3300005548 | Bacteria | 9699 |
| 118 | Ga0070665_100063185 | 3300005548 | Bacteria | 3712 |
| 119 | Ga0070665_100237840 | 3300005548 | Bacteria | 1822 |
| 120 | Ga0070665_100360172 | 3300005548 | Bacteria | 1460 |
| 121 | Ga0070665_100579006 | 3300005548 | Bacteria | 1135 |
| 122 | Ga0070665_101072015 | 3300005548 | Bacteria | 817 |
| 123 | Ga0070704_100025802 | 3300005549 | Bacteria | 3873 |
| 124 | Ga0070704_100208955 | 3300005549 | Bacteria | 1580 |
| 125 | Ga0068855_100018412 | 3300005563 | Bacteria | 8391 |
| 126 | Ga0068855_100099837 | 3300005563 | Bacteria | 3343 |
| 127 | Ga0068855_100121549 | 3300005563 | Bacteria | 2988 |
| 128 | Ga0070664_100069419 | 3300005564 | Bacteria | 3015 |
| 129 | Ga0070664_100118200 | 3300005564 | Bacteria | 2319 |
| 130 | Ga0068857_100038621 | 3300005577 | Bacteria | 4228 |
| 131 | Ga0068857_100124799 | 3300005577 | Bacteria | 2319 |
| 132 | Ga0068854_100016856 | 3300005578 | Bacteria | 4878 |
| 133 | Ga0068854_100246521 | 3300005578 | Bacteria | 1425 |
| 134 | Ga0068856_100074006 | 3300005614 | Bacteria | 3372 |
| 135 | Ga0070702_100058574 | 3300005615 | Bacteria | 2232 |
| 136 | Ga0070702_100091658 | 3300005615 | Unclassified | 1844 |
| 137 | Ga0070702_100108151 | 3300005615 | Bacteria | 1718 |
| 138 | Ga0068852_100024735 | 3300005616 | Bacteria | 4858 |
| 139 | Ga0068852_100028928 | 3300005616 | Bacteria | 4543 |
| 140 | Ga0068852_100135745 | 3300005616 | Bacteria | 2271 |
| 141 | Ga0068852_100321492 | 3300005616 | Bacteria | 1503 |
| 142 | Ga0068852_100597485 | 3300005616 | Bacteria | 1107 |
| 143 | Ga0068859_100035913 | 3300005617 | Bacteria | 4973 |
| 144 | Ga0068859_100096333 | 3300005617 | Bacteria | 3012 |
| 145 | Ga0068859_100279653 | 3300005617 | Bacteria | 1761 |
| 146 | Ga0068864_100026533 | 3300005618 | Bacteria | 4885 |
| 147 | Ga0068864_100459111 | 3300005618 | Bacteria | 1219 |
| 148 | Ga0068866_10100091 | 3300005718 | Bacteria | 1597 |
| 149 | Ga0068866_10195582 | 3300005718 | Unclassified | 1204 |
| 150 | Ga0068861_100019676 | 3300005719 | Bacteria | 4823 |
| 151 | Ga0068861_100042474 | 3300005719 | Bacteria | 3407 |
| 152 | Ga0068861_100048184 | 3300005719 | Bacteria | 3220 |
| 153 | Ga0068861_100111473 | 3300005719 | Bacteria | 2192 |
| 154 | Ga0068861_100214160 | 3300005719 | Bacteria | 1624 |
| 155 | Ga0068851_10206447 | 3300005834 | Bacteria | 1099 |
| 156 | Ga0068870_10026852 | 3300005840 | Bacteria | 2874 |
| 157 | Ga0068863_100006825 | 3300005841 | Bacteria | 11196 |
| 158 | Ga0068863_100142125 | 3300005841 | Bacteria | 2294 |
| 159 | Ga0068858_100057433 | 3300005842 | Bacteria | 3597 |
| 160 | Ga0068858_100079901 | 3300005842 | Bacteria | 3038 |
| 161 | Ga0068858_100484718 | 3300005842 | Bacteria | 1194 |
| 162 | Ga0068858_100806662 | 3300005842 | Unclassified | 916 |
| 163 | Ga0068860_100002033 | 3300005843 | Bacteria | 21319 |
| 164 | Ga0068860_100018432 | 3300005843 | Bacteria | 6790 |
| 165 | Ga0068860_100040901 | 3300005843 | Bacteria | 4429 |
| 166 | Ga0068860_100158101 | 3300005843 | Bacteria | 2184 |
| 167 | Ga0068860_100192601 | 3300005843 | Bacteria | 1973 |
| 168 | Ga0068860_101373457 | 3300005843 | Bacteria | 728 |
| 169 | Ga0068862_100010222 | 3300005844 | Bacteria | 7743 |
| 170 | Ga0068862_100028055 | 3300005844 | Bacteria | 4741 |
| 171 | Ga0068862_100083389 | 3300005844 | Bacteria | 2775 |
| 172 | Ga0068862_100342269 | 3300005844 | Bacteria | 1385 |
| 173 | Ga0081455_10000200 | 3300005937 | Bacteria | 76013 |
| 174 | Ga0081455_10033922 | 3300005937 | Bacteria | 4579 |
| 175 | Ga0081455_10051904 | 3300005937 | Bacteria | 3515 |
| 176 | Ga0081455_10091058 | 3300005937 | Bacteria | 2471 |
| 177 | Ga0081455_10114395 | 3300005937 | Bacteria | 2138 |
| 178 | Ga0081538_10011493 | 3300005981 | Bacteria | 7167 |
| 179 | Ga0081540_1002062 | 3300005983 | Bacteria | 16766 |
| 180 | Ga0081540_1004242 | 3300005983 | Bacteria | 11009 |
| 181 | Ga0081540_1012946 | 3300005983 | Bacteria | 5450 |
| 182 | Ga0081540_1021026 | 3300005983 | Bacteria | 3904 |
| 183 | Ga0081540_1070985 | 3300005983 | Bacteria | 1611 |
| 184 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 185 | Ga0070717_10003779 | 3300006028 | Bacteria | 10878 |
| 186 | Ga0070717_10004793 | 3300006028 | Bacteria | 9837 |
| 187 | Ga0070717_10082660 | 3300006028 | Bacteria | 2699 |
| 188 | Ga0075365_10012654 | 3300006038 | Bacteria | 5020 |
| 189 | Ga0075368_10010256 | 3300006042 | Bacteria | 3384 |
| 190 | Ga0075368_10197072 | 3300006042 | Bacteria | 852 |
| 191 | Ga0075363_100005067 | 3300006048 | Bacteria | 5827 |
| 192 | Ga0075363_100011785 | 3300006048 | Bacteria | 4195 |
| 193 | Ga0075363_100223399 | 3300006048 | Bacteria | 1080 |
| 194 | Ga0075363_100476049 | 3300006048 | Bacteria | 740 |
| 195 | Ga0075364_10115711 | 3300006051 | Bacteria | 1792 |
| 196 | Ga0075364_10263586 | 3300006051 | Bacteria | 1171 |
| 197 | Ga0070716_100235027 | 3300006173 | Bacteria | 1240 |
| 198 | Ga0070712_100062605 | 3300006175 | Bacteria | 2631 |
| 199 | Ga0070712_100233934 | 3300006175 | Bacteria | 1461 |
| 200 | Ga0075367_10013887 | 3300006178 | Bacteria | 4344 |
| 201 | Ga0075367_10021083 | 3300006178 | Bacteria | 3638 |
| 202 | Ga0075366_10027167 | 3300006195 | Bacteria | 3357 |
| 203 | Ga0075366_10225549 | 3300006195 | Bacteria | 1141 |
| 204 | Ga0075366_10284461 | 3300006195 | Bacteria | 1011 |
| 205 | Ga0097621_100007897 | 3300006237 | Bacteria | 7631 |
| 206 | Ga0097621_100053560 | 3300006237 | Bacteria | 3289 |
| 207 | Ga0097621_100302683 | 3300006237 | Bacteria | 1412 |
| 208 | Ga0075370_10003183 | 3300006353 | Bacteria | 7771 |
| 209 | Ga0075370_10104230 | 3300006353 | Bacteria | 1643 |
| 210 | Ga0075370_10401972 | 3300006353 | Bacteria | 822 |
| 211 | Ga0068871_100029425 | 3300006358 | Bacteria | 4314 |
| 212 | Ga0075428_100300564 | 3300006844 | Bacteria | 1725 |
| 213 | Ga0075433_10025119 | 3300006852 | Bacteria | 5036 |
| 214 | Ga0075433_10201324 | 3300006852 | Bacteria | 1770 |
| 215 | Ga0075434_100008091 | 3300006871 | Bacteria | 9750 |
| 216 | Ga0075434_100021009 | 3300006871 | Bacteria | 6341 |
| 217 | Ga0068865_100001544 | 3300006881 | Bacteria | 13429 |
| 218 | Ga0068865_100216332 | 3300006881 | Bacteria | 1496 |
| 219 | Ga0097620_100035916 | 3300006931 | Bacteria | 4973 |
| 220 | Ga0097620_100096333 | 3300006931 | Bacteria | 3012 |
| 221 | Ga0097620_100279657 | 3300006931 | Bacteria | 1761 |
| 222 | Ga0075435_100603384 | 3300007076 | Unclassified | 952 |
| 223 | Ga0099795_10033214 | 3300007788 | Bacteria | 1790 |
| 224 | Ga0099795_10067720 | 3300007788 | Bacteria | 1340 |
| 225 | Ga0099795_10235779 | 3300007788 | Bacteria | 784 |
| 226 | Ga0105244_10185079 | 3300009036 | Bacteria | 987 |
| 227 | Ga0105250_10043606 | 3300009092 | Bacteria | 1798 |
| 228 | Ga0105250_10122793 | 3300009092 | Bacteria | 1069 |
| 229 | Ga0105240_10012128 | 3300009093 | Bacteria | 11932 |
| 230 | Ga0105240_10140846 | 3300009093 | Bacteria | 2884 |
| 231 | Ga0111539_10001808 | 3300009094 | Bacteria | 28479 |
| 232 | Ga0111539_10057213 | 3300009094 | Bacteria | 4631 |
| 233 | Ga0111539_10739166 | 3300009094 | Bacteria | 1145 |
| 234 | Ga0105245_10014034 | 3300009098 | Bacteria | 6976 |
| 235 | Ga0105245_10060262 | 3300009098 | Bacteria | 3418 |
| 236 | Ga0105245_10514256 | 3300009098 | Bacteria | 1215 |
| 237 | Ga0105247_10087187 | 3300009101 | Bacteria | 1976 |
| 238 | Ga0105247_10143497 | 3300009101 | Bacteria | 1567 |
| 239 | Ga0105247_10167620 | 3300009101 | Bacteria | 1458 |
| 240 | Ga0105243_10139000 | 3300009148 | Bacteria | 2070 |
| 241 | Ga0105243_10162608 | 3300009148 | Bacteria | 1926 |
| 242 | Ga0105243_10241861 | 3300009148 | Bacteria | 1607 |
| 243 | Ga0105241_10031108 | 3300009174 | Bacteria | 3994 |
| 244 | Ga0105241_10272783 | 3300009174 | Bacteria | 1442 |
| 245 | Ga0105241_10649305 | 3300009174 | Bacteria | 958 |
| 246 | Ga0105242_10153900 | 3300009176 | Unclassified | 2007 |
| 247 | Ga0105242_10204421 | 3300009176 | Bacteria | 1756 |
| 248 | Ga0105248_10005933 | 3300009177 | Bacteria | 13426 |
| 249 | Ga0105248_10011779 | 3300009177 | Bacteria | 9647 |
| 250 | Ga0105248_10029891 | 3300009177 | Bacteria | 6080 |
| 251 | Ga0105248_10034176 | 3300009177 | Bacteria | 5684 |
| 252 | Ga0105237_10004719 | 3300009545 | Bacteria | 15684 |
| 253 | Ga0105237_10007432 | 3300009545 | Bacteria | 11993 |
| 254 | Ga0105237_10070348 | 3300009545 | Bacteria | 3495 |
| 255 | Ga0105237_10599999 | 3300009545 | Bacteria | 1108 |
| 256 | Ga0105238_10003421 | 3300009551 | Bacteria | 15825 |
| 257 | Ga0105238_10436192 | 3300009551 | Bacteria | 1306 |
| 258 | Ga0105238_10935501 | 3300009551 | Bacteria | 886 |
| 259 | Ga0105249_10014723 | 3300009553 | Bacteria | 6914 |
| 260 | Ga0105249_10019871 | 3300009553 | Bacteria | 5999 |
| 261 | Ga0105249_10528641 | 3300009553 | Bacteria | 1228 |
| 262 | Ga0099796_10022143 | 3300010159 | Bacteria | 1968 |
| 263 | Ga0099796_10055610 | 3300010159 | Bacteria | 1387 |
| 264 | Ga0099796_10130836 | 3300010159 | Bacteria | 973 |
| 265 | Ga0105239_10023212 | 3300010375 | Bacteria | 6836 |
| 266 | Ga0105239_10053470 | 3300010375 | Bacteria | 4430 |
| 267 | Ga0105239_10102667 | 3300010375 | Bacteria | 3164 |
| 268 | Ga0105239_10783691 | 3300010375 | Bacteria | 1092 |
| 269 | Ga0105239_10797822 | 3300010375 | Bacteria | 1082 |
| 270 | Ga0105239_11371603 | 3300010375 | Bacteria | 816 |
| 271 | Ga0105246_10032205 | 3300011119 | Bacteria | 3475 |
| 272 | Ga0105246_10079330 | 3300011119 | Bacteria | 2334 |
| 273 | Ga0105246_10597510 | 3300011119 | Bacteria | 953 |
| 274 | Ga0157373_10024897 | 3300013100 | Bacteria | 4334 |
| 275 | Ga0157373_10298226 | 3300013100 | Unclassified | 1144 |
| 276 | Ga0157370_10101962 | 3300013104 | Bacteria | 2688 |
| 277 | Ga0157369_10065365 | 3300013105 | Bacteria | 3914 |
| 278 | Ga0157369_10315863 | 3300013105 | Bacteria | 1624 |
| 279 | Ga0157374_10411201 | 3300013296 | Bacteria | 1351 |
| 280 | Ga0157378_10031566 | 3300013297 | Bacteria | 4679 |
| 281 | Ga0157378_10086387 | 3300013297 | Bacteria | 2844 |
| 282 | Ga0157378_10104776 | 3300013297 | Bacteria | 2586 |
| 283 | Ga0157378_10258421 | 3300013297 | Unclassified | 1670 |
| 284 | Ga0163162_10022234 | 3300013306 | Bacteria | 6250 |
| 285 | Ga0163162_10053512 | 3300013306 | Bacteria | 4057 |
| 286 | Ga0163162_10602920 | 3300013306 | Bacteria | 1224 |
| 287 | Ga0157372_10016582 | 3300013307 | Bacteria | 7904 |
| 288 | Ga0157372_10186079 | 3300013307 | Bacteria | 2405 |
| 289 | Ga0157375_10084799 | 3300013308 | Bacteria | 3217 |
| 290 | Ga0157375_10261478 | 3300013308 | Bacteria | 1892 |
| 291 | Ga0157375_10298866 | 3300013308 | Bacteria | 1773 |
| 292 | Ga0163163_10016805 | 3300014325 | Bacteria | 6811 |
| 293 | Ga0163163_10226212 | 3300014325 | Unclassified | 1920 |
| 294 | Ga0157380_10100984 | 3300014326 | Bacteria | 2403 |
| 295 | Ga0157377_10013798 | 3300014745 | Bacteria | 4096 |
| 296 | Ga0157379_10089794 | 3300014968 | Bacteria | 2756 |
| 297 | Ga0157379_10153801 | 3300014968 | Bacteria | 2075 |
| 298 | Ga0157379_10848577 | 3300014968 | Bacteria | 864 |
| 299 | Ga0157376_10006128 | 3300014969 | Bacteria | 8466 |
| 300 | Ga0157376_10135746 | 3300014969 | Bacteria | 2201 |
| 301 | Ga0157376_10217613 | 3300014969 | Unclassified | 1767 |
| 302 | Ga0163161_10006229 | 3300017792 | Bacteria | 8265 |
| 303 | Ga0163161_10675526 | 3300017792 | Bacteria | 858 |
| 304 | Ga0213876_10340105 | 3300021384 | Bacteria | 798 |
| 305 | Ga0213875_10034248 | 3300021388 | Bacteria | 2398 |
| 306 | Ga0209233_1005084 | 3300025261 | Bacteria | 4400 |
| 307 | Ga0207666_1000311 | 3300025271 | Bacteria | 6768 |
| 308 | Ga0207673_1003304 | 3300025290 | Bacteria | 1880 |
| 309 | Ga0209758_1001737 | 3300025297 | Bacteria | 24275 |
| 310 | Ga0209758_1003580 | 3300025297 | Bacteria | 13909 |
| 311 | Ga0207697_10006626 | 3300025315 | Bacteria | 5222 |
| 312 | Ga0207653_10002805 | 3300025885 | Bacteria | 5539 |
| 313 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 314 | Ga0207682_10014469 | 3300025893 | Bacteria | 3074 |
| 315 | Ga0207692_10092310 | 3300025898 | Bacteria | 1645 |
| 316 | Ga0207642_10044313 | 3300025899 | Bacteria | 1968 |
| 317 | Ga0207710_10002730 | 3300025900 | Bacteria | 8088 |
| 318 | Ga0207688_10000892 | 3300025901 | Bacteria | 15087 |
| 319 | Ga0207688_10094545 | 3300025901 | Bacteria | 1719 |
| 320 | Ga0207647_10002160 | 3300025904 | Bacteria | 15015 |
| 321 | Ga0207685_10406230 | 3300025905 | Bacteria | 699 |
| 322 | Ga0207645_10000999 | 3300025907 | Bacteria | 23365 |
| 323 | Ga0207645_10194083 | 3300025907 | Bacteria | 1335 |
| 324 | Ga0207643_10006739 | 3300025908 | Bacteria | 6161 |
| 325 | Ga0207705_10522401 | 3300025909 | Bacteria | 922 |
| 326 | Ga0207705_10596831 | 3300025909 | Bacteria | 859 |
| 327 | Ga0207654_10236456 | 3300025911 | Bacteria | 1219 |
| 328 | Ga0207654_10401528 | 3300025911 | Bacteria | 953 |
| 329 | Ga0207707_10002224 | 3300025912 | Bacteria | 17529 |
| 330 | Ga0207707_10020542 | 3300025912 | Bacteria | 5767 |
| 331 | Ga0207695_10046019 | 3300025913 | Bacteria | 4626 |
| 332 | Ga0207671_10035416 | 3300025914 | Bacteria | 3705 |
| 333 | Ga0207671_10064994 | 3300025914 | Bacteria | 2713 |
| 334 | Ga0207671_10077969 | 3300025914 | Bacteria | 2481 |
| 335 | Ga0207671_10180264 | 3300025914 | Bacteria | 1644 |
| 336 | Ga0207693_10018708 | 3300025915 | Bacteria | 5514 |
| 337 | Ga0207693_10205162 | 3300025915 | Bacteria | 1550 |
| 338 | Ga0207693_10227981 | 3300025915 | Bacteria | 1463 |
| 339 | Ga0207663_10132464 | 3300025916 | Bacteria | 1724 |
| 340 | Ga0207663_10599911 | 3300025916 | Bacteria | 865 |
| 341 | Ga0207660_10001283 | 3300025917 | Bacteria | 16867 |
| 342 | Ga0207660_10010206 | 3300025917 | Bacteria | 6087 |
| 343 | Ga0207660_10294273 | 3300025917 | Bacteria | 1291 |
| 344 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 345 | Ga0207662_10037874 | 3300025918 | Bacteria | 2825 |
| 346 | Ga0207657_10005246 | 3300025919 | Bacteria | 13576 |
| 347 | Ga0207657_10018108 | 3300025919 | Bacteria | 6739 |
| 348 | Ga0207657_10044766 | 3300025919 | Bacteria | 3889 |
| 349 | Ga0207657_10546461 | 3300025919 | Bacteria | 906 |
| 350 | Ga0207649_10002186 | 3300025920 | Bacteria | 11047 |
| 351 | Ga0207652_10004348 | 3300025921 | Bacteria | 11546 |
| 352 | Ga0207652_10035191 | 3300025921 | Bacteria | 4225 |
| 353 | Ga0207681_10007074 | 3300025923 | Bacteria | 6881 |
| 354 | Ga0207681_10068564 | 3300025923 | Bacteria | 2464 |
| 355 | Ga0207681_10248997 | 3300025923 | Bacteria | 1386 |
| 356 | Ga0207694_10075578 | 3300025924 | Bacteria | 2637 |
| 357 | Ga0207694_10082962 | 3300025924 | Bacteria | 2520 |
| 358 | Ga0207694_10318994 | 3300025924 | Bacteria | 1282 |
| 359 | Ga0207650_10190498 | 3300025925 | Bacteria | 1638 |
| 360 | Ga0207650_10388174 | 3300025925 | Bacteria | 1154 |
| 361 | Ga0207650_10669745 | 3300025925 | Bacteria | 875 |
| 362 | Ga0207659_10030381 | 3300025926 | Bacteria | 3691 |
| 363 | Ga0207659_10262721 | 3300025926 | Bacteria | 1405 |
| 364 | Ga0207687_10001197 | 3300025927 | Bacteria | 17741 |
| 365 | Ga0207687_10002549 | 3300025927 | Bacteria | 12372 |
| 366 | Ga0207700_10055969 | 3300025928 | Bacteria | 2967 |
| 367 | Ga0207700_10092879 | 3300025928 | Bacteria | 2387 |
| 368 | Ga0207700_10144687 | 3300025928 | Bacteria | 1958 |
| 369 | Ga0207700_10469555 | 3300025928 | Bacteria | 1111 |
| 370 | Ga0207664_10152833 | 3300025929 | Bacteria | 1962 |
| 371 | Ga0207664_10375743 | 3300025929 | Bacteria | 1261 |
| 372 | Ga0207664_10828401 | 3300025929 | Bacteria | 832 |
| 373 | Ga0207644_10036076 | 3300025931 | Bacteria | 3469 |
| 374 | Ga0207644_10066815 | 3300025931 | Bacteria | 2619 |
| 375 | Ga0207644_10365892 | 3300025931 | Bacteria | 1174 |
| 376 | Ga0207690_10011755 | 3300025932 | Bacteria | 5236 |
| 377 | Ga0207690_10310657 | 3300025932 | Bacteria | 1236 |
| 378 | Ga0207706_10005363 | 3300025933 | Bacteria | 11952 |
| 379 | Ga0207706_10040844 | 3300025933 | Bacteria | 4112 |
| 380 | Ga0207706_10103304 | 3300025933 | Bacteria | 2507 |
| 381 | Ga0207686_10001310 | 3300025934 | Bacteria | 14258 |
| 382 | Ga0207686_10274618 | 3300025934 | Bacteria | 1241 |
| 383 | Ga0207709_10006190 | 3300025935 | Bacteria | 6736 |
| 384 | Ga0207709_10012682 | 3300025935 | Bacteria | 4646 |
| 385 | Ga0207709_10688635 | 3300025935 | Bacteria | 817 |
| 386 | Ga0207670_10013997 | 3300025936 | Bacteria | 4749 |
| 387 | Ga0207670_10118723 | 3300025936 | Bacteria | 1919 |
| 388 | Ga0207670_10194202 | 3300025936 | Unclassified | 1538 |
| 389 | Ga0207670_10406048 | 3300025936 | Bacteria | 1090 |
| 390 | Ga0207669_10001324 | 3300025937 | Bacteria | 10540 |
| 391 | Ga0207669_10157264 | 3300025937 | Bacteria | 1600 |
| 392 | Ga0207669_10659658 | 3300025937 | Bacteria | 856 |
| 393 | Ga0207704_10003457 | 3300025938 | Bacteria | 7181 |
| 394 | Ga0207665_10198325 | 3300025939 | Bacteria | 1461 |
| 395 | Ga0207691_10002604 | 3300025940 | Bacteria | 17616 |
| 396 | Ga0207691_10159553 | 3300025940 | Bacteria | 1979 |
| 397 | Ga0207711_10031474 | 3300025941 | Bacteria | 4479 |
| 398 | Ga0207711_10073623 | 3300025941 | Bacteria | 2969 |
| 399 | Ga0207711_10101876 | 3300025941 | Bacteria | 2541 |
| 400 | Ga0207711_10218792 | 3300025941 | Bacteria | 1741 |
| 401 | Ga0207689_10001156 | 3300025942 | Bacteria | 25400 |
| 402 | Ga0207689_10038650 | 3300025942 | Bacteria | 3952 |
| 403 | Ga0207689_10049010 | 3300025942 | Bacteria | 3485 |
| 404 | Ga0207689_10087744 | 3300025942 | Bacteria | 2555 |
| 405 | Ga0207661_10007789 | 3300025944 | Bacteria | 7627 |
| 406 | Ga0207679_10004160 | 3300025945 | Bacteria | 8991 |
| 407 | Ga0207667_10012980 | 3300025949 | Bacteria | 9561 |
| 408 | Ga0207667_10077987 | 3300025949 | Bacteria | 3434 |
| 409 | Ga0207667_10095327 | 3300025949 | Bacteria | 3072 |
| 410 | Ga0207667_10310444 | 3300025949 | Bacteria | 1611 |
| 411 | Ga0207667_10507823 | 3300025949 | Bacteria | 1222 |
| 412 | Ga0207667_10961565 | 3300025949 | Bacteria | 843 |
| 413 | Ga0207651_10087185 | 3300025960 | Bacteria | 2271 |
| 414 | Ga0207651_10328099 | 3300025960 | Bacteria | 1281 |
| 415 | Ga0207712_10000579 | 3300025961 | Bacteria | 29666 |
| 416 | Ga0207712_10252552 | 3300025961 | Bacteria | 1426 |
| 417 | Ga0207668_10001403 | 3300025972 | Bacteria | 14194 |
| 418 | Ga0207668_10005581 | 3300025972 | Bacteria | 7417 |
| 419 | Ga0207668_10032114 | 3300025972 | Bacteria | 3465 |
| 420 | Ga0207668_10033457 | 3300025972 | Bacteria | 3405 |
| 421 | Ga0207668_10079730 | 3300025972 | Bacteria | 2369 |
| 422 | Ga0207668_10481642 | 3300025972 | Bacteria | 1064 |
| 423 | Ga0207640_10003644 | 3300025981 | Bacteria | 8306 |
| 424 | Ga0207658_10113485 | 3300025986 | Bacteria | 2147 |
| 425 | Ga0207658_10359771 | 3300025986 | Bacteria | 1269 |
| 426 | Ga0207658_10372366 | 3300025986 | Bacteria | 1249 |
| 427 | Ga0207658_10608626 | 3300025986 | Unclassified | 982 |
| 428 | Ga0207658_10639432 | 3300025986 | Bacteria | 958 |
| 429 | Ga0207703_10014416 | 3300026035 | Bacteria | 6164 |
| 430 | Ga0207703_10032293 | 3300026035 | Bacteria | 4143 |
| 431 | Ga0207639_10001866 | 3300026041 | Bacteria | 14170 |
| 432 | Ga0207639_10117459 | 3300026041 | Bacteria | 2180 |
| 433 | Ga0207639_10128563 | 3300026041 | Bacteria | 2094 |
| 434 | Ga0207639_10547058 | 3300026041 | Bacteria | 1062 |
| 435 | Ga0207678_10027315 | 3300026067 | Bacteria | 4977 |
| 436 | Ga0207678_10033660 | 3300026067 | Bacteria | 4464 |
| 437 | Ga0207678_10042596 | 3300026067 | Bacteria | 3932 |
| 438 | Ga0207678_10048901 | 3300026067 | Bacteria | 3654 |
| 439 | Ga0207678_10062786 | 3300026067 | Bacteria | 3193 |
| 440 | Ga0207678_10080462 | 3300026067 | Bacteria | 2789 |
| 441 | Ga0207678_10080882 | 3300026067 | Bacteria | 2781 |
| 442 | Ga0207678_10222167 | 3300026067 | Bacteria | 1617 |
| 443 | Ga0207708_10020931 | 3300026075 | Bacteria | 4935 |
| 444 | Ga0207708_10023687 | 3300026075 | Bacteria | 4641 |
| 445 | Ga0207708_10050635 | 3300026075 | Bacteria | 3162 |
| 446 | Ga0207708_10480363 | 3300026075 | Bacteria | 1039 |
| 447 | Ga0207702_10010946 | 3300026078 | Bacteria | 7566 |
| 448 | Ga0207702_10257067 | 3300026078 | Bacteria | 1643 |
| 449 | Ga0207702_10359494 | 3300026078 | Bacteria | 1395 |
| 450 | Ga0207641_10006404 | 3300026088 | Bacteria | 9923 |
| 451 | Ga0207641_10171571 | 3300026088 | Bacteria | 1980 |
| 452 | Ga0207641_10315377 | 3300026088 | Unclassified | 1481 |
| 453 | Ga0207648_10004627 | 3300026089 | Bacteria | 14090 |
| 454 | Ga0207648_10046915 | 3300026089 | Bacteria | 3787 |
| 455 | Ga0207648_10807228 | 3300026089 | Bacteria | 874 |
| 456 | Ga0207676_10030863 | 3300026095 | Bacteria | 4026 |
| 457 | Ga0207676_10282270 | 3300026095 | Bacteria | 1508 |
| 458 | Ga0207674_10094104 | 3300026116 | Bacteria | 2983 |
| 459 | Ga0207674_10112597 | 3300026116 | Bacteria | 2695 |
| 460 | Ga0207674_10530319 | 3300026116 | Bacteria | 1137 |
| 461 | Ga0207675_100003859 | 3300026118 | Bacteria | 14570 |
| 462 | Ga0207683_10000850 | 3300026121 | Bacteria | 28050 |
| 463 | Ga0207683_10051919 | 3300026121 | Bacteria | 3592 |
| 464 | Ga0207683_10075790 | 3300026121 | Bacteria | 2978 |
| 465 | Ga0207683_10176198 | 3300026121 | Bacteria | 1938 |
| 466 | Ga0207698_10087412 | 3300026142 | Bacteria | 2539 |
| 467 | Ga0207698_10089661 | 3300026142 | Bacteria | 2512 |
| 468 | Ga0207698_10636350 | 3300026142 | Bacteria | 1055 |
| 469 | Ga0209984_1018261 | 3300027424 | Bacteria | 947 |
| 470 | Ga0210002_1003557 | 3300027617 | Bacteria | 2298 |
| 471 | Ga0209998_10002588 | 3300027717 | Bacteria | 4111 |
| 472 | Ga0209813_10105597 | 3300027866 | Bacteria | 964 |
| 473 | Ga0209974_10003747 | 3300027876 | Bacteria | 5444 |
| 474 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 475 | Ga0207428_10459443 | 3300027907 | Bacteria | 928 |
| 476 | Ga0268266_10012217 | 3300028379 | Bacteria | 7429 |
| 477 | Ga0268266_10013853 | 3300028379 | Bacteria | 6942 |
| 478 | Ga0268266_10164400 | 3300028379 | Bacteria | 2009 |
| 479 | Ga0268266_10227310 | 3300028379 | Bacteria | 1717 |
| 480 | Ga0268266_10363782 | 3300028379 | Bacteria | 1361 |
| 481 | Ga0268266_10559329 | 3300028379 | Bacteria | 1096 |
| 482 | Ga0268265_10004025 | 3300028380 | Bacteria | 10352 |
| 483 | Ga0268265_10022554 | 3300028380 | Bacteria | 4425 |
| 484 | Ga0268265_10079812 | 3300028380 | Bacteria | 2578 |
| 485 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 486 | Ga0268264_10049152 | 3300028381 | Bacteria | 3508 |
| 487 | Ga0268264_10102694 | 3300028381 | Bacteria | 2488 |
| 488 | Ga0268264_10158236 | 3300028381 | Bacteria | 2038 |
| 489 | Ga0268264_10756675 | 3300028381 | Bacteria | 968 |
| 490 | Ga0265334_10031226 | 3300028573 | Bacteria | 2130 |
| 491 | Ga0307517_10000859 | 3300028786 | Bacteria | 51881 |
| 492 | Ga0307511_10032093 | 3300030521 | Bacteria | 4676 |
| 493 | Ga0307512_10244813 | 3300030522 | Bacteria | 902 |
| 494 | Ga0265330_10052577 | 3300031235 | Bacteria | 1784 |
| 495 | Ga0265332_10029296 | 3300031238 | Bacteria | 2407 |
| 496 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 497 | Ga0265339_10303624 | 3300031249 | Bacteria | 760 |
| 498 | Ga0265331_10110613 | 3300031250 | Bacteria | 1260 |
| 499 | Ga0307513_10377142 | 3300031456 | Bacteria | 1159 |
| 500 | Ga0307509_10006398 | 3300031507 | Bacteria | 15864 |
| 501 | Ga0307509_10082116 | 3300031507 | Bacteria | 3325 |
| 502 | Ga0307408_100180430 | 3300031548 | Bacteria | 1693 |
| 503 | Ga0307408_100715716 | 3300031548 | Bacteria | 901 |
| 504 | Ga0265313_10067069 | 3300031595 | Bacteria | 1661 |
| 505 | Ga0265313_10117892 | 3300031595 | Bacteria | 1161 |
| 506 | Ga0307508_10494422 | 3300031616 | Bacteria | 817 |
| 507 | Ga0307516_10059646 | 3300031730 | Bacteria | 3710 |
| 508 | Ga0307516_10060402 | 3300031730 | Bacteria | 3683 |
| 509 | Ga0307405_10595972 | 3300031731 | Bacteria | 901 |
| 510 | Ga0307405_11002876 | 3300031731 | Bacteria | 712 |
| 511 | Ga0307413_10038231 | 3300031824 | Bacteria | 2780 |
| 512 | Ga0307413_10491927 | 3300031824 | Bacteria | 983 |
| 513 | Ga0307407_10258970 | 3300031903 | Bacteria | 1196 |
| 514 | Ga0307409_100021933 | 3300031995 | Bacteria | 4391 |
| 515 | Ga0307416_100558321 | 3300032002 | Bacteria | 1219 |
| 516 | Ga0307415_100004684 | 3300032126 | Bacteria | 7153 |
| 517 | Ga0307507_10028588 | 3300033179 | Bacteria | 5937 |
| 518 | Ga0307510_10019115 | 3300033180 | Bacteria | 8037 |
| 519 | Ga0307510_10201911 | 3300033180 | Bacteria | 1522 |
| 520 | Ga0315911_1000040 | 3300033442 | Bacteria | 50766 |
| 521 | Ga0316215_1000931 | 3300033544 | Bacteria | 2860 |
| 522 | Ga0373930_0002256 | 3300034816 | Bacteria | 2972 |
| 523 | Ga0373948_0001906 | 3300034817 | Bacteria | 2989 |
| 524 | Ga0373950_0013019 | 3300034818 | Bacteria | 1382 |
| 525 | Ga0373959_0008747 | 3300034820 | Bacteria | 1731 |
| 526 | Ga0373926_0054548 | 3300035083 | Bacteria | 1448 |
| 527 | Ga0373926_0083666 | 3300035083 | Bacteria | 1182 |
| 528 | Ga0373929_0006845 | 3300035085 | Bacteria | 2070 |
| 529 | Ga0373929_0007992 | 3300035085 | Bacteria | 1945 |
| 530 | Ga0373951_0029322 | 3300035091 | Bacteria | 1292 |
| 531 | Ga0373952_0000933 | 3300035092 | Bacteria | 5313 |
| 532 | Ga0373923_0003867 | 3300035111 | Bacteria | 4879 |
| 533 | Ga0373923_0021124 | 3300035111 | Bacteria | 2538 |
| 534 | Ga0373923_0027670 | 3300035111 | Bacteria | 2263 |
| 535 | Ga0373932_0003751 | 3300035112 | Bacteria | 3626 |
| 536 | Ga0373936_0006062 | 3300035113 | Bacteria | 4555 |
| 537 | Ga0373936_0179144 | 3300035113 | Bacteria | 929 |
| 538 | Ga0373939_0003090 | 3300035114 | Bacteria | 3908 |
| 539 | Ga0373941_0013201 | 3300035115 | Bacteria | 2178 |
| 540 | Ga0373953_0012482 | 3300035117 | Bacteria | 3010 |
| 541 | Ga0373953_0018244 | 3300035117 | Plasmid | 2594 |
| 542 | Ga0373953_0066408 | 3300035117 | Bacteria | 1482 |
| 543 | Ga0373954_0000213 | 3300035118 | Bacteria | 21171 |
| 544 | Ga0373954_0001219 | 3300035118 | Bacteria | 10343 |
| 545 | Ga0373954_0008152 | 3300035118 | Bacteria | 4590 |
| 546 | Ga0373954_0015754 | 3300035118 | Bacteria | 3381 |
| 547 | Ga0373954_0349097 | 3300035118 | Bacteria | 731 |
| 548 | Ga0373956_0004720 | 3300035119 | Bacteria | 5448 |
| 549 | Ga0373956_0112176 | 3300035119 | Bacteria | 1270 |
| 550 | Ga0373957_0003464 | 3300035120 | Bacteria | 4665 |
| 551 | Ga0373957_0182082 | 3300035120 | Bacteria | 871 |
| 552 | Ga0373960_0006476 | 3300035121 | Bacteria | 2749 |
| 553 | Ga0373943_0005037 | 3300035170 | Bacteria | 5958 |
| 554 | Ga0373943_0066209 | 3300035170 | Bacteria | 1819 |
| 555 | Ga0373943_0255544 | 3300035170 | Bacteria | 985 |
| 556 | Ga0373955_0002049 | 3300035172 | Bacteria | 8671 |
| 557 | Ga0373955_0012895 | 3300035172 | Plasmid | 4029 |
| 558 | Ga0373955_0241240 | 3300035172 | Bacteria | 1082 |
| 559 | Ga0373955_0503749 | 3300035172 | Bacteria | 739 |
| 560 | Ga0373942_0027318 | 3300035207 | Bacteria | 1484 |
| 561 | Ga0373961_0036817 | 3300035241 | Bacteria | 1395 |
| 562 | Ga0373962_0009071 | 3300035242 | Bacteria | 2457 |
| 563 | Ga0373924_0007721 | 3300035410 | Bacteria | 3888 |
| 564 | Ga0373924_0014698 | 3300035410 | Bacteria | 2961 |
| 565 | Ga0373931_0002611 | 3300035691 | Bacteria | 8014 |
| 566 | Ga0373931_0004766 | 3300035691 | Bacteria | 6220 |
| 567 | Ga0373935_0000942 | 3300035692 | Bacteria | 15748 |
| 568 | Ga0373935_0057406 | 3300035692 | Unclassified | 2483 |
| 569 | Ga0373927_0000528 | 3300035695 | Bacteria | 29016 |
| 570 | Ga0373927_0007183 | 3300035695 | Bacteria | 7558 |
| 571 | Ga0373927_0064676 | 3300035695 | Bacteria | 2366 |
| 572 | Ga0373927_0089359 | 3300035695 | Bacteria | 2000 |
| 573 | Ga0373927_0202177 | 3300035695 | Bacteria | 1304 |
| 574 | Ga0373927_0327937 | 3300035695 | Bacteria | 1008 |
| 575 | Ga0373933_0010853 | 3300035724 | Bacteria | 4999 |
| 576 | Ga0373933_0034817 | 3300035724 | Plasmid | 2937 |
| 577 | Ga0373933_0112377 | 3300035724 | Bacteria | 1700 |
| 578 | Ga0373933_0340671 | 3300035724 | Bacteria | 973 |
| 579 | Ga0373947_0000455 | 3300035725 | Bacteria | 23308 |
| 580 | Ga0373947_0035994 | 3300035725 | Bacteria | 2933 |
| 581 | Ga0373947_0039442 | 3300035725 | Bacteria | 2810 |
| 582 | Ga0373947_0091001 | 3300035725 | Bacteria | 1903 |
| 583 | Ga0373947_0183995 | 3300035725 | Bacteria | 1361 |
| 584 | Ga0373947_0376258 | 3300035725 | Bacteria | 955 |
| 585 | Ga0373937_0004613 | 3300036401 | Bacteria | 11701 |
| 586 | Ga0373937_0008188 | 3300036401 | Bacteria | 9080 |
| 587 | Ga0373937_0015336 | 3300036401 | Bacteria | 6776 |
| 588 | Ga0373937_0185926 | 3300036401 | Bacteria | 1951 |
| 589 | Ga0373937_0485225 | 3300036401 | Bacteria | 1174 |
| 590 | Ga0372808_023218 | 3300036459 | Bacteria | 891 |
| 591 | Ga0373925_0003563 | 3300037068 | Bacteria | 12000 |
| 592 | Ga0373925_0023694 | 3300037068 | Bacteria | 4479 |
| 593 | Ga0373925_0034269 | 3300037068 | Bacteria | 3741 |
| 594 | Ga0373925_0081325 | 3300037068 | Bacteria | 2463 |
| 595 | Ga0373925_0085487 | 3300037068 | Unclassified | 2405 |
| 596 | Ga0373925_0154434 | 3300037068 | Bacteria | 1804 |
| 597 | Ga0373925_0301832 | 3300037068 | Bacteria | 1293 |
| 598 | Ga0373925_0466402 | 3300037068 | Bacteria | 1035 |
| 599 | Ga0395905_0077529 | 3300037471 | Bacteria | 3114 |
| 600 | Ga0436364_0157539 | 3300037853 | Bacteria | 2550 |
| 601 | Ga0436364_0476354 | 3300037853 | Bacteria | 863 |
| 602 | Ga0436364_1289063 | 3300037853 | Bacteria | 1174 |
| 603 | Ga0395901_0067053 | 3300038443 | Bacteria | 3738 |
| 604 | Ga0436365_1698837 | 3300039437 | Bacteria | 869 |
| 605 | Ga0436363_1437817 | 3300039450 | Bacteria | 1546 |
| 606 | Ga0439465_0132882 | 3300041413 | Bacteria | 879 |
| 607 | Ga0451791_0240992 | 3300041451 | Bacteria | 1064 |
| 608 | Ga0451791_0284711 | 3300041451 | Bacteria | 886 |
| 609 | Ga0451791_0441720 | 3300041451 | Bacteria | 774 |
| 610 | Ga0451793_1400233 | 3300041452 | Bacteria | 729 |
| 611 | Ga0451807_0428279 | 3300041486 | Bacteria | 994 |
| 612 | Ga0451837_1412964 | 3300041494 | Bacteria | 1276 |
| 613 | Ga0451853_0921849 | 3300041512 | Bacteria | 811 |
| 614 | Ga0451853_4011993 | 3300041512 | Bacteria | 1075 |
| 615 | Ga0466968_0247024 | 3300044735 | Bacteria | 847 |
| 616 | Ga0495617_085353 | 3300046452 | Bacteria | 1033 |
| 617 | Ga0495617_165209 | 3300046452 | Bacteria | 700 |
| 618 | Ga0495592_0005277 | 3300046454 | Bacteria | 9521 |
| 619 | Ga0495592_0021465 | 3300046454 | Bacteria | 4910 |
| 620 | Ga0495592_0032569 | 3300046454 | Bacteria | 3932 |
| 621 | Ga0495592_0218026 | 3300046454 | Bacteria | 1277 |
| 622 | Ga0495592_0341783 | 3300046454 | Bacteria | 962 |
| 623 | Ga0495603_0000239 | 3300046455 | Bacteria | 28578 |
| 624 | Ga0495603_0009322 | 3300046455 | Bacteria | 5935 |
| 625 | Ga0495603_0058945 | 3300046455 | Bacteria | 2269 |
| 626 | Ga0495590_0068691 | 3300046457 | Bacteria | 1242 |
| 627 | Ga0495629_0000457 | 3300046459 | Bacteria | 34088 |
| 628 | Ga0495629_0007972 | 3300046459 | Bacteria | 7791 |
| 629 | Ga0495629_0225537 | 3300046459 | Bacteria | 1292 |
| 630 | Ga0495638_0021622 | 3300046460 | Bacteria | 4236 |
| 631 | Ga0495638_0076101 | 3300046460 | Bacteria | 2045 |
| 632 | Ga0495641_0002157 | 3300046461 | Bacteria | 15774 |
| 633 | Ga0495641_0094341 | 3300046461 | Bacteria | 1337 |
| 634 | Ga0495641_0209869 | 3300046461 | Bacteria | 873 |
| 635 | Ga0495651_0014000 | 3300046462 | Bacteria | 6203 |
| 636 | Ga0495651_0037984 | 3300046462 | Bacteria | 3749 |
| 637 | Ga0495651_0054995 | 3300046462 | Bacteria | 3058 |
| 638 | Ga0495651_0363524 | 3300046462 | Bacteria | 953 |
| 639 | Ga0495653_0004257 | 3300046463 | Bacteria | 11596 |
| 640 | Ga0495653_0009797 | 3300046463 | Bacteria | 7835 |
| 641 | Ga0495653_0021824 | 3300046463 | Bacteria | 5182 |
| 642 | Ga0495653_0155003 | 3300046463 | Bacteria | 1596 |
| 643 | Ga0495650_0051594 | 3300046471 | Bacteria | 1694 |
| 644 | Ga0495580_0002960 | 3300046472 | Bacteria | 14585 |
| 645 | Ga0495580_0198659 | 3300046472 | Bacteria | 1382 |
| 646 | Ga0495582_0000077 | 3300046473 | Bacteria | 49112 |
| 647 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 648 | Ga0495639_0095966 | 3300046475 | Bacteria | 1396 |
| 649 | Ga0495639_0179661 | 3300046475 | Unclassified | 1030 |
| 650 | Ga0495662_0012510 | 3300046476 | Bacteria | 4140 |
| 651 | Ga0495662_0033507 | 3300046476 | Bacteria | 2481 |
| 652 | Ga0495664_0005157 | 3300046477 | Bacteria | 7169 |
| 653 | Ga0495664_0038052 | 3300046477 | Plasmid | 2839 |
| 654 | Ga0495664_0041464 | 3300046477 | Bacteria | 2724 |
| 655 | Ga0495664_0432353 | 3300046477 | Bacteria | 789 |
| 656 | Ga0495664_0530360 | 3300046477 | Bacteria | 702 |
| 657 | Ga0495584_0046170 | 3300046491 | Bacteria | 2197 |
| 658 | Ga0495584_0108892 | 3300046491 | Bacteria | 1401 |
| 659 | Ga0495585_0031320 | 3300046492 | Bacteria | 3019 |
| 660 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 661 | Ga0495594_0186100 | 3300046499 | Bacteria | 1182 |
| 662 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 663 | Ga0495606_0313024 | 3300046507 | Bacteria | 846 |
| 664 | Ga0495608_0000911 | 3300046511 | Bacteria | 20725 |
| 665 | Ga0495608_0004649 | 3300046511 | Bacteria | 9811 |
| 666 | Ga0495616_0335648 | 3300046513 | Bacteria | 632 |
| 667 | Ga0495618_0003586 | 3300046514 | Bacteria | 9613 |
| 668 | Ga0495618_0014258 | 3300046514 | Bacteria | 4840 |
| 669 | Ga0495628_0023578 | 3300046516 | Bacteria | 5049 |
| 670 | Ga0495628_0046394 | 3300046516 | Bacteria | 3451 |
| 671 | Ga0495628_0055320 | 3300046516 | Plasmid | 3125 |
| 672 | Ga0495628_0062832 | 3300046516 | Bacteria | 2910 |
| 673 | Ga0495630_0074877 | 3300046517 | Bacteria | 2551 |
| 674 | Ga0495630_0079394 | 3300046517 | Unclassified | 2475 |
| 675 | Ga0495630_0167276 | 3300046517 | Bacteria | 1674 |
| 676 | Ga0495630_0268244 | 3300046517 | Bacteria | 1304 |
| 677 | Ga0495632_0015464 | 3300046519 | Bacteria | 4277 |
| 678 | Ga0495644_0046783 | 3300046523 | Bacteria | 1626 |
| 679 | Ga0495666_0037457 | 3300046526 | Bacteria | 2359 |
| 680 | Ga0495652_0021917 | 3300046529 | Bacteria | 5680 |
| 681 | Ga0495652_0046433 | 3300046529 | Bacteria | 3729 |
| 682 | Ga0495652_0046645 | 3300046529 | Bacteria | 3719 |
| 683 | Ga0495652_0145338 | 3300046529 | Unclassified | 1859 |
| 684 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 685 | Ga0495640_0011661 | 3300046533 | Bacteria | 6748 |
| 686 | Ga0495640_0051741 | 3300046533 | Bacteria | 2822 |
| 687 | Ga0495640_0053786 | 3300046533 | Plasmid | 2759 |
| 688 | Ga0495640_0169903 | 3300046533 | Bacteria | 1393 |
| 689 | Ga0495640_0486452 | 3300046533 | Bacteria | 752 |
| 690 | Ga0495586_0026013 | 3300046535 | Bacteria | 3131 |
| 691 | Ga0495586_0590969 | 3300046535 | Bacteria | 641 |
| 692 | Ga0495587_0005897 | 3300046536 | Bacteria | 7984 |
| 693 | Ga0495587_0011562 | 3300046536 | Bacteria | 5588 |
| 694 | Ga0495587_0015897 | 3300046536 | Bacteria | 4687 |
| 695 | Ga0495587_0165550 | 3300046536 | Bacteria | 1257 |
| 696 | Ga0495598_0005561 | 3300046537 | Bacteria | 2802 |
| 697 | Ga0495597_0148045 | 3300046542 | Bacteria | 965 |
| 698 | Ga0495645_0031846 | 3300046543 | Bacteria | 3844 |
| 699 | Ga0495645_0042847 | 3300046543 | Bacteria | 3300 |
| 700 | Ga0495645_0061920 | 3300046543 | Bacteria | 2711 |
| 701 | Ga0495645_0331495 | 3300046543 | Bacteria | 985 |
| 702 | Ga0495622_0002233 | 3300046557 | Bacteria | 9422 |
| 703 | Ga0495622_0128327 | 3300046557 | Bacteria | 1155 |
| 704 | Ga0495622_0162331 | 3300046557 | Bacteria | 1007 |
| 705 | Ga0495633_0094045 | 3300046558 | Bacteria | 1393 |
| 706 | Ga0495667_0013782 | 3300046559 | Bacteria | 5460 |
| 707 | Ga0495667_0021423 | 3300046559 | Bacteria | 4361 |
| 708 | Ga0495667_0023279 | 3300046559 | Bacteria | 4173 |
| 709 | Ga0495667_0048600 | 3300046559 | Bacteria | 2801 |
| 710 | Ga0495667_0093406 | 3300046559 | Bacteria | 1948 |
| 711 | Ga0495656_0008262 | 3300046615 | Bacteria | 3711 |
| 712 | Ga0495656_0308414 | 3300046615 | Bacteria | 813 |
| 713 | Ga0495668_0114332 | 3300046616 | Bacteria | 1476 |
| 714 | Ga0495634_0001036 | 3300046642 | Bacteria | 26033 |
| 715 | Ga0495611_0063779 | 3300046648 | Bacteria | 1677 |
| 716 | Ga0495625_0592842 | 3300046660 | Bacteria | 666 |
| 717 | Ga0495635_0000815 | 3300046663 | Bacteria | 20434 |
| 718 | Ga0495635_0004810 | 3300046663 | Bacteria | 9387 |
| 719 | Ga0495635_0011194 | 3300046663 | Bacteria | 6289 |
| 720 | Ga0495635_0029736 | 3300046663 | Bacteria | 3799 |
| 721 | Ga0495635_0053819 | 3300046663 | Bacteria | 2772 |
| 722 | Ga0495659_0004501 | 3300046664 | Bacteria | 4388 |
| 723 | Ga0495588_0005058 | 3300046674 | Bacteria | 5855 |
| 724 | Ga0495588_0005077 | 3300046674 | Bacteria | 5848 |
| 725 | Ga0495657_0003079 | 3300046675 | Bacteria | 13781 |
| 726 | Ga0495657_0034720 | 3300046675 | Bacteria | 3500 |
| 727 | Ga0495657_0068646 | 3300046675 | Bacteria | 2322 |
| 728 | Ga0495599_0001945 | 3300046678 | Bacteria | 11972 |
| 729 | Ga0495599_0097068 | 3300046678 | Bacteria | 1837 |
| 730 | Ga0495599_0156310 | 3300046678 | Bacteria | 1411 |
| 731 | Ga0495623_0001015 | 3300046679 | Bacteria | 18970 |
| 732 | Ga0495623_0020870 | 3300046679 | Bacteria | 4233 |
| 733 | Ga0495623_0077150 | 3300046679 | Bacteria | 2066 |
| 734 | Ga0495646_0001642 | 3300046680 | Bacteria | 13342 |
| 735 | Ga0495646_0014188 | 3300046680 | Bacteria | 5065 |
| 736 | Ga0495646_0113094 | 3300046680 | Bacteria | 1544 |
| 737 | Ga0495646_0189630 | 3300046680 | Bacteria | 1124 |
| 738 | Ga0495647_0067226 | 3300046681 | Bacteria | 1427 |
| 739 | Ga0495658_0001572 | 3300046683 | Bacteria | 11910 |
| 740 | Ga0495669_0002048 | 3300046684 | Bacteria | 8266 |
| 741 | Ga0495613_0003480 | 3300046689 | Bacteria | 11777 |
| 742 | Ga0495613_0078788 | 3300046689 | Unclassified | 2396 |
| 743 | Ga0495613_0092005 | 3300046689 | Bacteria | 2196 |
| 744 | Ga0495613_0168523 | 3300046689 | Bacteria | 1555 |
| 745 | Ga0495613_0660189 | 3300046689 | Bacteria | 691 |
| 746 | Ga0495624_0000235 | 3300046690 | Bacteria | 43165 |
| 747 | Ga0495624_0050807 | 3300046690 | Plasmid | 2625 |
| 748 | Ga0495624_0179546 | 3300046690 | Bacteria | 1290 |
| 749 | Ga0495670_0192981 | 3300046691 | Bacteria | 1077 |
| 750 | Ga0495671_0061334 | 3300046692 | Bacteria | 1855 |
| 751 | Ga0495589_0184650 | 3300046794 | Bacteria | 988 |
| 752 | Ga0495600_0012719 | 3300046809 | Bacteria | 5268 |
| 753 | Ga0495600_0015287 | 3300046809 | Bacteria | 4851 |
| 754 | Ga0495600_0245824 | 3300046809 | Bacteria | 1139 |
| 755 | Ga0495600_0339237 | 3300046809 | Bacteria | 942 |
| 756 | Ga0495600_0344774 | 3300046809 | Bacteria | 934 |
| 757 | Ga0495600_0574508 | 3300046809 | Bacteria | 687 |
| 758 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 759 | Ga0495581_0196067 | 3300047315 | Bacteria | 1181 |
| 760 | Ga0495604_0007221 | 3300047317 | Bacteria | 8800 |
| 761 | Ga0495604_0272830 | 3300047317 | Bacteria | 1145 |
| 762 | Ga0495674_0028002 | 3300047319 | Bacteria | 5145 |
| 763 | Ga0495674_0036100 | 3300047319 | Bacteria | 4451 |
| 764 | Ga0495674_0602898 | 3300047319 | Bacteria | 870 |
| 765 | Ga0495676_0018550 | 3300047321 | Bacteria | 6135 |
| 766 | Ga0495680_0017765 | 3300047322 | Bacteria | 6056 |
| 767 | Ga0495680_0028245 | 3300047322 | Bacteria | 4600 |
| 768 | Ga0495680_0154374 | 3300047322 | Bacteria | 1671 |
| 769 | Ga0495680_0414882 | 3300047322 | Bacteria | 927 |
| 770 | Ga0495675_0025398 | 3300047444 | Bacteria | 3777 |
| 771 | Ga0495675_0048080 | 3300047444 | Bacteria | 2713 |
| 772 | Ga0495677_0151369 | 3300047445 | Bacteria | 893 |
| 773 | Ga0495679_093047 | 3300047446 | Bacteria | 844 |
| 774 | Ga0495673_0025589 | 3300047469 | Bacteria | 2830 |
| 775 | Ga0495684_0001399 | 3300047471 | Bacteria | 19329 |
| 776 | Ga0495684_0028335 | 3300047471 | Bacteria | 4301 |
| 777 | Ga0495684_0405869 | 3300047471 | Bacteria | 955 |
| 778 | Ga0495686_0224071 | 3300047472 | Bacteria | 1068 |
| 779 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 780 | Ga0495593_0004938 | 3300047673 | Bacteria | 7905 |
| 781 | Ga0495593_0019588 | 3300047673 | Bacteria | 3793 |
| 782 | Ga0495602_0019419 | 3300048088 | Bacteria | 6748 |
| 783 | Ga0495602_0035012 | 3300048088 | Bacteria | 4687 |
| 784 | Ga0495602_0067291 | 3300048088 | Bacteria | 3082 |
| 785 | Ga0495626_0219016 | 3300048091 | Bacteria | 774 |
| 786 | Ga0496100_0032123 | 3300048903 | Bacteria | 3270 |
| 787 | Ga0496100_0084124 | 3300048903 | Bacteria | 2156 |
| 788 | Ga0496100_0301201 | 3300048903 | Bacteria | 1200 |
| 789 | Ga0496100_0552808 | 3300048903 | Bacteria | 891 |
| 790 | Ga0496101_0002275 | 3300048904 | Bacteria | 11728 |
| 791 | Ga0496101_0017665 | 3300048904 | Bacteria | 4839 |
| 792 | Ga0496101_0257139 | 3300048904 | Unclassified | 1361 |
| 793 | Ga0496101_0290603 | 3300048904 | Bacteria | 1279 |
| 794 | Ga0496101_0475822 | 3300048904 | Unclassified | 986 |
| 795 | Ga0496102_0015668 | 3300048905 | Bacteria | 6604 |
| 796 | Ga0496102_0022366 | 3300048905 | Bacteria | 5601 |
| 797 | Ga0496102_0076164 | 3300048905 | Bacteria | 3085 |
| 798 | Ga0496102_0286670 | 3300048905 | Bacteria | 1552 |
| 799 | Ga0496102_0414593 | 3300048905 | Bacteria | 1265 |
| 800 | Ga0496103_0019772 | 3300048906 | Bacteria | 4042 |
| 801 | Ga0496103_0026671 | 3300048906 | Bacteria | 3498 |
| 802 | Ga0496103_0413174 | 3300048906 | Bacteria | 866 |
| 803 | Ga0496104_0047895 | 3300048907 | Bacteria | 4029 |
| 804 | Ga0496104_0088890 | 3300048907 | Bacteria | 2951 |
| 805 | Ga0496104_0121736 | 3300048907 | Bacteria | 2505 |
| 806 | Ga0496104_0135420 | 3300048907 | Bacteria | 2366 |
| 807 | Ga0496104_0249235 | 3300048907 | Unclassified | 1689 |
| 808 | Ga0496104_0353360 | 3300048907 | Bacteria | 1382 |
| 809 | Ga0496105_0012396 | 3300048908 | Bacteria | 6749 |
| 810 | Ga0496105_0292958 | 3300048908 | Unclassified | 1310 |
| 811 | Ga0496105_0827525 | 3300048908 | Bacteria | 702 |
| 812 | Ga0496106_0003446 | 3300048909 | Bacteria | 11782 |
| 813 | Ga0496106_0039727 | 3300048909 | Bacteria | 3524 |
| 814 | Ga0496106_0058706 | 3300048909 | Bacteria | 2913 |
| 815 | Ga0496106_0103687 | 3300048909 | Unclassified | 2208 |
| 816 | Ga0496106_0147996 | 3300048909 | Bacteria | 1851 |
| 817 | Ga0496106_0149447 | 3300048909 | Bacteria | 1842 |
| 818 | Ga0496106_0267929 | 3300048909 | Bacteria | 1367 |
| 819 | Ga0496106_0299272 | 3300048909 | Bacteria | 1290 |
| 820 | Ga0496107_0000509 | 3300048910 | Bacteria | 21565 |
| 821 | Ga0496107_0021914 | 3300048910 | Bacteria | 4514 |
| 822 | Ga0496107_0055248 | 3300048910 | Bacteria | 2868 |
| 823 | Ga0496107_0159541 | 3300048910 | Bacteria | 1671 |
| 824 | Ga0496107_0184967 | 3300048910 | Unclassified | 1547 |
| 825 | Ga0496107_0210648 | 3300048910 | Bacteria | 1445 |
| 826 | Ga0496107_0397163 | 3300048910 | Unclassified | 1025 |
| 827 | Ga0496108_0031275 | 3300048911 | Bacteria | 4415 |
| 828 | Ga0496108_0043219 | 3300048911 | Bacteria | 3764 |
| 829 | Ga0496108_0150590 | 3300048911 | Bacteria | 2007 |
| 830 | Ga0496109_0026994 | 3300048912 | Bacteria | 5122 |
| 831 | Ga0496109_0063752 | 3300048912 | Bacteria | 3371 |
| 832 | Ga0496109_0170543 | 3300048912 | Bacteria | 2041 |
| 833 | Ga0496109_0207049 | 3300048912 | Bacteria | 1844 |
| 834 | Ga0496109_0241523 | 3300048912 | Bacteria | 1700 |
| 835 | Ga0496109_0273602 | 3300048912 | Bacteria | 1591 |
| 836 | Ga0496109_0995085 | 3300048912 | Bacteria | 776 |
| 837 | Ga0496110_0033752 | 3300048913 | Bacteria | 4429 |
| 838 | Ga0496110_0130718 | 3300048913 | Bacteria | 2267 |
| 839 | Ga0496110_0313674 | 3300048913 | Bacteria | 1428 |
| 840 | Ga0496110_0703311 | 3300048913 | Bacteria | 912 |
| 841 | Ga0496110_0799685 | 3300048913 | Bacteria | 847 |
| 842 | Ga0496110_0920507 | 3300048913 | Bacteria | 781 |
| 843 | Ga0496111_0024753 | 3300048914 | Bacteria | 4233 |
| 844 | Ga0496111_0039292 | 3300048914 | Bacteria | 3392 |
| 845 | Ga0496111_0233770 | 3300048914 | Bacteria | 1365 |
| 846 | Ga0496111_0348952 | 3300048914 | Bacteria | 1095 |
| 847 | Ga0496111_0510088 | 3300048914 | Bacteria | 885 |
| 848 | Ga0496112_0012715 | 3300048915 | Bacteria | 7740 |
| 849 | Ga0496112_0048594 | 3300048915 | Bacteria | 4159 |
| 850 | Ga0496112_0086667 | 3300048915 | Bacteria | 3098 |
| 851 | Ga0496112_0252685 | 3300048915 | Unclassified | 1714 |
| 852 | Ga0496112_0284141 | 3300048915 | Bacteria | 1601 |
| 853 | Ga0496113_0002503 | 3300048916 | Bacteria | 10701 |
| 854 | Ga0496113_0008294 | 3300048916 | Bacteria | 6760 |
| 855 | Ga0496113_0056499 | 3300048916 | Bacteria | 2947 |
| 856 | Ga0496113_0057698 | 3300048916 | Bacteria | 2919 |
| 857 | Ga0496113_0533929 | 3300048916 | Bacteria | 941 |
| 858 | Ga0496114_0009294 | 3300048917 | Bacteria | 7801 |
| 859 | Ga0496114_0048418 | 3300048917 | Bacteria | 3536 |
| 860 | Ga0496114_0079135 | 3300048917 | Bacteria | 2774 |
| 861 | Ga0496114_0401699 | 3300048917 | Bacteria | 1213 |
| 862 | Ga0496115_0045511 | 3300048918 | Bacteria | 3504 |
| 863 | Ga0496115_0059345 | 3300048918 | Bacteria | 3081 |
| 864 | Ga0496115_0106674 | 3300048918 | Unclassified | 2300 |
| 865 | Ga0496115_0133773 | 3300048918 | Bacteria | 2044 |
| 866 | Ga0496115_0266420 | 3300048918 | Bacteria | 1408 |
| 867 | Ga0496117_0238499 | 3300048920 | Bacteria | 1000 |
| 868 | Ga0496119_0047619 | 3300048922 | Bacteria | 2666 |
| 869 | Ga0496121_0000927 | 3300048924 | Bacteria | 53016 |
| 870 | Ga0496121_0095423 | 3300048924 | Bacteria | 2311 |
| 871 | Ga0496121_0151137 | 3300048924 | Bacteria | 1708 |
| 872 | Ga0496121_0203641 | 3300048924 | Bacteria | 1408 |
| 873 | Ga0496124_0233805 | 3300048927 | Bacteria | 1372 |
| 874 | Ga0496126_0060792 | 3300048929 | Bacteria | 3396 |
| 875 | Ga0496126_0082014 | 3300048929 | Bacteria | 2850 |
| 876 | Ga0496126_0378771 | 3300048929 | Bacteria | 1152 |
| 877 | Ga0496126_0570173 | 3300048929 | Bacteria | 896 |
| 878 | Ga0496126_0726628 | 3300048929 | Bacteria | 769 |
| 879 | Ga0501032_0139342 | 3300049569 | Bacteria | 1598 |
| 880 | Ga0501043_0280819 | 3300049579 | Bacteria | 1276 |
| 881 | Ga0501046_0060334 | 3300049580 | Bacteria | 2968 |
| 882 | Ga0501047_0014411 | 3300049581 | Bacteria | 7517 |
| 883 | Ga0501067_0039577 | 3300049583 | Bacteria | 2618 |
| 884 | Ga0501070_0006598 | 3300049586 | Bacteria | 9876 |
| 885 | Ga0501044_0005514 | 3300049823 | Bacteria | 14047 |
| 886 | Ga0501044_0209640 | 3300049823 | Unclassified | 1903 |
| 887 | nmdc:mga00v17_297583_c1 | 3300050491 | Bacteria | 1048 |
| 888 | nmdc:mga0yw44_13282_c1 | 3300050492 | Bacteria | 4330 |
| 889 | nmdc:mga0yw44_168291_c1 | 3300050492 | Bacteria | 1438 |
| 890 | nmdc:mga0yw44_211928_c1 | 3300050492 | Bacteria | 1282 |
| 891 | nmdc:mga0yw44_285890_c1 | 3300050492 | Bacteria | 1103 |
| 892 | nmdc:mga0k408_292622_c1 | 3300050493 | Bacteria | 972 |
| 893 | nmdc:mga06z11_151224_c1 | 3300050494 | Bacteria | 1320 |
| 894 | nmdc:mga06z11_45147_c1 | 3300050494 | Bacteria | 1399 |
| 895 | nmdc:mga06z11_84370_c1 | 3300050494 | Bacteria | 1712 |
| 896 | nmdc:mga04h51_9301_c1 | 3300050495 | Bacteria | 2658 |
| 897 | nmdc:mga07m45_8848_c1 | 3300050496 | Bacteria | 5195 |
| 898 | nmdc:mga07m45_94518_c1 | 3300050496 | Bacteria | 1714 |
| 899 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 900 | nmdc:mga08y16_191984_c1 | 3300050511 | Bacteria | 2118 |
| 901 | nmdc:mga08y16_366135_c1 | 3300050511 | Bacteria | 1479 |
| 902 | nmdc:mga0n895_121255_c1 | 3300050512 | Bacteria | 2636 |
| 903 | nmdc:mga0n895_216385_c1 | 3300050512 | Unclassified | 1945 |
| 904 | nmdc:mga0n895_37633_c1 | 3300050512 | Bacteria | 4682 |
| 905 | nmdc:mga0rr50_537400_c1 | 3300050513 | Bacteria | 995 |
| 906 | nmdc:mga08x19_396636_c1 | 3300050514 | Bacteria | 967 |
| 907 | nmdc:mga0a205_1049_c1 | 3300050515 | Bacteria | 23004 |
| 908 | nmdc:mga0a205_206208_c1 | 3300050515 | Bacteria | 1855 |
| 909 | nmdc:mga0sz30_114689_c1 | 3300050516 | Bacteria | 1182 |
| 910 | Ga0495601_0009169 | 3300053077 | Bacteria | 5846 |
| 911 | Ga0495601_0141831 | 3300053077 | Unclassified | 1567 |
| 912 | Ga0495601_0173060 | 3300053077 | Bacteria | 1411 |
| 913 | Ga0495601_0249003 | 3300053077 | Bacteria | 1160 |
| 914 | Ga0495601_0250303 | 3300053077 | Bacteria | 1157 |
| 915 | Ga0495612_0193999 | 3300053078 | Bacteria | 894 |
| 916 | Ga0500635_0001974 | 3300053080 | Bacteria | 5009 |
| 917 | Ga0500635_0031249 | 3300053080 | Bacteria | 1722 |
| 918 | Ga0495595_0000554 | 3300053084 | Bacteria | 14279 |
| 919 | Ga0495595_0000637 | 3300053084 | Bacteria | 13319 |
| 920 | Ga0495619_0001080 | 3300053085 | Bacteria | 17897 |
| 921 | Ga0495619_0425381 | 3300053085 | Bacteria | 916 |
| 922 | Ga0500578_0445488 | 3300053086 | Bacteria | 738 |
| 923 | Ga0500647_0195221 | 3300053091 | Bacteria | 921 |
| 924 | Ga0500583_0009184 | 3300053092 | Bacteria | 3598 |
| 925 | Ga0500583_0051691 | 3300053092 | Bacteria | 1910 |
| 926 | Ga0500641_0005024 | 3300053096 | Bacteria | 4691 |
| 927 | Ga0500641_0024967 | 3300053096 | Bacteria | 2309 |
| 928 | Ga0500641_0133006 | 3300053096 | Bacteria | 1073 |
| 929 | Ga0500648_100720 | 3300053097 | Bacteria | 1607 |
| 930 | Ga0500595_001951 | 3300053119 | Bacteria | 10615 |
| 931 | Ga0500595_026055 | 3300053119 | Bacteria | 2020 |
| 932 | Ga0500658_0145563 | 3300053134 | Bacteria | 1065 |
| 933 | Ga0500658_0147074 | 3300053134 | Bacteria | 1060 |
| 934 | Ga0500559_0015190 | 3300053136 | Bacteria | 3253 |
| 935 | Ga0500568_0006709 | 3300053139 | Bacteria | 5754 |
| 936 | Ga0500568_0096636 | 3300053139 | Bacteria | 1111 |
| 937 | Ga0500573_0008543 | 3300053140 | Bacteria | 5644 |
| 938 | Ga0500588_0013956 | 3300053146 | Bacteria | 2025 |
| 939 | Ga0500588_0129991 | 3300053146 | Bacteria | 896 |
| 940 | Ga0500589_021876 | 3300053147 | Bacteria | 2937 |
| 941 | Ga0500589_042286 | 3300053147 | Bacteria | 2125 |
| 942 | Ga0500590_093943 | 3300053148 | Bacteria | 1452 |
| 943 | Ga0500603_000226 | 3300053150 | Bacteria | 14827 |
| 944 | Ga0500622_0248361 | 3300053156 | Bacteria | 782 |
| 945 | Ga0500634_0075126 | 3300053161 | Bacteria | 1758 |
| 946 | Ga0500634_0091011 | 3300053161 | Bacteria | 1548 |
| 947 | Ga0500639_048715 | 3300053163 | Bacteria | 2212 |
| 948 | Ga0500636_0013138 | 3300053177 | Bacteria | 4858 |
| 949 | Ga0500637_0003349 | 3300053178 | Bacteria | 7387 |
| 950 | Ga0500637_0165132 | 3300053178 | Bacteria | 1274 |
| 951 | Ga0500645_012764 | 3300053730 | Bacteria | 2712 |
| 952 | Ga0500596_003281 | 3300053735 | Bacteria | 3099 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100062605 | Ga0070712_1000626053 | 167 |
| 2 | 3300006028 | Ga0070717_10082660 | Ga0070717_100826603 | 172 |
| 3 | 3300021388 | Ga0213875_10034248 | Ga0213875_100342483 | 173 |
| 4 | 3300037853 | Ga0436364_0157539 | Ga0436364_0157539_489_1115 | 173 |
| 5 | 3300048929 | Ga0496126_0378771 | Ga0496126_0378771_416_1045 | 173 |
| 6 | 3300009098 | Ga0105245_10014034 | Ga0105245_100140346 | 174 |
| 7 | 3300009101 | Ga0105247_10167620 | Ga0105247_101676202 | 174 |
| 8 | 3300009174 | Ga0105241_10649305 | Ga0105241_106493052 | 174 |
| 9 | 3300009177 | Ga0105248_10029891 | Ga0105248_100298915 | 174 |
| 10 | 3300011119 | Ga0105246_10032205 | Ga0105246_100322052 | 174 |
| 11 | 3300025911 | Ga0207654_10401528 | Ga0207654_104015282 | 174 |
| 12 | 3300048909 | Ga0496106_0299272 | Ga0496106_0299272_156_755 | 174 |
| 13 | 3300048910 | Ga0496107_0159541 | Ga0496107_0159541_271_870 | 174 |
| 14 | 3300048912 | Ga0496109_0207049 | Ga0496109_0207049_502_1101 | 174 |
| 15 | 3300050492 | nmdc:mga0yw44_285890_c1 | nmdc:mga0yw44_285890_c1_184_783 | 174 |
| 16 | 3300050494 | nmdc:mga06z11_84370_c1 | nmdc:mga06z11_84370_c1_843_1442 | 174 |
| 17 | 3300050514 | nmdc:mga08x19_396636_c1 | nmdc:mga08x19_396636_c1_318_917 | 174 |
| 18 | 3300033442 | Ga0315911_1000040 | Ga0315911_10000408 | 175 |
| 19 | 3300048929 | Ga0496126_0726628 | Ga0496126_0726628_96_704 | 175 |
| 20 | 3300005339 | Ga0070660_100034303 | Ga0070660_1000343033 | 177 |
| 21 | 3300005340 | Ga0070689_100327516 | Ga0070689_1003275161 | 177 |
| 22 | 3300005347 | Ga0070668_100036445 | Ga0070668_1000364452 | 177 |
| 23 | 3300005366 | Ga0070659_100079331 | Ga0070659_1000793313 | 177 |
| 24 | 3300005367 | Ga0070667_100731541 | Ga0070667_1007315411 | 177 |
| 25 | 3300005539 | Ga0068853_100060238 | Ga0068853_1000602384 | 177 |
| 26 | 3300005548 | Ga0070665_100579006 | Ga0070665_1005790062 | 177 |
| 27 | 3300005563 | Ga0068855_100099837 | Ga0068855_1000998372 | 177 |
| 28 | 3300005577 | Ga0068857_100124799 | Ga0068857_1001247993 | 177 |
| 29 | 3300005578 | Ga0068854_100246521 | Ga0068854_1002465212 | 177 |
| 30 | 3300005719 | Ga0068861_100111473 | Ga0068861_1001114732 | 177 |
| 31 | 3300005842 | Ga0068858_100079901 | Ga0068858_1000799013 | 177 |
| 32 | 3300005843 | Ga0068860_100192601 | Ga0068860_1001926012 | 177 |
| 33 | 3300006048 | Ga0075363_100005067 | Ga0075363_1000050673 | 177 |
| 34 | 3300006178 | Ga0075367_10021083 | Ga0075367_100210832 | 177 |
| 35 | 3300006195 | Ga0075366_10027167 | Ga0075366_100271674 | 177 |
| 36 | 3300006237 | Ga0097621_100053560 | Ga0097621_1000535605 | 177 |
| 37 | 3300025901 | Ga0207688_10094545 | Ga0207688_100945451 | 177 |
| 38 | 3300025907 | Ga0207645_10194083 | Ga0207645_101940831 | 177 |
| 39 | 3300025914 | Ga0207671_10077969 | Ga0207671_100779692 | 177 |
| 40 | 3300025919 | Ga0207657_10044766 | Ga0207657_100447663 | 177 |
| 41 | 3300025925 | Ga0207650_10669745 | Ga0207650_106697451 | 177 |
| 42 | 3300025927 | Ga0207687_10002549 | Ga0207687_1000254911 | 177 |
| 43 | 3300025931 | Ga0207644_10066815 | Ga0207644_100668151 | 177 |
| 44 | 3300025932 | Ga0207690_10310657 | Ga0207690_103106572 | 177 |
| 45 | 3300025936 | Ga0207670_10406048 | Ga0207670_104060482 | 177 |
| 46 | 3300025941 | Ga0207711_10218792 | Ga0207711_102187922 | 177 |
| 47 | 3300025942 | Ga0207689_10049010 | Ga0207689_100490102 | 177 |
| 48 | 3300025972 | Ga0207668_10005581 | Ga0207668_100055815 | 177 |
| 49 | 3300025986 | Ga0207658_10639432 | Ga0207658_106394322 | 177 |
| 50 | 3300026035 | Ga0207703_10032293 | Ga0207703_100322935 | 177 |
| 51 | 3300026041 | Ga0207639_10117459 | Ga0207639_101174592 | 177 |
| 52 | 3300026067 | Ga0207678_10033660 | Ga0207678_100336602 | 177 |
| 53 | 3300026078 | Ga0207702_10359494 | Ga0207702_103594942 | 177 |
| 54 | 3300026088 | Ga0207641_10171571 | Ga0207641_101715712 | 177 |
| 55 | 3300026116 | Ga0207674_10094104 | Ga0207674_100941043 | 177 |
| 56 | 3300026121 | Ga0207683_10075790 | Ga0207683_100757902 | 177 |
| 57 | 3300028379 | Ga0268266_10164400 | Ga0268266_101644002 | 177 |
| 58 | 3300048903 | Ga0496100_0552808 | Ga0496100_0552808_161_787 | 177 |
| 59 | 3300048914 | Ga0496111_0233770 | Ga0496111_0233770_500_1126 | 177 |
| 60 | 3300048916 | Ga0496113_0057698 | Ga0496113_0057698_230_856 | 177 |
| 61 | 3300048909 | Ga0496106_0267929 | Ga0496106_0267929_74_694 | 178 |
| 62 | 3300048917 | Ga0496114_0079135 | Ga0496114_0079135_1438_2004 | 178 |
| 63 | 3300035117 | Ga0373953_0066408 | Ga0373953_0066408_911_1468 | 180 |
| 64 | 3300035172 | Ga0373955_0503749 | Ga0373955_0503749_70_627 | 180 |
| 65 | 3300046459 | Ga0495629_0225537 | Ga0495629_0225537_706_1281 | 180 |
| 66 | 3300046535 | Ga0495586_0590969 | Ga0495586_0590969_15_572 | 180 |
| 67 | 3300048918 | Ga0496115_0266420 | Ga0496115_0266420_329_901 | 180 |
| 68 | 3300025261 | Ga0209233_1005084 | Ga0209233_10050843 | 181 |
| 69 | 3300041451 | Ga0451791_0441720 | Ga0451791_0441720_26_619 | 182 |
| 70 | 3300006173 | Ga0070716_100235027 | Ga0070716_1002350272 | 183 |
| 71 | 3300013297 | Ga0157378_10086387 | Ga0157378_100863872 | 183 |
| 72 | 3300013306 | Ga0163162_10602920 | Ga0163162_106029201 | 183 |
| 73 | 3300035118 | Ga0373954_0349097 | Ga0373954_0349097_105_683 | 183 |
| 74 | 3300048910 | Ga0496107_0210648 | Ga0496107_0210648_396_1022 | 183 |
| 75 | 3300005440 | Ga0070705_100215842 | Ga0070705_1002158422 | 184 |
| 76 | 3300005615 | Ga0070702_100091658 | Ga0070702_1000916583 | 184 |
| 77 | 3300005841 | Ga0068863_100142125 | Ga0068863_1001421252 | 184 |
| 78 | 3300005983 | Ga0081540_1012946 | Ga0081540_10129464 | 184 |
| 79 | 3300014969 | Ga0157376_10135746 | Ga0157376_101357462 | 184 |
| 80 | 3300026088 | Ga0207641_10315377 | Ga0207641_103153771 | 184 |
| 81 | 3300035111 | Ga0373923_0003867 | Ga0373923_0003867_2370_2975 | 184 |
| 82 | 3300035117 | Ga0373953_0012482 | Ga0373953_0012482_1914_2519 | 184 |
| 83 | 3300035118 | Ga0373954_0008152 | Ga0373954_0008152_2931_3536 | 184 |
| 84 | 3300035119 | Ga0373956_0004720 | Ga0373956_0004720_2111_2716 | 184 |
| 85 | 3300035172 | Ga0373955_0002049 | Ga0373955_0002049_1893_2498 | 184 |
| 86 | 3300035410 | Ga0373924_0014698 | Ga0373924_0014698_369_974 | 184 |
| 87 | 3300035724 | Ga0373933_0010853 | Ga0373933_0010853_2078_2683 | 184 |
| 88 | 3300036401 | Ga0373937_0008188 | Ga0373937_0008188_3748_4353 | 184 |
| 89 | 3300046454 | Ga0495592_0021465 | Ga0495592_0021465_1452_2057 | 184 |
| 90 | 3300046459 | Ga0495629_0007972 | Ga0495629_0007972_6543_7148 | 184 |
| 91 | 3300046462 | Ga0495651_0054995 | Ga0495651_0054995_1055_1660 | 184 |
| 92 | 3300046463 | Ga0495653_0009797 | Ga0495653_0009797_1912_2517 | 184 |
| 93 | 3300046511 | Ga0495608_0004649 | Ga0495608_0004649_2098_2703 | 184 |
| 94 | 3300046516 | Ga0495628_0046394 | Ga0495628_0046394_2446_3051 | 184 |
| 95 | 3300046529 | Ga0495652_0046433 | Ga0495652_0046433_1942_2547 | 184 |
| 96 | 3300046533 | Ga0495640_0011661 | Ga0495640_0011661_2004_2609 | 184 |
| 97 | 3300046536 | Ga0495587_0015897 | Ga0495587_0015897_2317_2922 | 184 |
| 98 | 3300046543 | Ga0495645_0061920 | Ga0495645_0061920_347_952 | 184 |
| 99 | 3300046559 | Ga0495667_0021423 | Ga0495667_0021423_2574_3179 | 184 |
| 100 | 3300046663 | Ga0495635_0004810 | Ga0495635_0004810_7236_7841 | 184 |
| 101 | 3300046675 | Ga0495657_0003079 | Ga0495657_0003079_9191_9796 | 184 |
| 102 | 3300046678 | Ga0495599_0001945 | Ga0495599_0001945_2173_2778 | 184 |
| 103 | 3300046679 | Ga0495623_0020870 | Ga0495623_0020870_2574_3179 | 184 |
| 104 | 3300046680 | Ga0495646_0001642 | Ga0495646_0001642_1415_2020 | 184 |
| 105 | 3300046689 | Ga0495613_0092005 | Ga0495613_0092005_119_724 | 184 |
| 106 | 3300046809 | Ga0495600_0012719 | Ga0495600_0012719_1055_1660 | 184 |
| 107 | 3300047317 | Ga0495604_0007221 | Ga0495604_0007221_5191_5796 | 184 |
| 108 | 3300047319 | Ga0495674_0028002 | Ga0495674_0028002_2478_3083 | 184 |
| 109 | 3300047322 | Ga0495680_0017765 | Ga0495680_0017765_2446_3051 | 184 |
| 110 | 3300047444 | Ga0495675_0048080 | Ga0495675_0048080_167_772 | 184 |
| 111 | 3300047471 | Ga0495684_0001399 | Ga0495684_0001399_6543_7148 | 184 |
| 112 | 3300047673 | Ga0495593_0004938 | Ga0495593_0004938_2572_3177 | 184 |
| 113 | 3300048088 | Ga0495602_0035012 | Ga0495602_0035012_2317_2922 | 184 |
| 114 | 3300048903 | Ga0496100_0084124 | Ga0496100_0084124_459_1061 | 184 |
| 115 | 3300048904 | Ga0496101_0475822 | Ga0496101_0475822_44_646 | 184 |
| 116 | 3300048907 | Ga0496104_0249235 | Ga0496104_0249235_54_656 | 184 |
| 117 | 3300048907 | Ga0496104_0353360 | Ga0496104_0353360_98_700 | 184 |
| 118 | 3300048908 | Ga0496105_0827525 | Ga0496105_0827525_47_649 | 184 |
| 119 | 3300048909 | Ga0496106_0103687 | Ga0496106_0103687_1145_1747 | 184 |
| 120 | 3300048918 | Ga0496115_0106674 | Ga0496115_0106674_1428_2030 | 184 |
| 121 | 3300049569 | Ga0501032_0139342 | Ga0501032_0139342_612_1217 | 184 |
| 122 | 3300049579 | Ga0501043_0280819 | Ga0501043_0280819_234_839 | 184 |
| 123 | 3300049580 | Ga0501046_0060334 | Ga0501046_0060334_2029_2634 | 184 |
| 124 | 3300049581 | Ga0501047_0014411 | Ga0501047_0014411_4783_5388 | 184 |
| 125 | 3300049586 | Ga0501070_0006598 | Ga0501070_0006598_6185_6790 | 184 |
| 126 | 3300049823 | Ga0501044_0005514 | Ga0501044_0005514_440_1045 | 184 |
| 127 | 3300049823 | Ga0501044_0209640 | Ga0501044_0209640_265_870 | 184 |
| 128 | 3300053077 | Ga0495601_0009169 | Ga0495601_0009169_1783_2388 | 184 |
| 129 | 3300053084 | Ga0495595_0000637 | Ga0495595_0000637_10426_11031 | 184 |
| 130 | 3300053085 | Ga0495619_0001080 | Ga0495619_0001080_5319_5924 | 184 |
| 131 | 3300005336 | Ga0070680_100226621 | Ga0070680_1002266212 | 185 |
| 132 | 3300006852 | Ga0075433_10201324 | Ga0075433_102013242 | 185 |
| 133 | 3300006871 | Ga0075434_100021009 | Ga0075434_1000210093 | 185 |
| 134 | 3300025949 | Ga0207667_10961565 | Ga0207667_109615651 | 185 |
| 135 | 3300035725 | Ga0373947_0183995 | Ga0373947_0183995_447_1034 | 185 |
| 136 | 3300037068 | Ga0373925_0034269 | Ga0373925_0034269_395_982 | 185 |
| 137 | 3300037068 | Ga0373925_0154434 | Ga0373925_0154434_1145_1732 | 185 |
| 138 | 3300046472 | Ga0495580_0198659 | Ga0495580_0198659_583_1170 | 185 |
| 139 | 3300046516 | Ga0495628_0023578 | Ga0495628_0023578_4435_5037 | 185 |
| 140 | 3300046529 | Ga0495652_0046645 | Ga0495652_0046645_2164_2751 | 185 |
| 141 | 3300046543 | Ga0495645_0031846 | Ga0495645_0031846_1285_1872 | 185 |
| 142 | 3300046681 | Ga0495647_0067226 | Ga0495647_0067226_174_761 | 185 |
| 143 | 3300046689 | Ga0495613_0168523 | Ga0495613_0168523_535_1122 | 185 |
| 144 | 3300046690 | Ga0495624_0179546 | Ga0495624_0179546_415_1002 | 185 |
| 145 | 3300046809 | Ga0495600_0245824 | Ga0495600_0245824_526_1113 | 185 |
| 146 | 3300047315 | Ga0495581_0196067 | Ga0495581_0196067_98_685 | 185 |
| 147 | 3300047471 | Ga0495684_0405869 | Ga0495684_0405869_94_681 | 185 |
| 148 | 3300048915 | Ga0496112_0252685 | Ga0496112_0252685_721_1329 | 185 |
| 149 | 3300050511 | nmdc:mga08y16_191984_c1 | nmdc:mga08y16_191984_c1_1376_1978 | 185 |
| 150 | 3300050512 | nmdc:mga0n895_121255_c1 | nmdc:mga0n895_121255_c1_1872_2474 | 185 |
| 151 | 3300050515 | nmdc:mga0a205_206208_c1 | nmdc:mga0a205_206208_c1_713_1315 | 185 |
| 152 | 3300005336 | Ga0070680_100205891 | Ga0070680_1002058912 | 186 |
| 153 | 3300005339 | Ga0070660_100375198 | Ga0070660_1003751981 | 186 |
| 154 | 3300005445 | Ga0070708_100767105 | Ga0070708_1007671052 | 186 |
| 155 | 3300005455 | Ga0070663_100679161 | Ga0070663_1006791611 | 186 |
| 156 | 3300005458 | Ga0070681_10475268 | Ga0070681_104752681 | 186 |
| 157 | 3300005937 | Ga0081455_10051904 | Ga0081455_100519042 | 186 |
| 158 | 3300005983 | Ga0081540_1070985 | Ga0081540_10709853 | 186 |
| 159 | 3300009176 | Ga0105242_10204421 | Ga0105242_102044212 | 186 |
| 160 | 3300010159 | Ga0099796_10055610 | Ga0099796_100556102 | 186 |
| 161 | 3300010375 | Ga0105239_10053470 | Ga0105239_100534702 | 186 |
| 162 | 3300010375 | Ga0105239_10783691 | Ga0105239_107836911 | 186 |
| 163 | 3300013104 | Ga0157370_10101962 | Ga0157370_101019622 | 186 |
| 164 | 3300014968 | Ga0157379_10848577 | Ga0157379_108485771 | 186 |
| 165 | 3300025917 | Ga0207660_10294273 | Ga0207660_102942732 | 186 |
| 166 | 3300025919 | Ga0207657_10546461 | Ga0207657_105464611 | 186 |
| 167 | 3300025949 | Ga0207667_10095327 | Ga0207667_100953274 | 186 |
| 168 | 3300031548 | Ga0307408_100180430 | Ga0307408_1001804302 | 186 |
| 169 | 3300035083 | Ga0373926_0054548 | Ga0373926_0054548_95_697 | 186 |
| 170 | 3300035118 | Ga0373954_0000213 | Ga0373954_0000213_13345_13947 | 186 |
| 171 | 3300035118 | Ga0373954_0015754 | Ga0373954_0015754_1618_2226 | 186 |
| 172 | 3300035119 | Ga0373956_0112176 | Ga0373956_0112176_170_796 | 186 |
| 173 | 3300035120 | Ga0373957_0182082 | Ga0373957_0182082_63_671 | 186 |
| 174 | 3300035172 | Ga0373955_0241240 | Ga0373955_0241240_373_999 | 186 |
| 175 | 3300035695 | Ga0373927_0089359 | Ga0373927_0089359_1218_1826 | 186 |
| 176 | 3300035724 | Ga0373933_0340671 | Ga0373933_0340671_238_864 | 186 |
| 177 | 3300035725 | Ga0373947_0035994 | Ga0373947_0035994_138_746 | 186 |
| 178 | 3300036401 | Ga0373937_0004613 | Ga0373937_0004613_6547_7173 | 186 |
| 179 | 3300037068 | Ga0373925_0466402 | Ga0373925_0466402_316_930 | 186 |
| 180 | 3300037471 | Ga0395905_0077529 | Ga0395905_0077529_1424_2035 | 186 |
| 181 | 3300037853 | Ga0436364_0476354 | Ga0436364_0476354_184_792 | 186 |
| 182 | 3300038443 | Ga0395901_0067053 | Ga0395901_0067053_1786_2397 | 186 |
| 183 | 3300039437 | Ga0436365_1698837 | Ga0436365_1698837_234_845 | 186 |
| 184 | 3300039450 | Ga0436363_1437817 | Ga0436363_1437817_152_775 | 186 |
| 185 | 3300041451 | Ga0451791_0284711 | Ga0451791_0284711_21_620 | 186 |
| 186 | 3300041512 | Ga0451853_0921849 | Ga0451853_0921849_87_686 | 186 |
| 187 | 3300044735 | Ga0466968_0247024 | Ga0466968_0247024_134_748 | 186 |
| 188 | 3300046452 | Ga0495617_085353 | Ga0495617_085353_358_957 | 186 |
| 189 | 3300046454 | Ga0495592_0218026 | Ga0495592_0218026_197_805 | 186 |
| 190 | 3300046460 | Ga0495638_0021622 | Ga0495638_0021622_3485_4084 | 186 |
| 191 | 3300046460 | Ga0495638_0076101 | Ga0495638_0076101_56_661 | 186 |
| 192 | 3300046462 | Ga0495651_0037984 | Ga0495651_0037984_278_886 | 186 |
| 193 | 3300046463 | Ga0495653_0021824 | Ga0495653_0021824_261_848 | 186 |
| 194 | 3300046463 | Ga0495653_0155003 | Ga0495653_0155003_952_1560 | 186 |
| 195 | 3300046476 | Ga0495662_0033507 | Ga0495662_0033507_1578_2165 | 186 |
| 196 | 3300046477 | Ga0495664_0005157 | Ga0495664_0005157_2150_2737 | 186 |
| 197 | 3300046477 | Ga0495664_0432353 | Ga0495664_0432353_110_724 | 186 |
| 198 | 3300046477 | Ga0495664_0530360 | Ga0495664_0530360_64_672 | 186 |
| 199 | 3300046491 | Ga0495584_0108892 | Ga0495584_0108892_755_1354 | 186 |
| 200 | 3300046507 | Ga0495606_0313024 | Ga0495606_0313024_17_616 | 186 |
| 201 | 3300046513 | Ga0495616_0335648 | Ga0495616_0335648_20_619 | 186 |
| 202 | 3300046514 | Ga0495618_0014258 | Ga0495618_0014258_2334_2942 | 186 |
| 203 | 3300046533 | Ga0495640_0051741 | Ga0495640_0051741_2208_2795 | 186 |
| 204 | 3300046533 | Ga0495640_0169903 | Ga0495640_0169903_528_1136 | 186 |
| 205 | 3300046533 | Ga0495640_0486452 | Ga0495640_0486452_71_685 | 186 |
| 206 | 3300046536 | Ga0495587_0005897 | Ga0495587_0005897_6045_6653 | 186 |
| 207 | 3300046558 | Ga0495633_0094045 | Ga0495633_0094045_450_1049 | 186 |
| 208 | 3300046615 | Ga0495656_0308414 | Ga0495656_0308414_115_717 | 186 |
| 209 | 3300046648 | Ga0495611_0063779 | Ga0495611_0063779_59_658 | 186 |
| 210 | 3300046663 | Ga0495635_0029736 | Ga0495635_0029736_2942_3550 | 186 |
| 211 | 3300046663 | Ga0495635_0053819 | Ga0495635_0053819_2158_2745 | 186 |
| 212 | 3300046675 | Ga0495657_0068646 | Ga0495657_0068646_65_673 | 186 |
| 213 | 3300046678 | Ga0495599_0156310 | Ga0495599_0156310_564_1151 | 186 |
| 214 | 3300046679 | Ga0495623_0077150 | Ga0495623_0077150_1395_2003 | 186 |
| 215 | 3300046680 | Ga0495646_0113094 | Ga0495646_0113094_250_837 | 186 |
| 216 | 3300046689 | Ga0495613_0660189 | Ga0495613_0660189_36_644 | 186 |
| 217 | 3300046809 | Ga0495600_0339237 | Ga0495600_0339237_129_737 | 186 |
| 218 | 3300046809 | Ga0495600_0344774 | Ga0495600_0344774_278_892 | 186 |
| 219 | 3300046809 | Ga0495600_0574508 | Ga0495600_0574508_41_655 | 186 |
| 220 | 3300047317 | Ga0495604_0272830 | Ga0495604_0272830_43_630 | 186 |
| 221 | 3300047322 | Ga0495680_0154374 | Ga0495680_0154374_1018_1626 | 186 |
| 222 | 3300047471 | Ga0495684_0028335 | Ga0495684_0028335_358_945 | 186 |
| 223 | 3300047472 | Ga0495686_0224071 | Ga0495686_0224071_372_971 | 186 |
| 224 | 3300048088 | Ga0495602_0067291 | Ga0495602_0067291_2389_2997 | 186 |
| 225 | 3300048904 | Ga0496101_0290603 | Ga0496101_0290603_12_611 | 186 |
| 226 | 3300048914 | Ga0496111_0510088 | Ga0496111_0510088_212_811 | 186 |
| 227 | 3300048924 | Ga0496121_0095423 | Ga0496121_0095423_320_919 | 186 |
| 228 | 3300048924 | Ga0496121_0151137 | Ga0496121_0151137_231_830 | 186 |
| 229 | 3300048929 | Ga0496126_0060792 | Ga0496126_0060792_1822_2421 | 186 |
| 230 | 3300048929 | Ga0496126_0570173 | Ga0496126_0570173_237_851 | 186 |
| 231 | 3300050492 | nmdc:mga0yw44_168291_c1 | nmdc:mga0yw44_168291_c1_140_739 | 186 |
| 232 | 3300050495 | nmdc:mga04h51_9301_c1 | nmdc:mga04h51_9301_c1_27_626 | 186 |
| 233 | 3300050496 | nmdc:mga07m45_94518_c1 | nmdc:mga07m45_94518_c1_433_1032 | 186 |
| 234 | 3300050511 | nmdc:mga08y16_366135_c1 | nmdc:mga08y16_366135_c1_727_1326 | 186 |
| 235 | 3300053077 | Ga0495601_0173060 | Ga0495601_0173060_579_1187 | 186 |
| 236 | 3300053077 | Ga0495601_0249003 | Ga0495601_0249003_217_819 | 186 |
| 237 | 3300053078 | Ga0495612_0193999 | Ga0495612_0193999_11_598 | 186 |
| 238 | 3300053086 | Ga0500578_0445488 | Ga0500578_0445488_58_663 | 186 |
| 239 | 3300053091 | Ga0500647_0195221 | Ga0500647_0195221_259_873 | 186 |
| 240 | 3300053092 | Ga0500583_0009184 | Ga0500583_0009184_2246_2845 | 186 |
| 241 | 3300053092 | Ga0500583_0051691 | Ga0500583_0051691_33_632 | 186 |
| 242 | 3300053096 | Ga0500641_0005024 | Ga0500641_0005024_2577_3176 | 186 |
| 243 | 3300053096 | Ga0500641_0024967 | Ga0500641_0024967_103_702 | 186 |
| 244 | 3300053097 | Ga0500648_100720 | Ga0500648_100720_238_852 | 186 |
| 245 | 3300053119 | Ga0500595_001951 | Ga0500595_001951_1078_1677 | 186 |
| 246 | 3300053134 | Ga0500658_0145563 | Ga0500658_0145563_106_705 | 186 |
| 247 | 3300053134 | Ga0500658_0147074 | Ga0500658_0147074_120_719 | 186 |
| 248 | 3300053136 | Ga0500559_0015190 | Ga0500559_0015190_1019_1633 | 186 |
| 249 | 3300053139 | Ga0500568_0006709 | Ga0500568_0006709_4340_4948 | 186 |
| 250 | 3300053140 | Ga0500573_0008543 | Ga0500573_0008543_529_1143 | 186 |
| 251 | 3300053146 | Ga0500588_0129991 | Ga0500588_0129991_60_665 | 186 |
| 252 | 3300053147 | Ga0500589_042286 | Ga0500589_042286_1424_2023 | 186 |
| 253 | 3300053156 | Ga0500622_0248361 | Ga0500622_0248361_136_753 | 186 |
| 254 | 3300053161 | Ga0500634_0075126 | Ga0500634_0075126_413_1012 | 186 |
| 255 | 3300053161 | Ga0500634_0091011 | Ga0500634_0091011_713_1312 | 186 |
| 256 | 3300053177 | Ga0500636_0013138 | Ga0500636_0013138_3300_3914 | 186 |
| 257 | 3300053735 | Ga0500596_003281 | Ga0500596_003281_1676_2290 | 186 |
| 258 | iso_pu_bacteria | 2507262055 | 2507511875 | 186 |
| 259 | iso_pu_bacteria | 2508501009 | 2508545539 | 186 |
| 260 | iso_pu_bacteria | 2508501042 | 2508694357 | 186 |
| 261 | iso_pu_bacteria | 2513237096 | 2513659240 | 186 |
| 262 | iso_pu_bacteria | 2513237101 | 2513696314 | 186 |
| 263 | iso_pu_bacteria | 2513237137 | 2513859039 | 186 |
| 264 | iso_pu_bacteria | 2513237141 | 2513887727 | 186 |
| 265 | iso_pu_bacteria | 2513237145 | 2513921880 | 186 |
| 266 | iso_pu_bacteria | 2515154112 | 2515624712 | 186 |
| 267 | iso_pu_bacteria | 2517572143 | 2517895961 | 186 |
| 268 | iso_pu_bacteria | 2667528175 | 2671122755 | 186 |
| 269 | iso_pu_bacteria | 2721755755 | 2723842810 | 186 |
| 270 | iso_pu_bacteria | 2728368998 | 2728752344 | 186 |
| 271 | iso_pu_bacteria | 2791355197 | 2793069609 | 186 |
| 272 | iso_pu_bacteria | 2791355199 | 2793080288 | 186 |
| 273 | iso_pu_bacteria | 2874590934 | 2874592255 | 186 |
| 274 | iso_pu_bacteria | 2874604998 | 2874606516 | 186 |
| 275 | iso_pu_bacteria | 2874645413 | 2874647371 | 186 |
| 276 | iso_pu_bacteria | 2876771140 | 2876774782 | 186 |
| 277 | iso_pu_bacteria | 2876808645 | 2876809827 | 186 |
| 278 | iso_pu_bacteria | 2876818435 | 2876819735 | 186 |
| 279 | iso_pu_bacteria | 2879074833 | 2879079350 | 186 |
| 280 | iso_pu_bacteria | 2879110137 | 2879113774 | 186 |
| 281 | iso_pu_bacteria | 2879127579 | 2879129084 | 186 |
| 282 | iso_pu_bacteria | 2879142872 | 2879144761 | 186 |
| 283 | iso_pu_bacteria | 2885374607 | 2885382988 | 186 |
| 284 | iso_pu_bacteria | 2889033259 | 2889033863 | 186 |
| 285 | iso_pu_bacteria | 2903748898 | 2903756065 | 186 |
| 286 | iso_pu_bacteria | 2904690495 | 2904699113 | 186 |
| 287 | iso_pu_bacteria | 2904699407 | 2904707116 | 186 |
| 288 | iso_pu_bacteria | 2906610324 | 2906615569 | 186 |
| 289 | iso_pu_bacteria | 2906635258 | 2906642017 | 186 |
| 290 | iso_pu_bacteria | 2906660503 | 2906665003 | 186 |
| 291 | iso_pu_bacteria | 2908739725 | 2908745610 | 186 |
| 292 | iso_pu_bacteria | 2908756301 | 2908763682 | 186 |
| 293 | iso_pu_bacteria | 2922361189 | 2922367285 | 186 |
| 294 | iso_pu_bacteria | 2922386360 | 2922390011 | 186 |
| 295 | iso_pu_bacteria | 2922425934 | 2922432436 | 186 |
| 296 | iso_pu_bacteria | 2935630451 | 2935630750 | 186 |
| 297 | iso_pu_bacteria | 2935648319 | 2935650478 | 186 |
| 298 | iso_pu_bacteria | 2935656913 | 2935662920 | 186 |
| 299 | iso_pu_bacteria | 2935908558 | 2935911235 | 186 |
| 300 | iso_pu_bacteria | 2935916978 | 2935920767 | 186 |
| 301 | iso_pu_bacteria | 2935926038 | 2935928264 | 186 |
| 302 | iso_pu_bacteria | 2935934488 | 2935937909 | 186 |
| 303 | iso_pu_bacteria | 2935942939 | 2935945191 | 186 |
| 304 | iso_pu_bacteria | 2935951376 | 2935954303 | 186 |
| 305 | iso_pu_bacteria | 2935967501 | 2935971429 | 186 |
| 306 | iso_pu_bacteria | 2935975950 | 2935982049 | 186 |
| 307 | iso_pu_bacteria | 2935984226 | 2935990612 | 186 |
| 308 | iso_pu_bacteria | 2936011229 | 2936017166 | 186 |
| 309 | iso_pu_bacteria | 2936019824 | 2936026699 | 186 |
| 310 | iso_pu_bacteria | 2936028420 | 2936035442 | 186 |
| 311 | iso_pu_bacteria | 2936046547 | 2936053591 | 186 |
| 312 | iso_pu_bacteria | 2936055302 | 2936062669 | 186 |
| 313 | iso_pu_bacteria | 2941507105 | 2941507402 | 186 |
| 314 | iso_pu_bacteria | 2941515067 | 2941515829 | 186 |
| 315 | iso_pu_bacteria | 2941523033 | 2941523463 | 186 |
| 316 | iso_pu_bacteria | 3005474847 | 3005476602 | 186 |
| 317 | iso_pu_bacteria | 8006933436 | 8006934884 | 186 |
| 318 | iso_pu_bacteria | 8006964411 | 8006966127 | 186 |
| 319 | iso_pu_bacteria | 8006973647 | 8006974852 | 186 |
| 320 | iso_pu_bacteria | 8006984368 | 8006989710 | 186 |
| 321 | iso_pu_bacteria | 8006994254 | 8006998097 | 186 |
| 322 | iso_pu_bacteria | 8019555841 | 8019563775 | 186 |
| 323 | iso_pu_bacteria | 8019565922 | 8019573840 | 186 |
| 324 | iso_pu_bacteria | 8019619141 | 8019624152 | 186 |
| 325 | iso_pu_bacteria | 8019629233 | 8019637875 | 186 |
| 326 | iso_pu_bacteria | 8019638758 | 8019641749 | 186 |
| 327 | iso_pu_bacteria | 8019659431 | 8019665804 | 186 |
| 328 | iso_pu_bacteria | 8019668869 | 8019675330 | 186 |
| 329 | iso_pu_bacteria | 8019678201 | 8019680775 | 186 |
| 330 | iso_pu_bacteria | 8019687851 | 8019694993 | 186 |
| 331 | iso_pu_bacteria | 8056673599 | 8056675121 | 186 |
| 332 | iso_pu_bacteria | 8056689827 | 8056696202 | 186 |
| 333 | 3300005439 | Ga0070711_100077792 | Ga0070711_1000777922 | 187 |
| 334 | 3300031241 | Ga0265325_10000019 | Ga0265325_1000001958 | 187 |
| 335 | 3300031595 | Ga0265313_10067069 | Ga0265313_100670692 | 187 |
| 336 | 3300035170 | Ga0373943_0066209 | Ga0373943_0066209_325_942 | 187 |
| 337 | 3300035695 | Ga0373927_0007183 | Ga0373927_0007183_4354_4959 | 187 |
| 338 | 3300035695 | Ga0373927_0064676 | Ga0373927_0064676_17_622 | 187 |
| 339 | 3300037068 | Ga0373925_0023694 | Ga0373925_0023694_1483_2088 | 187 |
| 340 | 3300046517 | Ga0495630_0074877 | Ga0495630_0074877_1575_2180 | 187 |
| 341 | 3300048907 | Ga0496104_0047895 | Ga0496104_0047895_1915_2538 | 187 |
| 342 | 3300005353 | Ga0070669_100434671 | Ga0070669_1004346712 | 188 |
| 343 | 3300005355 | Ga0070671_100441341 | Ga0070671_1004413412 | 188 |
| 344 | 3300005437 | Ga0070710_10106609 | Ga0070710_101066092 | 188 |
| 345 | 3300005439 | Ga0070711_100591894 | Ga0070711_1005918941 | 188 |
| 346 | 3300006881 | Ga0068865_100216332 | Ga0068865_1002163323 | 188 |
| 347 | 3300009148 | Ga0105243_10162608 | Ga0105243_101626082 | 188 |
| 348 | 3300009551 | Ga0105238_10935501 | Ga0105238_109355011 | 188 |
| 349 | 3300025898 | Ga0207692_10092310 | Ga0207692_100923102 | 188 |
| 350 | 3300025915 | Ga0207693_10018708 | Ga0207693_100187085 | 188 |
| 351 | 3300025916 | Ga0207663_10132464 | Ga0207663_101324642 | 188 |
| 352 | 3300025931 | Ga0207644_10365892 | Ga0207644_103658921 | 188 |
| 353 | 3300025935 | Ga0207709_10688635 | Ga0207709_106886352 | 188 |
| 354 | 3300025939 | Ga0207665_10198325 | Ga0207665_101983252 | 188 |
| 355 | 3300025961 | Ga0207712_10252552 | Ga0207712_102525522 | 188 |
| 356 | 3300028573 | Ga0265334_10031226 | Ga0265334_100312262 | 188 |
| 357 | 3300031235 | Ga0265330_10052577 | Ga0265330_100525772 | 188 |
| 358 | 3300031238 | Ga0265332_10029296 | Ga0265332_100292962 | 188 |
| 359 | 3300031249 | Ga0265339_10303624 | Ga0265339_103036241 | 188 |
| 360 | 3300031250 | Ga0265331_10110613 | Ga0265331_101106132 | 188 |
| 361 | 3300031595 | Ga0265313_10117892 | Ga0265313_101178921 | 188 |
| 362 | 3300036459 | Ga0372808_023218 | Ga0372808_023218_96_728 | 188 |
| 363 | 3300046454 | Ga0495592_0341783 | Ga0495592_0341783_194_820 | 188 |
| 364 | 3300046536 | Ga0495587_0165550 | Ga0495587_0165550_360_986 | 188 |
| 365 | 3300048903 | Ga0496100_0032123 | Ga0496100_0032123_1060_1686 | 188 |
| 366 | 3300048904 | Ga0496101_0017665 | Ga0496101_0017665_3853_4479 | 188 |
| 367 | 3300048909 | Ga0496106_0149447 | Ga0496106_0149447_368_994 | 188 |
| 368 | 3300048918 | Ga0496115_0045511 | Ga0496115_0045511_270_896 | 188 |
| 369 | 3300053077 | Ga0495601_0250303 | Ga0495601_0250303_344_970 | 188 |
| 370 | 3300001430 | JGI24032J14994_100531 | JGI24032J14994_1005311 | 189 |
| 371 | 3300001989 | JGI24739J22299_10000871 | JGI24739J22299_1000087112 | 189 |
| 372 | 3300001990 | JGI24737J22298_10010529 | JGI24737J22298_100105293 | 189 |
| 373 | 3300002070 | JGI24750J21931_1009691 | JGI24750J21931_10096911 | 189 |
| 374 | 3300002074 | JGI24748J21848_1006767 | JGI24748J21848_10067671 | 189 |
| 375 | 3300002075 | JGI24738J21930_10002474 | JGI24738J21930_100024742 | 189 |
| 376 | 3300002077 | JGI24744J21845_10007283 | JGI24744J21845_100072832 | 189 |
| 377 | 3300002077 | JGI24744J21845_10007868 | JGI24744J21845_100078682 | 189 |
| 378 | 3300002239 | JGI24034J26672_10006652 | JGI24034J26672_100066522 | 189 |
| 379 | 3300002244 | JGI24742J22300_10003578 | JGI24742J22300_100035782 | 189 |
| 380 | 3300003203 | JGI25406J46586_10000064 | JGI25406J46586_1000006437 | 189 |
| 381 | 3300003659 | JGI25404J52841_10033318 | JGI25404J52841_100333182 | 189 |
| 382 | 3300003659 | JGI25404J52841_10078960 | JGI25404J52841_100789601 | 189 |
| 383 | 3300004798 | Ga0058859_11740492 | Ga0058859_117404921 | 189 |
| 384 | 3300005293 | Ga0065715_10174306 | Ga0065715_101743061 | 189 |
| 385 | 3300005293 | Ga0065715_10565648 | Ga0065715_105656481 | 189 |
| 386 | 3300005327 | Ga0070658_10710365 | Ga0070658_107103651 | 189 |
| 387 | 3300005328 | Ga0070676_10020837 | Ga0070676_100208373 | 189 |
| 388 | 3300005329 | Ga0070683_100041896 | Ga0070683_1000418962 | 189 |
| 389 | 3300005330 | Ga0070690_100226054 | Ga0070690_1002260542 | 189 |
| 390 | 3300005330 | Ga0070690_100230852 | Ga0070690_1002308522 | 189 |
| 391 | 3300005331 | Ga0070670_100077132 | Ga0070670_1000771322 | 189 |
| 392 | 3300005331 | Ga0070670_100183096 | Ga0070670_1001830962 | 189 |
| 393 | 3300005334 | Ga0068869_100021302 | Ga0068869_1000213022 | 189 |
| 394 | 3300005334 | Ga0068869_100082663 | Ga0068869_1000826631 | 189 |
| 395 | 3300005336 | Ga0070680_100003647 | Ga0070680_10000364711 | 189 |
| 396 | 3300005336 | Ga0070680_100029856 | Ga0070680_1000298562 | 189 |
| 397 | 3300005336 | Ga0070680_100121614 | Ga0070680_1001216142 | 189 |
| 398 | 3300005337 | Ga0070682_100007969 | Ga0070682_1000079697 | 189 |
| 399 | 3300005338 | Ga0068868_100138279 | Ga0068868_1001382793 | 189 |
| 400 | 3300005338 | Ga0068868_100408198 | Ga0068868_1004081981 | 189 |
| 401 | 3300005340 | Ga0070689_100031062 | Ga0070689_1000310622 | 189 |
| 402 | 3300005340 | Ga0070689_100121015 | Ga0070689_1001210152 | 189 |
| 403 | 3300005340 | Ga0070689_100208226 | Ga0070689_1002082262 | 189 |
| 404 | 3300005341 | Ga0070691_10004859 | Ga0070691_100048594 | 189 |
| 405 | 3300005343 | Ga0070687_100049605 | Ga0070687_1000496053 | 189 |
| 406 | 3300005343 | Ga0070687_100052564 | Ga0070687_1000525642 | 189 |
| 407 | 3300005344 | Ga0070661_100009866 | Ga0070661_1000098662 | 189 |
| 408 | 3300005345 | Ga0070692_10045412 | Ga0070692_100454123 | 189 |
| 409 | 3300005345 | Ga0070692_10260157 | Ga0070692_102601571 | 189 |
| 410 | 3300005347 | Ga0070668_100013726 | Ga0070668_1000137265 | 189 |
| 411 | 3300005347 | Ga0070668_100067131 | Ga0070668_1000671312 | 189 |
| 412 | 3300005347 | Ga0070668_100672016 | Ga0070668_1006720161 | 189 |
| 413 | 3300005353 | Ga0070669_100014406 | Ga0070669_1000144062 | 189 |
| 414 | 3300005353 | Ga0070669_100035084 | Ga0070669_1000350842 | 189 |
| 415 | 3300005353 | Ga0070669_100093037 | Ga0070669_1000930372 | 189 |
| 416 | 3300005354 | Ga0070675_100018170 | Ga0070675_1000181702 | 189 |
| 417 | 3300005354 | Ga0070675_100732289 | Ga0070675_1007322891 | 189 |
| 418 | 3300005355 | Ga0070671_100034258 | Ga0070671_1000342585 | 189 |
| 419 | 3300005355 | Ga0070671_100296361 | Ga0070671_1002963612 | 189 |
| 420 | 3300005356 | Ga0070674_100005693 | Ga0070674_1000056938 | 189 |
| 421 | 3300005356 | Ga0070674_100047397 | Ga0070674_1000473972 | 189 |
| 422 | 3300005364 | Ga0070673_100015849 | Ga0070673_1000158493 | 189 |
| 423 | 3300005365 | Ga0070688_100037805 | Ga0070688_1000378052 | 189 |
| 424 | 3300005365 | Ga0070688_100348498 | Ga0070688_1003484982 | 189 |
| 425 | 3300005365 | Ga0070688_100381848 | Ga0070688_1003818481 | 189 |
| 426 | 3300005366 | Ga0070659_100076576 | Ga0070659_1000765762 | 189 |
| 427 | 3300005366 | Ga0070659_100161364 | Ga0070659_1001613642 | 189 |
| 428 | 3300005366 | Ga0070659_100374802 | Ga0070659_1003748021 | 189 |
| 429 | 3300005366 | Ga0070659_100445386 | Ga0070659_1004453861 | 189 |
| 430 | 3300005367 | Ga0070667_100024258 | Ga0070667_1000242582 | 189 |
| 431 | 3300005367 | Ga0070667_100032997 | Ga0070667_1000329977 | 189 |
| 432 | 3300005406 | Ga0070703_10003201 | Ga0070703_100032012 | 189 |
| 433 | 3300005436 | Ga0070713_100003057 | Ga0070713_1000030574 | 189 |
| 434 | 3300005436 | Ga0070713_100347891 | Ga0070713_1003478911 | 189 |
| 435 | 3300005438 | Ga0070701_10004348 | Ga0070701_100043485 | 189 |
| 436 | 3300005440 | Ga0070705_100023373 | Ga0070705_1000233734 | 189 |
| 437 | 3300005440 | Ga0070705_100126002 | Ga0070705_1001260023 | 189 |
| 438 | 3300005441 | Ga0070700_100039431 | Ga0070700_1000394312 | 189 |
| 439 | 3300005444 | Ga0070694_100019693 | Ga0070694_1000196932 | 189 |
| 440 | 3300005444 | Ga0070694_100109804 | Ga0070694_1001098042 | 189 |
| 441 | 3300005445 | Ga0070708_100209630 | Ga0070708_1002096302 | 189 |
| 442 | 3300005445 | Ga0070708_100521341 | Ga0070708_1005213412 | 189 |
| 443 | 3300005455 | Ga0070663_100027341 | Ga0070663_1000273412 | 189 |
| 444 | 3300005455 | Ga0070663_100059872 | Ga0070663_1000598722 | 189 |
| 445 | 3300005455 | Ga0070663_100082344 | Ga0070663_1000823442 | 189 |
| 446 | 3300005456 | Ga0070678_100052290 | Ga0070678_1000522902 | 189 |
| 447 | 3300005456 | Ga0070678_100086184 | Ga0070678_1000861843 | 189 |
| 448 | 3300005457 | Ga0070662_100033312 | Ga0070662_1000333122 | 189 |
| 449 | 3300005457 | Ga0070662_100071711 | Ga0070662_1000717112 | 189 |
| 450 | 3300005457 | Ga0070662_100120688 | Ga0070662_1001206883 | 189 |
| 451 | 3300005458 | Ga0070681_10032947 | Ga0070681_100329472 | 189 |
| 452 | 3300005459 | Ga0068867_100021271 | Ga0068867_1000212715 | 189 |
| 453 | 3300005459 | Ga0068867_100128077 | Ga0068867_1001280772 | 189 |
| 454 | 3300005466 | Ga0070685_10048441 | Ga0070685_100484412 | 189 |
| 455 | 3300005467 | Ga0070706_100624318 | Ga0070706_1006243181 | 189 |
| 456 | 3300005535 | Ga0070684_100022473 | Ga0070684_1000224732 | 189 |
| 457 | 3300005535 | Ga0070684_100254112 | Ga0070684_1002541121 | 189 |
| 458 | 3300005536 | Ga0070697_100173177 | Ga0070697_1001731772 | 189 |
| 459 | 3300005539 | Ga0068853_100002207 | Ga0068853_1000022077 | 189 |
| 460 | 3300005539 | Ga0068853_100003634 | Ga0068853_10000363411 | 189 |
| 461 | 3300005539 | Ga0068853_100061086 | Ga0068853_1000610862 | 189 |
| 462 | 3300005539 | Ga0068853_100426138 | Ga0068853_1004261382 | 189 |
| 463 | 3300005543 | Ga0070672_100006742 | Ga0070672_1000067428 | 189 |
| 464 | 3300005544 | Ga0070686_100035110 | Ga0070686_1000351102 | 189 |
| 465 | 3300005545 | Ga0070695_100027274 | Ga0070695_1000272742 | 189 |
| 466 | 3300005546 | Ga0070696_100027513 | Ga0070696_1000275132 | 189 |
| 467 | 3300005547 | Ga0070693_100024374 | Ga0070693_1000243743 | 189 |
| 468 | 3300005548 | Ga0070665_100009777 | Ga0070665_1000097777 | 189 |
| 469 | 3300005548 | Ga0070665_100063185 | Ga0070665_1000631854 | 189 |
| 470 | 3300005548 | Ga0070665_100237840 | Ga0070665_1002378402 | 189 |
| 471 | 3300005548 | Ga0070665_100360172 | Ga0070665_1003601721 | 189 |
| 472 | 3300005548 | Ga0070665_101072015 | Ga0070665_1010720152 | 189 |
| 473 | 3300005549 | Ga0070704_100025802 | Ga0070704_1000258023 | 189 |
| 474 | 3300005549 | Ga0070704_100208955 | Ga0070704_1002089552 | 189 |
| 475 | 3300005563 | Ga0068855_100018412 | Ga0068855_1000184122 | 189 |
| 476 | 3300005563 | Ga0068855_100121549 | Ga0068855_1001215492 | 189 |
| 477 | 3300005564 | Ga0070664_100069419 | Ga0070664_1000694192 | 189 |
| 478 | 3300005564 | Ga0070664_100118200 | Ga0070664_1001182003 | 189 |
| 479 | 3300005577 | Ga0068857_100038621 | Ga0068857_1000386212 | 189 |
| 480 | 3300005578 | Ga0068854_100016856 | Ga0068854_1000168564 | 189 |
| 481 | 3300005614 | Ga0068856_100074006 | Ga0068856_1000740062 | 189 |
| 482 | 3300005615 | Ga0070702_100058574 | Ga0070702_1000585742 | 189 |
| 483 | 3300005615 | Ga0070702_100108151 | Ga0070702_1001081512 | 189 |
| 484 | 3300005616 | Ga0068852_100024735 | Ga0068852_1000247354 | 189 |
| 485 | 3300005616 | Ga0068852_100028928 | Ga0068852_1000289282 | 189 |
| 486 | 3300005616 | Ga0068852_100135745 | Ga0068852_1001357453 | 189 |
| 487 | 3300005616 | Ga0068852_100321492 | Ga0068852_1003214922 | 189 |
| 488 | 3300005616 | Ga0068852_100597485 | Ga0068852_1005974851 | 189 |
| 489 | 3300005617 | Ga0068859_100035913 | Ga0068859_1000359132 | 189 |
| 490 | 3300005617 | Ga0068859_100096333 | Ga0068859_1000963332 | 189 |
| 491 | 3300005617 | Ga0068859_100279653 | Ga0068859_1002796531 | 189 |
| 492 | 3300005618 | Ga0068864_100026533 | Ga0068864_1000265334 | 189 |
| 493 | 3300005618 | Ga0068864_100459111 | Ga0068864_1004591112 | 189 |
| 494 | 3300005718 | Ga0068866_10100091 | Ga0068866_101000912 | 189 |
| 495 | 3300005718 | Ga0068866_10195582 | Ga0068866_101955822 | 189 |
| 496 | 3300005719 | Ga0068861_100019676 | Ga0068861_1000196762 | 189 |
| 497 | 3300005719 | Ga0068861_100042474 | Ga0068861_1000424744 | 189 |
| 498 | 3300005719 | Ga0068861_100048184 | Ga0068861_1000481842 | 189 |
| 499 | 3300005719 | Ga0068861_100214160 | Ga0068861_1002141602 | 189 |
| 500 | 3300005834 | Ga0068851_10206447 | Ga0068851_102064472 | 189 |
| 501 | 3300005840 | Ga0068870_10026852 | Ga0068870_100268522 | 189 |
| 502 | 3300005841 | Ga0068863_100006825 | Ga0068863_1000068252 | 189 |
| 503 | 3300005842 | Ga0068858_100057433 | Ga0068858_1000574332 | 189 |
| 504 | 3300005842 | Ga0068858_100484718 | Ga0068858_1004847182 | 189 |
| 505 | 3300005842 | Ga0068858_100806662 | Ga0068858_1008066622 | 189 |
| 506 | 3300005843 | Ga0068860_100002033 | Ga0068860_1000020333 | 189 |
| 507 | 3300005843 | Ga0068860_100018432 | Ga0068860_1000184326 | 189 |
| 508 | 3300005843 | Ga0068860_100040901 | Ga0068860_1000409018 | 189 |
| 509 | 3300005843 | Ga0068860_100158101 | Ga0068860_1001581013 | 189 |
| 510 | 3300005843 | Ga0068860_101373457 | Ga0068860_1013734571 | 189 |
| 511 | 3300005844 | Ga0068862_100010222 | Ga0068862_1000102222 | 189 |
| 512 | 3300005844 | Ga0068862_100028055 | Ga0068862_1000280554 | 189 |
| 513 | 3300005844 | Ga0068862_100083389 | Ga0068862_1000833894 | 189 |
| 514 | 3300005844 | Ga0068862_100342269 | Ga0068862_1003422692 | 189 |
| 515 | 3300005937 | Ga0081455_10000200 | Ga0081455_1000020055 | 189 |
| 516 | 3300005937 | Ga0081455_10033922 | Ga0081455_100339224 | 189 |
| 517 | 3300005937 | Ga0081455_10091058 | Ga0081455_100910583 | 189 |
| 518 | 3300005937 | Ga0081455_10114395 | Ga0081455_101143951 | 189 |
| 519 | 3300005981 | Ga0081538_10011493 | Ga0081538_100114931 | 189 |
| 520 | 3300005983 | Ga0081540_1002062 | Ga0081540_100206210 | 189 |
| 521 | 3300005983 | Ga0081540_1004242 | Ga0081540_100424211 | 189 |
| 522 | 3300005983 | Ga0081540_1021026 | Ga0081540_10210264 | 189 |
| 523 | 3300005985 | Ga0081539_10000099 | Ga0081539_1000009999 | 189 |
| 524 | 3300006028 | Ga0070717_10003779 | Ga0070717_100037799 | 189 |
| 525 | 3300006028 | Ga0070717_10004793 | Ga0070717_100047939 | 189 |
| 526 | 3300006038 | Ga0075365_10012654 | Ga0075365_100126546 | 189 |
| 527 | 3300006042 | Ga0075368_10010256 | Ga0075368_100102562 | 189 |
| 528 | 3300006042 | Ga0075368_10197072 | Ga0075368_101970721 | 189 |
| 529 | 3300006048 | Ga0075363_100011785 | Ga0075363_1000117852 | 189 |
| 530 | 3300006048 | Ga0075363_100223399 | Ga0075363_1002233991 | 189 |
| 531 | 3300006048 | Ga0075363_100476049 | Ga0075363_1004760491 | 189 |
| 532 | 3300006051 | Ga0075364_10115711 | Ga0075364_101157112 | 189 |
| 533 | 3300006051 | Ga0075364_10263586 | Ga0075364_102635862 | 189 |
| 534 | 3300006175 | Ga0070712_100233934 | Ga0070712_1002339341 | 189 |
| 535 | 3300006178 | Ga0075367_10013887 | Ga0075367_100138873 | 189 |
| 536 | 3300006195 | Ga0075366_10225549 | Ga0075366_102255492 | 189 |
| 537 | 3300006195 | Ga0075366_10284461 | Ga0075366_102844611 | 189 |
| 538 | 3300006237 | Ga0097621_100007897 | Ga0097621_1000078976 | 189 |
| 539 | 3300006237 | Ga0097621_100302683 | Ga0097621_1003026832 | 189 |
| 540 | 3300006353 | Ga0075370_10003183 | Ga0075370_100031834 | 189 |
| 541 | 3300006353 | Ga0075370_10104230 | Ga0075370_101042302 | 189 |
| 542 | 3300006353 | Ga0075370_10401972 | Ga0075370_104019721 | 189 |
| 543 | 3300006358 | Ga0068871_100029425 | Ga0068871_1000294252 | 189 |
| 544 | 3300006844 | Ga0075428_100300564 | Ga0075428_1003005641 | 189 |
| 545 | 3300006852 | Ga0075433_10025119 | Ga0075433_100251196 | 189 |
| 546 | 3300006871 | Ga0075434_100008091 | Ga0075434_1000080912 | 189 |
| 547 | 3300006881 | Ga0068865_100001544 | Ga0068865_10000154413 | 189 |
| 548 | 3300006931 | Ga0097620_100035916 | Ga0097620_1000359162 | 189 |
| 549 | 3300006931 | Ga0097620_100096333 | Ga0097620_1000963332 | 189 |
| 550 | 3300006931 | Ga0097620_100279657 | Ga0097620_1002796571 | 189 |
| 551 | 3300007076 | Ga0075435_100603384 | Ga0075435_1006033841 | 189 |
| 552 | 3300007788 | Ga0099795_10033214 | Ga0099795_100332142 | 189 |
| 553 | 3300007788 | Ga0099795_10067720 | Ga0099795_100677202 | 189 |
| 554 | 3300007788 | Ga0099795_10235779 | Ga0099795_102357791 | 189 |
| 555 | 3300009036 | Ga0105244_10185079 | Ga0105244_101850791 | 189 |
| 556 | 3300009092 | Ga0105250_10043606 | Ga0105250_100436062 | 189 |
| 557 | 3300009092 | Ga0105250_10122793 | Ga0105250_101227931 | 189 |
| 558 | 3300009093 | Ga0105240_10012128 | Ga0105240_100121284 | 189 |
| 559 | 3300009093 | Ga0105240_10140846 | Ga0105240_101408462 | 189 |
| 560 | 3300009094 | Ga0111539_10001808 | Ga0111539_100018082 | 189 |
| 561 | 3300009094 | Ga0111539_10057213 | Ga0111539_100572134 | 189 |
| 562 | 3300009094 | Ga0111539_10739166 | Ga0111539_107391662 | 189 |
| 563 | 3300009098 | Ga0105245_10060262 | Ga0105245_100602622 | 189 |
| 564 | 3300009098 | Ga0105245_10514256 | Ga0105245_105142562 | 189 |
| 565 | 3300009101 | Ga0105247_10087187 | Ga0105247_100871873 | 189 |
| 566 | 3300009101 | Ga0105247_10143497 | Ga0105247_101434972 | 189 |
| 567 | 3300009148 | Ga0105243_10139000 | Ga0105243_101390003 | 189 |
| 568 | 3300009148 | Ga0105243_10241861 | Ga0105243_102418612 | 189 |
| 569 | 3300009174 | Ga0105241_10031108 | Ga0105241_100311084 | 189 |
| 570 | 3300009174 | Ga0105241_10272783 | Ga0105241_102727831 | 189 |
| 571 | 3300009176 | Ga0105242_10153900 | Ga0105242_101539002 | 189 |
| 572 | 3300009177 | Ga0105248_10005933 | Ga0105248_100059333 | 189 |
| 573 | 3300009177 | Ga0105248_10011779 | Ga0105248_100117795 | 189 |
| 574 | 3300009177 | Ga0105248_10034176 | Ga0105248_100341762 | 189 |
| 575 | 3300009545 | Ga0105237_10004719 | Ga0105237_1000471914 | 189 |
| 576 | 3300009545 | Ga0105237_10007432 | Ga0105237_100074322 | 189 |
| 577 | 3300009545 | Ga0105237_10070348 | Ga0105237_100703481 | 189 |
| 578 | 3300009545 | Ga0105237_10599999 | Ga0105237_105999992 | 189 |
| 579 | 3300009551 | Ga0105238_10003421 | Ga0105238_100034215 | 189 |
| 580 | 3300009551 | Ga0105238_10436192 | Ga0105238_104361922 | 189 |
| 581 | 3300009553 | Ga0105249_10014723 | Ga0105249_100147231 | 189 |
| 582 | 3300009553 | Ga0105249_10019871 | Ga0105249_100198712 | 189 |
| 583 | 3300009553 | Ga0105249_10528641 | Ga0105249_105286412 | 189 |
| 584 | 3300010159 | Ga0099796_10022143 | Ga0099796_100221432 | 189 |
| 585 | 3300010159 | Ga0099796_10130836 | Ga0099796_101308361 | 189 |
| 586 | 3300010375 | Ga0105239_10023212 | Ga0105239_100232123 | 189 |
| 587 | 3300010375 | Ga0105239_10102667 | Ga0105239_101026672 | 189 |
| 588 | 3300010375 | Ga0105239_10797822 | Ga0105239_107978222 | 189 |
| 589 | 3300010375 | Ga0105239_11371603 | Ga0105239_113716032 | 189 |
| 590 | 3300011119 | Ga0105246_10079330 | Ga0105246_100793302 | 189 |
| 591 | 3300011119 | Ga0105246_10597510 | Ga0105246_105975102 | 189 |
| 592 | 3300013100 | Ga0157373_10024897 | Ga0157373_100248975 | 189 |
| 593 | 3300013100 | Ga0157373_10298226 | Ga0157373_102982262 | 189 |
| 594 | 3300013105 | Ga0157369_10065365 | Ga0157369_100653655 | 189 |
| 595 | 3300013105 | Ga0157369_10315863 | Ga0157369_103158632 | 189 |
| 596 | 3300013296 | Ga0157374_10411201 | Ga0157374_104112012 | 189 |
| 597 | 3300013297 | Ga0157378_10031566 | Ga0157378_100315662 | 189 |
| 598 | 3300013297 | Ga0157378_10104776 | Ga0157378_101047763 | 189 |
| 599 | 3300013297 | Ga0157378_10258421 | Ga0157378_102584212 | 189 |
| 600 | 3300013306 | Ga0163162_10022234 | Ga0163162_100222347 | 189 |
| 601 | 3300013306 | Ga0163162_10053512 | Ga0163162_100535122 | 189 |
| 602 | 3300013307 | Ga0157372_10016582 | Ga0157372_100165823 | 189 |
| 603 | 3300013307 | Ga0157372_10186079 | Ga0157372_101860792 | 189 |
| 604 | 3300013308 | Ga0157375_10084799 | Ga0157375_100847993 | 189 |
| 605 | 3300013308 | Ga0157375_10261478 | Ga0157375_102614782 | 189 |
| 606 | 3300013308 | Ga0157375_10298866 | Ga0157375_102988663 | 189 |
| 607 | 3300014325 | Ga0163163_10016805 | Ga0163163_100168052 | 189 |
| 608 | 3300014325 | Ga0163163_10226212 | Ga0163163_102262122 | 189 |
| 609 | 3300014326 | Ga0157380_10100984 | Ga0157380_101009842 | 189 |
| 610 | 3300014745 | Ga0157377_10013798 | Ga0157377_100137982 | 189 |
| 611 | 3300014968 | Ga0157379_10089794 | Ga0157379_100897942 | 189 |
| 612 | 3300014968 | Ga0157379_10153801 | Ga0157379_101538012 | 189 |
| 613 | 3300014969 | Ga0157376_10006128 | Ga0157376_100061286 | 189 |
| 614 | 3300014969 | Ga0157376_10217613 | Ga0157376_102176132 | 189 |
| 615 | 3300017792 | Ga0163161_10006229 | Ga0163161_100062292 | 189 |
| 616 | 3300017792 | Ga0163161_10675526 | Ga0163161_106755262 | 189 |
| 617 | 3300021384 | Ga0213876_10340105 | Ga0213876_103401051 | 189 |
| 618 | 3300025271 | Ga0207666_1000311 | Ga0207666_10003112 | 189 |
| 619 | 3300025290 | Ga0207673_1003304 | Ga0207673_10033042 | 189 |
| 620 | 3300025297 | Ga0209758_1001737 | Ga0209758_100173716 | 189 |
| 621 | 3300025297 | Ga0209758_1003580 | Ga0209758_10035804 | 189 |
| 622 | 3300025315 | Ga0207697_10006626 | Ga0207697_100066262 | 189 |
| 623 | 3300025885 | Ga0207653_10002805 | Ga0207653_100028056 | 189 |
| 624 | 3300025893 | Ga0207682_10000009 | Ga0207682_1000000968 | 189 |
| 625 | 3300025893 | Ga0207682_10014469 | Ga0207682_100144694 | 189 |
| 626 | 3300025899 | Ga0207642_10044313 | Ga0207642_100443132 | 189 |
| 627 | 3300025900 | Ga0207710_10002730 | Ga0207710_100027305 | 189 |
| 628 | 3300025901 | Ga0207688_10000892 | Ga0207688_1000089215 | 189 |
| 629 | 3300025904 | Ga0207647_10002160 | Ga0207647_1000216015 | 189 |
| 630 | 3300025905 | Ga0207685_10406230 | Ga0207685_104062301 | 189 |
| 631 | 3300025907 | Ga0207645_10000999 | Ga0207645_1000099921 | 189 |
| 632 | 3300025908 | Ga0207643_10006739 | Ga0207643_100067393 | 189 |
| 633 | 3300025909 | Ga0207705_10522401 | Ga0207705_105224011 | 189 |
| 634 | 3300025909 | Ga0207705_10596831 | Ga0207705_105968311 | 189 |
| 635 | 3300025911 | Ga0207654_10236456 | Ga0207654_102364561 | 189 |
| 636 | 3300025912 | Ga0207707_10002224 | Ga0207707_1000222417 | 189 |
| 637 | 3300025912 | Ga0207707_10020542 | Ga0207707_100205427 | 189 |
| 638 | 3300025913 | Ga0207695_10046019 | Ga0207695_100460193 | 189 |
| 639 | 3300025914 | Ga0207671_10035416 | Ga0207671_100354164 | 189 |
| 640 | 3300025914 | Ga0207671_10064994 | Ga0207671_100649943 | 189 |
| 641 | 3300025914 | Ga0207671_10180264 | Ga0207671_101802641 | 189 |
| 642 | 3300025915 | Ga0207693_10205162 | Ga0207693_102051622 | 189 |
| 643 | 3300025915 | Ga0207693_10227981 | Ga0207693_102279811 | 189 |
| 644 | 3300025916 | Ga0207663_10599911 | Ga0207663_105999111 | 189 |
| 645 | 3300025917 | Ga0207660_10001283 | Ga0207660_100012832 | 189 |
| 646 | 3300025917 | Ga0207660_10010206 | Ga0207660_100102065 | 189 |
| 647 | 3300025918 | Ga0207662_10000025 | Ga0207662_1000002567 | 189 |
| 648 | 3300025918 | Ga0207662_10037874 | Ga0207662_100378743 | 189 |
| 649 | 3300025919 | Ga0207657_10005246 | Ga0207657_100052468 | 189 |
| 650 | 3300025919 | Ga0207657_10018108 | Ga0207657_100181082 | 189 |
| 651 | 3300025920 | Ga0207649_10002186 | Ga0207649_100021865 | 189 |
| 652 | 3300025921 | Ga0207652_10004348 | Ga0207652_100043488 | 189 |
| 653 | 3300025921 | Ga0207652_10035191 | Ga0207652_100351912 | 189 |
| 654 | 3300025923 | Ga0207681_10007074 | Ga0207681_100070742 | 189 |
| 655 | 3300025923 | Ga0207681_10068564 | Ga0207681_100685643 | 189 |
| 656 | 3300025923 | Ga0207681_10248997 | Ga0207681_102489972 | 189 |
| 657 | 3300025924 | Ga0207694_10075578 | Ga0207694_100755783 | 189 |
| 658 | 3300025924 | Ga0207694_10082962 | Ga0207694_100829621 | 189 |
| 659 | 3300025924 | Ga0207694_10318994 | Ga0207694_103189942 | 189 |
| 660 | 3300025925 | Ga0207650_10190498 | Ga0207650_101904982 | 189 |
| 661 | 3300025925 | Ga0207650_10388174 | Ga0207650_103881741 | 189 |
| 662 | 3300025926 | Ga0207659_10030381 | Ga0207659_100303813 | 189 |
| 663 | 3300025926 | Ga0207659_10262721 | Ga0207659_102627212 | 189 |
| 664 | 3300025927 | Ga0207687_10001197 | Ga0207687_1000119714 | 189 |
| 665 | 3300025928 | Ga0207700_10055969 | Ga0207700_100559692 | 189 |
| 666 | 3300025928 | Ga0207700_10092879 | Ga0207700_100928792 | 189 |
| 667 | 3300025928 | Ga0207700_10144687 | Ga0207700_101446873 | 189 |
| 668 | 3300025928 | Ga0207700_10469555 | Ga0207700_104695552 | 189 |
| 669 | 3300025929 | Ga0207664_10152833 | Ga0207664_101528331 | 189 |
| 670 | 3300025929 | Ga0207664_10375743 | Ga0207664_103757431 | 189 |
| 671 | 3300025929 | Ga0207664_10828401 | Ga0207664_108284011 | 189 |
| 672 | 3300025931 | Ga0207644_10036076 | Ga0207644_100360764 | 189 |
| 673 | 3300025932 | Ga0207690_10011755 | Ga0207690_100117552 | 189 |
| 674 | 3300025933 | Ga0207706_10005363 | Ga0207706_1000536312 | 189 |
| 675 | 3300025933 | Ga0207706_10040844 | Ga0207706_100408442 | 189 |
| 676 | 3300025933 | Ga0207706_10103304 | Ga0207706_101033042 | 189 |
| 677 | 3300025934 | Ga0207686_10001310 | Ga0207686_100013103 | 189 |
| 678 | 3300025934 | Ga0207686_10274618 | Ga0207686_102746182 | 189 |
| 679 | 3300025935 | Ga0207709_10006190 | Ga0207709_100061904 | 189 |
| 680 | 3300025935 | Ga0207709_10012682 | Ga0207709_100126824 | 189 |
| 681 | 3300025936 | Ga0207670_10013997 | Ga0207670_100139972 | 189 |
| 682 | 3300025936 | Ga0207670_10118723 | Ga0207670_101187232 | 189 |
| 683 | 3300025936 | Ga0207670_10194202 | Ga0207670_101942022 | 189 |
| 684 | 3300025937 | Ga0207669_10001324 | Ga0207669_1000132411 | 189 |
| 685 | 3300025937 | Ga0207669_10157264 | Ga0207669_101572642 | 189 |
| 686 | 3300025937 | Ga0207669_10659658 | Ga0207669_106596581 | 189 |
| 687 | 3300025938 | Ga0207704_10003457 | Ga0207704_100034572 | 189 |
| 688 | 3300025940 | Ga0207691_10002604 | Ga0207691_100026042 | 189 |
| 689 | 3300025940 | Ga0207691_10159553 | Ga0207691_101595532 | 189 |
| 690 | 3300025941 | Ga0207711_10031474 | Ga0207711_100314743 | 189 |
| 691 | 3300025941 | Ga0207711_10073623 | Ga0207711_100736232 | 189 |
| 692 | 3300025941 | Ga0207711_10101876 | Ga0207711_101018761 | 189 |
| 693 | 3300025942 | Ga0207689_10001156 | Ga0207689_1000115624 | 189 |
| 694 | 3300025942 | Ga0207689_10038650 | Ga0207689_100386502 | 189 |
| 695 | 3300025942 | Ga0207689_10087744 | Ga0207689_100877442 | 189 |
| 696 | 3300025944 | Ga0207661_10007789 | Ga0207661_100077893 | 189 |
| 697 | 3300025945 | Ga0207679_10004160 | Ga0207679_100041603 | 189 |
| 698 | 3300025949 | Ga0207667_10012980 | Ga0207667_100129808 | 189 |
| 699 | 3300025949 | Ga0207667_10077987 | Ga0207667_100779874 | 189 |
| 700 | 3300025949 | Ga0207667_10310444 | Ga0207667_103104443 | 189 |
| 701 | 3300025949 | Ga0207667_10507823 | Ga0207667_105078232 | 189 |
| 702 | 3300025960 | Ga0207651_10087185 | Ga0207651_100871852 | 189 |
| 703 | 3300025960 | Ga0207651_10328099 | Ga0207651_103280992 | 189 |
| 704 | 3300025961 | Ga0207712_10000579 | Ga0207712_100005792 | 189 |
| 705 | 3300025972 | Ga0207668_10001403 | Ga0207668_100014039 | 189 |
| 706 | 3300025972 | Ga0207668_10032114 | Ga0207668_100321143 | 189 |
| 707 | 3300025972 | Ga0207668_10033457 | Ga0207668_100334573 | 189 |
| 708 | 3300025972 | Ga0207668_10079730 | Ga0207668_100797303 | 189 |
| 709 | 3300025972 | Ga0207668_10481642 | Ga0207668_104816422 | 189 |
| 710 | 3300025981 | Ga0207640_10003644 | Ga0207640_100036442 | 189 |
| 711 | 3300025986 | Ga0207658_10113485 | Ga0207658_101134852 | 189 |
| 712 | 3300025986 | Ga0207658_10359771 | Ga0207658_103597712 | 189 |
| 713 | 3300025986 | Ga0207658_10372366 | Ga0207658_103723662 | 189 |
| 714 | 3300025986 | Ga0207658_10608626 | Ga0207658_106086261 | 189 |
| 715 | 3300026035 | Ga0207703_10014416 | Ga0207703_100144162 | 189 |
| 716 | 3300026041 | Ga0207639_10001866 | Ga0207639_1000186613 | 189 |
| 717 | 3300026041 | Ga0207639_10128563 | Ga0207639_101285632 | 189 |
| 718 | 3300026041 | Ga0207639_10547058 | Ga0207639_105470581 | 189 |
| 719 | 3300026067 | Ga0207678_10027315 | Ga0207678_100273154 | 189 |
| 720 | 3300026067 | Ga0207678_10042596 | Ga0207678_100425962 | 189 |
| 721 | 3300026067 | Ga0207678_10048901 | Ga0207678_100489014 | 189 |
| 722 | 3300026067 | Ga0207678_10062786 | Ga0207678_100627862 | 189 |
| 723 | 3300026067 | Ga0207678_10080462 | Ga0207678_100804623 | 189 |
| 724 | 3300026067 | Ga0207678_10080882 | Ga0207678_100808823 | 189 |
| 725 | 3300026067 | Ga0207678_10222167 | Ga0207678_102221672 | 189 |
| 726 | 3300026075 | Ga0207708_10020931 | Ga0207708_100209313 | 189 |
| 727 | 3300026075 | Ga0207708_10023687 | Ga0207708_100236872 | 189 |
| 728 | 3300026075 | Ga0207708_10050635 | Ga0207708_100506352 | 189 |
| 729 | 3300026075 | Ga0207708_10480363 | Ga0207708_104803631 | 189 |
| 730 | 3300026078 | Ga0207702_10010946 | Ga0207702_100109465 | 189 |
| 731 | 3300026078 | Ga0207702_10257067 | Ga0207702_102570672 | 189 |
| 732 | 3300026088 | Ga0207641_10006404 | Ga0207641_100064046 | 189 |
| 733 | 3300026089 | Ga0207648_10004627 | Ga0207648_1000462714 | 189 |
| 734 | 3300026089 | Ga0207648_10046915 | Ga0207648_100469154 | 189 |
| 735 | 3300026089 | Ga0207648_10807228 | Ga0207648_108072281 | 189 |
| 736 | 3300026095 | Ga0207676_10030863 | Ga0207676_100308632 | 189 |
| 737 | 3300026095 | Ga0207676_10282270 | Ga0207676_102822702 | 189 |
| 738 | 3300026116 | Ga0207674_10112597 | Ga0207674_101125972 | 189 |
| 739 | 3300026116 | Ga0207674_10530319 | Ga0207674_105303192 | 189 |
| 740 | 3300026118 | Ga0207675_100003859 | Ga0207675_10000385915 | 189 |
| 741 | 3300026121 | Ga0207683_10000850 | Ga0207683_100008502 | 189 |
| 742 | 3300026121 | Ga0207683_10051919 | Ga0207683_100519194 | 189 |
| 743 | 3300026121 | Ga0207683_10176198 | Ga0207683_101761983 | 189 |
| 744 | 3300026142 | Ga0207698_10087412 | Ga0207698_100874123 | 189 |
| 745 | 3300026142 | Ga0207698_10089661 | Ga0207698_100896613 | 189 |
| 746 | 3300026142 | Ga0207698_10636350 | Ga0207698_106363502 | 189 |
| 747 | 3300027424 | Ga0209984_1018261 | Ga0209984_10182612 | 189 |
| 748 | 3300027617 | Ga0210002_1003557 | Ga0210002_10035572 | 189 |
| 749 | 3300027717 | Ga0209998_10002588 | Ga0209998_100025885 | 189 |
| 750 | 3300027866 | Ga0209813_10105597 | Ga0209813_101055971 | 189 |
| 751 | 3300027876 | Ga0209974_10003747 | Ga0209974_100037477 | 189 |
| 752 | 3300027907 | Ga0207428_10000164 | Ga0207428_1000016443 | 189 |
| 753 | 3300027907 | Ga0207428_10459443 | Ga0207428_104594432 | 189 |
| 754 | 3300028379 | Ga0268266_10012217 | Ga0268266_100122174 | 189 |
| 755 | 3300028379 | Ga0268266_10013853 | Ga0268266_100138531 | 189 |
| 756 | 3300028379 | Ga0268266_10227310 | Ga0268266_102273102 | 189 |
| 757 | 3300028379 | Ga0268266_10363782 | Ga0268266_103637822 | 189 |
| 758 | 3300028379 | Ga0268266_10559329 | Ga0268266_105593291 | 189 |
| 759 | 3300028380 | Ga0268265_10004025 | Ga0268265_100040257 | 189 |
| 760 | 3300028380 | Ga0268265_10022554 | Ga0268265_100225544 | 189 |
| 761 | 3300028380 | Ga0268265_10079812 | Ga0268265_100798121 | 189 |
| 762 | 3300028381 | Ga0268264_10000174 | Ga0268264_1000017490 | 189 |
| 763 | 3300028381 | Ga0268264_10049152 | Ga0268264_100491523 | 189 |
| 764 | 3300028381 | Ga0268264_10102694 | Ga0268264_101026942 | 189 |
| 765 | 3300028381 | Ga0268264_10158236 | Ga0268264_101582362 | 189 |
| 766 | 3300028381 | Ga0268264_10756675 | Ga0268264_107566751 | 189 |
| 767 | 3300028786 | Ga0307517_10000859 | Ga0307517_100008592 | 189 |
| 768 | 3300030521 | Ga0307511_10032093 | Ga0307511_100320935 | 189 |
| 769 | 3300030522 | Ga0307512_10244813 | Ga0307512_102448131 | 189 |
| 770 | 3300031456 | Ga0307513_10377142 | Ga0307513_103771421 | 189 |
| 771 | 3300031507 | Ga0307509_10006398 | Ga0307509_100063983 | 189 |
| 772 | 3300031507 | Ga0307509_10082116 | Ga0307509_100821163 | 189 |
| 773 | 3300031548 | Ga0307408_100715716 | Ga0307408_1007157161 | 189 |
| 774 | 3300031616 | Ga0307508_10494422 | Ga0307508_104944221 | 189 |
| 775 | 3300031730 | Ga0307516_10059646 | Ga0307516_100596465 | 189 |
| 776 | 3300031730 | Ga0307516_10060402 | Ga0307516_100604024 | 189 |
| 777 | 3300031731 | Ga0307405_10595972 | Ga0307405_105959721 | 189 |
| 778 | 3300031731 | Ga0307405_11002876 | Ga0307405_110028761 | 189 |
| 779 | 3300031824 | Ga0307413_10038231 | Ga0307413_100382313 | 189 |
| 780 | 3300031824 | Ga0307413_10491927 | Ga0307413_104919271 | 189 |
| 781 | 3300031903 | Ga0307407_10258970 | Ga0307407_102589701 | 189 |
| 782 | 3300031995 | Ga0307409_100021933 | Ga0307409_1000219336 | 189 |
| 783 | 3300032002 | Ga0307416_100558321 | Ga0307416_1005583211 | 189 |
| 784 | 3300032126 | Ga0307415_100004684 | Ga0307415_1000046842 | 189 |
| 785 | 3300033179 | Ga0307507_10028588 | Ga0307507_100285887 | 189 |
| 786 | 3300033180 | Ga0307510_10019115 | Ga0307510_100191151 | 189 |
| 787 | 3300033180 | Ga0307510_10201911 | Ga0307510_102019111 | 189 |
| 788 | 3300033544 | Ga0316215_1000931 | Ga0316215_10009313 | 189 |
| 789 | 3300034816 | Ga0373930_0002256 | Ga0373930_0002256_1119_1721 | 189 |
| 790 | 3300034817 | Ga0373948_0001906 | Ga0373948_0001906_1284_1886 | 189 |
| 791 | 3300034818 | Ga0373950_0013019 | Ga0373950_0013019_673_1290 | 189 |
| 792 | 3300034820 | Ga0373959_0008747 | Ga0373959_0008747_610_1212 | 189 |
| 793 | 3300035083 | Ga0373926_0083666 | Ga0373926_0083666_435_1064 | 189 |
| 794 | 3300035085 | Ga0373929_0006845 | Ga0373929_0006845_1285_1887 | 189 |
| 795 | 3300035085 | Ga0373929_0007992 | Ga0373929_0007992_88_705 | 189 |
| 796 | 3300035091 | Ga0373951_0029322 | Ga0373951_0029322_199_801 | 189 |
| 797 | 3300035092 | Ga0373952_0000933 | Ga0373952_0000933_1159_1761 | 189 |
| 798 | 3300035111 | Ga0373923_0021124 | Ga0373923_0021124_272_901 | 189 |
| 799 | 3300035111 | Ga0373923_0027670 | Ga0373923_0027670_788_1417 | 189 |
| 800 | 3300035112 | Ga0373932_0003751 | Ga0373932_0003751_2449_3051 | 189 |
| 801 | 3300035113 | Ga0373936_0006062 | Ga0373936_0006062_650_1279 | 189 |
| 802 | 3300035113 | Ga0373936_0179144 | Ga0373936_0179144_166_792 | 189 |
| 803 | 3300035114 | Ga0373939_0003090 | Ga0373939_0003090_2449_3051 | 189 |
| 804 | 3300035115 | Ga0373941_0013201 | Ga0373941_0013201_215_817 | 189 |
| 805 | 3300035117 | Ga0373953_0018244 | Ga0373953_0018244_211_816 | 189 |
| 806 | 3300035118 | Ga0373954_0001219 | Ga0373954_0001219_4464_5069 | 189 |
| 807 | 3300035120 | Ga0373957_0003464 | Ga0373957_0003464_2202_2807 | 189 |
| 808 | 3300035121 | Ga0373960_0006476 | Ga0373960_0006476_936_1538 | 189 |
| 809 | 3300035170 | Ga0373943_0005037 | Ga0373943_0005037_340_969 | 189 |
| 810 | 3300035170 | Ga0373943_0255544 | Ga0373943_0255544_244_873 | 189 |
| 811 | 3300035172 | Ga0373955_0012895 | Ga0373955_0012895_436_1041 | 189 |
| 812 | 3300035207 | Ga0373942_0027318 | Ga0373942_0027318_658_1260 | 189 |
| 813 | 3300035241 | Ga0373961_0036817 | Ga0373961_0036817_239_841 | 189 |
| 814 | 3300035242 | Ga0373962_0009071 | Ga0373962_0009071_459_1061 | 189 |
| 815 | 3300035410 | Ga0373924_0007721 | Ga0373924_0007721_207_836 | 189 |
| 816 | 3300035691 | Ga0373931_0002611 | Ga0373931_0002611_300_902 | 189 |
| 817 | 3300035691 | Ga0373931_0004766 | Ga0373931_0004766_5275_5892 | 189 |
| 818 | 3300035692 | Ga0373935_0000942 | Ga0373935_0000942_11834_12463 | 189 |
| 819 | 3300035692 | Ga0373935_0057406 | Ga0373935_0057406_1598_2203 | 189 |
| 820 | 3300035695 | Ga0373927_0000528 | Ga0373927_0000528_1883_2512 | 189 |
| 821 | 3300035695 | Ga0373927_0202177 | Ga0373927_0202177_211_840 | 189 |
| 822 | 3300035695 | Ga0373927_0327937 | Ga0373927_0327937_237_854 | 189 |
| 823 | 3300035724 | Ga0373933_0034817 | Ga0373933_0034817_696_1301 | 189 |
| 824 | 3300035724 | Ga0373933_0112377 | Ga0373933_0112377_310_939 | 189 |
| 825 | 3300035725 | Ga0373947_0000455 | Ga0373947_0000455_16031_16660 | 189 |
| 826 | 3300035725 | Ga0373947_0039442 | Ga0373947_0039442_820_1449 | 189 |
| 827 | 3300035725 | Ga0373947_0091001 | Ga0373947_0091001_863_1468 | 189 |
| 828 | 3300035725 | Ga0373947_0376258 | Ga0373947_0376258_240_866 | 189 |
| 829 | 3300036401 | Ga0373937_0015336 | Ga0373937_0015336_784_1389 | 189 |
| 830 | 3300036401 | Ga0373937_0185926 | Ga0373937_0185926_243_914 | 189 |
| 831 | 3300036401 | Ga0373937_0485225 | Ga0373937_0485225_516_1133 | 189 |
| 832 | 3300037068 | Ga0373925_0003563 | Ga0373925_0003563_9968_10597 | 189 |
| 833 | 3300037068 | Ga0373925_0081325 | Ga0373925_0081325_1438_2067 | 189 |
| 834 | 3300037068 | Ga0373925_0085487 | Ga0373925_0085487_1363_1968 | 189 |
| 835 | 3300037068 | Ga0373925_0301832 | Ga0373925_0301832_199_825 | 189 |
| 836 | 3300037853 | Ga0436364_1289063 | Ga0436364_1289063_497_1123 | 189 |
| 837 | 3300041413 | Ga0439465_0132882 | Ga0439465_0132882_87_713 | 189 |
| 838 | 3300041451 | Ga0451791_0240992 | Ga0451791_0240992_88_711 | 189 |
| 839 | 3300041452 | Ga0451793_1400233 | Ga0451793_1400233_28_666 | 189 |
| 840 | 3300041486 | Ga0451807_0428279 | Ga0451807_0428279_288_914 | 189 |
| 841 | 3300041494 | Ga0451837_1412964 | Ga0451837_1412964_293_919 | 189 |
| 842 | 3300041512 | Ga0451853_4011993 | Ga0451853_4011993_58_681 | 189 |
| 843 | 3300046452 | Ga0495617_165209 | Ga0495617_165209_60_686 | 189 |
| 844 | 3300046454 | Ga0495592_0005277 | Ga0495592_0005277_8229_8834 | 189 |
| 845 | 3300046454 | Ga0495592_0032569 | Ga0495592_0032569_2016_2645 | 189 |
| 846 | 3300046455 | Ga0495603_0000239 | Ga0495603_0000239_14528_15157 | 189 |
| 847 | 3300046455 | Ga0495603_0009322 | Ga0495603_0009322_5144_5770 | 189 |
| 848 | 3300046455 | Ga0495603_0058945 | Ga0495603_0058945_83_709 | 189 |
| 849 | 3300046457 | Ga0495590_0068691 | Ga0495590_0068691_126_752 | 189 |
| 850 | 3300046459 | Ga0495629_0000457 | Ga0495629_0000457_11945_12574 | 189 |
| 851 | 3300046461 | Ga0495641_0002157 | Ga0495641_0002157_9720_10349 | 189 |
| 852 | 3300046461 | Ga0495641_0094341 | Ga0495641_0094341_478_1104 | 189 |
| 853 | 3300046461 | Ga0495641_0209869 | Ga0495641_0209869_176_805 | 189 |
| 854 | 3300046462 | Ga0495651_0014000 | Ga0495651_0014000_2445_3050 | 189 |
| 855 | 3300046462 | Ga0495651_0363524 | Ga0495651_0363524_51_680 | 189 |
| 856 | 3300046463 | Ga0495653_0004257 | Ga0495653_0004257_8763_9368 | 189 |
| 857 | 3300046471 | Ga0495650_0051594 | Ga0495650_0051594_601_1227 | 189 |
| 858 | 3300046472 | Ga0495580_0002960 | Ga0495580_0002960_103_732 | 189 |
| 859 | 3300046473 | Ga0495582_0000077 | Ga0495582_0000077_33456_34085 | 189 |
| 860 | 3300046475 | Ga0495639_0000101 | Ga0495639_0000101_16369_16998 | 189 |
| 861 | 3300046475 | Ga0495639_0095966 | Ga0495639_0095966_288_905 | 189 |
| 862 | 3300046475 | Ga0495639_0179661 | Ga0495639_0179661_43_648 | 189 |
| 863 | 3300046476 | Ga0495662_0012510 | Ga0495662_0012510_434_1063 | 189 |
| 864 | 3300046477 | Ga0495664_0038052 | Ga0495664_0038052_363_968 | 189 |
| 865 | 3300046477 | Ga0495664_0041464 | Ga0495664_0041464_141_770 | 189 |
| 866 | 3300046491 | Ga0495584_0046170 | Ga0495584_0046170_1127_1753 | 189 |
| 867 | 3300046492 | Ga0495585_0031320 | Ga0495585_0031320_1990_2616 | 189 |
| 868 | 3300046499 | Ga0495594_0000083 | Ga0495594_0000083_1118_1747 | 189 |
| 869 | 3300046499 | Ga0495594_0186100 | Ga0495594_0186100_49_675 | 189 |
| 870 | 3300046507 | Ga0495606_0000357 | Ga0495606_0000357_18235_18861 | 189 |
| 871 | 3300046511 | Ga0495608_0000911 | Ga0495608_0000911_11090_11695 | 189 |
| 872 | 3300046514 | Ga0495618_0003586 | Ga0495618_0003586_2160_2765 | 189 |
| 873 | 3300046516 | Ga0495628_0055320 | Ga0495628_0055320_1037_1642 | 189 |
| 874 | 3300046516 | Ga0495628_0062832 | Ga0495628_0062832_1986_2615 | 189 |
| 875 | 3300046517 | Ga0495630_0079394 | Ga0495630_0079394_1461_2066 | 189 |
| 876 | 3300046517 | Ga0495630_0167276 | Ga0495630_0167276_499_1128 | 189 |
| 877 | 3300046517 | Ga0495630_0268244 | Ga0495630_0268244_444_1115 | 189 |
| 878 | 3300046519 | Ga0495632_0015464 | Ga0495632_0015464_3180_3806 | 189 |
| 879 | 3300046523 | Ga0495644_0046783 | Ga0495644_0046783_512_1189 | 189 |
| 880 | 3300046526 | Ga0495666_0037457 | Ga0495666_0037457_77_706 | 189 |
| 881 | 3300046529 | Ga0495652_0021917 | Ga0495652_0021917_2654_3283 | 189 |
| 882 | 3300046529 | Ga0495652_0145338 | Ga0495652_0145338_567_1172 | 189 |
| 883 | 3300046531 | Ga0495665_0000055 | Ga0495665_0000055_27942_28571 | 189 |
| 884 | 3300046533 | Ga0495640_0053786 | Ga0495640_0053786_1717_2322 | 189 |
| 885 | 3300046535 | Ga0495586_0026013 | Ga0495586_0026013_1297_1902 | 189 |
| 886 | 3300046536 | Ga0495587_0011562 | Ga0495587_0011562_567_1172 | 189 |
| 887 | 3300046537 | Ga0495598_0005561 | Ga0495598_0005561_1849_2475 | 189 |
| 888 | 3300046542 | Ga0495597_0148045 | Ga0495597_0148045_160_786 | 189 |
| 889 | 3300046543 | Ga0495645_0042847 | Ga0495645_0042847_2327_2932 | 189 |
| 890 | 3300046543 | Ga0495645_0331495 | Ga0495645_0331495_169_798 | 189 |
| 891 | 3300046557 | Ga0495622_0002233 | Ga0495622_0002233_3568_4197 | 189 |
| 892 | 3300046557 | Ga0495622_0128327 | Ga0495622_0128327_515_1144 | 189 |
| 893 | 3300046557 | Ga0495622_0162331 | Ga0495622_0162331_366_992 | 189 |
| 894 | 3300046559 | Ga0495667_0013782 | Ga0495667_0013782_4289_4894 | 189 |
| 895 | 3300046559 | Ga0495667_0023279 | Ga0495667_0023279_1901_2572 | 189 |
| 896 | 3300046559 | Ga0495667_0048600 | Ga0495667_0048600_1816_2445 | 189 |
| 897 | 3300046559 | Ga0495667_0093406 | Ga0495667_0093406_1053_1682 | 189 |
| 898 | 3300046615 | Ga0495656_0008262 | Ga0495656_0008262_1632_2258 | 189 |
| 899 | 3300046616 | Ga0495668_0114332 | Ga0495668_0114332_99_776 | 189 |
| 900 | 3300046642 | Ga0495634_0001036 | Ga0495634_0001036_526_1155 | 189 |
| 901 | 3300046660 | Ga0495625_0592842 | Ga0495625_0592842_31_654 | 189 |
| 902 | 3300046663 | Ga0495635_0000815 | Ga0495635_0000815_18409_19038 | 189 |
| 903 | 3300046663 | Ga0495635_0011194 | Ga0495635_0011194_882_1487 | 189 |
| 904 | 3300046664 | Ga0495659_0004501 | Ga0495659_0004501_2830_3456 | 189 |
| 905 | 3300046674 | Ga0495588_0005058 | Ga0495588_0005058_2094_2723 | 189 |
| 906 | 3300046674 | Ga0495588_0005077 | Ga0495588_0005077_4954_5580 | 189 |
| 907 | 3300046675 | Ga0495657_0034720 | Ga0495657_0034720_2805_3410 | 189 |
| 908 | 3300046678 | Ga0495599_0097068 | Ga0495599_0097068_956_1627 | 189 |
| 909 | 3300046679 | Ga0495623_0001015 | Ga0495623_0001015_17103_17708 | 189 |
| 910 | 3300046680 | Ga0495646_0014188 | Ga0495646_0014188_2403_3008 | 189 |
| 911 | 3300046680 | Ga0495646_0189630 | Ga0495646_0189630_352_981 | 189 |
| 912 | 3300046683 | Ga0495658_0001572 | Ga0495658_0001572_10064_10693 | 189 |
| 913 | 3300046684 | Ga0495669_0002048 | Ga0495669_0002048_6229_6906 | 189 |
| 914 | 3300046689 | Ga0495613_0003480 | Ga0495613_0003480_1424_2053 | 189 |
| 915 | 3300046689 | Ga0495613_0078788 | Ga0495613_0078788_155_760 | 189 |
| 916 | 3300046690 | Ga0495624_0000235 | Ga0495624_0000235_12480_13109 | 189 |
| 917 | 3300046690 | Ga0495624_0050807 | Ga0495624_0050807_333_938 | 189 |
| 918 | 3300046691 | Ga0495670_0192981 | Ga0495670_0192981_197_823 | 189 |
| 919 | 3300046692 | Ga0495671_0061334 | Ga0495671_0061334_1152_1778 | 189 |
| 920 | 3300046794 | Ga0495589_0184650 | Ga0495589_0184650_333_959 | 189 |
| 921 | 3300046809 | Ga0495600_0015287 | Ga0495600_0015287_1263_1868 | 189 |
| 922 | 3300047315 | Ga0495581_0000041 | Ga0495581_0000041_20403_21032 | 189 |
| 923 | 3300047319 | Ga0495674_0036100 | Ga0495674_0036100_2363_2968 | 189 |
| 924 | 3300047319 | Ga0495674_0602898 | Ga0495674_0602898_208_825 | 189 |
| 925 | 3300047321 | Ga0495676_0018550 | Ga0495676_0018550_2557_3186 | 189 |
| 926 | 3300047322 | Ga0495680_0028245 | Ga0495680_0028245_1264_1869 | 189 |
| 927 | 3300047322 | Ga0495680_0414882 | Ga0495680_0414882_23_652 | 189 |
| 928 | 3300047444 | Ga0495675_0025398 | Ga0495675_0025398_2230_2835 | 189 |
| 929 | 3300047445 | Ga0495677_0151369 | Ga0495677_0151369_106_732 | 189 |
| 930 | 3300047446 | Ga0495679_093047 | Ga0495679_093047_28_654 | 189 |
| 931 | 3300047469 | Ga0495673_0025589 | Ga0495673_0025589_1882_2511 | 189 |
| 932 | 3300047673 | Ga0495593_0000024 | Ga0495593_0000024_22745_23374 | 189 |
| 933 | 3300047673 | Ga0495593_0019588 | Ga0495593_0019588_1784_2389 | 189 |
| 934 | 3300048088 | Ga0495602_0019419 | Ga0495602_0019419_5456_6061 | 189 |
| 935 | 3300048091 | Ga0495626_0219016 | Ga0495626_0219016_70_696 | 189 |
| 936 | 3300048903 | Ga0496100_0301201 | Ga0496100_0301201_245_871 | 189 |
| 937 | 3300048904 | Ga0496101_0002275 | Ga0496101_0002275_1507_2109 | 189 |
| 938 | 3300048904 | Ga0496101_0257139 | Ga0496101_0257139_529_1134 | 189 |
| 939 | 3300048905 | Ga0496102_0015668 | Ga0496102_0015668_4004_4621 | 189 |
| 940 | 3300048905 | Ga0496102_0022366 | Ga0496102_0022366_267_869 | 189 |
| 941 | 3300048905 | Ga0496102_0076164 | Ga0496102_0076164_1256_1861 | 189 |
| 942 | 3300048905 | Ga0496102_0286670 | Ga0496102_0286670_738_1367 | 189 |
| 943 | 3300048905 | Ga0496102_0414593 | Ga0496102_0414593_575_1201 | 189 |
| 944 | 3300048906 | Ga0496103_0019772 | Ga0496103_0019772_2016_2618 | 189 |
| 945 | 3300048906 | Ga0496103_0026671 | Ga0496103_0026671_2643_3260 | 189 |
| 946 | 3300048906 | Ga0496103_0413174 | Ga0496103_0413174_39_665 | 189 |
| 947 | 3300048907 | Ga0496104_0088890 | Ga0496104_0088890_1634_2239 | 189 |
| 948 | 3300048907 | Ga0496104_0121736 | Ga0496104_0121736_1686_2288 | 189 |
| 949 | 3300048907 | Ga0496104_0135420 | Ga0496104_0135420_964_1581 | 189 |
| 950 | 3300048908 | Ga0496105_0012396 | Ga0496105_0012396_3726_4343 | 189 |
| 951 | 3300048908 | Ga0496105_0292958 | Ga0496105_0292958_679_1284 | 189 |
| 952 | 3300048909 | Ga0496106_0003446 | Ga0496106_0003446_5357_5959 | 189 |
| 953 | 3300048909 | Ga0496106_0039727 | Ga0496106_0039727_1862_2479 | 189 |
| 954 | 3300048909 | Ga0496106_0058706 | Ga0496106_0058706_1837_2514 | 189 |
| 955 | 3300048909 | Ga0496106_0147996 | Ga0496106_0147996_637_1239 | 189 |
| 956 | 3300048910 | Ga0496107_0000509 | Ga0496107_0000509_14022_14624 | 189 |
| 957 | 3300048910 | Ga0496107_0021914 | Ga0496107_0021914_1934_2551 | 189 |
| 958 | 3300048910 | Ga0496107_0055248 | Ga0496107_0055248_1416_2093 | 189 |
| 959 | 3300048910 | Ga0496107_0184967 | Ga0496107_0184967_220_822 | 189 |
| 960 | 3300048910 | Ga0496107_0397163 | Ga0496107_0397163_29_634 | 189 |
| 961 | 3300048911 | Ga0496108_0031275 | Ga0496108_0031275_3664_4266 | 189 |
| 962 | 3300048911 | Ga0496108_0043219 | Ga0496108_0043219_1274_1891 | 189 |
| 963 | 3300048911 | Ga0496108_0150590 | Ga0496108_0150590_1112_1714 | 189 |
| 964 | 3300048912 | Ga0496109_0026994 | Ga0496109_0026994_3700_4302 | 189 |
| 965 | 3300048912 | Ga0496109_0063752 | Ga0496109_0063752_2065_2682 | 189 |
| 966 | 3300048912 | Ga0496109_0170543 | Ga0496109_0170543_839_1441 | 189 |
| 967 | 3300048912 | Ga0496109_0241523 | Ga0496109_0241523_112_741 | 189 |
| 968 | 3300048912 | Ga0496109_0273602 | Ga0496109_0273602_256_879 | 189 |
| 969 | 3300048912 | Ga0496109_0995085 | Ga0496109_0995085_77_703 | 189 |
| 970 | 3300048913 | Ga0496110_0033752 | Ga0496110_0033752_1113_1715 | 189 |
| 971 | 3300048913 | Ga0496110_0130718 | Ga0496110_0130718_1545_2147 | 189 |
| 972 | 3300048913 | Ga0496110_0313674 | Ga0496110_0313674_585_1214 | 189 |
| 973 | 3300048913 | Ga0496110_0703311 | Ga0496110_0703311_96_722 | 189 |
| 974 | 3300048913 | Ga0496110_0799685 | Ga0496110_0799685_13_630 | 189 |
| 975 | 3300048913 | Ga0496110_0920507 | Ga0496110_0920507_122_748 | 189 |
| 976 | 3300048914 | Ga0496111_0024753 | Ga0496111_0024753_1176_1793 | 189 |
| 977 | 3300048914 | Ga0496111_0039292 | Ga0496111_0039292_1137_1739 | 189 |
| 978 | 3300048914 | Ga0496111_0348952 | Ga0496111_0348952_447_1073 | 189 |
| 979 | 3300048915 | Ga0496112_0012715 | Ga0496112_0012715_747_1364 | 189 |
| 980 | 3300048915 | Ga0496112_0048594 | Ga0496112_0048594_715_1317 | 189 |
| 981 | 3300048915 | Ga0496112_0086667 | Ga0496112_0086667_1917_2546 | 189 |
| 982 | 3300048915 | Ga0496112_0284141 | Ga0496112_0284141_165_794 | 189 |
| 983 | 3300048916 | Ga0496113_0002503 | Ga0496113_0002503_8600_9217 | 189 |
| 984 | 3300048916 | Ga0496113_0008294 | Ga0496113_0008294_1443_2045 | 189 |
| 985 | 3300048916 | Ga0496113_0056499 | Ga0496113_0056499_997_1635 | 189 |
| 986 | 3300048916 | Ga0496113_0533929 | Ga0496113_0533929_297_923 | 189 |
| 987 | 3300048917 | Ga0496114_0009294 | Ga0496114_0009294_4345_4962 | 189 |
| 988 | 3300048917 | Ga0496114_0048418 | Ga0496114_0048418_1527_2204 | 189 |
| 989 | 3300048917 | Ga0496114_0401699 | Ga0496114_0401699_212_814 | 189 |
| 990 | 3300048918 | Ga0496115_0059345 | Ga0496115_0059345_2352_2978 | 189 |
| 991 | 3300048918 | Ga0496115_0133773 | Ga0496115_0133773_373_975 | 189 |
| 992 | 3300048920 | Ga0496117_0238499 | Ga0496117_0238499_356_988 | 189 |
| 993 | 3300048922 | Ga0496119_0047619 | Ga0496119_0047619_1032_1655 | 189 |
| 994 | 3300048924 | Ga0496121_0000927 | Ga0496121_0000927_50214_50840 | 189 |
| 995 | 3300048924 | Ga0496121_0203641 | Ga0496121_0203641_213_839 | 189 |
| 996 | 3300048927 | Ga0496124_0233805 | Ga0496124_0233805_124_747 | 189 |
| 997 | 3300048929 | Ga0496126_0082014 | Ga0496126_0082014_1742_2374 | 189 |
| 998 | 3300049583 | Ga0501067_0039577 | Ga0501067_0039577_1653_2279 | 189 |
| 999 | 3300050491 | nmdc:mga00v17_297583_c1 | nmdc:mga00v17_297583_c1_412_1029 | 189 |
| 1000 | 3300050492 | nmdc:mga0yw44_13282_c1 | nmdc:mga0yw44_13282_c1_533_1159 | 189 |
| 1001 | 3300050492 | nmdc:mga0yw44_211928_c1 | nmdc:mga0yw44_211928_c1_310_936 | 189 |
| 1002 | 3300050493 | nmdc:mga0k408_292622_c1 | nmdc:mga0k408_292622_c1_318_944 | 189 |
| 1003 | 3300050494 | nmdc:mga06z11_151224_c1 | nmdc:mga06z11_151224_c1_411_1037 | 189 |
| 1004 | 3300050494 | nmdc:mga06z11_45147_c1 | nmdc:mga06z11_45147_c1_34_636 | 189 |
| 1005 | 3300050496 | nmdc:mga07m45_8848_c1 | nmdc:mga07m45_8848_c1_157_783 | 189 |
| 1006 | 3300050511 | nmdc:mga08y16_108_c1 | nmdc:mga08y16_108_c1_54078_54680 | 189 |
| 1007 | 3300050512 | nmdc:mga0n895_216385_c1 | nmdc:mga0n895_216385_c1_308_910 | 189 |
| 1008 | 3300050512 | nmdc:mga0n895_37633_c1 | nmdc:mga0n895_37633_c1_3407_4009 | 189 |
| 1009 | 3300050513 | nmdc:mga0rr50_537400_c1 | nmdc:mga0rr50_537400_c1_252_854 | 189 |
| 1010 | 3300050515 | nmdc:mga0a205_1049_c1 | nmdc:mga0a205_1049_c1_13914_14516 | 189 |
| 1011 | 3300050516 | nmdc:mga0sz30_114689_c1 | nmdc:mga0sz30_114689_c1_159_785 | 189 |
| 1012 | 3300053077 | Ga0495601_0141831 | Ga0495601_0141831_466_1071 | 189 |
| 1013 | 3300053080 | Ga0500635_0001974 | Ga0500635_0001974_687_1316 | 189 |
| 1014 | 3300053080 | Ga0500635_0031249 | Ga0500635_0031249_342_971 | 189 |
| 1015 | 3300053084 | Ga0495595_0000554 | Ga0495595_0000554_6533_7138 | 189 |
| 1016 | 3300053085 | Ga0495619_0425381 | Ga0495619_0425381_67_696 | 189 |
| 1017 | 3300053096 | Ga0500641_0133006 | Ga0500641_0133006_264_890 | 189 |
| 1018 | 3300053119 | Ga0500595_026055 | Ga0500595_026055_286_915 | 189 |
| 1019 | 3300053139 | Ga0500568_0096636 | Ga0500568_0096636_437_1066 | 189 |
| 1020 | 3300053146 | Ga0500588_0013956 | Ga0500588_0013956_660_1286 | 189 |
| 1021 | 3300053147 | Ga0500589_021876 | Ga0500589_021876_2177_2806 | 189 |
| 1022 | 3300053148 | Ga0500590_093943 | Ga0500590_093943_425_1054 | 189 |
| 1023 | 3300053150 | Ga0500603_000226 | Ga0500603_000226_10140_10769 | 189 |
| 1024 | 3300053163 | Ga0500639_048715 | Ga0500639_048715_1476_2105 | 189 |
| 1025 | 3300053178 | Ga0500637_0003349 | Ga0500637_0003349_1436_2065 | 189 |
| 1026 | 3300053178 | Ga0500637_0165132 | Ga0500637_0165132_181_810 | 189 |
| 1027 | 3300053730 | Ga0500645_012764 | Ga0500645_012764_2061_2687 | 189 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eug-assembly1.cif.gz_n | ytm1 associated nascent 60s ribosome state 3 | 0.8696 | 113 | 139 |
| 8eui-assembly1.cif.gz_n | ytm1 associated nascent 60s ribosome (-fkbp39) state 3 | 0.8689 | 113 | 139 |
| 8ev3-assembly1.cif.gz_n | ytm1 associated 60s nascent ribosome (-fkbp39) state 1b | 0.862 | 113 | 141 |
| 8etg-assembly1.cif.gz_n | fkbp39 associated 60s nascent ribosome state 3 | 0.8451 | 113 | 141 |
| 8fku-assembly1.cif.gz_SM | human nucleolar pre-60s ribosomal subunit (state c2) | 0.8448 | 113 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IBZ4_29_132_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8355 | 12 | 44 | 2.40.50.140 |
| af_A0A1D6MPP2_1_86_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8338 | 12 | 42 | 2.40.50.140 |
| af_M9PDL2_134_240_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7685 | 12 | 48 | 2.40.50.140 |
| 5xyiE03 | Mainly Beta;Roll;SH3 type barrels.; | 0.7563 | 110 | 137 | 2.30.30.30 |
| af_Q8I262_123_205_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7468 | 14 | 42 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P9H572-F1-model_v4 | DUF5666 domain-containing protein | 0.9584 | 15 | 188 |
|
| AF-A0A2S5TVB9-F1-model_v4 | deleted | 0.947 | 16 | 189 |
|
| AF-A0A2P9H572-F1-model_v4 | DUF5666 domain-containing protein | 0.9426 | 15 | 188 |
|
| AF-L2EHC2-F1-model_v4 | deleted | 0.9382 | 6 | 188 |
|
| AF-A0A537QAT7-F1-model_v4 | DUF5666 domain-containing protein | 0.937 | 12 | 188 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar