F488506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1026 | 391 | 2052 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10702105|Ga0070709_107021051 |
| Length | 197 |
| Sequence | MFTVLYGCSPLPSAYWVPYMSVSDLNFHIGDKVVYPNHGVGVIEQISSRSIGATIERFYLLNIKASSLKVMVPCNNAGSVGLRRVVRNGEIQKVIDLLSLAETNGSGDWKDRFKENSDRMRTGSLIEVAGVLKNLIALHQAKPLSFREKKMLERARYLLVSELAMARNCEESKIEEVLTAALAKCKLRFPEASEFQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 148 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 155 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 157 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 158 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 244 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 329 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 330 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 357 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 371 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 391 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.05 |
| Metatranscriptomes | 5.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.02 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10702105 | 3300005434 | Unclassified | 787 |
| 2 | MRS1b_contig_3743146 | 2162886011 | Bacteria | 1150 |
| 3 | MRS1b_contig_4719877 | 2162886011 | Bacteria | 875 |
| 4 | MBSR1b_contig_376918 | 2162886012 | Bacteria | 927 |
| 5 | LJNas_1000022 | 3300000546 | Bacteria | 20891 |
| 6 | rootL2_10303851 | 3300003322 | Bacteria | 1220 |
| 7 | rootH1_10335305 | 3300003323 | Bacteria | 1321 |
| 8 | Ga0058859_11454794 | 3300004798 | Unclassified | 787 |
| 9 | Ga0058863_11867713 | 3300004799 | Unclassified | 966 |
| 10 | Ga0058863_11966271 | 3300004799 | Unclassified | 688 |
| 11 | Ga0058861_10061650 | 3300004800 | Bacteria | 1031 |
| 12 | Ga0058860_11825380 | 3300004801 | Unclassified | 594 |
| 13 | Ga0058862_12739121 | 3300004803 | Unclassified | 910 |
| 14 | Ga0065704_10171747 | 3300005289 | Bacteria | 1287 |
| 15 | Ga0065712_10098164 | 3300005290 | Bacteria | 2101 |
| 16 | Ga0065712_10558904 | 3300005290 | Unclassified | 613 |
| 17 | Ga0065715_10040951 | 3300005293 | Bacteria | 1477 |
| 18 | Ga0065707_10159589 | 3300005295 | Bacteria | 1572 |
| 19 | Ga0070658_10293117 | 3300005327 | Bacteria | 1387 |
| 20 | Ga0070676_10395109 | 3300005328 | Bacteria | 961 |
| 21 | Ga0070683_100011670 | 3300005329 | Bacteria | 7608 |
| 22 | Ga0070683_100076106 | 3300005329 | Bacteria | 3137 |
| 23 | Ga0070683_100140291 | 3300005329 | Bacteria | 2290 |
| 24 | Ga0070683_100662715 | 3300005329 | Bacteria | 999 |
| 25 | Ga0070690_100766569 | 3300005330 | Unclassified | 746 |
| 26 | Ga0070670_100024685 | 3300005331 | Bacteria | 5170 |
| 27 | Ga0070670_101074019 | 3300005331 | Bacteria | 733 |
| 28 | Ga0068869_100001094 | 3300005334 | Bacteria | 15789 |
| 29 | Ga0068869_100004860 | 3300005334 | Bacteria | 8397 |
| 30 | Ga0068869_100083630 | 3300005334 | Bacteria | 2387 |
| 31 | Ga0070666_10451809 | 3300005335 | Bacteria | 928 |
| 32 | Ga0070666_10508422 | 3300005335 | Unclassified | 874 |
| 33 | Ga0070680_100083264 | 3300005336 | Unclassified | 2642 |
| 34 | Ga0070680_100107961 | 3300005336 | Bacteria | 2315 |
| 35 | Ga0070680_100120414 | 3300005336 | Bacteria | 2191 |
| 36 | Ga0070680_100214334 | 3300005336 | Bacteria | 1625 |
| 37 | Ga0070680_100987537 | 3300005336 | Bacteria | 727 |
| 38 | Ga0068868_100001559 | 3300005338 | Bacteria | 15661 |
| 39 | Ga0068868_100006728 | 3300005338 | Bacteria | 8160 |
| 40 | Ga0068868_100008270 | 3300005338 | Bacteria | 7450 |
| 41 | Ga0068868_100068976 | 3300005338 | Bacteria | 2816 |
| 42 | Ga0068868_101271065 | 3300005338 | Bacteria | 683 |
| 43 | Ga0070660_100286934 | 3300005339 | Bacteria | 1347 |
| 44 | Ga0070689_100008073 | 3300005340 | Bacteria | 7394 |
| 45 | Ga0070689_100011858 | 3300005340 | Bacteria | 6257 |
| 46 | Ga0070691_10189837 | 3300005341 | Unclassified | 1074 |
| 47 | Ga0070687_100013069 | 3300005343 | Bacteria | 3688 |
| 48 | Ga0070687_100111448 | 3300005343 | Bacteria | 1549 |
| 49 | Ga0070661_100199992 | 3300005344 | Bacteria | 1526 |
| 50 | Ga0070692_10059706 | 3300005345 | Unclassified | 2005 |
| 51 | Ga0070668_100139362 | 3300005347 | Bacteria | 1953 |
| 52 | Ga0070668_101136287 | 3300005347 | Bacteria | 706 |
| 53 | Ga0070669_100250282 | 3300005353 | Bacteria | 1411 |
| 54 | Ga0070669_100568879 | 3300005353 | Bacteria | 947 |
| 55 | Ga0070669_100926776 | 3300005353 | Bacteria | 745 |
| 56 | Ga0070675_100166546 | 3300005354 | Bacteria | 1898 |
| 57 | Ga0070675_100192372 | 3300005354 | Bacteria | 1768 |
| 58 | Ga0070671_100318248 | 3300005355 | Unclassified | 1326 |
| 59 | Ga0070671_100351039 | 3300005355 | Bacteria | 1259 |
| 60 | Ga0070673_100079167 | 3300005364 | Bacteria | 2660 |
| 61 | Ga0070673_100150532 | 3300005364 | Bacteria | 1970 |
| 62 | Ga0070688_100089161 | 3300005365 | Bacteria | 2012 |
| 63 | Ga0070688_100486479 | 3300005365 | Bacteria | 928 |
| 64 | Ga0070659_100249007 | 3300005366 | Bacteria | 1472 |
| 65 | Ga0070667_100440812 | 3300005367 | Bacteria | 1189 |
| 66 | Ga0070667_100495438 | 3300005367 | Bacteria | 1120 |
| 67 | Ga0070709_10132896 | 3300005434 | Bacteria | 1701 |
| 68 | Ga0070709_10171665 | 3300005434 | Bacteria | 1516 |
| 69 | Ga0070709_10321213 | 3300005434 | Bacteria | 1136 |
| 70 | Ga0070709_11073338 | 3300005434 | Unclassified | 643 |
| 71 | Ga0070714_100005380 | 3300005435 | Bacteria | 9771 |
| 72 | Ga0070714_100019795 | 3300005435 | Bacteria | 5489 |
| 73 | Ga0070714_100117417 | 3300005435 | Bacteria | 2363 |
| 74 | Ga0070714_100200088 | 3300005435 | Bacteria | 1827 |
| 75 | Ga0070714_100324997 | 3300005435 | Bacteria | 1439 |
| 76 | Ga0070714_100415969 | 3300005435 | Bacteria | 1273 |
| 77 | Ga0070713_100000460 | 3300005436 | Bacteria | 26005 |
| 78 | Ga0070713_100041420 | 3300005436 | Unclassified | 3752 |
| 79 | Ga0070713_100042459 | 3300005436 | Bacteria | 3711 |
| 80 | Ga0070713_100111171 | 3300005436 | Unclassified | 2389 |
| 81 | Ga0070713_100185078 | 3300005436 | Bacteria | 1874 |
| 82 | Ga0070713_100342865 | 3300005436 | Bacteria | 1385 |
| 83 | Ga0070713_100356650 | 3300005436 | Bacteria | 1358 |
| 84 | Ga0070713_100469068 | 3300005436 | Bacteria | 1185 |
| 85 | Ga0070713_100680935 | 3300005436 | Bacteria | 981 |
| 86 | Ga0070710_10044792 | 3300005437 | Unclassified | 2456 |
| 87 | Ga0070710_10135353 | 3300005437 | Bacteria | 1506 |
| 88 | Ga0070710_10163999 | 3300005437 | Bacteria | 1380 |
| 89 | Ga0070710_10180310 | 3300005437 | Bacteria | 1322 |
| 90 | Ga0070701_10012483 | 3300005438 | Bacteria | 3835 |
| 91 | Ga0070711_100000656 | 3300005439 | Bacteria | 18067 |
| 92 | Ga0070711_100013246 | 3300005439 | Bacteria | 5176 |
| 93 | Ga0070711_100085734 | 3300005439 | Bacteria | 2257 |
| 94 | Ga0070711_100191559 | 3300005439 | Bacteria | 1572 |
| 95 | Ga0070711_100197507 | 3300005439 | Bacteria | 1550 |
| 96 | Ga0070711_100351292 | 3300005439 | Unclassified | 1185 |
| 97 | Ga0070711_101179825 | 3300005439 | Unclassified | 662 |
| 98 | Ga0070705_100066046 | 3300005440 | Bacteria | 2168 |
| 99 | Ga0070705_100167949 | 3300005440 | Bacteria | 1474 |
| 100 | Ga0070700_100025428 | 3300005441 | Bacteria | 3485 |
| 101 | Ga0070694_100025427 | 3300005444 | Bacteria | 3830 |
| 102 | Ga0070694_100150788 | 3300005444 | Unclassified | 1698 |
| 103 | Ga0070694_100174306 | 3300005444 | Unclassified | 1586 |
| 104 | Ga0070694_100495132 | 3300005444 | Bacteria | 972 |
| 105 | Ga0070708_100001918 | 3300005445 | Bacteria | 16013 |
| 106 | Ga0070708_100002306 | 3300005445 | Bacteria | 14779 |
| 107 | Ga0070708_100008762 | 3300005445 | Bacteria | 8133 |
| 108 | Ga0070708_100019770 | 3300005445 | Bacteria | 5665 |
| 109 | Ga0070708_100061160 | 3300005445 | Bacteria | 3364 |
| 110 | Ga0070708_100469920 | 3300005445 | Bacteria | 1187 |
| 111 | Ga0070708_100471199 | 3300005445 | Bacteria | 1185 |
| 112 | Ga0070708_100535594 | 3300005445 | Unclassified | 1105 |
| 113 | Ga0070663_100032244 | 3300005455 | Bacteria | 3610 |
| 114 | Ga0070663_100136037 | 3300005455 | Bacteria | 1871 |
| 115 | Ga0070678_100006161 | 3300005456 | Bacteria | 7008 |
| 116 | Ga0070678_100517427 | 3300005456 | Unclassified | 1055 |
| 117 | Ga0070662_100115609 | 3300005457 | Bacteria | 2049 |
| 118 | Ga0070662_100508637 | 3300005457 | Bacteria | 1005 |
| 119 | Ga0070662_100556797 | 3300005457 | Bacteria | 961 |
| 120 | Ga0070662_100688452 | 3300005457 | Bacteria | 864 |
| 121 | Ga0070681_10000242 | 3300005458 | Bacteria | 43180 |
| 122 | Ga0070681_10087482 | 3300005458 | Bacteria | 3069 |
| 123 | Ga0070681_10139074 | 3300005458 | Bacteria | 2358 |
| 124 | Ga0070681_10165112 | 3300005458 | Bacteria | 2137 |
| 125 | Ga0070681_10171172 | 3300005458 | Bacteria | 2094 |
| 126 | Ga0070681_10562788 | 3300005458 | Bacteria | 1054 |
| 127 | Ga0070681_10802521 | 3300005458 | Bacteria | 858 |
| 128 | Ga0068867_100008371 | 3300005459 | Bacteria | 7296 |
| 129 | Ga0068867_100167497 | 3300005459 | Bacteria | 1738 |
| 130 | Ga0070685_10024826 | 3300005466 | Bacteria | 3295 |
| 131 | Ga0070685_10029052 | 3300005466 | Bacteria | 3069 |
| 132 | Ga0070706_100008661 | 3300005467 | Bacteria | 9481 |
| 133 | Ga0070706_100019421 | 3300005467 | Bacteria | 6267 |
| 134 | Ga0070706_100020092 | 3300005467 | Bacteria | 6155 |
| 135 | Ga0070706_100060134 | 3300005467 | Bacteria | 3507 |
| 136 | Ga0070706_100088518 | 3300005467 | Bacteria | 2870 |
| 137 | Ga0070706_100193011 | 3300005467 | Bacteria | 1903 |
| 138 | Ga0070706_100267843 | 3300005467 | Bacteria | 1594 |
| 139 | Ga0070707_100003999 | 3300005468 | Bacteria | 13875 |
| 140 | Ga0070707_100008148 | 3300005468 | Bacteria | 9723 |
| 141 | Ga0070707_100015413 | 3300005468 | Bacteria | 7171 |
| 142 | Ga0070707_100021880 | 3300005468 | Bacteria | 6045 |
| 143 | Ga0070707_100031054 | 3300005468 | Bacteria | 5087 |
| 144 | Ga0070707_100051410 | 3300005468 | Bacteria | 3951 |
| 145 | Ga0070707_100075803 | 3300005468 | Bacteria | 3244 |
| 146 | Ga0070707_100129018 | 3300005468 | Bacteria | 2458 |
| 147 | Ga0070707_100148170 | 3300005468 | Bacteria | 2284 |
| 148 | Ga0070707_100696610 | 3300005468 | Unclassified | 979 |
| 149 | Ga0070698_100000182 | 3300005471 | Bacteria | 59279 |
| 150 | Ga0070698_100001098 | 3300005471 | Bacteria | 29768 |
| 151 | Ga0070698_100010878 | 3300005471 | Bacteria | 9681 |
| 152 | Ga0070698_100011307 | 3300005471 | Bacteria | 9476 |
| 153 | Ga0070698_100116352 | 3300005471 | Bacteria | 2637 |
| 154 | Ga0070698_100252375 | 3300005471 | Bacteria | 1696 |
| 155 | Ga0070698_100716924 | 3300005471 | Unclassified | 943 |
| 156 | Ga0070698_100813766 | 3300005471 | Unclassified | 878 |
| 157 | Ga0070698_100956638 | 3300005471 | Unclassified | 803 |
| 158 | Ga0070699_100002044 | 3300005518 | Bacteria | 18236 |
| 159 | Ga0070699_100003968 | 3300005518 | Bacteria | 13080 |
| 160 | Ga0070699_100007000 | 3300005518 | Bacteria | 9800 |
| 161 | Ga0070699_100036337 | 3300005518 | Bacteria | 4261 |
| 162 | Ga0070699_100094700 | 3300005518 | Bacteria | 2614 |
| 163 | Ga0070699_100454251 | 3300005518 | Bacteria | 1162 |
| 164 | Ga0070699_100472375 | 3300005518 | Bacteria | 1138 |
| 165 | Ga0070699_101339404 | 3300005518 | Unclassified | 656 |
| 166 | Ga0070679_100016723 | 3300005530 | Bacteria | 7087 |
| 167 | Ga0070679_100029648 | 3300005530 | Bacteria | 5398 |
| 168 | Ga0070679_100060877 | 3300005530 | Unclassified | 3763 |
| 169 | Ga0070679_100106030 | 3300005530 | Bacteria | 2796 |
| 170 | Ga0070679_100519375 | 3300005530 | Bacteria | 1135 |
| 171 | Ga0070684_100083051 | 3300005535 | Bacteria | 2838 |
| 172 | Ga0070684_100480673 | 3300005535 | Bacteria | 1150 |
| 173 | Ga0070697_100000045 | 3300005536 | Bacteria | 92181 |
| 174 | Ga0070697_100003087 | 3300005536 | Bacteria | 12783 |
| 175 | Ga0070697_100006105 | 3300005536 | Bacteria | 9319 |
| 176 | Ga0070697_100007161 | 3300005536 | Bacteria | 8679 |
| 177 | Ga0070697_100008121 | 3300005536 | Bacteria | 8188 |
| 178 | Ga0070697_100012774 | 3300005536 | Bacteria | 6578 |
| 179 | Ga0070697_100045258 | 3300005536 | Bacteria | 3566 |
| 180 | Ga0070697_100217099 | 3300005536 | Unclassified | 1629 |
| 181 | Ga0070697_100309586 | 3300005536 | Bacteria | 1359 |
| 182 | Ga0070697_100564365 | 3300005536 | Unclassified | 999 |
| 183 | Ga0068853_100018922 | 3300005539 | Bacteria | 5704 |
| 184 | Ga0068853_100190406 | 3300005539 | Bacteria | 1863 |
| 185 | Ga0068853_100209777 | 3300005539 | Bacteria | 1775 |
| 186 | Ga0068853_100502772 | 3300005539 | Unclassified | 1144 |
| 187 | Ga0070672_100005147 | 3300005543 | Bacteria | 8635 |
| 188 | Ga0070672_100063481 | 3300005543 | Bacteria | 2917 |
| 189 | Ga0070686_100413406 | 3300005544 | Unclassified | 1029 |
| 190 | Ga0070686_100447109 | 3300005544 | Bacteria | 993 |
| 191 | Ga0070695_100008702 | 3300005545 | Bacteria | 6032 |
| 192 | Ga0070695_100157767 | 3300005545 | Bacteria | 1590 |
| 193 | Ga0070696_100300129 | 3300005546 | Bacteria | 1230 |
| 194 | Ga0070693_100968378 | 3300005547 | Bacteria | 642 |
| 195 | Ga0070704_100007901 | 3300005549 | Bacteria | 6348 |
| 196 | Ga0070704_100034509 | 3300005549 | Bacteria | 3432 |
| 197 | Ga0070704_100050303 | 3300005549 | Bacteria | 2928 |
| 198 | Ga0070704_100179979 | 3300005549 | Bacteria | 1690 |
| 199 | Ga0070704_100187540 | 3300005549 | Bacteria | 1660 |
| 200 | Ga0070704_100224288 | 3300005549 | Bacteria | 1529 |
| 201 | Ga0070704_100470105 | 3300005549 | Unclassified | 1086 |
| 202 | Ga0070704_100479902 | 3300005549 | Unclassified | 1076 |
| 203 | Ga0070704_100813382 | 3300005549 | Bacteria | 836 |
| 204 | Ga0068855_100000722 | 3300005563 | Bacteria | 40559 |
| 205 | Ga0068855_100012781 | 3300005563 | Bacteria | 10127 |
| 206 | Ga0068855_100059377 | 3300005563 | Bacteria | 4475 |
| 207 | Ga0068855_100078538 | 3300005563 | Bacteria | 3828 |
| 208 | Ga0068855_100162078 | 3300005563 | Bacteria | 2537 |
| 209 | Ga0068855_100792601 | 3300005563 | Bacteria | 1008 |
| 210 | Ga0070664_100002060 | 3300005564 | Bacteria | 16060 |
| 211 | Ga0070664_100057431 | 3300005564 | Bacteria | 3308 |
| 212 | Ga0070664_100060588 | 3300005564 | Bacteria | 3223 |
| 213 | Ga0068857_100005616 | 3300005577 | Bacteria | 10721 |
| 214 | Ga0068857_100006773 | 3300005577 | Bacteria | 9858 |
| 215 | Ga0068857_100162149 | 3300005577 | Bacteria | 2029 |
| 216 | Ga0068857_100162791 | 3300005577 | Bacteria | 2025 |
| 217 | Ga0068857_100226896 | 3300005577 | Bacteria | 1707 |
| 218 | Ga0068857_100504760 | 3300005577 | Unclassified | 1135 |
| 219 | Ga0068854_100007803 | 3300005578 | Bacteria | 6846 |
| 220 | Ga0068854_100008281 | 3300005578 | Bacteria | 6674 |
| 221 | Ga0068854_100012746 | 3300005578 | Bacteria | 5505 |
| 222 | Ga0068854_100039098 | 3300005578 | Bacteria | 3340 |
| 223 | Ga0068854_100281380 | 3300005578 | Unclassified | 1339 |
| 224 | Ga0068854_100461935 | 3300005578 | Unclassified | 1062 |
| 225 | Ga0068856_100000893 | 3300005614 | Bacteria | 31927 |
| 226 | Ga0068856_100001601 | 3300005614 | Bacteria | 23661 |
| 227 | Ga0068856_100010172 | 3300005614 | Bacteria | 9144 |
| 228 | Ga0068856_100025934 | 3300005614 | Bacteria | 5716 |
| 229 | Ga0068856_100140369 | 3300005614 | Bacteria | 2423 |
| 230 | Ga0068856_100274670 | 3300005614 | Bacteria | 1701 |
| 231 | Ga0068856_100321255 | 3300005614 | Bacteria | 1565 |
| 232 | Ga0068856_100569109 | 3300005614 | Unclassified | 1154 |
| 233 | Ga0068852_100061504 | 3300005616 | Bacteria | 3264 |
| 234 | Ga0068852_100166419 | 3300005616 | Bacteria | 2063 |
| 235 | Ga0068859_100001851 | 3300005617 | Bacteria | 21505 |
| 236 | Ga0068859_100003598 | 3300005617 | Bacteria | 15799 |
| 237 | Ga0068859_100008916 | 3300005617 | Bacteria | 10129 |
| 238 | Ga0068859_100012850 | 3300005617 | Bacteria | 8409 |
| 239 | Ga0068859_100328245 | 3300005617 | Bacteria | 1624 |
| 240 | Ga0068859_101308894 | 3300005617 | Unclassified | 799 |
| 241 | Ga0068864_100007801 | 3300005618 | Bacteria | 8816 |
| 242 | Ga0068864_100146501 | 3300005618 | Bacteria | 2135 |
| 243 | Ga0068864_100171899 | 3300005618 | Bacteria | 1976 |
| 244 | Ga0068864_100693499 | 3300005618 | Bacteria | 994 |
| 245 | Ga0068864_100954342 | 3300005618 | Unclassified | 849 |
| 246 | Ga0068861_100035120 | 3300005719 | Bacteria | 3712 |
| 247 | Ga0068861_100168998 | 3300005719 | Bacteria | 1811 |
| 248 | Ga0068851_10018899 | 3300005834 | Bacteria | 3327 |
| 249 | Ga0068870_10040462 | 3300005840 | Unclassified | 2417 |
| 250 | Ga0068870_10071433 | 3300005840 | Bacteria | 1894 |
| 251 | Ga0068870_10385212 | 3300005840 | Unclassified | 908 |
| 252 | Ga0068863_100017333 | 3300005841 | Bacteria | 6906 |
| 253 | Ga0068863_100027438 | 3300005841 | Bacteria | 5431 |
| 254 | Ga0068863_100037911 | 3300005841 | Bacteria | 4587 |
| 255 | Ga0068863_100091673 | 3300005841 | Unclassified | 2882 |
| 256 | Ga0068863_100094527 | 3300005841 | Bacteria | 2837 |
| 257 | Ga0068863_100541306 | 3300005841 | Bacteria | 1149 |
| 258 | Ga0068858_100001080 | 3300005842 | Bacteria | 28247 |
| 259 | Ga0068858_100001918 | 3300005842 | Bacteria | 21203 |
| 260 | Ga0068858_100024884 | 3300005842 | Bacteria | 5574 |
| 261 | Ga0068858_100038794 | 3300005842 | Bacteria | 4418 |
| 262 | Ga0068858_100096333 | 3300005842 | Bacteria | 2757 |
| 263 | Ga0068858_100272306 | 3300005842 | Bacteria | 1611 |
| 264 | Ga0068860_100039593 | 3300005843 | Bacteria | 4508 |
| 265 | Ga0068860_100063271 | 3300005843 | Bacteria | 3514 |
| 266 | Ga0068860_100089107 | 3300005843 | Unclassified | 2937 |
| 267 | Ga0068860_100148545 | 3300005843 | Bacteria | 2256 |
| 268 | Ga0068860_100178131 | 3300005843 | Bacteria | 2055 |
| 269 | Ga0068860_100288257 | 3300005843 | Bacteria | 1606 |
| 270 | Ga0068860_100358033 | 3300005843 | Bacteria | 1437 |
| 271 | Ga0068860_100518184 | 3300005843 | Bacteria | 1192 |
| 272 | Ga0068862_100126415 | 3300005844 | Bacteria | 2257 |
| 273 | Ga0068862_100344383 | 3300005844 | Bacteria | 1381 |
| 274 | Ga0068862_100694919 | 3300005844 | Bacteria | 985 |
| 275 | Ga0081455_10162099 | 3300005937 | Bacteria | 1713 |
| 276 | Ga0081540_1051473 | 3300005983 | Bacteria | 2036 |
| 277 | Ga0070717_10001125 | 3300006028 | Bacteria | 18088 |
| 278 | Ga0070717_10014637 | 3300006028 | Bacteria | 6039 |
| 279 | Ga0070717_10025999 | 3300006028 | Unclassified | 4666 |
| 280 | Ga0070717_10037812 | 3300006028 | Unclassified | 3920 |
| 281 | Ga0070717_10070833 | 3300006028 | Bacteria | 2907 |
| 282 | Ga0070717_10108607 | 3300006028 | Bacteria | 2364 |
| 283 | Ga0070717_10171078 | 3300006028 | Bacteria | 1889 |
| 284 | Ga0070717_10220687 | 3300006028 | Bacteria | 1666 |
| 285 | Ga0070717_10314866 | 3300006028 | Unclassified | 1393 |
| 286 | Ga0070717_10436755 | 3300006028 | Bacteria | 1179 |
| 287 | Ga0075365_10026433 | 3300006038 | Bacteria | 3685 |
| 288 | Ga0075365_10068707 | 3300006038 | Unclassified | 2381 |
| 289 | Ga0075368_10087693 | 3300006042 | Bacteria | 1271 |
| 290 | Ga0075363_100050938 | 3300006048 | Bacteria | 2207 |
| 291 | Ga0075364_10097475 | 3300006051 | Unclassified | 1956 |
| 292 | Ga0075364_10227900 | 3300006051 | Unclassified | 1266 |
| 293 | Ga0070715_10075192 | 3300006163 | Unclassified | 1519 |
| 294 | Ga0070715_10337078 | 3300006163 | Unclassified | 819 |
| 295 | Ga0070716_100020885 | 3300006173 | Bacteria | 3443 |
| 296 | Ga0070716_100023415 | 3300006173 | Bacteria | 3275 |
| 297 | Ga0070716_100067732 | 3300006173 | Unclassified | 2086 |
| 298 | Ga0070716_100193397 | 3300006173 | Bacteria | 1346 |
| 299 | Ga0070716_100216756 | 3300006173 | Bacteria | 1283 |
| 300 | Ga0070716_100302612 | 3300006173 | Bacteria | 1113 |
| 301 | Ga0070716_100671693 | 3300006173 | Bacteria | 788 |
| 302 | Ga0070712_100000117 | 3300006175 | Bacteria | 41403 |
| 303 | Ga0070712_100001433 | 3300006175 | Bacteria | 14543 |
| 304 | Ga0070712_100060003 | 3300006175 | Unclassified | 2681 |
| 305 | Ga0070712_100085354 | 3300006175 | Bacteria | 2298 |
| 306 | Ga0070712_100192019 | 3300006175 | Bacteria | 1599 |
| 307 | Ga0070712_100216154 | 3300006175 | Unclassified | 1514 |
| 308 | Ga0075362_10000281 | 3300006177 | Bacteria | 14342 |
| 309 | Ga0075362_10317791 | 3300006177 | Unclassified | 775 |
| 310 | Ga0075367_10021802 | 3300006178 | Bacteria | 3586 |
| 311 | Ga0075367_10034626 | 3300006178 | Unclassified | 2919 |
| 312 | Ga0075366_10000367 | 3300006195 | Bacteria | 20854 |
| 313 | Ga0097621_100000058 | 3300006237 | Bacteria | 58363 |
| 314 | Ga0097621_100000214 | 3300006237 | Bacteria | 38208 |
| 315 | Ga0097621_100002700 | 3300006237 | Bacteria | 12139 |
| 316 | Ga0097621_100096277 | 3300006237 | Unclassified | 2484 |
| 317 | Ga0097621_100112189 | 3300006237 | Unclassified | 2305 |
| 318 | Ga0097621_100154053 | 3300006237 | Bacteria | 1972 |
| 319 | Ga0068871_100000167 | 3300006358 | Bacteria | 43972 |
| 320 | Ga0068871_100001129 | 3300006358 | Bacteria | 17928 |
| 321 | Ga0068871_100033834 | 3300006358 | Bacteria | 4049 |
| 322 | Ga0068871_100094064 | 3300006358 | Bacteria | 2501 |
| 323 | Ga0068871_100232613 | 3300006358 | Bacteria | 1600 |
| 324 | Ga0068871_100500600 | 3300006358 | Bacteria | 1095 |
| 325 | Ga0075428_100041624 | 3300006844 | Bacteria | 5051 |
| 326 | Ga0075428_100177918 | 3300006844 | Bacteria | 2303 |
| 327 | Ga0075428_100460585 | 3300006844 | Unclassified | 1362 |
| 328 | Ga0075430_100038683 | 3300006846 | Bacteria | 4040 |
| 329 | Ga0075430_100048471 | 3300006846 | Bacteria | 3587 |
| 330 | Ga0075430_100697451 | 3300006846 | Bacteria | 837 |
| 331 | Ga0075431_100000068 | 3300006847 | Bacteria | 60176 |
| 332 | Ga0075431_100269302 | 3300006847 | Bacteria | 1727 |
| 333 | Ga0075431_100434565 | 3300006847 | Bacteria | 1310 |
| 334 | Ga0075431_100512925 | 3300006847 | Bacteria | 1189 |
| 335 | Ga0075431_100715897 | 3300006847 | Bacteria | 978 |
| 336 | Ga0075431_100744691 | 3300006847 | Unclassified | 956 |
| 337 | Ga0075431_100810987 | 3300006847 | Bacteria | 909 |
| 338 | Ga0075433_10022035 | 3300006852 | Bacteria | 5346 |
| 339 | Ga0075433_10074838 | 3300006852 | Bacteria | 2980 |
| 340 | Ga0075433_10100418 | 3300006852 | Bacteria | 2562 |
| 341 | Ga0075433_10147954 | 3300006852 | Bacteria | 2088 |
| 342 | Ga0075433_10921779 | 3300006852 | Unclassified | 762 |
| 343 | Ga0075433_10975567 | 3300006852 | Bacteria | 738 |
| 344 | Ga0075434_100011129 | 3300006871 | Bacteria | 8466 |
| 345 | Ga0075434_100078897 | 3300006871 | Bacteria | 3289 |
| 346 | Ga0075434_100139032 | 3300006871 | Unclassified | 2448 |
| 347 | Ga0075434_100294114 | 3300006871 | Bacteria | 1644 |
| 348 | Ga0075434_100535245 | 3300006871 | Bacteria | 1191 |
| 349 | Ga0075429_100000340 | 3300006880 | Bacteria | 34005 |
| 350 | Ga0075429_100030110 | 3300006880 | Bacteria | 4715 |
| 351 | Ga0075429_100160664 | 3300006880 | Bacteria | 1968 |
| 352 | Ga0068865_100293594 | 3300006881 | Unclassified | 1298 |
| 353 | Ga0075436_100012092 | 3300006914 | Bacteria | 5918 |
| 354 | Ga0075436_100094035 | 3300006914 | Bacteria | 2085 |
| 355 | Ga0075436_100129329 | 3300006914 | Bacteria | 1770 |
| 356 | Ga0075436_100304465 | 3300006914 | Bacteria | 1143 |
| 357 | Ga0097620_100001850 | 3300006931 | Bacteria | 21505 |
| 358 | Ga0097620_100003598 | 3300006931 | Bacteria | 15799 |
| 359 | Ga0097620_100008916 | 3300006931 | Bacteria | 10129 |
| 360 | Ga0097620_100012850 | 3300006931 | Bacteria | 8409 |
| 361 | Ga0097620_100328225 | 3300006931 | Bacteria | 1624 |
| 362 | Ga0097620_101309049 | 3300006931 | Unclassified | 799 |
| 363 | Ga0075435_100026673 | 3300007076 | Bacteria | 4511 |
| 364 | Ga0075435_100066652 | 3300007076 | Bacteria | 2930 |
| 365 | Ga0099794_10195183 | 3300007265 | Bacteria | 1036 |
| 366 | Ga0099795_10106782 | 3300007788 | Bacteria | 1105 |
| 367 | Ga0105240_10076862 | 3300009093 | Unclassified | 4115 |
| 368 | Ga0105240_10115522 | 3300009093 | Bacteria | 3240 |
| 369 | Ga0105240_10156926 | 3300009093 | Bacteria | 2705 |
| 370 | Ga0111539_10000594 | 3300009094 | Bacteria | 46740 |
| 371 | Ga0111539_10051539 | 3300009094 | Bacteria | 4901 |
| 372 | Ga0111539_10209694 | 3300009094 | Bacteria | 2270 |
| 373 | Ga0111539_12166290 | 3300009094 | Unclassified | 645 |
| 374 | Ga0105245_10008717 | 3300009098 | Bacteria | 8843 |
| 375 | Ga0105245_10277975 | 3300009098 | Bacteria | 1635 |
| 376 | Ga0105245_11158046 | 3300009098 | Unclassified | 820 |
| 377 | Ga0105247_10131199 | 3300009101 | Bacteria | 1633 |
| 378 | Ga0105247_10277664 | 3300009101 | Bacteria | 1155 |
| 379 | Ga0114129_10001988 | 3300009147 | Bacteria | 27977 |
| 380 | Ga0114129_10043115 | 3300009147 | Bacteria | 6350 |
| 381 | Ga0114129_10102611 | 3300009147 | Bacteria | 3956 |
| 382 | Ga0114129_10116598 | 3300009147 | Bacteria | 3680 |
| 383 | Ga0114129_10126576 | 3300009147 | Unclassified | 3512 |
| 384 | Ga0114129_10137126 | 3300009147 | Bacteria | 3356 |
| 385 | Ga0114129_10499207 | 3300009147 | Bacteria | 1589 |
| 386 | Ga0114129_10957685 | 3300009147 | Unclassified | 1081 |
| 387 | Ga0105243_10087448 | 3300009148 | Bacteria | 2558 |
| 388 | Ga0105243_11438335 | 3300009148 | Unclassified | 711 |
| 389 | Ga0105241_10029168 | 3300009174 | Unclassified | 4114 |
| 390 | Ga0105241_10042322 | 3300009174 | Bacteria | 3445 |
| 391 | Ga0105241_10126627 | 3300009174 | Bacteria | 2063 |
| 392 | Ga0105241_10316689 | 3300009174 | Unclassified | 1344 |
| 393 | Ga0105241_10461648 | 3300009174 | Bacteria | 1125 |
| 394 | Ga0105242_10013831 | 3300009176 | Bacteria | 6246 |
| 395 | Ga0105242_10132852 | 3300009176 | Bacteria | 2151 |
| 396 | Ga0105242_10572270 | 3300009176 | Unclassified | 1086 |
| 397 | Ga0105242_10743336 | 3300009176 | Bacteria | 965 |
| 398 | Ga0105242_10809000 | 3300009176 | Unclassified | 928 |
| 399 | Ga0105248_10014941 | 3300009177 | Bacteria | 8548 |
| 400 | Ga0105248_10069290 | 3300009177 | Bacteria | 3960 |
| 401 | Ga0105248_10082685 | 3300009177 | Bacteria | 3612 |
| 402 | Ga0105248_10089677 | 3300009177 | Bacteria | 3461 |
| 403 | Ga0105248_10091875 | 3300009177 | Bacteria | 3418 |
| 404 | Ga0105248_10173639 | 3300009177 | Unclassified | 2429 |
| 405 | Ga0105248_10258773 | 3300009177 | Bacteria | 1959 |
| 406 | Ga0105248_10519462 | 3300009177 | Unclassified | 1343 |
| 407 | Ga0105237_10040678 | 3300009545 | Bacteria | 4688 |
| 408 | Ga0105237_10191521 | 3300009545 | Bacteria | 2045 |
| 409 | Ga0105237_10417674 | 3300009545 | Bacteria | 1347 |
| 410 | Ga0105237_10733999 | 3300009545 | Bacteria | 994 |
| 411 | Ga0105238_10006322 | 3300009551 | Bacteria | 11777 |
| 412 | Ga0105238_11352553 | 3300009551 | Bacteria | 739 |
| 413 | Ga0105249_10420134 | 3300009553 | Bacteria | 1371 |
| 414 | Ga0105239_10007920 | 3300010375 | Bacteria | 12147 |
| 415 | Ga0105239_10044315 | 3300010375 | Bacteria | 4877 |
| 416 | Ga0105239_10233069 | 3300010375 | Bacteria | 2066 |
| 417 | Ga0105239_10543099 | 3300010375 | Bacteria | 1323 |
| 418 | Ga0105246_10091183 | 3300011119 | Bacteria | 2196 |
| 419 | Ga0157373_10043823 | 3300013100 | Bacteria | 3195 |
| 420 | Ga0157371_10037588 | 3300013102 | Bacteria | 3464 |
| 421 | Ga0157370_10181120 | 3300013104 | Bacteria | 1958 |
| 422 | Ga0157369_10000592 | 3300013105 | Bacteria | 47171 |
| 423 | Ga0157369_10000794 | 3300013105 | Bacteria | 40368 |
| 424 | Ga0157369_10079290 | 3300013105 | Bacteria | 3517 |
| 425 | Ga0157369_10654845 | 3300013105 | Unclassified | 1083 |
| 426 | Ga0157369_10806255 | 3300013105 | Bacteria | 965 |
| 427 | Ga0157369_10882658 | 3300013105 | Unclassified | 917 |
| 428 | Ga0157374_10000181 | 3300013296 | Bacteria | 58388 |
| 429 | Ga0157374_10145719 | 3300013296 | Bacteria | 2300 |
| 430 | Ga0157374_10155817 | 3300013296 | Bacteria | 2223 |
| 431 | Ga0157374_10939060 | 3300013296 | Unclassified | 883 |
| 432 | Ga0157378_10000429 | 3300013297 | Bacteria | 41084 |
| 433 | Ga0157378_10000680 | 3300013297 | Bacteria | 31989 |
| 434 | Ga0157378_10002074 | 3300013297 | Bacteria | 17939 |
| 435 | Ga0157378_10005249 | 3300013297 | Bacteria | 11379 |
| 436 | Ga0157378_10063848 | 3300013297 | Bacteria | 3291 |
| 437 | Ga0157378_10110691 | 3300013297 | Unclassified | 2517 |
| 438 | Ga0157378_10145631 | 3300013297 | Bacteria | 2203 |
| 439 | Ga0163162_10126222 | 3300013306 | Bacteria | 2665 |
| 440 | Ga0163162_10157427 | 3300013306 | Bacteria | 2392 |
| 441 | Ga0163162_10202660 | 3300013306 | Bacteria | 2113 |
| 442 | Ga0163162_10244102 | 3300013306 | Bacteria | 1927 |
| 443 | Ga0163162_10520870 | 3300013306 | Unclassified | 1318 |
| 444 | Ga0163162_10577872 | 3300013306 | Bacteria | 1251 |
| 445 | Ga0157372_10001790 | 3300013307 | Bacteria | 23336 |
| 446 | Ga0157372_10004416 | 3300013307 | Bacteria | 14996 |
| 447 | Ga0157372_10005439 | 3300013307 | Archaea | 13533 |
| 448 | Ga0157372_10039482 | 3300013307 | Bacteria | 5210 |
| 449 | Ga0157372_10046271 | 3300013307 | Bacteria | 4830 |
| 450 | Ga0157372_10314946 | 3300013307 | Bacteria | 1822 |
| 451 | Ga0157372_10849705 | 3300013307 | Bacteria | 1060 |
| 452 | Ga0157372_11086871 | 3300013307 | Unclassified | 925 |
| 453 | Ga0157372_11108930 | 3300013307 | Bacteria | 915 |
| 454 | Ga0157375_10045058 | 3300013308 | Unclassified | 4291 |
| 455 | Ga0157375_10159235 | 3300013308 | Unclassified | 2399 |
| 456 | Ga0157375_10188103 | 3300013308 | Bacteria | 2219 |
| 457 | Ga0157375_10692285 | 3300013308 | Bacteria | 1173 |
| 458 | Ga0157375_11327355 | 3300013308 | Bacteria | 846 |
| 459 | Ga0163163_10007167 | 3300014325 | Bacteria | 9810 |
| 460 | Ga0163163_10200487 | 3300014325 | Bacteria | 2044 |
| 461 | Ga0163163_10522474 | 3300014325 | Bacteria | 1249 |
| 462 | Ga0157380_10004649 | 3300014326 | Bacteria | 9549 |
| 463 | Ga0157380_10075487 | 3300014326 | Bacteria | 2740 |
| 464 | Ga0157380_10938989 | 3300014326 | Unclassified | 894 |
| 465 | Ga0182008_10021755 | 3300014497 | Bacteria | 3293 |
| 466 | Ga0157377_10080770 | 3300014745 | Bacteria | 1900 |
| 467 | Ga0157377_10081733 | 3300014745 | Bacteria | 1890 |
| 468 | Ga0157379_10005240 | 3300014968 | Bacteria | 11138 |
| 469 | Ga0157379_10107467 | 3300014968 | Bacteria | 2505 |
| 470 | Ga0157379_10395246 | 3300014968 | Bacteria | 1270 |
| 471 | Ga0157376_10017528 | 3300014969 | Bacteria | 5466 |
| 472 | Ga0157376_10084529 | 3300014969 | Bacteria | 2733 |
| 473 | Ga0157376_10085534 | 3300014969 | Bacteria | 2717 |
| 474 | Ga0182007_10031543 | 3300015262 | Bacteria | 1803 |
| 475 | Ga0182005_1029456 | 3300015265 | Bacteria | 1497 |
| 476 | Ga0163161_10031147 | 3300017792 | Bacteria | 3799 |
| 477 | Ga0184601_125905 | 3300019183 | Unclassified | 564 |
| 478 | Ga0184600_138855 | 3300019190 | Unclassified | 585 |
| 479 | Ga0184603_148376 | 3300019192 | Unclassified | 564 |
| 480 | Ga0206356_10627380 | 3300020070 | Unclassified | 754 |
| 481 | Ga0206356_10816522 | 3300020070 | Bacteria | 1370 |
| 482 | Ga0206349_1885320 | 3300020075 | Unclassified | 807 |
| 483 | Ga0206355_1123533 | 3300020076 | Unclassified | 956 |
| 484 | Ga0206352_10589987 | 3300020078 | Bacteria | 1299 |
| 485 | Ga0206352_10614394 | 3300020078 | Unclassified | 579 |
| 486 | Ga0206350_10869449 | 3300020080 | Bacteria | 1080 |
| 487 | Ga0206354_10872379 | 3300020081 | Unclassified | 628 |
| 488 | Ga0206353_11757009 | 3300020082 | Bacteria | 1075 |
| 489 | Ga0213876_10038282 | 3300021384 | Bacteria | 2531 |
| 490 | Ga0224712_10150682 | 3300022467 | Bacteria | 1030 |
| 491 | Ga0224712_10308664 | 3300022467 | Unclassified | 741 |
| 492 | Ga0224570_100361 | 3300022730 | Bacteria | 3536 |
| 493 | Ga0247553_109522 | 3300023672 | Unclassified | 552 |
| 494 | Ga0228600_1003986 | 3300024123 | Unclassified | 1072 |
| 495 | Ga0224572_1004119 | 3300024225 | Bacteria | 2508 |
| 496 | Ga0224572_1010950 | 3300024225 | Unclassified | 1712 |
| 497 | Ga0224572_1016643 | 3300024225 | Unclassified | 1410 |
| 498 | Ga0224572_1020018 | 3300024225 | Unclassified | 1285 |
| 499 | Ga0224572_1020278 | 3300024225 | Bacteria | 1277 |
| 500 | Ga0228598_1008363 | 3300024227 | Bacteria | 2091 |
| 501 | Ga0228598_1009848 | 3300024227 | Bacteria | 1909 |
| 502 | Ga0207656_10035109 | 3300025321 | Bacteria | 2097 |
| 503 | Ga0207653_10042422 | 3300025885 | Unclassified | 1496 |
| 504 | Ga0207692_10027459 | 3300025898 | Unclassified | 2682 |
| 505 | Ga0207692_10241923 | 3300025898 | Bacteria | 1078 |
| 506 | Ga0207642_10256328 | 3300025899 | Bacteria | 995 |
| 507 | Ga0207688_10176572 | 3300025901 | Bacteria | 1272 |
| 508 | Ga0207680_10205149 | 3300025903 | Bacteria | 1345 |
| 509 | Ga0207680_10218296 | 3300025903 | Bacteria | 1306 |
| 510 | Ga0207647_10002148 | 3300025904 | Bacteria | 15069 |
| 511 | Ga0207647_10005640 | 3300025904 | Bacteria | 9141 |
| 512 | Ga0207647_10456588 | 3300025904 | Bacteria | 716 |
| 513 | Ga0207685_10040547 | 3300025905 | Unclassified | 1736 |
| 514 | Ga0207699_10049464 | 3300025906 | Unclassified | 2475 |
| 515 | Ga0207699_10074388 | 3300025906 | Unclassified | 2087 |
| 516 | Ga0207699_10323092 | 3300025906 | Unclassified | 1083 |
| 517 | Ga0207699_10350058 | 3300025906 | Unclassified | 1043 |
| 518 | Ga0207699_10355958 | 3300025906 | Bacteria | 1034 |
| 519 | Ga0207699_10388545 | 3300025906 | Unclassified | 992 |
| 520 | Ga0207699_10571628 | 3300025906 | Unclassified | 821 |
| 521 | Ga0207699_10864199 | 3300025906 | Unclassified | 666 |
| 522 | Ga0207643_10048132 | 3300025908 | Unclassified | 2414 |
| 523 | Ga0207643_10268506 | 3300025908 | Bacteria | 1055 |
| 524 | Ga0207684_10000081 | 3300025910 | Bacteria | 178619 |
| 525 | Ga0207684_10001840 | 3300025910 | Bacteria | 22120 |
| 526 | Ga0207684_10009103 | 3300025910 | Bacteria | 8794 |
| 527 | Ga0207684_10031814 | 3300025910 | Bacteria | 4488 |
| 528 | Ga0207684_10384666 | 3300025910 | Bacteria | 1207 |
| 529 | Ga0207684_10677768 | 3300025910 | Bacteria | 877 |
| 530 | Ga0207654_10114778 | 3300025911 | Bacteria | 1681 |
| 531 | Ga0207654_10814068 | 3300025911 | Unclassified | 675 |
| 532 | Ga0207707_10001674 | 3300025912 | Bacteria | 20441 |
| 533 | Ga0207707_10075858 | 3300025912 | Bacteria | 2934 |
| 534 | Ga0207707_10097311 | 3300025912 | Bacteria | 2572 |
| 535 | Ga0207707_10130031 | 3300025912 | Bacteria | 2202 |
| 536 | Ga0207707_10448517 | 3300025912 | Bacteria | 1104 |
| 537 | Ga0207695_10057707 | 3300025913 | Unclassified | 4032 |
| 538 | Ga0207695_10153914 | 3300025913 | Bacteria | 2236 |
| 539 | Ga0207695_10174828 | 3300025913 | Unclassified | 2070 |
| 540 | Ga0207695_10265838 | 3300025913 | Bacteria | 1612 |
| 541 | Ga0207671_10205819 | 3300025914 | Bacteria | 1538 |
| 542 | Ga0207671_10255870 | 3300025914 | Bacteria | 1377 |
| 543 | Ga0207693_10000158 | 3300025915 | Bacteria | 63123 |
| 544 | Ga0207693_10034140 | 3300025915 | Bacteria | 4013 |
| 545 | Ga0207693_10064231 | 3300025915 | Bacteria | 2875 |
| 546 | Ga0207693_10147713 | 3300025915 | Bacteria | 1848 |
| 547 | Ga0207663_10000394 | 3300025916 | Bacteria | 18953 |
| 548 | Ga0207663_10032188 | 3300025916 | Bacteria | 3111 |
| 549 | Ga0207663_10078668 | 3300025916 | Bacteria | 2150 |
| 550 | Ga0207663_10342332 | 3300025916 | Unclassified | 1130 |
| 551 | Ga0207660_10278503 | 3300025917 | Bacteria | 1327 |
| 552 | Ga0207660_10320270 | 3300025917 | Unclassified | 1238 |
| 553 | Ga0207662_10037374 | 3300025918 | Bacteria | 2841 |
| 554 | Ga0207662_10053551 | 3300025918 | Bacteria | 2404 |
| 555 | Ga0207657_10015325 | 3300025919 | Bacteria | 7430 |
| 556 | Ga0207657_10294081 | 3300025919 | Bacteria | 1287 |
| 557 | Ga0207649_10073936 | 3300025920 | Bacteria | 2185 |
| 558 | Ga0207652_10012797 | 3300025921 | Bacteria | 6784 |
| 559 | Ga0207652_10146437 | 3300025921 | Bacteria | 2114 |
| 560 | Ga0207652_10294892 | 3300025921 | Bacteria | 1463 |
| 561 | Ga0207652_10452483 | 3300025921 | Unclassified | 1157 |
| 562 | Ga0207652_10703205 | 3300025921 | Bacteria | 902 |
| 563 | Ga0207652_10860311 | 3300025921 | Bacteria | 802 |
| 564 | Ga0207646_10005419 | 3300025922 | Bacteria | 13420 |
| 565 | Ga0207646_10006067 | 3300025922 | Bacteria | 12585 |
| 566 | Ga0207646_10007260 | 3300025922 | Bacteria | 11294 |
| 567 | Ga0207646_10012725 | 3300025922 | Bacteria | 8074 |
| 568 | Ga0207646_10027006 | 3300025922 | Bacteria | 5233 |
| 569 | Ga0207646_10029369 | 3300025922 | Unclassified | 4999 |
| 570 | Ga0207646_10061824 | 3300025922 | Bacteria | 3343 |
| 571 | Ga0207646_10329529 | 3300025922 | Bacteria | 1379 |
| 572 | Ga0207681_10124784 | 3300025923 | Bacteria | 1894 |
| 573 | Ga0207681_10654007 | 3300025923 | Bacteria | 871 |
| 574 | Ga0207694_10019688 | 3300025924 | Bacteria | 5105 |
| 575 | Ga0207694_10168890 | 3300025924 | Bacteria | 1770 |
| 576 | Ga0207694_10276720 | 3300025924 | Bacteria | 1378 |
| 577 | Ga0207650_10040781 | 3300025925 | Bacteria | 3399 |
| 578 | Ga0207659_10049386 | 3300025926 | Bacteria | 2984 |
| 579 | Ga0207687_10262754 | 3300025927 | Bacteria | 1377 |
| 580 | Ga0207700_10000129 | 3300025928 | Bacteria | 44957 |
| 581 | Ga0207700_10042548 | 3300025928 | Unclassified | 3331 |
| 582 | Ga0207700_10070767 | 3300025928 | Bacteria | 2683 |
| 583 | Ga0207700_10103724 | 3300025928 | Bacteria | 2274 |
| 584 | Ga0207700_10104341 | 3300025928 | Bacteria | 2268 |
| 585 | Ga0207700_10134610 | 3300025928 | Bacteria | 2022 |
| 586 | Ga0207700_10159435 | 3300025928 | Unclassified | 1872 |
| 587 | Ga0207700_10164803 | 3300025928 | Bacteria | 1843 |
| 588 | Ga0207700_10190305 | 3300025928 | Bacteria | 1724 |
| 589 | Ga0207700_10485981 | 3300025928 | Bacteria | 1091 |
| 590 | Ga0207700_10692195 | 3300025928 | Bacteria | 910 |
| 591 | Ga0207700_10730549 | 3300025928 | Bacteria | 884 |
| 592 | Ga0207664_10000284 | 3300025929 | Bacteria | 38480 |
| 593 | Ga0207664_10005601 | 3300025929 | Bacteria | 8594 |
| 594 | Ga0207664_10079142 | 3300025929 | Unclassified | 2667 |
| 595 | Ga0207664_10095160 | 3300025929 | Bacteria | 2450 |
| 596 | Ga0207664_10176736 | 3300025929 | Bacteria | 1831 |
| 597 | Ga0207664_10179871 | 3300025929 | Bacteria | 1815 |
| 598 | Ga0207664_10352848 | 3300025929 | Bacteria | 1302 |
| 599 | Ga0207664_10360630 | 3300025929 | Bacteria | 1288 |
| 600 | Ga0207664_10416860 | 3300025929 | Unclassified | 1196 |
| 601 | Ga0207664_10485638 | 3300025929 | Bacteria | 1105 |
| 602 | Ga0207690_10154126 | 3300025932 | Bacteria | 1706 |
| 603 | Ga0207690_10179007 | 3300025932 | Bacteria | 1595 |
| 604 | Ga0207690_10561174 | 3300025932 | Unclassified | 929 |
| 605 | Ga0207706_10095400 | 3300025933 | Bacteria | 2616 |
| 606 | Ga0207706_10224285 | 3300025933 | Bacteria | 1645 |
| 607 | Ga0207706_10421886 | 3300025933 | Bacteria | 1156 |
| 608 | Ga0207706_10568231 | 3300025933 | Bacteria | 975 |
| 609 | Ga0207686_10175518 | 3300025934 | Unclassified | 1515 |
| 610 | Ga0207686_10578883 | 3300025934 | Bacteria | 881 |
| 611 | Ga0207709_10013097 | 3300025935 | Bacteria | 4572 |
| 612 | Ga0207709_10921136 | 3300025935 | Unclassified | 711 |
| 613 | Ga0207670_10060699 | 3300025936 | Bacteria | 2577 |
| 614 | Ga0207670_10093078 | 3300025936 | Bacteria | 2135 |
| 615 | Ga0207670_10100911 | 3300025936 | Unclassified | 2061 |
| 616 | Ga0207670_10329914 | 3300025936 | Bacteria | 1203 |
| 617 | Ga0207669_10071781 | 3300025937 | Bacteria | 2177 |
| 618 | Ga0207704_10024694 | 3300025938 | Bacteria | 3265 |
| 619 | Ga0207704_10118716 | 3300025938 | Bacteria | 1805 |
| 620 | Ga0207704_10252014 | 3300025938 | Bacteria | 1326 |
| 621 | Ga0207665_10001257 | 3300025939 | Bacteria | 17084 |
| 622 | Ga0207665_10015257 | 3300025939 | Bacteria | 5046 |
| 623 | Ga0207665_10069495 | 3300025939 | Bacteria | 2402 |
| 624 | Ga0207665_10270620 | 3300025939 | Unclassified | 1261 |
| 625 | Ga0207665_10341024 | 3300025939 | Bacteria | 1129 |
| 626 | Ga0207665_10611546 | 3300025939 | Bacteria | 852 |
| 627 | Ga0207691_10002633 | 3300025940 | Bacteria | 17523 |
| 628 | Ga0207691_10071410 | 3300025940 | Bacteria | 3133 |
| 629 | Ga0207711_10011482 | 3300025941 | Bacteria | 7363 |
| 630 | Ga0207711_10107485 | 3300025941 | Bacteria | 2477 |
| 631 | Ga0207711_10167404 | 3300025941 | Bacteria | 1993 |
| 632 | Ga0207711_10313318 | 3300025941 | Bacteria | 1449 |
| 633 | Ga0207711_10321193 | 3300025941 | Bacteria | 1431 |
| 634 | Ga0207711_10515005 | 3300025941 | Bacteria | 1115 |
| 635 | Ga0207711_10742413 | 3300025941 | Bacteria | 915 |
| 636 | Ga0207689_10006279 | 3300025942 | Bacteria | 10529 |
| 637 | Ga0207689_10007004 | 3300025942 | Bacteria | 9912 |
| 638 | Ga0207689_10021498 | 3300025942 | Bacteria | 5424 |
| 639 | Ga0207689_10374078 | 3300025942 | Bacteria | 1186 |
| 640 | Ga0207689_10405171 | 3300025942 | Bacteria | 1137 |
| 641 | Ga0207661_10008597 | 3300025944 | Bacteria | 7297 |
| 642 | Ga0207661_10018914 | 3300025944 | Bacteria | 5127 |
| 643 | Ga0207661_10461724 | 3300025944 | Bacteria | 1157 |
| 644 | Ga0207667_10001950 | 3300025949 | Bacteria | 25855 |
| 645 | Ga0207667_10007869 | 3300025949 | Bacteria | 12730 |
| 646 | Ga0207667_10315714 | 3300025949 | Bacteria | 1596 |
| 647 | Ga0207667_10336764 | 3300025949 | Bacteria | 1540 |
| 648 | Ga0207651_10006530 | 3300025960 | Bacteria | 6119 |
| 649 | Ga0207651_10071608 | 3300025960 | Bacteria | 2458 |
| 650 | Ga0207668_10477673 | 3300025972 | Bacteria | 1068 |
| 651 | Ga0207640_10011254 | 3300025981 | Bacteria | 5060 |
| 652 | Ga0207640_10016852 | 3300025981 | Bacteria | 4260 |
| 653 | Ga0207640_10185949 | 3300025981 | Bacteria | 1562 |
| 654 | Ga0207640_11077433 | 3300025981 | Bacteria | 710 |
| 655 | Ga0207658_10412664 | 3300025986 | Bacteria | 1189 |
| 656 | Ga0207677_10010884 | 3300026023 | Bacteria | 5163 |
| 657 | Ga0207677_10011184 | 3300026023 | Bacteria | 5106 |
| 658 | Ga0207677_10011507 | 3300026023 | Bacteria | 5050 |
| 659 | Ga0207703_10006387 | 3300026035 | Bacteria | 9423 |
| 660 | Ga0207703_10017744 | 3300026035 | Bacteria | 5557 |
| 661 | Ga0207703_10032365 | 3300026035 | Unclassified | 4139 |
| 662 | Ga0207703_10126285 | 3300026035 | Unclassified | 2203 |
| 663 | Ga0207639_10205272 | 3300026041 | Bacteria | 1693 |
| 664 | Ga0207639_10226049 | 3300026041 | Unclassified | 1619 |
| 665 | Ga0207639_10246600 | 3300026041 | Bacteria | 1556 |
| 666 | Ga0207639_10636652 | 3300026041 | Bacteria | 986 |
| 667 | Ga0207639_11129248 | 3300026041 | Bacteria | 735 |
| 668 | Ga0207678_10022374 | 3300026067 | Bacteria | 5537 |
| 669 | Ga0207678_10305917 | 3300026067 | Bacteria | 1367 |
| 670 | Ga0207708_10019652 | 3300026075 | Bacteria | 5095 |
| 671 | Ga0207708_10069636 | 3300026075 | Bacteria | 2694 |
| 672 | Ga0207702_10000962 | 3300026078 | Bacteria | 29642 |
| 673 | Ga0207702_10000989 | 3300026078 | Bacteria | 29131 |
| 674 | Ga0207702_10007050 | 3300026078 | Bacteria | 9615 |
| 675 | Ga0207702_10037565 | 3300026078 | Bacteria | 4054 |
| 676 | Ga0207702_10788659 | 3300026078 | Unclassified | 939 |
| 677 | Ga0207641_10020452 | 3300026088 | Bacteria | 5435 |
| 678 | Ga0207641_10044390 | 3300026088 | Bacteria | 3738 |
| 679 | Ga0207641_10131116 | 3300026088 | Unclassified | 2251 |
| 680 | Ga0207641_10141495 | 3300026088 | Bacteria | 2171 |
| 681 | Ga0207641_10446599 | 3300026088 | Bacteria | 1249 |
| 682 | Ga0207648_10000621 | 3300026089 | Bacteria | 39779 |
| 683 | Ga0207648_10022238 | 3300026089 | Bacteria | 5697 |
| 684 | Ga0207648_10120701 | 3300026089 | Bacteria | 2305 |
| 685 | Ga0207676_10016801 | 3300026095 | Bacteria | 5298 |
| 686 | Ga0207676_10077228 | 3300026095 | Bacteria | 2693 |
| 687 | Ga0207676_10470759 | 3300026095 | Bacteria | 1188 |
| 688 | Ga0207674_10000867 | 3300026116 | Bacteria | 39599 |
| 689 | Ga0207674_10010008 | 3300026116 | Bacteria | 10793 |
| 690 | Ga0207674_10134956 | 3300026116 | Bacteria | 2430 |
| 691 | Ga0207674_10245849 | 3300026116 | Unclassified | 1736 |
| 692 | Ga0207674_10314628 | 3300026116 | Bacteria | 1515 |
| 693 | Ga0207674_11213828 | 3300026116 | Unclassified | 724 |
| 694 | Ga0207675_100018660 | 3300026118 | Bacteria | 6475 |
| 695 | Ga0207683_10084756 | 3300026121 | Unclassified | 2817 |
| 696 | Ga0207683_10547133 | 3300026121 | Unclassified | 1070 |
| 697 | Ga0207698_10584979 | 3300026142 | Bacteria | 1099 |
| 698 | Ga0207698_11052493 | 3300026142 | Bacteria | 825 |
| 699 | Ga0209588_1097025 | 3300027671 | Bacteria | 949 |
| 700 | Ga0209813_10040724 | 3300027866 | Bacteria | 1413 |
| 701 | Ga0209813_10066202 | 3300027866 | Archaea | 1165 |
| 702 | Ga0207428_10000041 | 3300027907 | Bacteria | 203097 |
| 703 | Ga0207428_10000275 | 3300027907 | Bacteria | 69128 |
| 704 | Ga0207428_10058904 | 3300027907 | Bacteria | 3046 |
| 705 | Ga0207428_10204447 | 3300027907 | Bacteria | 1485 |
| 706 | Ga0265356_1000604 | 3300028017 | Bacteria | 6297 |
| 707 | Ga0265356_1005173 | 3300028017 | Bacteria | 1569 |
| 708 | Ga0268265_10042525 | 3300028380 | Unclassified | 3372 |
| 709 | Ga0268265_10046839 | 3300028380 | Bacteria | 3235 |
| 710 | Ga0268265_10243619 | 3300028380 | Bacteria | 1588 |
| 711 | Ga0268265_10960392 | 3300028380 | Bacteria | 842 |
| 712 | Ga0268264_10118544 | 3300028381 | Bacteria | 2329 |
| 713 | Ga0268264_10144353 | 3300028381 | Bacteria | 2126 |
| 714 | Ga0268264_10238210 | 3300028381 | Bacteria | 1684 |
| 715 | Ga0268264_10318059 | 3300028381 | Bacteria | 1471 |
| 716 | Ga0265338_10010883 | 3300028800 | Bacteria | 10586 |
| 717 | Ga0265338_10025739 | 3300028800 | Archaea | 5961 |
| 718 | Ga0265338_10106886 | 3300028800 | Bacteria | 2264 |
| 719 | Ga0265338_10118254 | 3300028800 | Unclassified | 2118 |
| 720 | Ga0265338_10247136 | 3300028800 | Bacteria | 1318 |
| 721 | Ga0265338_10294286 | 3300028800 | Unclassified | 1182 |
| 722 | Ga0265762_1000985 | 3300030760 | Bacteria | 5115 |
| 723 | Ga0265762_1017137 | 3300030760 | Unclassified | 1317 |
| 724 | Ga0265762_1035894 | 3300030760 | Unclassified | 955 |
| 725 | Ga0265762_1045518 | 3300030760 | Unclassified | 868 |
| 726 | Ga0265767_114267 | 3300030836 | Unclassified | 564 |
| 727 | Ga0265765_1001211 | 3300030879 | Bacteria | 2332 |
| 728 | Ga0265764_105869 | 3300030882 | Unclassified | 697 |
| 729 | Ga0265761_104905 | 3300030889 | Bacteria | 690 |
| 730 | Ga0265761_109430 | 3300030889 | Unclassified | 559 |
| 731 | Ga0265761_109653 | 3300030889 | Unclassified | 554 |
| 732 | Ga0265771_1012144 | 3300031010 | Unclassified | 654 |
| 733 | Ga0265760_10000937 | 3300031090 | Bacteria | 8406 |
| 734 | Ga0265760_10001736 | 3300031090 | Bacteria | 6410 |
| 735 | Ga0265760_10009110 | 3300031090 | Unclassified | 2836 |
| 736 | Ga0265760_10035082 | 3300031090 | Unclassified | 1484 |
| 737 | Ga0265760_10035745 | 3300031090 | Bacteria | 1472 |
| 738 | Ga0265760_10052458 | 3300031090 | Bacteria | 1229 |
| 739 | Ga0265760_10100738 | 3300031090 | Bacteria | 913 |
| 740 | Ga0265328_10026747 | 3300031239 | Bacteria | 2167 |
| 741 | Ga0265325_10006060 | 3300031241 | Bacteria | 7394 |
| 742 | Ga0265329_10175700 | 3300031242 | Unclassified | 699 |
| 743 | Ga0265339_10008297 | 3300031249 | Bacteria | 6617 |
| 744 | Ga0265339_10050165 | 3300031249 | Bacteria | 2283 |
| 745 | Ga0265339_10075038 | 3300031249 | Bacteria | 1796 |
| 746 | Ga0265316_10019366 | 3300031344 | Bacteria | 5823 |
| 747 | Ga0265316_10153007 | 3300031344 | Bacteria | 1727 |
| 748 | Ga0307408_100359352 | 3300031548 | Bacteria | 1238 |
| 749 | Ga0265314_10026201 | 3300031711 | Bacteria | 4383 |
| 750 | Ga0265314_10162857 | 3300031711 | Unclassified | 1355 |
| 751 | Ga0265314_10202793 | 3300031711 | Unclassified | 1171 |
| 752 | Ga0316576_10064560 | 3300031727 | Bacteria | 2689 |
| 753 | Ga0316578_10061306 | 3300031728 | Bacteria | 2216 |
| 754 | Ga0316577_10000601 | 3300031733 | Bacteria | 14839 |
| 755 | Ga0316053_112410 | 3300032120 | Bacteria | 610 |
| 756 | Ga0316212_1021929 | 3300033547 | Bacteria | 895 |
| 757 | Ga0373926_0010630 | 3300035083 | Unclassified | 3086 |
| 758 | Ga0373926_0045658 | 3300035083 | Bacteria | 1571 |
| 759 | Ga0373928_0108807 | 3300035084 | Bacteria | 731 |
| 760 | Ga0373934_0085175 | 3300035086 | Unclassified | 1271 |
| 761 | Ga0373923_0038046 | 3300035111 | Bacteria | 1970 |
| 762 | Ga0373923_0053782 | 3300035111 | Unclassified | 1693 |
| 763 | Ga0373923_0543593 | 3300035111 | Unclassified | 569 |
| 764 | Ga0373936_0007952 | 3300035113 | Bacteria | 3984 |
| 765 | Ga0373936_0058037 | 3300035113 | Bacteria | 1575 |
| 766 | Ga0373945_0001372 | 3300035116 | Bacteria | 7396 |
| 767 | Ga0373945_0165827 | 3300035116 | Bacteria | 903 |
| 768 | Ga0373953_0012564 | 3300035117 | Bacteria | 3003 |
| 769 | Ga0373954_0011546 | 3300035118 | Bacteria | 3916 |
| 770 | Ga0373956_0302832 | 3300035119 | Unclassified | 761 |
| 771 | Ga0373943_0000120 | 3300035170 | Bacteria | 29179 |
| 772 | Ga0373943_0045811 | 3300035170 | Bacteria | 2133 |
| 773 | Ga0373946_0081654 | 3300035171 | Bacteria | 1416 |
| 774 | Ga0373955_0510756 | 3300035172 | Bacteria | 734 |
| 775 | Ga0316574_0110316 | 3300035398 | Bacteria | 1763 |
| 776 | Ga0316574_0164241 | 3300035398 | Bacteria | 1430 |
| 777 | Ga0373924_0169766 | 3300035410 | Bacteria | 958 |
| 778 | Ga0373924_0186782 | 3300035410 | Unclassified | 912 |
| 779 | Ga0373931_0142443 | 3300035691 | Bacteria | 1390 |
| 780 | Ga0373935_0000522 | 3300035692 | Bacteria | 20030 |
| 781 | Ga0373935_0087515 | 3300035692 | Unclassified | 2034 |
| 782 | Ga0373927_0000062 | 3300035695 | Bacteria | 77303 |
| 783 | Ga0373927_0405003 | 3300035695 | Bacteria | 900 |
| 784 | Ga0373933_0085855 | 3300035724 | Unclassified | 1935 |
| 785 | Ga0373933_0494220 | 3300035724 | Bacteria | 801 |
| 786 | Ga0373933_0526703 | 3300035724 | Unclassified | 775 |
| 787 | Ga0373947_0002314 | 3300035725 | Bacteria | 11513 |
| 788 | Ga0373947_0050692 | 3300035725 | Bacteria | 2496 |
| 789 | Ga0373947_0385304 | 3300035725 | Bacteria | 944 |
| 790 | Ga0373937_0053682 | 3300036401 | Bacteria | 3697 |
| 791 | Ga0373937_0119810 | 3300036401 | Bacteria | 2452 |
| 792 | Ga0373937_0200567 | 3300036401 | Bacteria | 1875 |
| 793 | Ga0373937_0996617 | 3300036401 | Unclassified | 786 |
| 794 | Ga0373937_1099845 | 3300036401 | Bacteria | 743 |
| 795 | Ga0265778_043107 | 3300036457 | Unclassified | 605 |
| 796 | Ga0265778_051187 | 3300036457 | Unclassified | 565 |
| 797 | Ga0265778_053004 | 3300036457 | Unclassified | 558 |
| 798 | Ga0265778_053804 | 3300036457 | Unclassified | 554 |
| 799 | Ga0316582_0066874 | 3300036647 | Bacteria | 2318 |
| 800 | Ga0316582_0200621 | 3300036647 | Bacteria | 1361 |
| 801 | Ga0316584_0449160 | 3300036712 | Unclassified | 912 |
| 802 | Ga0373925_0039043 | 3300037068 | Bacteria | 3512 |
| 803 | Ga0436365_0750672 | 3300039437 | Bacteria | 1477 |
| 804 | Ga0436365_0901241 | 3300039437 | Bacteria | 2533 |
| 805 | Ga0436365_0993814 | 3300039437 | Bacteria | 1665 |
| 806 | Ga0453683_0193623 | 3300044673 | Bacteria | 1290 |
| 807 | Ga0466966_0150104 | 3300044684 | Bacteria | 1422 |
| 808 | Ga0466961_0137896 | 3300044693 | Bacteria | 1528 |
| 809 | Ga0466961_0359016 | 3300044693 | Unclassified | 886 |
| 810 | Ga0466963_0047151 | 3300044694 | Bacteria | 2844 |
| 811 | Ga0466964_0254808 | 3300044706 | Unclassified | 867 |
| 812 | Ga0466971_0076486 | 3300044719 | Bacteria | 1523 |
| 813 | Ga0466957_0245495 | 3300044842 | Bacteria | 1189 |
| 814 | Ga0466959_0114973 | 3300045049 | Bacteria | 1917 |
| 815 | Ga0466959_0464586 | 3300045049 | Unclassified | 857 |
| 816 | Ga0466959_0685535 | 3300045049 | Unclassified | 687 |
| 817 | Ga0451576_0181316 | 3300045051 | Bacteria | 2199 |
| 818 | Ga0451576_0267497 | 3300045051 | Bacteria | 1787 |
| 819 | Ga0451576_0566645 | 3300045051 | Bacteria | 1193 |
| 820 | Ga0451576_0750609 | 3300045051 | Unclassified | 1025 |
| 821 | Ga0466958_0456214 | 3300045836 | Unclassified | 828 |
| 822 | Ga0466967_0005791 | 3300045976 | Bacteria | 8642 |
| 823 | Ga0466967_0419735 | 3300045976 | Unclassified | 1304 |
| 824 | Ga0495629_0005749 | 3300046459 | Bacteria | 9259 |
| 825 | Ga0495651_0565337 | 3300046462 | Unclassified | 721 |
| 826 | Ga0495580_0009994 | 3300046472 | Bacteria | 7418 |
| 827 | Ga0495580_0016836 | 3300046472 | Bacteria | 5483 |
| 828 | Ga0495580_0042692 | 3300046472 | Bacteria | 3229 |
| 829 | Ga0495580_0118118 | 3300046472 | Bacteria | 1841 |
| 830 | Ga0495580_0183100 | 3300046472 | Bacteria | 1446 |
| 831 | Ga0495580_0191137 | 3300046472 | Bacteria | 1412 |
| 832 | Ga0495580_0374468 | 3300046472 | Unclassified | 962 |
| 833 | Ga0495582_0075957 | 3300046473 | Bacteria | 1861 |
| 834 | Ga0495662_0368296 | 3300046476 | Unclassified | 706 |
| 835 | Ga0495664_0128957 | 3300046477 | Unclassified | 1531 |
| 836 | Ga0495594_0041367 | 3300046499 | Unclassified | 2524 |
| 837 | Ga0495628_0084490 | 3300046516 | Unclassified | 2463 |
| 838 | Ga0495630_0386161 | 3300046517 | Unclassified | 1072 |
| 839 | Ga0495665_0036666 | 3300046531 | Bacteria | 2618 |
| 840 | Ga0495665_0324789 | 3300046531 | Bacteria | 786 |
| 841 | Ga0495640_0400585 | 3300046533 | Unclassified | 843 |
| 842 | Ga0495587_0076648 | 3300046536 | Bacteria | 1942 |
| 843 | Ga0495621_0091896 | 3300046539 | Unclassified | 1145 |
| 844 | Ga0495645_0157460 | 3300046543 | Unclassified | 1573 |
| 845 | Ga0495667_0134397 | 3300046559 | Bacteria | 1595 |
| 846 | Ga0495635_0157070 | 3300046663 | Unclassified | 1548 |
| 847 | Ga0495635_0543856 | 3300046663 | Bacteria | 762 |
| 848 | Ga0495588_0522562 | 3300046674 | Bacteria | 622 |
| 849 | Ga0495657_0223993 | 3300046675 | Unclassified | 1139 |
| 850 | Ga0495657_0357040 | 3300046675 | Bacteria | 864 |
| 851 | Ga0495599_0392878 | 3300046678 | Bacteria | 827 |
| 852 | Ga0495623_0038268 | 3300046679 | Unclassified | 3068 |
| 853 | Ga0495623_0072214 | 3300046679 | Unclassified | 2146 |
| 854 | Ga0495623_0151350 | 3300046679 | Unclassified | 1371 |
| 855 | Ga0495623_0377821 | 3300046679 | Unclassified | 767 |
| 856 | Ga0495669_0123006 | 3300046684 | Bacteria | 1217 |
| 857 | Ga0495624_0129430 | 3300046690 | Unclassified | 1548 |
| 858 | Ga0495624_0161273 | 3300046690 | Bacteria | 1370 |
| 859 | Ga0495600_0037963 | 3300046809 | Bacteria | 3133 |
| 860 | Ga0495604_0192502 | 3300047317 | Bacteria | 1420 |
| 861 | Ga0495674_0007407 | 3300047319 | Bacteria | 10488 |
| 862 | Ga0495674_0352148 | 3300047319 | Bacteria | 1195 |
| 863 | Ga0495674_0620847 | 3300047319 | Bacteria | 855 |
| 864 | Ga0495672_0000913 | 3300047320 | Bacteria | 30912 |
| 865 | Ga0495680_0466195 | 3300047322 | Unclassified | 862 |
| 866 | Ga0495675_0148498 | 3300047444 | Bacteria | 1449 |
| 867 | Ga0495675_0423458 | 3300047444 | Unclassified | 773 |
| 868 | Ga0495602_0126162 | 3300048088 | Bacteria | 2050 |
| 869 | Ga0495602_0468993 | 3300048088 | Unclassified | 885 |
| 870 | Ga0495614_0159220 | 3300048089 | Bacteria | 1010 |
| 871 | Ga0496100_0046426 | 3300048903 | Bacteria | 2793 |
| 872 | Ga0496100_0474121 | 3300048903 | Unclassified | 962 |
| 873 | Ga0496101_0069925 | 3300048904 | Bacteria | 2569 |
| 874 | Ga0496102_0002080 | 3300048905 | Bacteria | 17214 |
| 875 | Ga0496102_0812085 | 3300048905 | Bacteria | 857 |
| 876 | Ga0496103_0036041 | 3300048906 | Bacteria | 3029 |
| 877 | Ga0496103_0108811 | 3300048906 | Bacteria | 1759 |
| 878 | Ga0496104_0023678 | 3300048907 | Bacteria | 5647 |
| 879 | Ga0496104_0079480 | 3300048907 | Unclassified | 3126 |
| 880 | Ga0496104_0120200 | 3300048907 | Unclassified | 2522 |
| 881 | Ga0496104_0339199 | 3300048907 | Unclassified | 1416 |
| 882 | Ga0496104_0427338 | 3300048907 | Bacteria | 1237 |
| 883 | Ga0496105_0292993 | 3300048908 | Unclassified | 1310 |
| 884 | Ga0496105_0531737 | 3300048908 | Unclassified | 920 |
| 885 | Ga0496105_0728469 | 3300048908 | Bacteria | 759 |
| 886 | Ga0496106_0061196 | 3300048909 | Unclassified | 2856 |
| 887 | Ga0496106_0188037 | 3300048909 | Bacteria | 1641 |
| 888 | Ga0496107_0169793 | 3300048910 | Bacteria | 1618 |
| 889 | Ga0496108_0040547 | 3300048911 | Bacteria | 3882 |
| 890 | Ga0496108_0266153 | 3300048911 | Bacteria | 1492 |
| 891 | Ga0496109_1017819 | 3300048912 | Bacteria | 766 |
| 892 | Ga0496110_0113142 | 3300048913 | Bacteria | 2440 |
| 893 | Ga0496111_0092455 | 3300048914 | Bacteria | 2217 |
| 894 | Ga0496112_0001114 | 3300048915 | Bacteria | 19958 |
| 895 | Ga0496112_0002004 | 3300048915 | Bacteria | 16104 |
| 896 | Ga0496112_0035410 | 3300048915 | Bacteria | 4863 |
| 897 | Ga0496112_0151319 | 3300048915 | Unclassified | 2287 |
| 898 | Ga0496112_0190132 | 3300048915 | Bacteria | 2015 |
| 899 | Ga0496112_0428782 | 3300048915 | Bacteria | 1261 |
| 900 | Ga0496113_0051332 | 3300048916 | Bacteria | 3077 |
| 901 | Ga0496113_0101182 | 3300048916 | Unclassified | 2234 |
| 902 | Ga0496113_0591309 | 3300048916 | Unclassified | 889 |
| 903 | Ga0496114_0293785 | 3300048917 | Bacteria | 1434 |
| 904 | Ga0496115_0054981 | 3300048918 | Unclassified | 3197 |
| 905 | Ga0496115_0178775 | 3300048918 | Bacteria | 1754 |
| 906 | Ga0501291_017803 | 3300049514 | Bacteria | 1098 |
| 907 | Ga0501294_010505 | 3300049517 | Bacteria | 915 |
| 908 | Ga0501297_011707 | 3300049520 | Bacteria | 1010 |
| 909 | Ga0501298_002952 | 3300049521 | Bacteria | 2612 |
| 910 | Ga0501301_005965 | 3300049524 | Bacteria | 906 |
| 911 | Ga0501032_0183160 | 3300049569 | Unclassified | 1371 |
| 912 | Ga0501033_0382225 | 3300049570 | Unclassified | 984 |
| 913 | Ga0501036_0677804 | 3300049572 | Unclassified | 853 |
| 914 | Ga0501036_0795681 | 3300049572 | Unclassified | 779 |
| 915 | Ga0501038_0068246 | 3300049574 | Bacteria | 3023 |
| 916 | Ga0501039_0348759 | 3300049575 | Unclassified | 1163 |
| 917 | Ga0501040_0108766 | 3300049576 | Bacteria | 1938 |
| 918 | Ga0501048_0048405 | 3300049582 | Bacteria | 3032 |
| 919 | Ga0501048_0673244 | 3300049582 | Unclassified | 743 |
| 920 | Ga0501071_0086416 | 3300049587 | Unclassified | 2300 |
| 921 | Ga0501071_1003467 | 3300049587 | Unclassified | 645 |
| 922 | Ga0501072_0156715 | 3300049588 | Unclassified | 1816 |
| 923 | Ga0501072_0763666 | 3300049588 | Unclassified | 758 |
| 924 | Ga0501074_0154850 | 3300049590 | Unclassified | 1638 |
| 925 | Ga0501075_0187856 | 3300049591 | Unclassified | 1576 |
| 926 | Ga0501075_0319619 | 3300049591 | Unclassified | 1183 |
| 927 | Ga0501075_0414302 | 3300049591 | Unclassified | 1027 |
| 928 | Ga0501076_0001228 | 3300049592 | Bacteria | 17052 |
| 929 | Ga0501077_0792186 | 3300049593 | Unclassified | 609 |
| 930 | Ga0501257_169945 | 3300049686 | Bacteria | 611 |
| 931 | Ga0501079_0210230 | 3300049741 | Bacteria | 1520 |
| 932 | Ga0501080_0120457 | 3300049742 | Bacteria | 2432 |
| 933 | Ga0501081_0144580 | 3300049743 | Unclassified | 1706 |
| 934 | Ga0501081_0482464 | 3300049743 | Bacteria | 923 |
| 935 | Ga0501083_0389818 | 3300049744 | Unclassified | 906 |
| 936 | Ga0501035_0628743 | 3300049822 | Unclassified | 872 |
| 937 | Ga0501045_0061368 | 3300049824 | Bacteria | 2758 |
| 938 | nmdc:mga03683_28667_c1 | 3300050489 | Unclassified | 2216 |
| 939 | nmdc:mga03n38_51735_c1 | 3300050490 | Bacteria | 1835 |
| 940 | nmdc:mga03n38_84975_c1 | 3300050490 | Unclassified | 1495 |
| 941 | nmdc:mga00v17_147142_c1 | 3300050491 | Bacteria | 1512 |
| 942 | nmdc:mga00v17_149537_c1 | 3300050491 | Bacteria | 1500 |
| 943 | nmdc:mga00v17_334036_c1 | 3300050491 | Unclassified | 985 |
| 944 | nmdc:mga00v17_9694_c1 | 3300050491 | Bacteria | 5225 |
| 945 | nmdc:mga0yw44_11427_c1 | 3300050492 | Unclassified | 706 |
| 946 | nmdc:mga0k408_182_c1 | 3300050493 | Bacteria | 32998 |
| 947 | nmdc:mga06z11_27669_c1 | 3300050494 | Unclassified | 2712 |
| 948 | nmdc:mga06z11_528728_c1 | 3300050494 | Bacteria | 715 |
| 949 | nmdc:mga06z11_726815_c1 | 3300050494 | Unclassified | 605 |
| 950 | nmdc:mga06z11_7564_c1 | 3300050494 | Bacteria | 4480 |
| 951 | nmdc:mga04h51_20597_c1 | 3300050495 | Unclassified | 1971 |
| 952 | nmdc:mga07m45_233158_c1 | 3300050496 | Unclassified | 1071 |
| 953 | nmdc:mga07m45_24324_c1 | 3300050496 | Bacteria | 3316 |
| 954 | nmdc:mga05p37_102551_c1 | 3300050507 | Bacteria | 3523 |
| 955 | nmdc:mga05p37_111978_c1 | 3300050507 | Bacteria | 3356 |
| 956 | nmdc:mga05p37_186901_c1 | 3300050507 | Bacteria | 2518 |
| 957 | nmdc:mga05p37_209263_c2 | 3300050507 | Unclassified | 738 |
| 958 | nmdc:mga05p37_25947_c1 | 3300050507 | Bacteria | 7125 |
| 959 | nmdc:mga05p37_261661_c1 | 3300050507 | Unclassified | 2070 |
| 960 | nmdc:mga05p37_276941_c1 | 3300050507 | Unclassified | 2003 |
| 961 | nmdc:mga05p37_41819_c1 | 3300050507 | Bacteria | 5628 |
| 962 | nmdc:mga05p37_511961_c1 | 3300050507 | Bacteria | 1375 |
| 963 | nmdc:mga05p37_83677_c1 | 3300050507 | Bacteria | 3930 |
| 964 | nmdc:mga09592_133886_c1 | 3300050508 | Bacteria | 2134 |
| 965 | nmdc:mga09592_15944_c1 | 3300050508 | Bacteria | 6139 |
| 966 | nmdc:mga09592_22740_c1 | 3300050508 | Bacteria | 5173 |
| 967 | nmdc:mga09592_469_c1 | 3300050508 | Bacteria | 30199 |
| 968 | nmdc:mga09592_6307_c1 | 3300050508 | Bacteria | 9663 |
| 969 | nmdc:mga0qj67_42830_c1 | 3300050509 | Bacteria | 3564 |
| 970 | nmdc:mga0qj67_54471_c1 | 3300050509 | Unclassified | 3167 |
| 971 | nmdc:mga0qj67_999860_c1 | 3300050509 | Bacteria | 656 |
| 972 | nmdc:mga06r32_1189786_c1 | 3300050510 | Unclassified | 709 |
| 973 | nmdc:mga06r32_209913_c1 | 3300050510 | Bacteria | 1935 |
| 974 | nmdc:mga06r32_243590_c1 | 3300050510 | Unclassified | 1785 |
| 975 | nmdc:mga06r32_277455_c1 | 3300050510 | Bacteria | 1307 |
| 976 | nmdc:mga06r32_3704_c1 | 3300050510 | Bacteria | 13657 |
| 977 | nmdc:mga06r32_497697_c1 | 3300050510 | Bacteria | 1196 |
| 978 | nmdc:mga08y16_1210895_c1 | 3300050511 | Unclassified | 725 |
| 979 | nmdc:mga08y16_2217_c1 | 3300050511 | Bacteria | 19922 |
| 980 | nmdc:mga08y16_93220_c1 | 3300050511 | Bacteria | 3138 |
| 981 | nmdc:mga0n895_318543_c1 | 3300050512 | Bacteria | 1576 |
| 982 | nmdc:mga0n895_405695_c1 | 3300050512 | Unclassified | 1378 |
| 983 | nmdc:mga0n895_546683_c1 | 3300050512 | Bacteria | 1164 |
| 984 | nmdc:mga0n895_867412_c1 | 3300050512 | Bacteria | 890 |
| 985 | nmdc:mga0rr50_23013_c1 | 3300050513 | Bacteria | 4287 |
| 986 | nmdc:mga0rr50_277418_c1 | 3300050513 | Bacteria | 1398 |
| 987 | nmdc:mga0rr50_405662_c1 | 3300050513 | Bacteria | 1152 |
| 988 | nmdc:mga08x19_10096_c1 | 3300050514 | Bacteria | 5664 |
| 989 | nmdc:mga08x19_101960_c1 | 3300050514 | Bacteria | 1905 |
| 990 | nmdc:mga08x19_107610_c1 | 3300050514 | Unclassified | 1856 |
| 991 | nmdc:mga08x19_18051_c1 | 3300050514 | Bacteria | 4323 |
| 992 | nmdc:mga0a205_218639_c1 | 3300050515 | Bacteria | 1792 |
| 993 | nmdc:mga0a205_63371_c1 | 3300050515 | Bacteria | 3571 |
| 994 | nmdc:mga0a205_670946_c1 | 3300050515 | Bacteria | 887 |
| 995 | nmdc:mga0a205_72213_c1 | 3300050515 | Bacteria | 3334 |
| 996 | nmdc:mga0a205_829624_c1 | 3300050515 | Unclassified | 772 |
| 997 | Ga0495601_0017230 | 3300053077 | Bacteria | 4385 |
| 998 | Ga0495601_0142788 | 3300053077 | Bacteria | 1562 |
| 999 | Ga0495601_0355100 | 3300053077 | Unclassified | 953 |
| 1000 | Ga0500588_0170093 | 3300053146 | Bacteria | 797 |
| 1001 | Ga0500590_176738 | 3300053148 | Bacteria | 932 |
| 1002 | Ga0501084_0127183 | 3300054114 | Bacteria | 2145 |
| 1003 | Ga0501084_0508330 | 3300054114 | Bacteria | 1018 |
| 1004 | Ga0587066_022077 | 3300059490 | Bacteria | 1061 |
| 1005 | Ga0587070_091793 | 3300059491 | Unclassified | 684 |
| 1006 | Ga0587073_0133613 | 3300059492 | Unclassified | 684 |
| 1007 | Ga0587083_0127223 | 3300059505 | Unclassified | 665 |
| 1008 | Ga0587085_078525 | 3300059506 | Unclassified | 660 |
| 1009 | Ga0587088_063155 | 3300059508 | Unclassified | 755 |
| 1010 | Ga0587090_051561 | 3300059510 | Unclassified | 755 |
| 1011 | Ga0587091_103118 | 3300059511 | Unclassified | 672 |
| 1012 | Ga0587094_054531 | 3300059513 | Unclassified | 685 |
| 1013 | Ga0587113_022974 | 3300059625 | Unclassified | 668 |
| 1014 | Ga0587128_070954 | 3300059630 | Unclassified | 678 |
| 1015 | Ga0587128_089401 | 3300059630 | Unclassified | 629 |
| 1016 | Ga0587067_095536 | 3300059640 | Unclassified | 680 |
| 1017 | Ga0587068_099442 | 3300059641 | Unclassified | 609 |
| 1018 | Ga0587076_094883 | 3300059645 | Bacteria | 658 |
| 1019 | Ga0587078_032194 | 3300059646 | Unclassified | 711 |
| 1020 | Ga0587114_052490 | 3300059655 | Unclassified | 694 |
| 1021 | Ga0501082_0779620 | 3300060353 | Unclassified | 836 |
| 1022 | Ga0501082_0840708 | 3300060353 | Bacteria | 803 |
| 1023 | Ga0466962_0113791 | 3300061719 | Bacteria | 1303 |
| 1024 | Ga0530510_0045990 | 3300061734 | Bacteria | 3154 |
| 1025 | Ga0530510_0343135 | 3300061734 | Bacteria | 1121 |
| 1026 | Ga0530510_0694816 | 3300061734 | Bacteria | 775 |
| 1027 | Ga0070709_10702105 | |||
| 1028 | MRS1b_contig_3743146 | |||
| 1029 | MRS1b_contig_4719877 | |||
| 1030 | MBSR1b_contig_376918 | |||
| 1031 | LJNas_1000022 | |||
| 1032 | rootL2_10303851 | |||
| 1033 | rootH1_10335305 | |||
| 1034 | Ga0058859_11454794 | |||
| 1035 | Ga0058863_11867713 | |||
| 1036 | Ga0058863_11966271 | |||
| 1037 | Ga0058861_10061650 | |||
| 1038 | Ga0058860_11825380 | |||
| 1039 | Ga0058862_12739121 | |||
| 1040 | Ga0065704_10171747 | |||
| 1041 | Ga0065712_10098164 | |||
| 1042 | Ga0065712_10558904 | |||
| 1043 | Ga0065715_10040951 | |||
| 1044 | Ga0065707_10159589 | |||
| 1045 | Ga0070658_10293117 | |||
| 1046 | Ga0070676_10395109 | |||
| 1047 | Ga0070683_100011670 | |||
| 1048 | Ga0070683_100076106 | |||
| 1049 | Ga0070683_100140291 | |||
| 1050 | Ga0070683_100662715 | |||
| 1051 | Ga0070690_100766569 | |||
| 1052 | Ga0070670_100024685 | |||
| 1053 | Ga0070670_101074019 | |||
| 1054 | Ga0068869_100001094 | |||
| 1055 | Ga0068869_100004860 | |||
| 1056 | Ga0068869_100083630 | |||
| 1057 | Ga0070666_10451809 | |||
| 1058 | Ga0070666_10508422 | |||
| 1059 | Ga0070680_100083264 | |||
| 1060 | Ga0070680_100107961 | |||
| 1061 | Ga0070680_100120414 | |||
| 1062 | Ga0070680_100214334 | |||
| 1063 | Ga0070680_100987537 | |||
| 1064 | Ga0068868_100001559 | |||
| 1065 | Ga0068868_100006728 | |||
| 1066 | Ga0068868_100008270 | |||
| 1067 | Ga0068868_100068976 | |||
| 1068 | Ga0068868_101271065 | |||
| 1069 | Ga0070660_100286934 | |||
| 1070 | Ga0070689_100008073 | |||
| 1071 | Ga0070689_100011858 | |||
| 1072 | Ga0070691_10189837 | |||
| 1073 | Ga0070687_100013069 | |||
| 1074 | Ga0070687_100111448 | |||
| 1075 | Ga0070661_100199992 | |||
| 1076 | Ga0070692_10059706 | |||
| 1077 | Ga0070668_100139362 | |||
| 1078 | Ga0070668_101136287 | |||
| 1079 | Ga0070669_100250282 | |||
| 1080 | Ga0070669_100568879 | |||
| 1081 | Ga0070669_100926776 | |||
| 1082 | Ga0070675_100166546 | |||
| 1083 | Ga0070675_100192372 | |||
| 1084 | Ga0070671_100318248 | |||
| 1085 | Ga0070671_100351039 | |||
| 1086 | Ga0070673_100079167 | |||
| 1087 | Ga0070673_100150532 | |||
| 1088 | Ga0070688_100089161 | |||
| 1089 | Ga0070688_100486479 | |||
| 1090 | Ga0070659_100249007 | |||
| 1091 | Ga0070667_100440812 | |||
| 1092 | Ga0070667_100495438 | |||
| 1093 | Ga0070709_10132896 | |||
| 1094 | Ga0070709_10171665 | |||
| 1095 | Ga0070709_10321213 | |||
| 1096 | Ga0070709_11073338 | |||
| 1097 | Ga0070714_100005380 | |||
| 1098 | Ga0070714_100019795 | |||
| 1099 | Ga0070714_100117417 | |||
| 1100 | Ga0070714_100200088 | |||
| 1101 | Ga0070714_100324997 | |||
| 1102 | Ga0070714_100415969 | |||
| 1103 | Ga0070713_100000460 | |||
| 1104 | Ga0070713_100041420 | |||
| 1105 | Ga0070713_100042459 | |||
| 1106 | Ga0070713_100111171 | |||
| 1107 | Ga0070713_100185078 | |||
| 1108 | Ga0070713_100342865 | |||
| 1109 | Ga0070713_100356650 | |||
| 1110 | Ga0070713_100469068 | |||
| 1111 | Ga0070713_100680935 | |||
| 1112 | Ga0070710_10044792 | |||
| 1113 | Ga0070710_10135353 | |||
| 1114 | Ga0070710_10163999 | |||
| 1115 | Ga0070710_10180310 | |||
| 1116 | Ga0070701_10012483 | |||
| 1117 | Ga0070711_100000656 | |||
| 1118 | Ga0070711_100013246 | |||
| 1119 | Ga0070711_100085734 | |||
| 1120 | Ga0070711_100191559 | |||
| 1121 | Ga0070711_100197507 | |||
| 1122 | Ga0070711_100351292 | |||
| 1123 | Ga0070711_101179825 | |||
| 1124 | Ga0070705_100066046 | |||
| 1125 | Ga0070705_100167949 | |||
| 1126 | Ga0070700_100025428 | |||
| 1127 | Ga0070694_100025427 | |||
| 1128 | Ga0070694_100150788 | |||
| 1129 | Ga0070694_100174306 | |||
| 1130 | Ga0070694_100495132 | |||
| 1131 | Ga0070708_100001918 | |||
| 1132 | Ga0070708_100002306 | |||
| 1133 | Ga0070708_100008762 | |||
| 1134 | Ga0070708_100019770 | |||
| 1135 | Ga0070708_100061160 | |||
| 1136 | Ga0070708_100469920 | |||
| 1137 | Ga0070708_100471199 | |||
| 1138 | Ga0070708_100535594 | |||
| 1139 | Ga0070663_100032244 | |||
| 1140 | Ga0070663_100136037 | |||
| 1141 | Ga0070678_100006161 | |||
| 1142 | Ga0070678_100517427 | |||
| 1143 | Ga0070662_100115609 | |||
| 1144 | Ga0070662_100508637 | |||
| 1145 | Ga0070662_100556797 | |||
| 1146 | Ga0070662_100688452 | |||
| 1147 | Ga0070681_10000242 | |||
| 1148 | Ga0070681_10087482 | |||
| 1149 | Ga0070681_10139074 | |||
| 1150 | Ga0070681_10165112 | |||
| 1151 | Ga0070681_10171172 | |||
| 1152 | Ga0070681_10562788 | |||
| 1153 | Ga0070681_10802521 | |||
| 1154 | Ga0068867_100008371 | |||
| 1155 | Ga0068867_100167497 | |||
| 1156 | Ga0070685_10024826 | |||
| 1157 | Ga0070685_10029052 | |||
| 1158 | Ga0070706_100008661 | |||
| 1159 | Ga0070706_100019421 | |||
| 1160 | Ga0070706_100020092 | |||
| 1161 | Ga0070706_100060134 | |||
| 1162 | Ga0070706_100088518 | |||
| 1163 | Ga0070706_100193011 | |||
| 1164 | Ga0070706_100267843 | |||
| 1165 | Ga0070707_100003999 | |||
| 1166 | Ga0070707_100008148 | |||
| 1167 | Ga0070707_100015413 | |||
| 1168 | Ga0070707_100021880 | |||
| 1169 | Ga0070707_100031054 | |||
| 1170 | Ga0070707_100051410 | |||
| 1171 | Ga0070707_100075803 | |||
| 1172 | Ga0070707_100129018 | |||
| 1173 | Ga0070707_100148170 | |||
| 1174 | Ga0070707_100696610 | |||
| 1175 | Ga0070698_100000182 | |||
| 1176 | Ga0070698_100001098 | |||
| 1177 | Ga0070698_100010878 | |||
| 1178 | Ga0070698_100011307 | |||
| 1179 | Ga0070698_100116352 | |||
| 1180 | Ga0070698_100252375 | |||
| 1181 | Ga0070698_100716924 | |||
| 1182 | Ga0070698_100813766 | |||
| 1183 | Ga0070698_100956638 | |||
| 1184 | Ga0070699_100002044 | |||
| 1185 | Ga0070699_100003968 | |||
| 1186 | Ga0070699_100007000 | |||
| 1187 | Ga0070699_100036337 | |||
| 1188 | Ga0070699_100094700 | |||
| 1189 | Ga0070699_100454251 | |||
| 1190 | Ga0070699_100472375 | |||
| 1191 | Ga0070699_101339404 | |||
| 1192 | Ga0070679_100016723 | |||
| 1193 | Ga0070679_100029648 | |||
| 1194 | Ga0070679_100060877 | |||
| 1195 | Ga0070679_100106030 | |||
| 1196 | Ga0070679_100519375 | |||
| 1197 | Ga0070684_100083051 | |||
| 1198 | Ga0070684_100480673 | |||
| 1199 | Ga0070697_100000045 | |||
| 1200 | Ga0070697_100003087 | |||
| 1201 | Ga0070697_100006105 | |||
| 1202 | Ga0070697_100007161 | |||
| 1203 | Ga0070697_100008121 | |||
| 1204 | Ga0070697_100012774 | |||
| 1205 | Ga0070697_100045258 | |||
| 1206 | Ga0070697_100217099 | |||
| 1207 | Ga0070697_100309586 | |||
| 1208 | Ga0070697_100564365 | |||
| 1209 | Ga0068853_100018922 | |||
| 1210 | Ga0068853_100190406 | |||
| 1211 | Ga0068853_100209777 | |||
| 1212 | Ga0068853_100502772 | |||
| 1213 | Ga0070672_100005147 | |||
| 1214 | Ga0070672_100063481 | |||
| 1215 | Ga0070686_100413406 | |||
| 1216 | Ga0070686_100447109 | |||
| 1217 | Ga0070695_100008702 | |||
| 1218 | Ga0070695_100157767 | |||
| 1219 | Ga0070696_100300129 | |||
| 1220 | Ga0070693_100968378 | |||
| 1221 | Ga0070704_100007901 | |||
| 1222 | Ga0070704_100034509 | |||
| 1223 | Ga0070704_100050303 | |||
| 1224 | Ga0070704_100179979 | |||
| 1225 | Ga0070704_100187540 | |||
| 1226 | Ga0070704_100224288 | |||
| 1227 | Ga0070704_100470105 | |||
| 1228 | Ga0070704_100479902 | |||
| 1229 | Ga0070704_100813382 | |||
| 1230 | Ga0068855_100000722 | |||
| 1231 | Ga0068855_100012781 | |||
| 1232 | Ga0068855_100059377 | |||
| 1233 | Ga0068855_100078538 | |||
| 1234 | Ga0068855_100162078 | |||
| 1235 | Ga0068855_100792601 | |||
| 1236 | Ga0070664_100002060 | |||
| 1237 | Ga0070664_100057431 | |||
| 1238 | Ga0070664_100060588 | |||
| 1239 | Ga0068857_100005616 | |||
| 1240 | Ga0068857_100006773 | |||
| 1241 | Ga0068857_100162149 | |||
| 1242 | Ga0068857_100162791 | |||
| 1243 | Ga0068857_100226896 | |||
| 1244 | Ga0068857_100504760 | |||
| 1245 | Ga0068854_100007803 | |||
| 1246 | Ga0068854_100008281 | |||
| 1247 | Ga0068854_100012746 | |||
| 1248 | Ga0068854_100039098 | |||
| 1249 | Ga0068854_100281380 | |||
| 1250 | Ga0068854_100461935 | |||
| 1251 | Ga0068856_100000893 | |||
| 1252 | Ga0068856_100001601 | |||
| 1253 | Ga0068856_100010172 | |||
| 1254 | Ga0068856_100025934 | |||
| 1255 | Ga0068856_100140369 | |||
| 1256 | Ga0068856_100274670 | |||
| 1257 | Ga0068856_100321255 | |||
| 1258 | Ga0068856_100569109 | |||
| 1259 | Ga0068852_100061504 | |||
| 1260 | Ga0068852_100166419 | |||
| 1261 | Ga0068859_100001851 | |||
| 1262 | Ga0068859_100003598 | |||
| 1263 | Ga0068859_100008916 | |||
| 1264 | Ga0068859_100012850 | |||
| 1265 | Ga0068859_100328245 | |||
| 1266 | Ga0068859_101308894 | |||
| 1267 | Ga0068864_100007801 | |||
| 1268 | Ga0068864_100146501 | |||
| 1269 | Ga0068864_100171899 | |||
| 1270 | Ga0068864_100693499 | |||
| 1271 | Ga0068864_100954342 | |||
| 1272 | Ga0068861_100035120 | |||
| 1273 | Ga0068861_100168998 | |||
| 1274 | Ga0068851_10018899 | |||
| 1275 | Ga0068870_10040462 | |||
| 1276 | Ga0068870_10071433 | |||
| 1277 | Ga0068870_10385212 | |||
| 1278 | Ga0068863_100017333 | |||
| 1279 | Ga0068863_100027438 | |||
| 1280 | Ga0068863_100037911 | |||
| 1281 | Ga0068863_100091673 | |||
| 1282 | Ga0068863_100094527 | |||
| 1283 | Ga0068863_100541306 | |||
| 1284 | Ga0068858_100001080 | |||
| 1285 | Ga0068858_100001918 | |||
| 1286 | Ga0068858_100024884 | |||
| 1287 | Ga0068858_100038794 | |||
| 1288 | Ga0068858_100096333 | |||
| 1289 | Ga0068858_100272306 | |||
| 1290 | Ga0068860_100039593 | |||
| 1291 | Ga0068860_100063271 | |||
| 1292 | Ga0068860_100089107 | |||
| 1293 | Ga0068860_100148545 | |||
| 1294 | Ga0068860_100178131 | |||
| 1295 | Ga0068860_100288257 | |||
| 1296 | Ga0068860_100358033 | |||
| 1297 | Ga0068860_100518184 | |||
| 1298 | Ga0068862_100126415 | |||
| 1299 | Ga0068862_100344383 | |||
| 1300 | Ga0068862_100694919 | |||
| 1301 | Ga0081455_10162099 | |||
| 1302 | Ga0081540_1051473 | |||
| 1303 | Ga0070717_10001125 | |||
| 1304 | Ga0070717_10014637 | |||
| 1305 | Ga0070717_10025999 | |||
| 1306 | Ga0070717_10037812 | |||
| 1307 | Ga0070717_10070833 | |||
| 1308 | Ga0070717_10108607 | |||
| 1309 | Ga0070717_10171078 | |||
| 1310 | Ga0070717_10220687 | |||
| 1311 | Ga0070717_10314866 | |||
| 1312 | Ga0070717_10436755 | |||
| 1313 | Ga0075365_10026433 | |||
| 1314 | Ga0075365_10068707 | |||
| 1315 | Ga0075368_10087693 | |||
| 1316 | Ga0075363_100050938 | |||
| 1317 | Ga0075364_10097475 | |||
| 1318 | Ga0075364_10227900 | |||
| 1319 | Ga0070715_10075192 | |||
| 1320 | Ga0070715_10337078 | |||
| 1321 | Ga0070716_100020885 | |||
| 1322 | Ga0070716_100023415 | |||
| 1323 | Ga0070716_100067732 | |||
| 1324 | Ga0070716_100193397 | |||
| 1325 | Ga0070716_100216756 | |||
| 1326 | Ga0070716_100302612 | |||
| 1327 | Ga0070716_100671693 | |||
| 1328 | Ga0070712_100000117 | |||
| 1329 | Ga0070712_100001433 | |||
| 1330 | Ga0070712_100060003 | |||
| 1331 | Ga0070712_100085354 | |||
| 1332 | Ga0070712_100192019 | |||
| 1333 | Ga0070712_100216154 | |||
| 1334 | Ga0075362_10000281 | |||
| 1335 | Ga0075362_10317791 | |||
| 1336 | Ga0075367_10021802 | |||
| 1337 | Ga0075367_10034626 | |||
| 1338 | Ga0075366_10000367 | |||
| 1339 | Ga0097621_100000058 | |||
| 1340 | Ga0097621_100000214 | |||
| 1341 | Ga0097621_100002700 | |||
| 1342 | Ga0097621_100096277 | |||
| 1343 | Ga0097621_100112189 | |||
| 1344 | Ga0097621_100154053 | |||
| 1345 | Ga0068871_100000167 | |||
| 1346 | Ga0068871_100001129 | |||
| 1347 | Ga0068871_100033834 | |||
| 1348 | Ga0068871_100094064 | |||
| 1349 | Ga0068871_100232613 | |||
| 1350 | Ga0068871_100500600 | |||
| 1351 | Ga0075428_100041624 | |||
| 1352 | Ga0075428_100177918 | |||
| 1353 | Ga0075428_100460585 | |||
| 1354 | Ga0075430_100038683 | |||
| 1355 | Ga0075430_100048471 | |||
| 1356 | Ga0075430_100697451 | |||
| 1357 | Ga0075431_100000068 | |||
| 1358 | Ga0075431_100269302 | |||
| 1359 | Ga0075431_100434565 | |||
| 1360 | Ga0075431_100512925 | |||
| 1361 | Ga0075431_100715897 | |||
| 1362 | Ga0075431_100744691 | |||
| 1363 | Ga0075431_100810987 | |||
| 1364 | Ga0075433_10022035 | |||
| 1365 | Ga0075433_10074838 | |||
| 1366 | Ga0075433_10100418 | |||
| 1367 | Ga0075433_10147954 | |||
| 1368 | Ga0075433_10921779 | |||
| 1369 | Ga0075433_10975567 | |||
| 1370 | Ga0075434_100011129 | |||
| 1371 | Ga0075434_100078897 | |||
| 1372 | Ga0075434_100139032 | |||
| 1373 | Ga0075434_100294114 | |||
| 1374 | Ga0075434_100535245 | |||
| 1375 | Ga0075429_100000340 | |||
| 1376 | Ga0075429_100030110 | |||
| 1377 | Ga0075429_100160664 | |||
| 1378 | Ga0068865_100293594 | |||
| 1379 | Ga0075436_100012092 | |||
| 1380 | Ga0075436_100094035 | |||
| 1381 | Ga0075436_100129329 | |||
| 1382 | Ga0075436_100304465 | |||
| 1383 | Ga0097620_100001850 | |||
| 1384 | Ga0097620_100003598 | |||
| 1385 | Ga0097620_100008916 | |||
| 1386 | Ga0097620_100012850 | |||
| 1387 | Ga0097620_100328225 | |||
| 1388 | Ga0097620_101309049 | |||
| 1389 | Ga0075435_100026673 | |||
| 1390 | Ga0075435_100066652 | |||
| 1391 | Ga0099794_10195183 | |||
| 1392 | Ga0099795_10106782 | |||
| 1393 | Ga0105240_10076862 | |||
| 1394 | Ga0105240_10115522 | |||
| 1395 | Ga0105240_10156926 | |||
| 1396 | Ga0111539_10000594 | |||
| 1397 | Ga0111539_10051539 | |||
| 1398 | Ga0111539_10209694 | |||
| 1399 | Ga0111539_12166290 | |||
| 1400 | Ga0105245_10008717 | |||
| 1401 | Ga0105245_10277975 | |||
| 1402 | Ga0105245_11158046 | |||
| 1403 | Ga0105247_10131199 | |||
| 1404 | Ga0105247_10277664 | |||
| 1405 | Ga0114129_10001988 | |||
| 1406 | Ga0114129_10043115 | |||
| 1407 | Ga0114129_10102611 | |||
| 1408 | Ga0114129_10116598 | |||
| 1409 | Ga0114129_10126576 | |||
| 1410 | Ga0114129_10137126 | |||
| 1411 | Ga0114129_10499207 | |||
| 1412 | Ga0114129_10957685 | |||
| 1413 | Ga0105243_10087448 | |||
| 1414 | Ga0105243_11438335 | |||
| 1415 | Ga0105241_10029168 | |||
| 1416 | Ga0105241_10042322 | |||
| 1417 | Ga0105241_10126627 | |||
| 1418 | Ga0105241_10316689 | |||
| 1419 | Ga0105241_10461648 | |||
| 1420 | Ga0105242_10013831 | |||
| 1421 | Ga0105242_10132852 | |||
| 1422 | Ga0105242_10572270 | |||
| 1423 | Ga0105242_10743336 | |||
| 1424 | Ga0105242_10809000 | |||
| 1425 | Ga0105248_10014941 | |||
| 1426 | Ga0105248_10069290 | |||
| 1427 | Ga0105248_10082685 | |||
| 1428 | Ga0105248_10089677 | |||
| 1429 | Ga0105248_10091875 | |||
| 1430 | Ga0105248_10173639 | |||
| 1431 | Ga0105248_10258773 | |||
| 1432 | Ga0105248_10519462 | |||
| 1433 | Ga0105237_10040678 | |||
| 1434 | Ga0105237_10191521 | |||
| 1435 | Ga0105237_10417674 | |||
| 1436 | Ga0105237_10733999 | |||
| 1437 | Ga0105238_10006322 | |||
| 1438 | Ga0105238_11352553 | |||
| 1439 | Ga0105249_10420134 | |||
| 1440 | Ga0105239_10007920 | |||
| 1441 | Ga0105239_10044315 | |||
| 1442 | Ga0105239_10233069 | |||
| 1443 | Ga0105239_10543099 | |||
| 1444 | Ga0105246_10091183 | |||
| 1445 | Ga0157373_10043823 | |||
| 1446 | Ga0157371_10037588 | |||
| 1447 | Ga0157370_10181120 | |||
| 1448 | Ga0157369_10000592 | |||
| 1449 | Ga0157369_10000794 | |||
| 1450 | Ga0157369_10079290 | |||
| 1451 | Ga0157369_10654845 | |||
| 1452 | Ga0157369_10806255 | |||
| 1453 | Ga0157369_10882658 | |||
| 1454 | Ga0157374_10000181 | |||
| 1455 | Ga0157374_10145719 | |||
| 1456 | Ga0157374_10155817 | |||
| 1457 | Ga0157374_10939060 | |||
| 1458 | Ga0157378_10000429 | |||
| 1459 | Ga0157378_10000680 | |||
| 1460 | Ga0157378_10002074 | |||
| 1461 | Ga0157378_10005249 | |||
| 1462 | Ga0157378_10063848 | |||
| 1463 | Ga0157378_10110691 | |||
| 1464 | Ga0157378_10145631 | |||
| 1465 | Ga0163162_10126222 | |||
| 1466 | Ga0163162_10157427 | |||
| 1467 | Ga0163162_10202660 | |||
| 1468 | Ga0163162_10244102 | |||
| 1469 | Ga0163162_10520870 | |||
| 1470 | Ga0163162_10577872 | |||
| 1471 | Ga0157372_10001790 | |||
| 1472 | Ga0157372_10004416 | |||
| 1473 | Ga0157372_10005439 | |||
| 1474 | Ga0157372_10039482 | |||
| 1475 | Ga0157372_10046271 | |||
| 1476 | Ga0157372_10314946 | |||
| 1477 | Ga0157372_10849705 | |||
| 1478 | Ga0157372_11086871 | |||
| 1479 | Ga0157372_11108930 | |||
| 1480 | Ga0157375_10045058 | |||
| 1481 | Ga0157375_10159235 | |||
| 1482 | Ga0157375_10188103 | |||
| 1483 | Ga0157375_10692285 | |||
| 1484 | Ga0157375_11327355 | |||
| 1485 | Ga0163163_10007167 | |||
| 1486 | Ga0163163_10200487 | |||
| 1487 | Ga0163163_10522474 | |||
| 1488 | Ga0157380_10004649 | |||
| 1489 | Ga0157380_10075487 | |||
| 1490 | Ga0157380_10938989 | |||
| 1491 | Ga0182008_10021755 | |||
| 1492 | Ga0157377_10080770 | |||
| 1493 | Ga0157377_10081733 | |||
| 1494 | Ga0157379_10005240 | |||
| 1495 | Ga0157379_10107467 | |||
| 1496 | Ga0157379_10395246 | |||
| 1497 | Ga0157376_10017528 | |||
| 1498 | Ga0157376_10084529 | |||
| 1499 | Ga0157376_10085534 | |||
| 1500 | Ga0182007_10031543 | |||
| 1501 | Ga0182005_1029456 | |||
| 1502 | Ga0163161_10031147 | |||
| 1503 | Ga0184601_125905 | |||
| 1504 | Ga0184600_138855 | |||
| 1505 | Ga0184603_148376 | |||
| 1506 | Ga0206356_10627380 | |||
| 1507 | Ga0206356_10816522 | |||
| 1508 | Ga0206349_1885320 | |||
| 1509 | Ga0206355_1123533 | |||
| 1510 | Ga0206352_10589987 | |||
| 1511 | Ga0206352_10614394 | |||
| 1512 | Ga0206350_10869449 | |||
| 1513 | Ga0206354_10872379 | |||
| 1514 | Ga0206353_11757009 | |||
| 1515 | Ga0213876_10038282 | |||
| 1516 | Ga0224712_10150682 | |||
| 1517 | Ga0224712_10308664 | |||
| 1518 | Ga0224570_100361 | |||
| 1519 | Ga0247553_109522 | |||
| 1520 | Ga0228600_1003986 | |||
| 1521 | Ga0224572_1004119 | |||
| 1522 | Ga0224572_1010950 | |||
| 1523 | Ga0224572_1016643 | |||
| 1524 | Ga0224572_1020018 | |||
| 1525 | Ga0224572_1020278 | |||
| 1526 | Ga0228598_1008363 | |||
| 1527 | Ga0228598_1009848 | |||
| 1528 | Ga0207656_10035109 | |||
| 1529 | Ga0207653_10042422 | |||
| 1530 | Ga0207692_10027459 | |||
| 1531 | Ga0207692_10241923 | |||
| 1532 | Ga0207642_10256328 | |||
| 1533 | Ga0207688_10176572 | |||
| 1534 | Ga0207680_10205149 | |||
| 1535 | Ga0207680_10218296 | |||
| 1536 | Ga0207647_10002148 | |||
| 1537 | Ga0207647_10005640 | |||
| 1538 | Ga0207647_10456588 | |||
| 1539 | Ga0207685_10040547 | |||
| 1540 | Ga0207699_10049464 | |||
| 1541 | Ga0207699_10074388 | |||
| 1542 | Ga0207699_10323092 | |||
| 1543 | Ga0207699_10350058 | |||
| 1544 | Ga0207699_10355958 | |||
| 1545 | Ga0207699_10388545 | |||
| 1546 | Ga0207699_10571628 | |||
| 1547 | Ga0207699_10864199 | |||
| 1548 | Ga0207643_10048132 | |||
| 1549 | Ga0207643_10268506 | |||
| 1550 | Ga0207684_10000081 | |||
| 1551 | Ga0207684_10001840 | |||
| 1552 | Ga0207684_10009103 | |||
| 1553 | Ga0207684_10031814 | |||
| 1554 | Ga0207684_10384666 | |||
| 1555 | Ga0207684_10677768 | |||
| 1556 | Ga0207654_10114778 | |||
| 1557 | Ga0207654_10814068 | |||
| 1558 | Ga0207707_10001674 | |||
| 1559 | Ga0207707_10075858 | |||
| 1560 | Ga0207707_10097311 | |||
| 1561 | Ga0207707_10130031 | |||
| 1562 | Ga0207707_10448517 | |||
| 1563 | Ga0207695_10057707 | |||
| 1564 | Ga0207695_10153914 | |||
| 1565 | Ga0207695_10174828 | |||
| 1566 | Ga0207695_10265838 | |||
| 1567 | Ga0207671_10205819 | |||
| 1568 | Ga0207671_10255870 | |||
| 1569 | Ga0207693_10000158 | |||
| 1570 | Ga0207693_10034140 | |||
| 1571 | Ga0207693_10064231 | |||
| 1572 | Ga0207693_10147713 | |||
| 1573 | Ga0207663_10000394 | |||
| 1574 | Ga0207663_10032188 | |||
| 1575 | Ga0207663_10078668 | |||
| 1576 | Ga0207663_10342332 | |||
| 1577 | Ga0207660_10278503 | |||
| 1578 | Ga0207660_10320270 | |||
| 1579 | Ga0207662_10037374 | |||
| 1580 | Ga0207662_10053551 | |||
| 1581 | Ga0207657_10015325 | |||
| 1582 | Ga0207657_10294081 | |||
| 1583 | Ga0207649_10073936 | |||
| 1584 | Ga0207652_10012797 | |||
| 1585 | Ga0207652_10146437 | |||
| 1586 | Ga0207652_10294892 | |||
| 1587 | Ga0207652_10452483 | |||
| 1588 | Ga0207652_10703205 | |||
| 1589 | Ga0207652_10860311 | |||
| 1590 | Ga0207646_10005419 | |||
| 1591 | Ga0207646_10006067 | |||
| 1592 | Ga0207646_10007260 | |||
| 1593 | Ga0207646_10012725 | |||
| 1594 | Ga0207646_10027006 | |||
| 1595 | Ga0207646_10029369 | |||
| 1596 | Ga0207646_10061824 | |||
| 1597 | Ga0207646_10329529 | |||
| 1598 | Ga0207681_10124784 | |||
| 1599 | Ga0207681_10654007 | |||
| 1600 | Ga0207694_10019688 | |||
| 1601 | Ga0207694_10168890 | |||
| 1602 | Ga0207694_10276720 | |||
| 1603 | Ga0207650_10040781 | |||
| 1604 | Ga0207659_10049386 | |||
| 1605 | Ga0207687_10262754 | |||
| 1606 | Ga0207700_10000129 | |||
| 1607 | Ga0207700_10042548 | |||
| 1608 | Ga0207700_10070767 | |||
| 1609 | Ga0207700_10103724 | |||
| 1610 | Ga0207700_10104341 | |||
| 1611 | Ga0207700_10134610 | |||
| 1612 | Ga0207700_10159435 | |||
| 1613 | Ga0207700_10164803 | |||
| 1614 | Ga0207700_10190305 | |||
| 1615 | Ga0207700_10485981 | |||
| 1616 | Ga0207700_10692195 | |||
| 1617 | Ga0207700_10730549 | |||
| 1618 | Ga0207664_10000284 | |||
| 1619 | Ga0207664_10005601 | |||
| 1620 | Ga0207664_10079142 | |||
| 1621 | Ga0207664_10095160 | |||
| 1622 | Ga0207664_10176736 | |||
| 1623 | Ga0207664_10179871 | |||
| 1624 | Ga0207664_10352848 | |||
| 1625 | Ga0207664_10360630 | |||
| 1626 | Ga0207664_10416860 | |||
| 1627 | Ga0207664_10485638 | |||
| 1628 | Ga0207690_10154126 | |||
| 1629 | Ga0207690_10179007 | |||
| 1630 | Ga0207690_10561174 | |||
| 1631 | Ga0207706_10095400 | |||
| 1632 | Ga0207706_10224285 | |||
| 1633 | Ga0207706_10421886 | |||
| 1634 | Ga0207706_10568231 | |||
| 1635 | Ga0207686_10175518 | |||
| 1636 | Ga0207686_10578883 | |||
| 1637 | Ga0207709_10013097 | |||
| 1638 | Ga0207709_10921136 | |||
| 1639 | Ga0207670_10060699 | |||
| 1640 | Ga0207670_10093078 | |||
| 1641 | Ga0207670_10100911 | |||
| 1642 | Ga0207670_10329914 | |||
| 1643 | Ga0207669_10071781 | |||
| 1644 | Ga0207704_10024694 | |||
| 1645 | Ga0207704_10118716 | |||
| 1646 | Ga0207704_10252014 | |||
| 1647 | Ga0207665_10001257 | |||
| 1648 | Ga0207665_10015257 | |||
| 1649 | Ga0207665_10069495 | |||
| 1650 | Ga0207665_10270620 | |||
| 1651 | Ga0207665_10341024 | |||
| 1652 | Ga0207665_10611546 | |||
| 1653 | Ga0207691_10002633 | |||
| 1654 | Ga0207691_10071410 | |||
| 1655 | Ga0207711_10011482 | |||
| 1656 | Ga0207711_10107485 | |||
| 1657 | Ga0207711_10167404 | |||
| 1658 | Ga0207711_10313318 | |||
| 1659 | Ga0207711_10321193 | |||
| 1660 | Ga0207711_10515005 | |||
| 1661 | Ga0207711_10742413 | |||
| 1662 | Ga0207689_10006279 | |||
| 1663 | Ga0207689_10007004 | |||
| 1664 | Ga0207689_10021498 | |||
| 1665 | Ga0207689_10374078 | |||
| 1666 | Ga0207689_10405171 | |||
| 1667 | Ga0207661_10008597 | |||
| 1668 | Ga0207661_10018914 | |||
| 1669 | Ga0207661_10461724 | |||
| 1670 | Ga0207667_10001950 | |||
| 1671 | Ga0207667_10007869 | |||
| 1672 | Ga0207667_10315714 | |||
| 1673 | Ga0207667_10336764 | |||
| 1674 | Ga0207651_10006530 | |||
| 1675 | Ga0207651_10071608 | |||
| 1676 | Ga0207668_10477673 | |||
| 1677 | Ga0207640_10011254 | |||
| 1678 | Ga0207640_10016852 | |||
| 1679 | Ga0207640_10185949 | |||
| 1680 | Ga0207640_11077433 | |||
| 1681 | Ga0207658_10412664 | |||
| 1682 | Ga0207677_10010884 | |||
| 1683 | Ga0207677_10011184 | |||
| 1684 | Ga0207677_10011507 | |||
| 1685 | Ga0207703_10006387 | |||
| 1686 | Ga0207703_10017744 | |||
| 1687 | Ga0207703_10032365 | |||
| 1688 | Ga0207703_10126285 | |||
| 1689 | Ga0207639_10205272 | |||
| 1690 | Ga0207639_10226049 | |||
| 1691 | Ga0207639_10246600 | |||
| 1692 | Ga0207639_10636652 | |||
| 1693 | Ga0207639_11129248 | |||
| 1694 | Ga0207678_10022374 | |||
| 1695 | Ga0207678_10305917 | |||
| 1696 | Ga0207708_10019652 | |||
| 1697 | Ga0207708_10069636 | |||
| 1698 | Ga0207702_10000962 | |||
| 1699 | Ga0207702_10000989 | |||
| 1700 | Ga0207702_10007050 | |||
| 1701 | Ga0207702_10037565 | |||
| 1702 | Ga0207702_10788659 | |||
| 1703 | Ga0207641_10020452 | |||
| 1704 | Ga0207641_10044390 | |||
| 1705 | Ga0207641_10131116 | |||
| 1706 | Ga0207641_10141495 | |||
| 1707 | Ga0207641_10446599 | |||
| 1708 | Ga0207648_10000621 | |||
| 1709 | Ga0207648_10022238 | |||
| 1710 | Ga0207648_10120701 | |||
| 1711 | Ga0207676_10016801 | |||
| 1712 | Ga0207676_10077228 | |||
| 1713 | Ga0207676_10470759 | |||
| 1714 | Ga0207674_10000867 | |||
| 1715 | Ga0207674_10010008 | |||
| 1716 | Ga0207674_10134956 | |||
| 1717 | Ga0207674_10245849 | |||
| 1718 | Ga0207674_10314628 | |||
| 1719 | Ga0207674_11213828 | |||
| 1720 | Ga0207675_100018660 | |||
| 1721 | Ga0207683_10084756 | |||
| 1722 | Ga0207683_10547133 | |||
| 1723 | Ga0207698_10584979 | |||
| 1724 | Ga0207698_11052493 | |||
| 1725 | Ga0209588_1097025 | |||
| 1726 | Ga0209813_10040724 | |||
| 1727 | Ga0209813_10066202 | |||
| 1728 | Ga0207428_10000041 | |||
| 1729 | Ga0207428_10000275 | |||
| 1730 | Ga0207428_10058904 | |||
| 1731 | Ga0207428_10204447 | |||
| 1732 | Ga0265356_1000604 | |||
| 1733 | Ga0265356_1005173 | |||
| 1734 | Ga0268265_10042525 | |||
| 1735 | Ga0268265_10046839 | |||
| 1736 | Ga0268265_10243619 | |||
| 1737 | Ga0268265_10960392 | |||
| 1738 | Ga0268264_10118544 | |||
| 1739 | Ga0268264_10144353 | |||
| 1740 | Ga0268264_10238210 | |||
| 1741 | Ga0268264_10318059 | |||
| 1742 | Ga0265338_10010883 | |||
| 1743 | Ga0265338_10025739 | |||
| 1744 | Ga0265338_10106886 | |||
| 1745 | Ga0265338_10118254 | |||
| 1746 | Ga0265338_10247136 | |||
| 1747 | Ga0265338_10294286 | |||
| 1748 | Ga0265762_1000985 | |||
| 1749 | Ga0265762_1017137 | |||
| 1750 | Ga0265762_1035894 | |||
| 1751 | Ga0265762_1045518 | |||
| 1752 | Ga0265767_114267 | |||
| 1753 | Ga0265765_1001211 | |||
| 1754 | Ga0265764_105869 | |||
| 1755 | Ga0265761_104905 | |||
| 1756 | Ga0265761_109430 | |||
| 1757 | Ga0265761_109653 | |||
| 1758 | Ga0265771_1012144 | |||
| 1759 | Ga0265760_10000937 | |||
| 1760 | Ga0265760_10001736 | |||
| 1761 | Ga0265760_10009110 | |||
| 1762 | Ga0265760_10035082 | |||
| 1763 | Ga0265760_10035745 | |||
| 1764 | Ga0265760_10052458 | |||
| 1765 | Ga0265760_10100738 | |||
| 1766 | Ga0265328_10026747 | |||
| 1767 | Ga0265325_10006060 | |||
| 1768 | Ga0265329_10175700 | |||
| 1769 | Ga0265339_10008297 | |||
| 1770 | Ga0265339_10050165 | |||
| 1771 | Ga0265339_10075038 | |||
| 1772 | Ga0265316_10019366 | |||
| 1773 | Ga0265316_10153007 | |||
| 1774 | Ga0307408_100359352 | |||
| 1775 | Ga0265314_10026201 | |||
| 1776 | Ga0265314_10162857 | |||
| 1777 | Ga0265314_10202793 | |||
| 1778 | Ga0316576_10064560 | |||
| 1779 | Ga0316578_10061306 | |||
| 1780 | Ga0316577_10000601 | |||
| 1781 | Ga0316053_112410 | |||
| 1782 | Ga0316212_1021929 | |||
| 1783 | Ga0373926_0010630 | |||
| 1784 | Ga0373926_0045658 | |||
| 1785 | Ga0373928_0108807 | |||
| 1786 | Ga0373934_0085175 | |||
| 1787 | Ga0373923_0038046 | |||
| 1788 | Ga0373923_0053782 | |||
| 1789 | Ga0373923_0543593 | |||
| 1790 | Ga0373936_0007952 | |||
| 1791 | Ga0373936_0058037 | |||
| 1792 | Ga0373945_0001372 | |||
| 1793 | Ga0373945_0165827 | |||
| 1794 | Ga0373953_0012564 | |||
| 1795 | Ga0373954_0011546 | |||
| 1796 | Ga0373956_0302832 | |||
| 1797 | Ga0373943_0000120 | |||
| 1798 | Ga0373943_0045811 | |||
| 1799 | Ga0373946_0081654 | |||
| 1800 | Ga0373955_0510756 | |||
| 1801 | Ga0316574_0110316 | |||
| 1802 | Ga0316574_0164241 | |||
| 1803 | Ga0373924_0169766 | |||
| 1804 | Ga0373924_0186782 | |||
| 1805 | Ga0373931_0142443 | |||
| 1806 | Ga0373935_0000522 | |||
| 1807 | Ga0373935_0087515 | |||
| 1808 | Ga0373927_0000062 | |||
| 1809 | Ga0373927_0405003 | |||
| 1810 | Ga0373933_0085855 | |||
| 1811 | Ga0373933_0494220 | |||
| 1812 | Ga0373933_0526703 | |||
| 1813 | Ga0373947_0002314 | |||
| 1814 | Ga0373947_0050692 | |||
| 1815 | Ga0373947_0385304 | |||
| 1816 | Ga0373937_0053682 | |||
| 1817 | Ga0373937_0119810 | |||
| 1818 | Ga0373937_0200567 | |||
| 1819 | Ga0373937_0996617 | |||
| 1820 | Ga0373937_1099845 | |||
| 1821 | Ga0265778_043107 | |||
| 1822 | Ga0265778_051187 | |||
| 1823 | Ga0265778_053004 | |||
| 1824 | Ga0265778_053804 | |||
| 1825 | Ga0316582_0066874 | |||
| 1826 | Ga0316582_0200621 | |||
| 1827 | Ga0316584_0449160 | |||
| 1828 | Ga0373925_0039043 | |||
| 1829 | Ga0436365_0750672 | |||
| 1830 | Ga0436365_0901241 | |||
| 1831 | Ga0436365_0993814 | |||
| 1832 | Ga0453683_0193623 | |||
| 1833 | Ga0466966_0150104 | |||
| 1834 | Ga0466961_0137896 | |||
| 1835 | Ga0466961_0359016 | |||
| 1836 | Ga0466963_0047151 | |||
| 1837 | Ga0466964_0254808 | |||
| 1838 | Ga0466971_0076486 | |||
| 1839 | Ga0466957_0245495 | |||
| 1840 | Ga0466959_0114973 | |||
| 1841 | Ga0466959_0464586 | |||
| 1842 | Ga0466959_0685535 | |||
| 1843 | Ga0451576_0181316 | |||
| 1844 | Ga0451576_0267497 | |||
| 1845 | Ga0451576_0566645 | |||
| 1846 | Ga0451576_0750609 | |||
| 1847 | Ga0466958_0456214 | |||
| 1848 | Ga0466967_0005791 | |||
| 1849 | Ga0466967_0419735 | |||
| 1850 | Ga0495629_0005749 | |||
| 1851 | Ga0495651_0565337 | |||
| 1852 | Ga0495580_0009994 | |||
| 1853 | Ga0495580_0016836 | |||
| 1854 | Ga0495580_0042692 | |||
| 1855 | Ga0495580_0118118 | |||
| 1856 | Ga0495580_0183100 | |||
| 1857 | Ga0495580_0191137 | |||
| 1858 | Ga0495580_0374468 | |||
| 1859 | Ga0495582_0075957 | |||
| 1860 | Ga0495662_0368296 | |||
| 1861 | Ga0495664_0128957 | |||
| 1862 | Ga0495594_0041367 | |||
| 1863 | Ga0495628_0084490 | |||
| 1864 | Ga0495630_0386161 | |||
| 1865 | Ga0495665_0036666 | |||
| 1866 | Ga0495665_0324789 | |||
| 1867 | Ga0495640_0400585 | |||
| 1868 | Ga0495587_0076648 | |||
| 1869 | Ga0495621_0091896 | |||
| 1870 | Ga0495645_0157460 | |||
| 1871 | Ga0495667_0134397 | |||
| 1872 | Ga0495635_0157070 | |||
| 1873 | Ga0495635_0543856 | |||
| 1874 | Ga0495588_0522562 | |||
| 1875 | Ga0495657_0223993 | |||
| 1876 | Ga0495657_0357040 | |||
| 1877 | Ga0495599_0392878 | |||
| 1878 | Ga0495623_0038268 | |||
| 1879 | Ga0495623_0072214 | |||
| 1880 | Ga0495623_0151350 | |||
| 1881 | Ga0495623_0377821 | |||
| 1882 | Ga0495669_0123006 | |||
| 1883 | Ga0495624_0129430 | |||
| 1884 | Ga0495624_0161273 | |||
| 1885 | Ga0495600_0037963 | |||
| 1886 | Ga0495604_0192502 | |||
| 1887 | Ga0495674_0007407 | |||
| 1888 | Ga0495674_0352148 | |||
| 1889 | Ga0495674_0620847 | |||
| 1890 | Ga0495672_0000913 | |||
| 1891 | Ga0495680_0466195 | |||
| 1892 | Ga0495675_0148498 | |||
| 1893 | Ga0495675_0423458 | |||
| 1894 | Ga0495602_0126162 | |||
| 1895 | Ga0495602_0468993 | |||
| 1896 | Ga0495614_0159220 | |||
| 1897 | Ga0496100_0046426 | |||
| 1898 | Ga0496100_0474121 | |||
| 1899 | Ga0496101_0069925 | |||
| 1900 | Ga0496102_0002080 | |||
| 1901 | Ga0496102_0812085 | |||
| 1902 | Ga0496103_0036041 | |||
| 1903 | Ga0496103_0108811 | |||
| 1904 | Ga0496104_0023678 | |||
| 1905 | Ga0496104_0079480 | |||
| 1906 | Ga0496104_0120200 | |||
| 1907 | Ga0496104_0339199 | |||
| 1908 | Ga0496104_0427338 | |||
| 1909 | Ga0496105_0292993 | |||
| 1910 | Ga0496105_0531737 | |||
| 1911 | Ga0496105_0728469 | |||
| 1912 | Ga0496106_0061196 | |||
| 1913 | Ga0496106_0188037 | |||
| 1914 | Ga0496107_0169793 | |||
| 1915 | Ga0496108_0040547 | |||
| 1916 | Ga0496108_0266153 | |||
| 1917 | Ga0496109_1017819 | |||
| 1918 | Ga0496110_0113142 | |||
| 1919 | Ga0496111_0092455 | |||
| 1920 | Ga0496112_0001114 | |||
| 1921 | Ga0496112_0002004 | |||
| 1922 | Ga0496112_0035410 | |||
| 1923 | Ga0496112_0151319 | |||
| 1924 | Ga0496112_0190132 | |||
| 1925 | Ga0496112_0428782 | |||
| 1926 | Ga0496113_0051332 | |||
| 1927 | Ga0496113_0101182 | |||
| 1928 | Ga0496113_0591309 | |||
| 1929 | Ga0496114_0293785 | |||
| 1930 | Ga0496115_0054981 | |||
| 1931 | Ga0496115_0178775 | |||
| 1932 | Ga0501291_017803 | |||
| 1933 | Ga0501294_010505 | |||
| 1934 | Ga0501297_011707 | |||
| 1935 | Ga0501298_002952 | |||
| 1936 | Ga0501301_005965 | |||
| 1937 | Ga0501032_0183160 | |||
| 1938 | Ga0501033_0382225 | |||
| 1939 | Ga0501036_0677804 | |||
| 1940 | Ga0501036_0795681 | |||
| 1941 | Ga0501038_0068246 | |||
| 1942 | Ga0501039_0348759 | |||
| 1943 | Ga0501040_0108766 | |||
| 1944 | Ga0501048_0048405 | |||
| 1945 | Ga0501048_0673244 | |||
| 1946 | Ga0501071_0086416 | |||
| 1947 | Ga0501071_1003467 | |||
| 1948 | Ga0501072_0156715 | |||
| 1949 | Ga0501072_0763666 | |||
| 1950 | Ga0501074_0154850 | |||
| 1951 | Ga0501075_0187856 | |||
| 1952 | Ga0501075_0319619 | |||
| 1953 | Ga0501075_0414302 | |||
| 1954 | Ga0501076_0001228 | |||
| 1955 | Ga0501077_0792186 | |||
| 1956 | Ga0501257_169945 | |||
| 1957 | Ga0501079_0210230 | |||
| 1958 | Ga0501080_0120457 | |||
| 1959 | Ga0501081_0144580 | |||
| 1960 | Ga0501081_0482464 | |||
| 1961 | Ga0501083_0389818 | |||
| 1962 | Ga0501035_0628743 | |||
| 1963 | Ga0501045_0061368 | |||
| 1964 | nmdc:mga03683_28667_c1 | |||
| 1965 | nmdc:mga03n38_51735_c1 | |||
| 1966 | nmdc:mga03n38_84975_c1 | |||
| 1967 | nmdc:mga00v17_147142_c1 | |||
| 1968 | nmdc:mga00v17_149537_c1 | |||
| 1969 | nmdc:mga00v17_334036_c1 | |||
| 1970 | nmdc:mga00v17_9694_c1 | |||
| 1971 | nmdc:mga0yw44_11427_c1 | |||
| 1972 | nmdc:mga0k408_182_c1 | |||
| 1973 | nmdc:mga06z11_27669_c1 | |||
| 1974 | nmdc:mga06z11_528728_c1 | |||
| 1975 | nmdc:mga06z11_726815_c1 | |||
| 1976 | nmdc:mga06z11_7564_c1 | |||
| 1977 | nmdc:mga04h51_20597_c1 | |||
| 1978 | nmdc:mga07m45_233158_c1 | |||
| 1979 | nmdc:mga07m45_24324_c1 | |||
| 1980 | nmdc:mga05p37_102551_c1 | |||
| 1981 | nmdc:mga05p37_111978_c1 | |||
| 1982 | nmdc:mga05p37_186901_c1 | |||
| 1983 | nmdc:mga05p37_209263_c2 | |||
| 1984 | nmdc:mga05p37_25947_c1 | |||
| 1985 | nmdc:mga05p37_261661_c1 | |||
| 1986 | nmdc:mga05p37_276941_c1 | |||
| 1987 | nmdc:mga05p37_41819_c1 | |||
| 1988 | nmdc:mga05p37_511961_c1 | |||
| 1989 | nmdc:mga05p37_83677_c1 | |||
| 1990 | nmdc:mga09592_133886_c1 | |||
| 1991 | nmdc:mga09592_15944_c1 | |||
| 1992 | nmdc:mga09592_22740_c1 | |||
| 1993 | nmdc:mga09592_469_c1 | |||
| 1994 | nmdc:mga09592_6307_c1 | |||
| 1995 | nmdc:mga0qj67_42830_c1 | |||
| 1996 | nmdc:mga0qj67_54471_c1 | |||
| 1997 | nmdc:mga0qj67_999860_c1 | |||
| 1998 | nmdc:mga06r32_1189786_c1 | |||
| 1999 | nmdc:mga06r32_209913_c1 | |||
| 2000 | nmdc:mga06r32_243590_c1 | |||
| 2001 | nmdc:mga06r32_277455_c1 | |||
| 2002 | nmdc:mga06r32_3704_c1 | |||
| 2003 | nmdc:mga06r32_497697_c1 | |||
| 2004 | nmdc:mga08y16_1210895_c1 | |||
| 2005 | nmdc:mga08y16_2217_c1 | |||
| 2006 | nmdc:mga08y16_93220_c1 | |||
| 2007 | nmdc:mga0n895_318543_c1 | |||
| 2008 | nmdc:mga0n895_405695_c1 | |||
| 2009 | nmdc:mga0n895_546683_c1 | |||
| 2010 | nmdc:mga0n895_867412_c1 | |||
| 2011 | nmdc:mga0rr50_23013_c1 | |||
| 2012 | nmdc:mga0rr50_277418_c1 | |||
| 2013 | nmdc:mga0rr50_405662_c1 | |||
| 2014 | nmdc:mga08x19_10096_c1 | |||
| 2015 | nmdc:mga08x19_101960_c1 | |||
| 2016 | nmdc:mga08x19_107610_c1 | |||
| 2017 | nmdc:mga08x19_18051_c1 | |||
| 2018 | nmdc:mga0a205_218639_c1 | |||
| 2019 | nmdc:mga0a205_63371_c1 | |||
| 2020 | nmdc:mga0a205_670946_c1 | |||
| 2021 | nmdc:mga0a205_72213_c1 | |||
| 2022 | nmdc:mga0a205_829624_c1 | |||
| 2023 | Ga0495601_0017230 | |||
| 2024 | Ga0495601_0142788 | |||
| 2025 | Ga0495601_0355100 | |||
| 2026 | Ga0500588_0170093 | |||
| 2027 | Ga0500590_176738 | |||
| 2028 | Ga0501084_0127183 | |||
| 2029 | Ga0501084_0508330 | |||
| 2030 | Ga0587066_022077 | |||
| 2031 | Ga0587070_091793 | |||
| 2032 | Ga0587073_0133613 | |||
| 2033 | Ga0587083_0127223 | |||
| 2034 | Ga0587085_078525 | |||
| 2035 | Ga0587088_063155 | |||
| 2036 | Ga0587090_051561 | |||
| 2037 | Ga0587091_103118 | |||
| 2038 | Ga0587094_054531 | |||
| 2039 | Ga0587113_022974 | |||
| 2040 | Ga0587128_070954 | |||
| 2041 | Ga0587128_089401 | |||
| 2042 | Ga0587067_095536 | |||
| 2043 | Ga0587068_099442 | |||
| 2044 | Ga0587076_094883 | |||
| 2045 | Ga0587078_032194 | |||
| 2046 | Ga0587114_052490 | |||
| 2047 | Ga0501082_0779620 | |||
| 2048 | Ga0501082_0840708 | |||
| 2049 | Ga0466962_0113791 | |||
| 2050 | Ga0530510_0045990 | |||
| 2051 | Ga0530510_0343135 | |||
| 2052 | Ga0530510_0694816 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kim-assembly1.cif.gz_M | mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor | 0.8606 | 8 | 165 |
| 7kim-assembly1.cif.gz_M | mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor | 0.8492 | 8 | 165 |
| 4xls-assembly2.cif.gz_N | crystal structure of t. aquaticus transcription initiation complex with card containing upstream fork promoter. | 0.8422 | 8 | 165 |
| 4xlr-assembly1.cif.gz_M | crystal structure of t.aquaticus transcription initiation complex with card containing bubble promoter and rna | 0.839 | 8 | 163 |
| 8hvr-assembly1.cif.gz_H | cryo-em structure of afsr-dependent transcription activation complex with afss promoter | 0.8278 | 8 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kbmB01 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.9343 | 8 | 65 | 2.40.10.170 |
| 4kbmB01 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.9032 | 8 | 65 | 2.40.10.170 |
| af_K7MX79_225_393_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8819 | 27 | 55 | 2.120.10.80 |
| af_F1Q9Z1_251_388_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.8724 | 21 | 47 | 3.90.70.10 |
| 4kbmB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain | 0.8496 | 67 | 165 | 1.20.58.1290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8IBF4-F1-model_v4 | CarD family transcriptional regulator | 0.944 | 8 | 88 |
GO:0009303
|
| AF-A0A3E0P0Z8-F1-model_v4 | CarD family transcriptional regulator | 0.942 | 8 | 167 |
GO:0009303
|
| AF-A0A3M1VQQ5-F1-model_v4 | CarD family transcriptional regulator | 0.9379 | 9 | 167 |
GO:0009303
|
| AF-W7ZMV4-F1-model_v4 | deleted | 0.9373 | 8 | 80 |
|
| AF-A0A259J447-F1-model_v4 | deleted | 0.9367 | 9 | 82 |
|