F488506

General Info

Members Datasets Scaffolds Average Seq Length
1026 391 2052 180

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10702105|Ga0070709_107021051
Length 197
Sequence MFTVLYGCSPLPSAYWVPYMSVSDLNFHIGDKVVYPNHGVGVIEQISSRSIGATIERFYLLNIKASSLKVMVPCNNAGSVGLRRVVRNGEIQKVIDLLSLAETNGSGDWKDRFKENSDRMRTGSLIEVAGVLKNLIALHQAKPLSFREKKMLERARYLLVSELAMARNCEESKIEEVLTAALAKCKLRFPEASEFQA

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
148 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
155 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
157 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
158 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
244 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
328 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
329 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
330 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
331 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
371 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 5.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 3.41
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 25.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10702105 3300005434 Unclassified 787
2 MRS1b_contig_3743146 2162886011 Bacteria 1150
3 MRS1b_contig_4719877 2162886011 Bacteria 875
4 MBSR1b_contig_376918 2162886012 Bacteria 927
5 LJNas_1000022 3300000546 Bacteria 20891
6 rootL2_10303851 3300003322 Bacteria 1220
7 rootH1_10335305 3300003323 Bacteria 1321
8 Ga0058859_11454794 3300004798 Unclassified 787
9 Ga0058863_11867713 3300004799 Unclassified 966
10 Ga0058863_11966271 3300004799 Unclassified 688
11 Ga0058861_10061650 3300004800 Bacteria 1031
12 Ga0058860_11825380 3300004801 Unclassified 594
13 Ga0058862_12739121 3300004803 Unclassified 910
14 Ga0065704_10171747 3300005289 Bacteria 1287
15 Ga0065712_10098164 3300005290 Bacteria 2101
16 Ga0065712_10558904 3300005290 Unclassified 613
17 Ga0065715_10040951 3300005293 Bacteria 1477
18 Ga0065707_10159589 3300005295 Bacteria 1572
19 Ga0070658_10293117 3300005327 Bacteria 1387
20 Ga0070676_10395109 3300005328 Bacteria 961
21 Ga0070683_100011670 3300005329 Bacteria 7608
22 Ga0070683_100076106 3300005329 Bacteria 3137
23 Ga0070683_100140291 3300005329 Bacteria 2290
24 Ga0070683_100662715 3300005329 Bacteria 999
25 Ga0070690_100766569 3300005330 Unclassified 746
26 Ga0070670_100024685 3300005331 Bacteria 5170
27 Ga0070670_101074019 3300005331 Bacteria 733
28 Ga0068869_100001094 3300005334 Bacteria 15789
29 Ga0068869_100004860 3300005334 Bacteria 8397
30 Ga0068869_100083630 3300005334 Bacteria 2387
31 Ga0070666_10451809 3300005335 Bacteria 928
32 Ga0070666_10508422 3300005335 Unclassified 874
33 Ga0070680_100083264 3300005336 Unclassified 2642
34 Ga0070680_100107961 3300005336 Bacteria 2315
35 Ga0070680_100120414 3300005336 Bacteria 2191
36 Ga0070680_100214334 3300005336 Bacteria 1625
37 Ga0070680_100987537 3300005336 Bacteria 727
38 Ga0068868_100001559 3300005338 Bacteria 15661
39 Ga0068868_100006728 3300005338 Bacteria 8160
40 Ga0068868_100008270 3300005338 Bacteria 7450
41 Ga0068868_100068976 3300005338 Bacteria 2816
42 Ga0068868_101271065 3300005338 Bacteria 683
43 Ga0070660_100286934 3300005339 Bacteria 1347
44 Ga0070689_100008073 3300005340 Bacteria 7394
45 Ga0070689_100011858 3300005340 Bacteria 6257
46 Ga0070691_10189837 3300005341 Unclassified 1074
47 Ga0070687_100013069 3300005343 Bacteria 3688
48 Ga0070687_100111448 3300005343 Bacteria 1549
49 Ga0070661_100199992 3300005344 Bacteria 1526
50 Ga0070692_10059706 3300005345 Unclassified 2005
51 Ga0070668_100139362 3300005347 Bacteria 1953
52 Ga0070668_101136287 3300005347 Bacteria 706
53 Ga0070669_100250282 3300005353 Bacteria 1411
54 Ga0070669_100568879 3300005353 Bacteria 947
55 Ga0070669_100926776 3300005353 Bacteria 745
56 Ga0070675_100166546 3300005354 Bacteria 1898
57 Ga0070675_100192372 3300005354 Bacteria 1768
58 Ga0070671_100318248 3300005355 Unclassified 1326
59 Ga0070671_100351039 3300005355 Bacteria 1259
60 Ga0070673_100079167 3300005364 Bacteria 2660
61 Ga0070673_100150532 3300005364 Bacteria 1970
62 Ga0070688_100089161 3300005365 Bacteria 2012
63 Ga0070688_100486479 3300005365 Bacteria 928
64 Ga0070659_100249007 3300005366 Bacteria 1472
65 Ga0070667_100440812 3300005367 Bacteria 1189
66 Ga0070667_100495438 3300005367 Bacteria 1120
67 Ga0070709_10132896 3300005434 Bacteria 1701
68 Ga0070709_10171665 3300005434 Bacteria 1516
69 Ga0070709_10321213 3300005434 Bacteria 1136
70 Ga0070709_11073338 3300005434 Unclassified 643
71 Ga0070714_100005380 3300005435 Bacteria 9771
72 Ga0070714_100019795 3300005435 Bacteria 5489
73 Ga0070714_100117417 3300005435 Bacteria 2363
74 Ga0070714_100200088 3300005435 Bacteria 1827
75 Ga0070714_100324997 3300005435 Bacteria 1439
76 Ga0070714_100415969 3300005435 Bacteria 1273
77 Ga0070713_100000460 3300005436 Bacteria 26005
78 Ga0070713_100041420 3300005436 Unclassified 3752
79 Ga0070713_100042459 3300005436 Bacteria 3711
80 Ga0070713_100111171 3300005436 Unclassified 2389
81 Ga0070713_100185078 3300005436 Bacteria 1874
82 Ga0070713_100342865 3300005436 Bacteria 1385
83 Ga0070713_100356650 3300005436 Bacteria 1358
84 Ga0070713_100469068 3300005436 Bacteria 1185
85 Ga0070713_100680935 3300005436 Bacteria 981
86 Ga0070710_10044792 3300005437 Unclassified 2456
87 Ga0070710_10135353 3300005437 Bacteria 1506
88 Ga0070710_10163999 3300005437 Bacteria 1380
89 Ga0070710_10180310 3300005437 Bacteria 1322
90 Ga0070701_10012483 3300005438 Bacteria 3835
91 Ga0070711_100000656 3300005439 Bacteria 18067
92 Ga0070711_100013246 3300005439 Bacteria 5176
93 Ga0070711_100085734 3300005439 Bacteria 2257
94 Ga0070711_100191559 3300005439 Bacteria 1572
95 Ga0070711_100197507 3300005439 Bacteria 1550
96 Ga0070711_100351292 3300005439 Unclassified 1185
97 Ga0070711_101179825 3300005439 Unclassified 662
98 Ga0070705_100066046 3300005440 Bacteria 2168
99 Ga0070705_100167949 3300005440 Bacteria 1474
100 Ga0070700_100025428 3300005441 Bacteria 3485
101 Ga0070694_100025427 3300005444 Bacteria 3830
102 Ga0070694_100150788 3300005444 Unclassified 1698
103 Ga0070694_100174306 3300005444 Unclassified 1586
104 Ga0070694_100495132 3300005444 Bacteria 972
105 Ga0070708_100001918 3300005445 Bacteria 16013
106 Ga0070708_100002306 3300005445 Bacteria 14779
107 Ga0070708_100008762 3300005445 Bacteria 8133
108 Ga0070708_100019770 3300005445 Bacteria 5665
109 Ga0070708_100061160 3300005445 Bacteria 3364
110 Ga0070708_100469920 3300005445 Bacteria 1187
111 Ga0070708_100471199 3300005445 Bacteria 1185
112 Ga0070708_100535594 3300005445 Unclassified 1105
113 Ga0070663_100032244 3300005455 Bacteria 3610
114 Ga0070663_100136037 3300005455 Bacteria 1871
115 Ga0070678_100006161 3300005456 Bacteria 7008
116 Ga0070678_100517427 3300005456 Unclassified 1055
117 Ga0070662_100115609 3300005457 Bacteria 2049
118 Ga0070662_100508637 3300005457 Bacteria 1005
119 Ga0070662_100556797 3300005457 Bacteria 961
120 Ga0070662_100688452 3300005457 Bacteria 864
121 Ga0070681_10000242 3300005458 Bacteria 43180
122 Ga0070681_10087482 3300005458 Bacteria 3069
123 Ga0070681_10139074 3300005458 Bacteria 2358
124 Ga0070681_10165112 3300005458 Bacteria 2137
125 Ga0070681_10171172 3300005458 Bacteria 2094
126 Ga0070681_10562788 3300005458 Bacteria 1054
127 Ga0070681_10802521 3300005458 Bacteria 858
128 Ga0068867_100008371 3300005459 Bacteria 7296
129 Ga0068867_100167497 3300005459 Bacteria 1738
130 Ga0070685_10024826 3300005466 Bacteria 3295
131 Ga0070685_10029052 3300005466 Bacteria 3069
132 Ga0070706_100008661 3300005467 Bacteria 9481
133 Ga0070706_100019421 3300005467 Bacteria 6267
134 Ga0070706_100020092 3300005467 Bacteria 6155
135 Ga0070706_100060134 3300005467 Bacteria 3507
136 Ga0070706_100088518 3300005467 Bacteria 2870
137 Ga0070706_100193011 3300005467 Bacteria 1903
138 Ga0070706_100267843 3300005467 Bacteria 1594
139 Ga0070707_100003999 3300005468 Bacteria 13875
140 Ga0070707_100008148 3300005468 Bacteria 9723
141 Ga0070707_100015413 3300005468 Bacteria 7171
142 Ga0070707_100021880 3300005468 Bacteria 6045
143 Ga0070707_100031054 3300005468 Bacteria 5087
144 Ga0070707_100051410 3300005468 Bacteria 3951
145 Ga0070707_100075803 3300005468 Bacteria 3244
146 Ga0070707_100129018 3300005468 Bacteria 2458
147 Ga0070707_100148170 3300005468 Bacteria 2284
148 Ga0070707_100696610 3300005468 Unclassified 979
149 Ga0070698_100000182 3300005471 Bacteria 59279
150 Ga0070698_100001098 3300005471 Bacteria 29768
151 Ga0070698_100010878 3300005471 Bacteria 9681
152 Ga0070698_100011307 3300005471 Bacteria 9476
153 Ga0070698_100116352 3300005471 Bacteria 2637
154 Ga0070698_100252375 3300005471 Bacteria 1696
155 Ga0070698_100716924 3300005471 Unclassified 943
156 Ga0070698_100813766 3300005471 Unclassified 878
157 Ga0070698_100956638 3300005471 Unclassified 803
158 Ga0070699_100002044 3300005518 Bacteria 18236
159 Ga0070699_100003968 3300005518 Bacteria 13080
160 Ga0070699_100007000 3300005518 Bacteria 9800
161 Ga0070699_100036337 3300005518 Bacteria 4261
162 Ga0070699_100094700 3300005518 Bacteria 2614
163 Ga0070699_100454251 3300005518 Bacteria 1162
164 Ga0070699_100472375 3300005518 Bacteria 1138
165 Ga0070699_101339404 3300005518 Unclassified 656
166 Ga0070679_100016723 3300005530 Bacteria 7087
167 Ga0070679_100029648 3300005530 Bacteria 5398
168 Ga0070679_100060877 3300005530 Unclassified 3763
169 Ga0070679_100106030 3300005530 Bacteria 2796
170 Ga0070679_100519375 3300005530 Bacteria 1135
171 Ga0070684_100083051 3300005535 Bacteria 2838
172 Ga0070684_100480673 3300005535 Bacteria 1150
173 Ga0070697_100000045 3300005536 Bacteria 92181
174 Ga0070697_100003087 3300005536 Bacteria 12783
175 Ga0070697_100006105 3300005536 Bacteria 9319
176 Ga0070697_100007161 3300005536 Bacteria 8679
177 Ga0070697_100008121 3300005536 Bacteria 8188
178 Ga0070697_100012774 3300005536 Bacteria 6578
179 Ga0070697_100045258 3300005536 Bacteria 3566
180 Ga0070697_100217099 3300005536 Unclassified 1629
181 Ga0070697_100309586 3300005536 Bacteria 1359
182 Ga0070697_100564365 3300005536 Unclassified 999
183 Ga0068853_100018922 3300005539 Bacteria 5704
184 Ga0068853_100190406 3300005539 Bacteria 1863
185 Ga0068853_100209777 3300005539 Bacteria 1775
186 Ga0068853_100502772 3300005539 Unclassified 1144
187 Ga0070672_100005147 3300005543 Bacteria 8635
188 Ga0070672_100063481 3300005543 Bacteria 2917
189 Ga0070686_100413406 3300005544 Unclassified 1029
190 Ga0070686_100447109 3300005544 Bacteria 993
191 Ga0070695_100008702 3300005545 Bacteria 6032
192 Ga0070695_100157767 3300005545 Bacteria 1590
193 Ga0070696_100300129 3300005546 Bacteria 1230
194 Ga0070693_100968378 3300005547 Bacteria 642
195 Ga0070704_100007901 3300005549 Bacteria 6348
196 Ga0070704_100034509 3300005549 Bacteria 3432
197 Ga0070704_100050303 3300005549 Bacteria 2928
198 Ga0070704_100179979 3300005549 Bacteria 1690
199 Ga0070704_100187540 3300005549 Bacteria 1660
200 Ga0070704_100224288 3300005549 Bacteria 1529
201 Ga0070704_100470105 3300005549 Unclassified 1086
202 Ga0070704_100479902 3300005549 Unclassified 1076
203 Ga0070704_100813382 3300005549 Bacteria 836
204 Ga0068855_100000722 3300005563 Bacteria 40559
205 Ga0068855_100012781 3300005563 Bacteria 10127
206 Ga0068855_100059377 3300005563 Bacteria 4475
207 Ga0068855_100078538 3300005563 Bacteria 3828
208 Ga0068855_100162078 3300005563 Bacteria 2537
209 Ga0068855_100792601 3300005563 Bacteria 1008
210 Ga0070664_100002060 3300005564 Bacteria 16060
211 Ga0070664_100057431 3300005564 Bacteria 3308
212 Ga0070664_100060588 3300005564 Bacteria 3223
213 Ga0068857_100005616 3300005577 Bacteria 10721
214 Ga0068857_100006773 3300005577 Bacteria 9858
215 Ga0068857_100162149 3300005577 Bacteria 2029
216 Ga0068857_100162791 3300005577 Bacteria 2025
217 Ga0068857_100226896 3300005577 Bacteria 1707
218 Ga0068857_100504760 3300005577 Unclassified 1135
219 Ga0068854_100007803 3300005578 Bacteria 6846
220 Ga0068854_100008281 3300005578 Bacteria 6674
221 Ga0068854_100012746 3300005578 Bacteria 5505
222 Ga0068854_100039098 3300005578 Bacteria 3340
223 Ga0068854_100281380 3300005578 Unclassified 1339
224 Ga0068854_100461935 3300005578 Unclassified 1062
225 Ga0068856_100000893 3300005614 Bacteria 31927
226 Ga0068856_100001601 3300005614 Bacteria 23661
227 Ga0068856_100010172 3300005614 Bacteria 9144
228 Ga0068856_100025934 3300005614 Bacteria 5716
229 Ga0068856_100140369 3300005614 Bacteria 2423
230 Ga0068856_100274670 3300005614 Bacteria 1701
231 Ga0068856_100321255 3300005614 Bacteria 1565
232 Ga0068856_100569109 3300005614 Unclassified 1154
233 Ga0068852_100061504 3300005616 Bacteria 3264
234 Ga0068852_100166419 3300005616 Bacteria 2063
235 Ga0068859_100001851 3300005617 Bacteria 21505
236 Ga0068859_100003598 3300005617 Bacteria 15799
237 Ga0068859_100008916 3300005617 Bacteria 10129
238 Ga0068859_100012850 3300005617 Bacteria 8409
239 Ga0068859_100328245 3300005617 Bacteria 1624
240 Ga0068859_101308894 3300005617 Unclassified 799
241 Ga0068864_100007801 3300005618 Bacteria 8816
242 Ga0068864_100146501 3300005618 Bacteria 2135
243 Ga0068864_100171899 3300005618 Bacteria 1976
244 Ga0068864_100693499 3300005618 Bacteria 994
245 Ga0068864_100954342 3300005618 Unclassified 849
246 Ga0068861_100035120 3300005719 Bacteria 3712
247 Ga0068861_100168998 3300005719 Bacteria 1811
248 Ga0068851_10018899 3300005834 Bacteria 3327
249 Ga0068870_10040462 3300005840 Unclassified 2417
250 Ga0068870_10071433 3300005840 Bacteria 1894
251 Ga0068870_10385212 3300005840 Unclassified 908
252 Ga0068863_100017333 3300005841 Bacteria 6906
253 Ga0068863_100027438 3300005841 Bacteria 5431
254 Ga0068863_100037911 3300005841 Bacteria 4587
255 Ga0068863_100091673 3300005841 Unclassified 2882
256 Ga0068863_100094527 3300005841 Bacteria 2837
257 Ga0068863_100541306 3300005841 Bacteria 1149
258 Ga0068858_100001080 3300005842 Bacteria 28247
259 Ga0068858_100001918 3300005842 Bacteria 21203
260 Ga0068858_100024884 3300005842 Bacteria 5574
261 Ga0068858_100038794 3300005842 Bacteria 4418
262 Ga0068858_100096333 3300005842 Bacteria 2757
263 Ga0068858_100272306 3300005842 Bacteria 1611
264 Ga0068860_100039593 3300005843 Bacteria 4508
265 Ga0068860_100063271 3300005843 Bacteria 3514
266 Ga0068860_100089107 3300005843 Unclassified 2937
267 Ga0068860_100148545 3300005843 Bacteria 2256
268 Ga0068860_100178131 3300005843 Bacteria 2055
269 Ga0068860_100288257 3300005843 Bacteria 1606
270 Ga0068860_100358033 3300005843 Bacteria 1437
271 Ga0068860_100518184 3300005843 Bacteria 1192
272 Ga0068862_100126415 3300005844 Bacteria 2257
273 Ga0068862_100344383 3300005844 Bacteria 1381
274 Ga0068862_100694919 3300005844 Bacteria 985
275 Ga0081455_10162099 3300005937 Bacteria 1713
276 Ga0081540_1051473 3300005983 Bacteria 2036
277 Ga0070717_10001125 3300006028 Bacteria 18088
278 Ga0070717_10014637 3300006028 Bacteria 6039
279 Ga0070717_10025999 3300006028 Unclassified 4666
280 Ga0070717_10037812 3300006028 Unclassified 3920
281 Ga0070717_10070833 3300006028 Bacteria 2907
282 Ga0070717_10108607 3300006028 Bacteria 2364
283 Ga0070717_10171078 3300006028 Bacteria 1889
284 Ga0070717_10220687 3300006028 Bacteria 1666
285 Ga0070717_10314866 3300006028 Unclassified 1393
286 Ga0070717_10436755 3300006028 Bacteria 1179
287 Ga0075365_10026433 3300006038 Bacteria 3685
288 Ga0075365_10068707 3300006038 Unclassified 2381
289 Ga0075368_10087693 3300006042 Bacteria 1271
290 Ga0075363_100050938 3300006048 Bacteria 2207
291 Ga0075364_10097475 3300006051 Unclassified 1956
292 Ga0075364_10227900 3300006051 Unclassified 1266
293 Ga0070715_10075192 3300006163 Unclassified 1519
294 Ga0070715_10337078 3300006163 Unclassified 819
295 Ga0070716_100020885 3300006173 Bacteria 3443
296 Ga0070716_100023415 3300006173 Bacteria 3275
297 Ga0070716_100067732 3300006173 Unclassified 2086
298 Ga0070716_100193397 3300006173 Bacteria 1346
299 Ga0070716_100216756 3300006173 Bacteria 1283
300 Ga0070716_100302612 3300006173 Bacteria 1113
301 Ga0070716_100671693 3300006173 Bacteria 788
302 Ga0070712_100000117 3300006175 Bacteria 41403
303 Ga0070712_100001433 3300006175 Bacteria 14543
304 Ga0070712_100060003 3300006175 Unclassified 2681
305 Ga0070712_100085354 3300006175 Bacteria 2298
306 Ga0070712_100192019 3300006175 Bacteria 1599
307 Ga0070712_100216154 3300006175 Unclassified 1514
308 Ga0075362_10000281 3300006177 Bacteria 14342
309 Ga0075362_10317791 3300006177 Unclassified 775
310 Ga0075367_10021802 3300006178 Bacteria 3586
311 Ga0075367_10034626 3300006178 Unclassified 2919
312 Ga0075366_10000367 3300006195 Bacteria 20854
313 Ga0097621_100000058 3300006237 Bacteria 58363
314 Ga0097621_100000214 3300006237 Bacteria 38208
315 Ga0097621_100002700 3300006237 Bacteria 12139
316 Ga0097621_100096277 3300006237 Unclassified 2484
317 Ga0097621_100112189 3300006237 Unclassified 2305
318 Ga0097621_100154053 3300006237 Bacteria 1972
319 Ga0068871_100000167 3300006358 Bacteria 43972
320 Ga0068871_100001129 3300006358 Bacteria 17928
321 Ga0068871_100033834 3300006358 Bacteria 4049
322 Ga0068871_100094064 3300006358 Bacteria 2501
323 Ga0068871_100232613 3300006358 Bacteria 1600
324 Ga0068871_100500600 3300006358 Bacteria 1095
325 Ga0075428_100041624 3300006844 Bacteria 5051
326 Ga0075428_100177918 3300006844 Bacteria 2303
327 Ga0075428_100460585 3300006844 Unclassified 1362
328 Ga0075430_100038683 3300006846 Bacteria 4040
329 Ga0075430_100048471 3300006846 Bacteria 3587
330 Ga0075430_100697451 3300006846 Bacteria 837
331 Ga0075431_100000068 3300006847 Bacteria 60176
332 Ga0075431_100269302 3300006847 Bacteria 1727
333 Ga0075431_100434565 3300006847 Bacteria 1310
334 Ga0075431_100512925 3300006847 Bacteria 1189
335 Ga0075431_100715897 3300006847 Bacteria 978
336 Ga0075431_100744691 3300006847 Unclassified 956
337 Ga0075431_100810987 3300006847 Bacteria 909
338 Ga0075433_10022035 3300006852 Bacteria 5346
339 Ga0075433_10074838 3300006852 Bacteria 2980
340 Ga0075433_10100418 3300006852 Bacteria 2562
341 Ga0075433_10147954 3300006852 Bacteria 2088
342 Ga0075433_10921779 3300006852 Unclassified 762
343 Ga0075433_10975567 3300006852 Bacteria 738
344 Ga0075434_100011129 3300006871 Bacteria 8466
345 Ga0075434_100078897 3300006871 Bacteria 3289
346 Ga0075434_100139032 3300006871 Unclassified 2448
347 Ga0075434_100294114 3300006871 Bacteria 1644
348 Ga0075434_100535245 3300006871 Bacteria 1191
349 Ga0075429_100000340 3300006880 Bacteria 34005
350 Ga0075429_100030110 3300006880 Bacteria 4715
351 Ga0075429_100160664 3300006880 Bacteria 1968
352 Ga0068865_100293594 3300006881 Unclassified 1298
353 Ga0075436_100012092 3300006914 Bacteria 5918
354 Ga0075436_100094035 3300006914 Bacteria 2085
355 Ga0075436_100129329 3300006914 Bacteria 1770
356 Ga0075436_100304465 3300006914 Bacteria 1143
357 Ga0097620_100001850 3300006931 Bacteria 21505
358 Ga0097620_100003598 3300006931 Bacteria 15799
359 Ga0097620_100008916 3300006931 Bacteria 10129
360 Ga0097620_100012850 3300006931 Bacteria 8409
361 Ga0097620_100328225 3300006931 Bacteria 1624
362 Ga0097620_101309049 3300006931 Unclassified 799
363 Ga0075435_100026673 3300007076 Bacteria 4511
364 Ga0075435_100066652 3300007076 Bacteria 2930
365 Ga0099794_10195183 3300007265 Bacteria 1036
366 Ga0099795_10106782 3300007788 Bacteria 1105
367 Ga0105240_10076862 3300009093 Unclassified 4115
368 Ga0105240_10115522 3300009093 Bacteria 3240
369 Ga0105240_10156926 3300009093 Bacteria 2705
370 Ga0111539_10000594 3300009094 Bacteria 46740
371 Ga0111539_10051539 3300009094 Bacteria 4901
372 Ga0111539_10209694 3300009094 Bacteria 2270
373 Ga0111539_12166290 3300009094 Unclassified 645
374 Ga0105245_10008717 3300009098 Bacteria 8843
375 Ga0105245_10277975 3300009098 Bacteria 1635
376 Ga0105245_11158046 3300009098 Unclassified 820
377 Ga0105247_10131199 3300009101 Bacteria 1633
378 Ga0105247_10277664 3300009101 Bacteria 1155
379 Ga0114129_10001988 3300009147 Bacteria 27977
380 Ga0114129_10043115 3300009147 Bacteria 6350
381 Ga0114129_10102611 3300009147 Bacteria 3956
382 Ga0114129_10116598 3300009147 Bacteria 3680
383 Ga0114129_10126576 3300009147 Unclassified 3512
384 Ga0114129_10137126 3300009147 Bacteria 3356
385 Ga0114129_10499207 3300009147 Bacteria 1589
386 Ga0114129_10957685 3300009147 Unclassified 1081
387 Ga0105243_10087448 3300009148 Bacteria 2558
388 Ga0105243_11438335 3300009148 Unclassified 711
389 Ga0105241_10029168 3300009174 Unclassified 4114
390 Ga0105241_10042322 3300009174 Bacteria 3445
391 Ga0105241_10126627 3300009174 Bacteria 2063
392 Ga0105241_10316689 3300009174 Unclassified 1344
393 Ga0105241_10461648 3300009174 Bacteria 1125
394 Ga0105242_10013831 3300009176 Bacteria 6246
395 Ga0105242_10132852 3300009176 Bacteria 2151
396 Ga0105242_10572270 3300009176 Unclassified 1086
397 Ga0105242_10743336 3300009176 Bacteria 965
398 Ga0105242_10809000 3300009176 Unclassified 928
399 Ga0105248_10014941 3300009177 Bacteria 8548
400 Ga0105248_10069290 3300009177 Bacteria 3960
401 Ga0105248_10082685 3300009177 Bacteria 3612
402 Ga0105248_10089677 3300009177 Bacteria 3461
403 Ga0105248_10091875 3300009177 Bacteria 3418
404 Ga0105248_10173639 3300009177 Unclassified 2429
405 Ga0105248_10258773 3300009177 Bacteria 1959
406 Ga0105248_10519462 3300009177 Unclassified 1343
407 Ga0105237_10040678 3300009545 Bacteria 4688
408 Ga0105237_10191521 3300009545 Bacteria 2045
409 Ga0105237_10417674 3300009545 Bacteria 1347
410 Ga0105237_10733999 3300009545 Bacteria 994
411 Ga0105238_10006322 3300009551 Bacteria 11777
412 Ga0105238_11352553 3300009551 Bacteria 739
413 Ga0105249_10420134 3300009553 Bacteria 1371
414 Ga0105239_10007920 3300010375 Bacteria 12147
415 Ga0105239_10044315 3300010375 Bacteria 4877
416 Ga0105239_10233069 3300010375 Bacteria 2066
417 Ga0105239_10543099 3300010375 Bacteria 1323
418 Ga0105246_10091183 3300011119 Bacteria 2196
419 Ga0157373_10043823 3300013100 Bacteria 3195
420 Ga0157371_10037588 3300013102 Bacteria 3464
421 Ga0157370_10181120 3300013104 Bacteria 1958
422 Ga0157369_10000592 3300013105 Bacteria 47171
423 Ga0157369_10000794 3300013105 Bacteria 40368
424 Ga0157369_10079290 3300013105 Bacteria 3517
425 Ga0157369_10654845 3300013105 Unclassified 1083
426 Ga0157369_10806255 3300013105 Bacteria 965
427 Ga0157369_10882658 3300013105 Unclassified 917
428 Ga0157374_10000181 3300013296 Bacteria 58388
429 Ga0157374_10145719 3300013296 Bacteria 2300
430 Ga0157374_10155817 3300013296 Bacteria 2223
431 Ga0157374_10939060 3300013296 Unclassified 883
432 Ga0157378_10000429 3300013297 Bacteria 41084
433 Ga0157378_10000680 3300013297 Bacteria 31989
434 Ga0157378_10002074 3300013297 Bacteria 17939
435 Ga0157378_10005249 3300013297 Bacteria 11379
436 Ga0157378_10063848 3300013297 Bacteria 3291
437 Ga0157378_10110691 3300013297 Unclassified 2517
438 Ga0157378_10145631 3300013297 Bacteria 2203
439 Ga0163162_10126222 3300013306 Bacteria 2665
440 Ga0163162_10157427 3300013306 Bacteria 2392
441 Ga0163162_10202660 3300013306 Bacteria 2113
442 Ga0163162_10244102 3300013306 Bacteria 1927
443 Ga0163162_10520870 3300013306 Unclassified 1318
444 Ga0163162_10577872 3300013306 Bacteria 1251
445 Ga0157372_10001790 3300013307 Bacteria 23336
446 Ga0157372_10004416 3300013307 Bacteria 14996
447 Ga0157372_10005439 3300013307 Archaea 13533
448 Ga0157372_10039482 3300013307 Bacteria 5210
449 Ga0157372_10046271 3300013307 Bacteria 4830
450 Ga0157372_10314946 3300013307 Bacteria 1822
451 Ga0157372_10849705 3300013307 Bacteria 1060
452 Ga0157372_11086871 3300013307 Unclassified 925
453 Ga0157372_11108930 3300013307 Bacteria 915
454 Ga0157375_10045058 3300013308 Unclassified 4291
455 Ga0157375_10159235 3300013308 Unclassified 2399
456 Ga0157375_10188103 3300013308 Bacteria 2219
457 Ga0157375_10692285 3300013308 Bacteria 1173
458 Ga0157375_11327355 3300013308 Bacteria 846
459 Ga0163163_10007167 3300014325 Bacteria 9810
460 Ga0163163_10200487 3300014325 Bacteria 2044
461 Ga0163163_10522474 3300014325 Bacteria 1249
462 Ga0157380_10004649 3300014326 Bacteria 9549
463 Ga0157380_10075487 3300014326 Bacteria 2740
464 Ga0157380_10938989 3300014326 Unclassified 894
465 Ga0182008_10021755 3300014497 Bacteria 3293
466 Ga0157377_10080770 3300014745 Bacteria 1900
467 Ga0157377_10081733 3300014745 Bacteria 1890
468 Ga0157379_10005240 3300014968 Bacteria 11138
469 Ga0157379_10107467 3300014968 Bacteria 2505
470 Ga0157379_10395246 3300014968 Bacteria 1270
471 Ga0157376_10017528 3300014969 Bacteria 5466
472 Ga0157376_10084529 3300014969 Bacteria 2733
473 Ga0157376_10085534 3300014969 Bacteria 2717
474 Ga0182007_10031543 3300015262 Bacteria 1803
475 Ga0182005_1029456 3300015265 Bacteria 1497
476 Ga0163161_10031147 3300017792 Bacteria 3799
477 Ga0184601_125905 3300019183 Unclassified 564
478 Ga0184600_138855 3300019190 Unclassified 585
479 Ga0184603_148376 3300019192 Unclassified 564
480 Ga0206356_10627380 3300020070 Unclassified 754
481 Ga0206356_10816522 3300020070 Bacteria 1370
482 Ga0206349_1885320 3300020075 Unclassified 807
483 Ga0206355_1123533 3300020076 Unclassified 956
484 Ga0206352_10589987 3300020078 Bacteria 1299
485 Ga0206352_10614394 3300020078 Unclassified 579
486 Ga0206350_10869449 3300020080 Bacteria 1080
487 Ga0206354_10872379 3300020081 Unclassified 628
488 Ga0206353_11757009 3300020082 Bacteria 1075
489 Ga0213876_10038282 3300021384 Bacteria 2531
490 Ga0224712_10150682 3300022467 Bacteria 1030
491 Ga0224712_10308664 3300022467 Unclassified 741
492 Ga0224570_100361 3300022730 Bacteria 3536
493 Ga0247553_109522 3300023672 Unclassified 552
494 Ga0228600_1003986 3300024123 Unclassified 1072
495 Ga0224572_1004119 3300024225 Bacteria 2508
496 Ga0224572_1010950 3300024225 Unclassified 1712
497 Ga0224572_1016643 3300024225 Unclassified 1410
498 Ga0224572_1020018 3300024225 Unclassified 1285
499 Ga0224572_1020278 3300024225 Bacteria 1277
500 Ga0228598_1008363 3300024227 Bacteria 2091
501 Ga0228598_1009848 3300024227 Bacteria 1909
502 Ga0207656_10035109 3300025321 Bacteria 2097
503 Ga0207653_10042422 3300025885 Unclassified 1496
504 Ga0207692_10027459 3300025898 Unclassified 2682
505 Ga0207692_10241923 3300025898 Bacteria 1078
506 Ga0207642_10256328 3300025899 Bacteria 995
507 Ga0207688_10176572 3300025901 Bacteria 1272
508 Ga0207680_10205149 3300025903 Bacteria 1345
509 Ga0207680_10218296 3300025903 Bacteria 1306
510 Ga0207647_10002148 3300025904 Bacteria 15069
511 Ga0207647_10005640 3300025904 Bacteria 9141
512 Ga0207647_10456588 3300025904 Bacteria 716
513 Ga0207685_10040547 3300025905 Unclassified 1736
514 Ga0207699_10049464 3300025906 Unclassified 2475
515 Ga0207699_10074388 3300025906 Unclassified 2087
516 Ga0207699_10323092 3300025906 Unclassified 1083
517 Ga0207699_10350058 3300025906 Unclassified 1043
518 Ga0207699_10355958 3300025906 Bacteria 1034
519 Ga0207699_10388545 3300025906 Unclassified 992
520 Ga0207699_10571628 3300025906 Unclassified 821
521 Ga0207699_10864199 3300025906 Unclassified 666
522 Ga0207643_10048132 3300025908 Unclassified 2414
523 Ga0207643_10268506 3300025908 Bacteria 1055
524 Ga0207684_10000081 3300025910 Bacteria 178619
525 Ga0207684_10001840 3300025910 Bacteria 22120
526 Ga0207684_10009103 3300025910 Bacteria 8794
527 Ga0207684_10031814 3300025910 Bacteria 4488
528 Ga0207684_10384666 3300025910 Bacteria 1207
529 Ga0207684_10677768 3300025910 Bacteria 877
530 Ga0207654_10114778 3300025911 Bacteria 1681
531 Ga0207654_10814068 3300025911 Unclassified 675
532 Ga0207707_10001674 3300025912 Bacteria 20441
533 Ga0207707_10075858 3300025912 Bacteria 2934
534 Ga0207707_10097311 3300025912 Bacteria 2572
535 Ga0207707_10130031 3300025912 Bacteria 2202
536 Ga0207707_10448517 3300025912 Bacteria 1104
537 Ga0207695_10057707 3300025913 Unclassified 4032
538 Ga0207695_10153914 3300025913 Bacteria 2236
539 Ga0207695_10174828 3300025913 Unclassified 2070
540 Ga0207695_10265838 3300025913 Bacteria 1612
541 Ga0207671_10205819 3300025914 Bacteria 1538
542 Ga0207671_10255870 3300025914 Bacteria 1377
543 Ga0207693_10000158 3300025915 Bacteria 63123
544 Ga0207693_10034140 3300025915 Bacteria 4013
545 Ga0207693_10064231 3300025915 Bacteria 2875
546 Ga0207693_10147713 3300025915 Bacteria 1848
547 Ga0207663_10000394 3300025916 Bacteria 18953
548 Ga0207663_10032188 3300025916 Bacteria 3111
549 Ga0207663_10078668 3300025916 Bacteria 2150
550 Ga0207663_10342332 3300025916 Unclassified 1130
551 Ga0207660_10278503 3300025917 Bacteria 1327
552 Ga0207660_10320270 3300025917 Unclassified 1238
553 Ga0207662_10037374 3300025918 Bacteria 2841
554 Ga0207662_10053551 3300025918 Bacteria 2404
555 Ga0207657_10015325 3300025919 Bacteria 7430
556 Ga0207657_10294081 3300025919 Bacteria 1287
557 Ga0207649_10073936 3300025920 Bacteria 2185
558 Ga0207652_10012797 3300025921 Bacteria 6784
559 Ga0207652_10146437 3300025921 Bacteria 2114
560 Ga0207652_10294892 3300025921 Bacteria 1463
561 Ga0207652_10452483 3300025921 Unclassified 1157
562 Ga0207652_10703205 3300025921 Bacteria 902
563 Ga0207652_10860311 3300025921 Bacteria 802
564 Ga0207646_10005419 3300025922 Bacteria 13420
565 Ga0207646_10006067 3300025922 Bacteria 12585
566 Ga0207646_10007260 3300025922 Bacteria 11294
567 Ga0207646_10012725 3300025922 Bacteria 8074
568 Ga0207646_10027006 3300025922 Bacteria 5233
569 Ga0207646_10029369 3300025922 Unclassified 4999
570 Ga0207646_10061824 3300025922 Bacteria 3343
571 Ga0207646_10329529 3300025922 Bacteria 1379
572 Ga0207681_10124784 3300025923 Bacteria 1894
573 Ga0207681_10654007 3300025923 Bacteria 871
574 Ga0207694_10019688 3300025924 Bacteria 5105
575 Ga0207694_10168890 3300025924 Bacteria 1770
576 Ga0207694_10276720 3300025924 Bacteria 1378
577 Ga0207650_10040781 3300025925 Bacteria 3399
578 Ga0207659_10049386 3300025926 Bacteria 2984
579 Ga0207687_10262754 3300025927 Bacteria 1377
580 Ga0207700_10000129 3300025928 Bacteria 44957
581 Ga0207700_10042548 3300025928 Unclassified 3331
582 Ga0207700_10070767 3300025928 Bacteria 2683
583 Ga0207700_10103724 3300025928 Bacteria 2274
584 Ga0207700_10104341 3300025928 Bacteria 2268
585 Ga0207700_10134610 3300025928 Bacteria 2022
586 Ga0207700_10159435 3300025928 Unclassified 1872
587 Ga0207700_10164803 3300025928 Bacteria 1843
588 Ga0207700_10190305 3300025928 Bacteria 1724
589 Ga0207700_10485981 3300025928 Bacteria 1091
590 Ga0207700_10692195 3300025928 Bacteria 910
591 Ga0207700_10730549 3300025928 Bacteria 884
592 Ga0207664_10000284 3300025929 Bacteria 38480
593 Ga0207664_10005601 3300025929 Bacteria 8594
594 Ga0207664_10079142 3300025929 Unclassified 2667
595 Ga0207664_10095160 3300025929 Bacteria 2450
596 Ga0207664_10176736 3300025929 Bacteria 1831
597 Ga0207664_10179871 3300025929 Bacteria 1815
598 Ga0207664_10352848 3300025929 Bacteria 1302
599 Ga0207664_10360630 3300025929 Bacteria 1288
600 Ga0207664_10416860 3300025929 Unclassified 1196
601 Ga0207664_10485638 3300025929 Bacteria 1105
602 Ga0207690_10154126 3300025932 Bacteria 1706
603 Ga0207690_10179007 3300025932 Bacteria 1595
604 Ga0207690_10561174 3300025932 Unclassified 929
605 Ga0207706_10095400 3300025933 Bacteria 2616
606 Ga0207706_10224285 3300025933 Bacteria 1645
607 Ga0207706_10421886 3300025933 Bacteria 1156
608 Ga0207706_10568231 3300025933 Bacteria 975
609 Ga0207686_10175518 3300025934 Unclassified 1515
610 Ga0207686_10578883 3300025934 Bacteria 881
611 Ga0207709_10013097 3300025935 Bacteria 4572
612 Ga0207709_10921136 3300025935 Unclassified 711
613 Ga0207670_10060699 3300025936 Bacteria 2577
614 Ga0207670_10093078 3300025936 Bacteria 2135
615 Ga0207670_10100911 3300025936 Unclassified 2061
616 Ga0207670_10329914 3300025936 Bacteria 1203
617 Ga0207669_10071781 3300025937 Bacteria 2177
618 Ga0207704_10024694 3300025938 Bacteria 3265
619 Ga0207704_10118716 3300025938 Bacteria 1805
620 Ga0207704_10252014 3300025938 Bacteria 1326
621 Ga0207665_10001257 3300025939 Bacteria 17084
622 Ga0207665_10015257 3300025939 Bacteria 5046
623 Ga0207665_10069495 3300025939 Bacteria 2402
624 Ga0207665_10270620 3300025939 Unclassified 1261
625 Ga0207665_10341024 3300025939 Bacteria 1129
626 Ga0207665_10611546 3300025939 Bacteria 852
627 Ga0207691_10002633 3300025940 Bacteria 17523
628 Ga0207691_10071410 3300025940 Bacteria 3133
629 Ga0207711_10011482 3300025941 Bacteria 7363
630 Ga0207711_10107485 3300025941 Bacteria 2477
631 Ga0207711_10167404 3300025941 Bacteria 1993
632 Ga0207711_10313318 3300025941 Bacteria 1449
633 Ga0207711_10321193 3300025941 Bacteria 1431
634 Ga0207711_10515005 3300025941 Bacteria 1115
635 Ga0207711_10742413 3300025941 Bacteria 915
636 Ga0207689_10006279 3300025942 Bacteria 10529
637 Ga0207689_10007004 3300025942 Bacteria 9912
638 Ga0207689_10021498 3300025942 Bacteria 5424
639 Ga0207689_10374078 3300025942 Bacteria 1186
640 Ga0207689_10405171 3300025942 Bacteria 1137
641 Ga0207661_10008597 3300025944 Bacteria 7297
642 Ga0207661_10018914 3300025944 Bacteria 5127
643 Ga0207661_10461724 3300025944 Bacteria 1157
644 Ga0207667_10001950 3300025949 Bacteria 25855
645 Ga0207667_10007869 3300025949 Bacteria 12730
646 Ga0207667_10315714 3300025949 Bacteria 1596
647 Ga0207667_10336764 3300025949 Bacteria 1540
648 Ga0207651_10006530 3300025960 Bacteria 6119
649 Ga0207651_10071608 3300025960 Bacteria 2458
650 Ga0207668_10477673 3300025972 Bacteria 1068
651 Ga0207640_10011254 3300025981 Bacteria 5060
652 Ga0207640_10016852 3300025981 Bacteria 4260
653 Ga0207640_10185949 3300025981 Bacteria 1562
654 Ga0207640_11077433 3300025981 Bacteria 710
655 Ga0207658_10412664 3300025986 Bacteria 1189
656 Ga0207677_10010884 3300026023 Bacteria 5163
657 Ga0207677_10011184 3300026023 Bacteria 5106
658 Ga0207677_10011507 3300026023 Bacteria 5050
659 Ga0207703_10006387 3300026035 Bacteria 9423
660 Ga0207703_10017744 3300026035 Bacteria 5557
661 Ga0207703_10032365 3300026035 Unclassified 4139
662 Ga0207703_10126285 3300026035 Unclassified 2203
663 Ga0207639_10205272 3300026041 Bacteria 1693
664 Ga0207639_10226049 3300026041 Unclassified 1619
665 Ga0207639_10246600 3300026041 Bacteria 1556
666 Ga0207639_10636652 3300026041 Bacteria 986
667 Ga0207639_11129248 3300026041 Bacteria 735
668 Ga0207678_10022374 3300026067 Bacteria 5537
669 Ga0207678_10305917 3300026067 Bacteria 1367
670 Ga0207708_10019652 3300026075 Bacteria 5095
671 Ga0207708_10069636 3300026075 Bacteria 2694
672 Ga0207702_10000962 3300026078 Bacteria 29642
673 Ga0207702_10000989 3300026078 Bacteria 29131
674 Ga0207702_10007050 3300026078 Bacteria 9615
675 Ga0207702_10037565 3300026078 Bacteria 4054
676 Ga0207702_10788659 3300026078 Unclassified 939
677 Ga0207641_10020452 3300026088 Bacteria 5435
678 Ga0207641_10044390 3300026088 Bacteria 3738
679 Ga0207641_10131116 3300026088 Unclassified 2251
680 Ga0207641_10141495 3300026088 Bacteria 2171
681 Ga0207641_10446599 3300026088 Bacteria 1249
682 Ga0207648_10000621 3300026089 Bacteria 39779
683 Ga0207648_10022238 3300026089 Bacteria 5697
684 Ga0207648_10120701 3300026089 Bacteria 2305
685 Ga0207676_10016801 3300026095 Bacteria 5298
686 Ga0207676_10077228 3300026095 Bacteria 2693
687 Ga0207676_10470759 3300026095 Bacteria 1188
688 Ga0207674_10000867 3300026116 Bacteria 39599
689 Ga0207674_10010008 3300026116 Bacteria 10793
690 Ga0207674_10134956 3300026116 Bacteria 2430
691 Ga0207674_10245849 3300026116 Unclassified 1736
692 Ga0207674_10314628 3300026116 Bacteria 1515
693 Ga0207674_11213828 3300026116 Unclassified 724
694 Ga0207675_100018660 3300026118 Bacteria 6475
695 Ga0207683_10084756 3300026121 Unclassified 2817
696 Ga0207683_10547133 3300026121 Unclassified 1070
697 Ga0207698_10584979 3300026142 Bacteria 1099
698 Ga0207698_11052493 3300026142 Bacteria 825
699 Ga0209588_1097025 3300027671 Bacteria 949
700 Ga0209813_10040724 3300027866 Bacteria 1413
701 Ga0209813_10066202 3300027866 Archaea 1165
702 Ga0207428_10000041 3300027907 Bacteria 203097
703 Ga0207428_10000275 3300027907 Bacteria 69128
704 Ga0207428_10058904 3300027907 Bacteria 3046
705 Ga0207428_10204447 3300027907 Bacteria 1485
706 Ga0265356_1000604 3300028017 Bacteria 6297
707 Ga0265356_1005173 3300028017 Bacteria 1569
708 Ga0268265_10042525 3300028380 Unclassified 3372
709 Ga0268265_10046839 3300028380 Bacteria 3235
710 Ga0268265_10243619 3300028380 Bacteria 1588
711 Ga0268265_10960392 3300028380 Bacteria 842
712 Ga0268264_10118544 3300028381 Bacteria 2329
713 Ga0268264_10144353 3300028381 Bacteria 2126
714 Ga0268264_10238210 3300028381 Bacteria 1684
715 Ga0268264_10318059 3300028381 Bacteria 1471
716 Ga0265338_10010883 3300028800 Bacteria 10586
717 Ga0265338_10025739 3300028800 Archaea 5961
718 Ga0265338_10106886 3300028800 Bacteria 2264
719 Ga0265338_10118254 3300028800 Unclassified 2118
720 Ga0265338_10247136 3300028800 Bacteria 1318
721 Ga0265338_10294286 3300028800 Unclassified 1182
722 Ga0265762_1000985 3300030760 Bacteria 5115
723 Ga0265762_1017137 3300030760 Unclassified 1317
724 Ga0265762_1035894 3300030760 Unclassified 955
725 Ga0265762_1045518 3300030760 Unclassified 868
726 Ga0265767_114267 3300030836 Unclassified 564
727 Ga0265765_1001211 3300030879 Bacteria 2332
728 Ga0265764_105869 3300030882 Unclassified 697
729 Ga0265761_104905 3300030889 Bacteria 690
730 Ga0265761_109430 3300030889 Unclassified 559
731 Ga0265761_109653 3300030889 Unclassified 554
732 Ga0265771_1012144 3300031010 Unclassified 654
733 Ga0265760_10000937 3300031090 Bacteria 8406
734 Ga0265760_10001736 3300031090 Bacteria 6410
735 Ga0265760_10009110 3300031090 Unclassified 2836
736 Ga0265760_10035082 3300031090 Unclassified 1484
737 Ga0265760_10035745 3300031090 Bacteria 1472
738 Ga0265760_10052458 3300031090 Bacteria 1229
739 Ga0265760_10100738 3300031090 Bacteria 913
740 Ga0265328_10026747 3300031239 Bacteria 2167
741 Ga0265325_10006060 3300031241 Bacteria 7394
742 Ga0265329_10175700 3300031242 Unclassified 699
743 Ga0265339_10008297 3300031249 Bacteria 6617
744 Ga0265339_10050165 3300031249 Bacteria 2283
745 Ga0265339_10075038 3300031249 Bacteria 1796
746 Ga0265316_10019366 3300031344 Bacteria 5823
747 Ga0265316_10153007 3300031344 Bacteria 1727
748 Ga0307408_100359352 3300031548 Bacteria 1238
749 Ga0265314_10026201 3300031711 Bacteria 4383
750 Ga0265314_10162857 3300031711 Unclassified 1355
751 Ga0265314_10202793 3300031711 Unclassified 1171
752 Ga0316576_10064560 3300031727 Bacteria 2689
753 Ga0316578_10061306 3300031728 Bacteria 2216
754 Ga0316577_10000601 3300031733 Bacteria 14839
755 Ga0316053_112410 3300032120 Bacteria 610
756 Ga0316212_1021929 3300033547 Bacteria 895
757 Ga0373926_0010630 3300035083 Unclassified 3086
758 Ga0373926_0045658 3300035083 Bacteria 1571
759 Ga0373928_0108807 3300035084 Bacteria 731
760 Ga0373934_0085175 3300035086 Unclassified 1271
761 Ga0373923_0038046 3300035111 Bacteria 1970
762 Ga0373923_0053782 3300035111 Unclassified 1693
763 Ga0373923_0543593 3300035111 Unclassified 569
764 Ga0373936_0007952 3300035113 Bacteria 3984
765 Ga0373936_0058037 3300035113 Bacteria 1575
766 Ga0373945_0001372 3300035116 Bacteria 7396
767 Ga0373945_0165827 3300035116 Bacteria 903
768 Ga0373953_0012564 3300035117 Bacteria 3003
769 Ga0373954_0011546 3300035118 Bacteria 3916
770 Ga0373956_0302832 3300035119 Unclassified 761
771 Ga0373943_0000120 3300035170 Bacteria 29179
772 Ga0373943_0045811 3300035170 Bacteria 2133
773 Ga0373946_0081654 3300035171 Bacteria 1416
774 Ga0373955_0510756 3300035172 Bacteria 734
775 Ga0316574_0110316 3300035398 Bacteria 1763
776 Ga0316574_0164241 3300035398 Bacteria 1430
777 Ga0373924_0169766 3300035410 Bacteria 958
778 Ga0373924_0186782 3300035410 Unclassified 912
779 Ga0373931_0142443 3300035691 Bacteria 1390
780 Ga0373935_0000522 3300035692 Bacteria 20030
781 Ga0373935_0087515 3300035692 Unclassified 2034
782 Ga0373927_0000062 3300035695 Bacteria 77303
783 Ga0373927_0405003 3300035695 Bacteria 900
784 Ga0373933_0085855 3300035724 Unclassified 1935
785 Ga0373933_0494220 3300035724 Bacteria 801
786 Ga0373933_0526703 3300035724 Unclassified 775
787 Ga0373947_0002314 3300035725 Bacteria 11513
788 Ga0373947_0050692 3300035725 Bacteria 2496
789 Ga0373947_0385304 3300035725 Bacteria 944
790 Ga0373937_0053682 3300036401 Bacteria 3697
791 Ga0373937_0119810 3300036401 Bacteria 2452
792 Ga0373937_0200567 3300036401 Bacteria 1875
793 Ga0373937_0996617 3300036401 Unclassified 786
794 Ga0373937_1099845 3300036401 Bacteria 743
795 Ga0265778_043107 3300036457 Unclassified 605
796 Ga0265778_051187 3300036457 Unclassified 565
797 Ga0265778_053004 3300036457 Unclassified 558
798 Ga0265778_053804 3300036457 Unclassified 554
799 Ga0316582_0066874 3300036647 Bacteria 2318
800 Ga0316582_0200621 3300036647 Bacteria 1361
801 Ga0316584_0449160 3300036712 Unclassified 912
802 Ga0373925_0039043 3300037068 Bacteria 3512
803 Ga0436365_0750672 3300039437 Bacteria 1477
804 Ga0436365_0901241 3300039437 Bacteria 2533
805 Ga0436365_0993814 3300039437 Bacteria 1665
806 Ga0453683_0193623 3300044673 Bacteria 1290
807 Ga0466966_0150104 3300044684 Bacteria 1422
808 Ga0466961_0137896 3300044693 Bacteria 1528
809 Ga0466961_0359016 3300044693 Unclassified 886
810 Ga0466963_0047151 3300044694 Bacteria 2844
811 Ga0466964_0254808 3300044706 Unclassified 867
812 Ga0466971_0076486 3300044719 Bacteria 1523
813 Ga0466957_0245495 3300044842 Bacteria 1189
814 Ga0466959_0114973 3300045049 Bacteria 1917
815 Ga0466959_0464586 3300045049 Unclassified 857
816 Ga0466959_0685535 3300045049 Unclassified 687
817 Ga0451576_0181316 3300045051 Bacteria 2199
818 Ga0451576_0267497 3300045051 Bacteria 1787
819 Ga0451576_0566645 3300045051 Bacteria 1193
820 Ga0451576_0750609 3300045051 Unclassified 1025
821 Ga0466958_0456214 3300045836 Unclassified 828
822 Ga0466967_0005791 3300045976 Bacteria 8642
823 Ga0466967_0419735 3300045976 Unclassified 1304
824 Ga0495629_0005749 3300046459 Bacteria 9259
825 Ga0495651_0565337 3300046462 Unclassified 721
826 Ga0495580_0009994 3300046472 Bacteria 7418
827 Ga0495580_0016836 3300046472 Bacteria 5483
828 Ga0495580_0042692 3300046472 Bacteria 3229
829 Ga0495580_0118118 3300046472 Bacteria 1841
830 Ga0495580_0183100 3300046472 Bacteria 1446
831 Ga0495580_0191137 3300046472 Bacteria 1412
832 Ga0495580_0374468 3300046472 Unclassified 962
833 Ga0495582_0075957 3300046473 Bacteria 1861
834 Ga0495662_0368296 3300046476 Unclassified 706
835 Ga0495664_0128957 3300046477 Unclassified 1531
836 Ga0495594_0041367 3300046499 Unclassified 2524
837 Ga0495628_0084490 3300046516 Unclassified 2463
838 Ga0495630_0386161 3300046517 Unclassified 1072
839 Ga0495665_0036666 3300046531 Bacteria 2618
840 Ga0495665_0324789 3300046531 Bacteria 786
841 Ga0495640_0400585 3300046533 Unclassified 843
842 Ga0495587_0076648 3300046536 Bacteria 1942
843 Ga0495621_0091896 3300046539 Unclassified 1145
844 Ga0495645_0157460 3300046543 Unclassified 1573
845 Ga0495667_0134397 3300046559 Bacteria 1595
846 Ga0495635_0157070 3300046663 Unclassified 1548
847 Ga0495635_0543856 3300046663 Bacteria 762
848 Ga0495588_0522562 3300046674 Bacteria 622
849 Ga0495657_0223993 3300046675 Unclassified 1139
850 Ga0495657_0357040 3300046675 Bacteria 864
851 Ga0495599_0392878 3300046678 Bacteria 827
852 Ga0495623_0038268 3300046679 Unclassified 3068
853 Ga0495623_0072214 3300046679 Unclassified 2146
854 Ga0495623_0151350 3300046679 Unclassified 1371
855 Ga0495623_0377821 3300046679 Unclassified 767
856 Ga0495669_0123006 3300046684 Bacteria 1217
857 Ga0495624_0129430 3300046690 Unclassified 1548
858 Ga0495624_0161273 3300046690 Bacteria 1370
859 Ga0495600_0037963 3300046809 Bacteria 3133
860 Ga0495604_0192502 3300047317 Bacteria 1420
861 Ga0495674_0007407 3300047319 Bacteria 10488
862 Ga0495674_0352148 3300047319 Bacteria 1195
863 Ga0495674_0620847 3300047319 Bacteria 855
864 Ga0495672_0000913 3300047320 Bacteria 30912
865 Ga0495680_0466195 3300047322 Unclassified 862
866 Ga0495675_0148498 3300047444 Bacteria 1449
867 Ga0495675_0423458 3300047444 Unclassified 773
868 Ga0495602_0126162 3300048088 Bacteria 2050
869 Ga0495602_0468993 3300048088 Unclassified 885
870 Ga0495614_0159220 3300048089 Bacteria 1010
871 Ga0496100_0046426 3300048903 Bacteria 2793
872 Ga0496100_0474121 3300048903 Unclassified 962
873 Ga0496101_0069925 3300048904 Bacteria 2569
874 Ga0496102_0002080 3300048905 Bacteria 17214
875 Ga0496102_0812085 3300048905 Bacteria 857
876 Ga0496103_0036041 3300048906 Bacteria 3029
877 Ga0496103_0108811 3300048906 Bacteria 1759
878 Ga0496104_0023678 3300048907 Bacteria 5647
879 Ga0496104_0079480 3300048907 Unclassified 3126
880 Ga0496104_0120200 3300048907 Unclassified 2522
881 Ga0496104_0339199 3300048907 Unclassified 1416
882 Ga0496104_0427338 3300048907 Bacteria 1237
883 Ga0496105_0292993 3300048908 Unclassified 1310
884 Ga0496105_0531737 3300048908 Unclassified 920
885 Ga0496105_0728469 3300048908 Bacteria 759
886 Ga0496106_0061196 3300048909 Unclassified 2856
887 Ga0496106_0188037 3300048909 Bacteria 1641
888 Ga0496107_0169793 3300048910 Bacteria 1618
889 Ga0496108_0040547 3300048911 Bacteria 3882
890 Ga0496108_0266153 3300048911 Bacteria 1492
891 Ga0496109_1017819 3300048912 Bacteria 766
892 Ga0496110_0113142 3300048913 Bacteria 2440
893 Ga0496111_0092455 3300048914 Bacteria 2217
894 Ga0496112_0001114 3300048915 Bacteria 19958
895 Ga0496112_0002004 3300048915 Bacteria 16104
896 Ga0496112_0035410 3300048915 Bacteria 4863
897 Ga0496112_0151319 3300048915 Unclassified 2287
898 Ga0496112_0190132 3300048915 Bacteria 2015
899 Ga0496112_0428782 3300048915 Bacteria 1261
900 Ga0496113_0051332 3300048916 Bacteria 3077
901 Ga0496113_0101182 3300048916 Unclassified 2234
902 Ga0496113_0591309 3300048916 Unclassified 889
903 Ga0496114_0293785 3300048917 Bacteria 1434
904 Ga0496115_0054981 3300048918 Unclassified 3197
905 Ga0496115_0178775 3300048918 Bacteria 1754
906 Ga0501291_017803 3300049514 Bacteria 1098
907 Ga0501294_010505 3300049517 Bacteria 915
908 Ga0501297_011707 3300049520 Bacteria 1010
909 Ga0501298_002952 3300049521 Bacteria 2612
910 Ga0501301_005965 3300049524 Bacteria 906
911 Ga0501032_0183160 3300049569 Unclassified 1371
912 Ga0501033_0382225 3300049570 Unclassified 984
913 Ga0501036_0677804 3300049572 Unclassified 853
914 Ga0501036_0795681 3300049572 Unclassified 779
915 Ga0501038_0068246 3300049574 Bacteria 3023
916 Ga0501039_0348759 3300049575 Unclassified 1163
917 Ga0501040_0108766 3300049576 Bacteria 1938
918 Ga0501048_0048405 3300049582 Bacteria 3032
919 Ga0501048_0673244 3300049582 Unclassified 743
920 Ga0501071_0086416 3300049587 Unclassified 2300
921 Ga0501071_1003467 3300049587 Unclassified 645
922 Ga0501072_0156715 3300049588 Unclassified 1816
923 Ga0501072_0763666 3300049588 Unclassified 758
924 Ga0501074_0154850 3300049590 Unclassified 1638
925 Ga0501075_0187856 3300049591 Unclassified 1576
926 Ga0501075_0319619 3300049591 Unclassified 1183
927 Ga0501075_0414302 3300049591 Unclassified 1027
928 Ga0501076_0001228 3300049592 Bacteria 17052
929 Ga0501077_0792186 3300049593 Unclassified 609
930 Ga0501257_169945 3300049686 Bacteria 611
931 Ga0501079_0210230 3300049741 Bacteria 1520
932 Ga0501080_0120457 3300049742 Bacteria 2432
933 Ga0501081_0144580 3300049743 Unclassified 1706
934 Ga0501081_0482464 3300049743 Bacteria 923
935 Ga0501083_0389818 3300049744 Unclassified 906
936 Ga0501035_0628743 3300049822 Unclassified 872
937 Ga0501045_0061368 3300049824 Bacteria 2758
938 nmdc:mga03683_28667_c1 3300050489 Unclassified 2216
939 nmdc:mga03n38_51735_c1 3300050490 Bacteria 1835
940 nmdc:mga03n38_84975_c1 3300050490 Unclassified 1495
941 nmdc:mga00v17_147142_c1 3300050491 Bacteria 1512
942 nmdc:mga00v17_149537_c1 3300050491 Bacteria 1500
943 nmdc:mga00v17_334036_c1 3300050491 Unclassified 985
944 nmdc:mga00v17_9694_c1 3300050491 Bacteria 5225
945 nmdc:mga0yw44_11427_c1 3300050492 Unclassified 706
946 nmdc:mga0k408_182_c1 3300050493 Bacteria 32998
947 nmdc:mga06z11_27669_c1 3300050494 Unclassified 2712
948 nmdc:mga06z11_528728_c1 3300050494 Bacteria 715
949 nmdc:mga06z11_726815_c1 3300050494 Unclassified 605
950 nmdc:mga06z11_7564_c1 3300050494 Bacteria 4480
951 nmdc:mga04h51_20597_c1 3300050495 Unclassified 1971
952 nmdc:mga07m45_233158_c1 3300050496 Unclassified 1071
953 nmdc:mga07m45_24324_c1 3300050496 Bacteria 3316
954 nmdc:mga05p37_102551_c1 3300050507 Bacteria 3523
955 nmdc:mga05p37_111978_c1 3300050507 Bacteria 3356
956 nmdc:mga05p37_186901_c1 3300050507 Bacteria 2518
957 nmdc:mga05p37_209263_c2 3300050507 Unclassified 738
958 nmdc:mga05p37_25947_c1 3300050507 Bacteria 7125
959 nmdc:mga05p37_261661_c1 3300050507 Unclassified 2070
960 nmdc:mga05p37_276941_c1 3300050507 Unclassified 2003
961 nmdc:mga05p37_41819_c1 3300050507 Bacteria 5628
962 nmdc:mga05p37_511961_c1 3300050507 Bacteria 1375
963 nmdc:mga05p37_83677_c1 3300050507 Bacteria 3930
964 nmdc:mga09592_133886_c1 3300050508 Bacteria 2134
965 nmdc:mga09592_15944_c1 3300050508 Bacteria 6139
966 nmdc:mga09592_22740_c1 3300050508 Bacteria 5173
967 nmdc:mga09592_469_c1 3300050508 Bacteria 30199
968 nmdc:mga09592_6307_c1 3300050508 Bacteria 9663
969 nmdc:mga0qj67_42830_c1 3300050509 Bacteria 3564
970 nmdc:mga0qj67_54471_c1 3300050509 Unclassified 3167
971 nmdc:mga0qj67_999860_c1 3300050509 Bacteria 656
972 nmdc:mga06r32_1189786_c1 3300050510 Unclassified 709
973 nmdc:mga06r32_209913_c1 3300050510 Bacteria 1935
974 nmdc:mga06r32_243590_c1 3300050510 Unclassified 1785
975 nmdc:mga06r32_277455_c1 3300050510 Bacteria 1307
976 nmdc:mga06r32_3704_c1 3300050510 Bacteria 13657
977 nmdc:mga06r32_497697_c1 3300050510 Bacteria 1196
978 nmdc:mga08y16_1210895_c1 3300050511 Unclassified 725
979 nmdc:mga08y16_2217_c1 3300050511 Bacteria 19922
980 nmdc:mga08y16_93220_c1 3300050511 Bacteria 3138
981 nmdc:mga0n895_318543_c1 3300050512 Bacteria 1576
982 nmdc:mga0n895_405695_c1 3300050512 Unclassified 1378
983 nmdc:mga0n895_546683_c1 3300050512 Bacteria 1164
984 nmdc:mga0n895_867412_c1 3300050512 Bacteria 890
985 nmdc:mga0rr50_23013_c1 3300050513 Bacteria 4287
986 nmdc:mga0rr50_277418_c1 3300050513 Bacteria 1398
987 nmdc:mga0rr50_405662_c1 3300050513 Bacteria 1152
988 nmdc:mga08x19_10096_c1 3300050514 Bacteria 5664
989 nmdc:mga08x19_101960_c1 3300050514 Bacteria 1905
990 nmdc:mga08x19_107610_c1 3300050514 Unclassified 1856
991 nmdc:mga08x19_18051_c1 3300050514 Bacteria 4323
992 nmdc:mga0a205_218639_c1 3300050515 Bacteria 1792
993 nmdc:mga0a205_63371_c1 3300050515 Bacteria 3571
994 nmdc:mga0a205_670946_c1 3300050515 Bacteria 887
995 nmdc:mga0a205_72213_c1 3300050515 Bacteria 3334
996 nmdc:mga0a205_829624_c1 3300050515 Unclassified 772
997 Ga0495601_0017230 3300053077 Bacteria 4385
998 Ga0495601_0142788 3300053077 Bacteria 1562
999 Ga0495601_0355100 3300053077 Unclassified 953
1000 Ga0500588_0170093 3300053146 Bacteria 797
1001 Ga0500590_176738 3300053148 Bacteria 932
1002 Ga0501084_0127183 3300054114 Bacteria 2145
1003 Ga0501084_0508330 3300054114 Bacteria 1018
1004 Ga0587066_022077 3300059490 Bacteria 1061
1005 Ga0587070_091793 3300059491 Unclassified 684
1006 Ga0587073_0133613 3300059492 Unclassified 684
1007 Ga0587083_0127223 3300059505 Unclassified 665
1008 Ga0587085_078525 3300059506 Unclassified 660
1009 Ga0587088_063155 3300059508 Unclassified 755
1010 Ga0587090_051561 3300059510 Unclassified 755
1011 Ga0587091_103118 3300059511 Unclassified 672
1012 Ga0587094_054531 3300059513 Unclassified 685
1013 Ga0587113_022974 3300059625 Unclassified 668
1014 Ga0587128_070954 3300059630 Unclassified 678
1015 Ga0587128_089401 3300059630 Unclassified 629
1016 Ga0587067_095536 3300059640 Unclassified 680
1017 Ga0587068_099442 3300059641 Unclassified 609
1018 Ga0587076_094883 3300059645 Bacteria 658
1019 Ga0587078_032194 3300059646 Unclassified 711
1020 Ga0587114_052490 3300059655 Unclassified 694
1021 Ga0501082_0779620 3300060353 Unclassified 836
1022 Ga0501082_0840708 3300060353 Bacteria 803
1023 Ga0466962_0113791 3300061719 Bacteria 1303
1024 Ga0530510_0045990 3300061734 Bacteria 3154
1025 Ga0530510_0343135 3300061734 Bacteria 1121
1026 Ga0530510_0694816 3300061734 Bacteria 775
1027 Ga0070709_10702105
1028 MRS1b_contig_3743146
1029 MRS1b_contig_4719877
1030 MBSR1b_contig_376918
1031 LJNas_1000022
1032 rootL2_10303851
1033 rootH1_10335305
1034 Ga0058859_11454794
1035 Ga0058863_11867713
1036 Ga0058863_11966271
1037 Ga0058861_10061650
1038 Ga0058860_11825380
1039 Ga0058862_12739121
1040 Ga0065704_10171747
1041 Ga0065712_10098164
1042 Ga0065712_10558904
1043 Ga0065715_10040951
1044 Ga0065707_10159589
1045 Ga0070658_10293117
1046 Ga0070676_10395109
1047 Ga0070683_100011670
1048 Ga0070683_100076106
1049 Ga0070683_100140291
1050 Ga0070683_100662715
1051 Ga0070690_100766569
1052 Ga0070670_100024685
1053 Ga0070670_101074019
1054 Ga0068869_100001094
1055 Ga0068869_100004860
1056 Ga0068869_100083630
1057 Ga0070666_10451809
1058 Ga0070666_10508422
1059 Ga0070680_100083264
1060 Ga0070680_100107961
1061 Ga0070680_100120414
1062 Ga0070680_100214334
1063 Ga0070680_100987537
1064 Ga0068868_100001559
1065 Ga0068868_100006728
1066 Ga0068868_100008270
1067 Ga0068868_100068976
1068 Ga0068868_101271065
1069 Ga0070660_100286934
1070 Ga0070689_100008073
1071 Ga0070689_100011858
1072 Ga0070691_10189837
1073 Ga0070687_100013069
1074 Ga0070687_100111448
1075 Ga0070661_100199992
1076 Ga0070692_10059706
1077 Ga0070668_100139362
1078 Ga0070668_101136287
1079 Ga0070669_100250282
1080 Ga0070669_100568879
1081 Ga0070669_100926776
1082 Ga0070675_100166546
1083 Ga0070675_100192372
1084 Ga0070671_100318248
1085 Ga0070671_100351039
1086 Ga0070673_100079167
1087 Ga0070673_100150532
1088 Ga0070688_100089161
1089 Ga0070688_100486479
1090 Ga0070659_100249007
1091 Ga0070667_100440812
1092 Ga0070667_100495438
1093 Ga0070709_10132896
1094 Ga0070709_10171665
1095 Ga0070709_10321213
1096 Ga0070709_11073338
1097 Ga0070714_100005380
1098 Ga0070714_100019795
1099 Ga0070714_100117417
1100 Ga0070714_100200088
1101 Ga0070714_100324997
1102 Ga0070714_100415969
1103 Ga0070713_100000460
1104 Ga0070713_100041420
1105 Ga0070713_100042459
1106 Ga0070713_100111171
1107 Ga0070713_100185078
1108 Ga0070713_100342865
1109 Ga0070713_100356650
1110 Ga0070713_100469068
1111 Ga0070713_100680935
1112 Ga0070710_10044792
1113 Ga0070710_10135353
1114 Ga0070710_10163999
1115 Ga0070710_10180310
1116 Ga0070701_10012483
1117 Ga0070711_100000656
1118 Ga0070711_100013246
1119 Ga0070711_100085734
1120 Ga0070711_100191559
1121 Ga0070711_100197507
1122 Ga0070711_100351292
1123 Ga0070711_101179825
1124 Ga0070705_100066046
1125 Ga0070705_100167949
1126 Ga0070700_100025428
1127 Ga0070694_100025427
1128 Ga0070694_100150788
1129 Ga0070694_100174306
1130 Ga0070694_100495132
1131 Ga0070708_100001918
1132 Ga0070708_100002306
1133 Ga0070708_100008762
1134 Ga0070708_100019770
1135 Ga0070708_100061160
1136 Ga0070708_100469920
1137 Ga0070708_100471199
1138 Ga0070708_100535594
1139 Ga0070663_100032244
1140 Ga0070663_100136037
1141 Ga0070678_100006161
1142 Ga0070678_100517427
1143 Ga0070662_100115609
1144 Ga0070662_100508637
1145 Ga0070662_100556797
1146 Ga0070662_100688452
1147 Ga0070681_10000242
1148 Ga0070681_10087482
1149 Ga0070681_10139074
1150 Ga0070681_10165112
1151 Ga0070681_10171172
1152 Ga0070681_10562788
1153 Ga0070681_10802521
1154 Ga0068867_100008371
1155 Ga0068867_100167497
1156 Ga0070685_10024826
1157 Ga0070685_10029052
1158 Ga0070706_100008661
1159 Ga0070706_100019421
1160 Ga0070706_100020092
1161 Ga0070706_100060134
1162 Ga0070706_100088518
1163 Ga0070706_100193011
1164 Ga0070706_100267843
1165 Ga0070707_100003999
1166 Ga0070707_100008148
1167 Ga0070707_100015413
1168 Ga0070707_100021880
1169 Ga0070707_100031054
1170 Ga0070707_100051410
1171 Ga0070707_100075803
1172 Ga0070707_100129018
1173 Ga0070707_100148170
1174 Ga0070707_100696610
1175 Ga0070698_100000182
1176 Ga0070698_100001098
1177 Ga0070698_100010878
1178 Ga0070698_100011307
1179 Ga0070698_100116352
1180 Ga0070698_100252375
1181 Ga0070698_100716924
1182 Ga0070698_100813766
1183 Ga0070698_100956638
1184 Ga0070699_100002044
1185 Ga0070699_100003968
1186 Ga0070699_100007000
1187 Ga0070699_100036337
1188 Ga0070699_100094700
1189 Ga0070699_100454251
1190 Ga0070699_100472375
1191 Ga0070699_101339404
1192 Ga0070679_100016723
1193 Ga0070679_100029648
1194 Ga0070679_100060877
1195 Ga0070679_100106030
1196 Ga0070679_100519375
1197 Ga0070684_100083051
1198 Ga0070684_100480673
1199 Ga0070697_100000045
1200 Ga0070697_100003087
1201 Ga0070697_100006105
1202 Ga0070697_100007161
1203 Ga0070697_100008121
1204 Ga0070697_100012774
1205 Ga0070697_100045258
1206 Ga0070697_100217099
1207 Ga0070697_100309586
1208 Ga0070697_100564365
1209 Ga0068853_100018922
1210 Ga0068853_100190406
1211 Ga0068853_100209777
1212 Ga0068853_100502772
1213 Ga0070672_100005147
1214 Ga0070672_100063481
1215 Ga0070686_100413406
1216 Ga0070686_100447109
1217 Ga0070695_100008702
1218 Ga0070695_100157767
1219 Ga0070696_100300129
1220 Ga0070693_100968378
1221 Ga0070704_100007901
1222 Ga0070704_100034509
1223 Ga0070704_100050303
1224 Ga0070704_100179979
1225 Ga0070704_100187540
1226 Ga0070704_100224288
1227 Ga0070704_100470105
1228 Ga0070704_100479902
1229 Ga0070704_100813382
1230 Ga0068855_100000722
1231 Ga0068855_100012781
1232 Ga0068855_100059377
1233 Ga0068855_100078538
1234 Ga0068855_100162078
1235 Ga0068855_100792601
1236 Ga0070664_100002060
1237 Ga0070664_100057431
1238 Ga0070664_100060588
1239 Ga0068857_100005616
1240 Ga0068857_100006773
1241 Ga0068857_100162149
1242 Ga0068857_100162791
1243 Ga0068857_100226896
1244 Ga0068857_100504760
1245 Ga0068854_100007803
1246 Ga0068854_100008281
1247 Ga0068854_100012746
1248 Ga0068854_100039098
1249 Ga0068854_100281380
1250 Ga0068854_100461935
1251 Ga0068856_100000893
1252 Ga0068856_100001601
1253 Ga0068856_100010172
1254 Ga0068856_100025934
1255 Ga0068856_100140369
1256 Ga0068856_100274670
1257 Ga0068856_100321255
1258 Ga0068856_100569109
1259 Ga0068852_100061504
1260 Ga0068852_100166419
1261 Ga0068859_100001851
1262 Ga0068859_100003598
1263 Ga0068859_100008916
1264 Ga0068859_100012850
1265 Ga0068859_100328245
1266 Ga0068859_101308894
1267 Ga0068864_100007801
1268 Ga0068864_100146501
1269 Ga0068864_100171899
1270 Ga0068864_100693499
1271 Ga0068864_100954342
1272 Ga0068861_100035120
1273 Ga0068861_100168998
1274 Ga0068851_10018899
1275 Ga0068870_10040462
1276 Ga0068870_10071433
1277 Ga0068870_10385212
1278 Ga0068863_100017333
1279 Ga0068863_100027438
1280 Ga0068863_100037911
1281 Ga0068863_100091673
1282 Ga0068863_100094527
1283 Ga0068863_100541306
1284 Ga0068858_100001080
1285 Ga0068858_100001918
1286 Ga0068858_100024884
1287 Ga0068858_100038794
1288 Ga0068858_100096333
1289 Ga0068858_100272306
1290 Ga0068860_100039593
1291 Ga0068860_100063271
1292 Ga0068860_100089107
1293 Ga0068860_100148545
1294 Ga0068860_100178131
1295 Ga0068860_100288257
1296 Ga0068860_100358033
1297 Ga0068860_100518184
1298 Ga0068862_100126415
1299 Ga0068862_100344383
1300 Ga0068862_100694919
1301 Ga0081455_10162099
1302 Ga0081540_1051473
1303 Ga0070717_10001125
1304 Ga0070717_10014637
1305 Ga0070717_10025999
1306 Ga0070717_10037812
1307 Ga0070717_10070833
1308 Ga0070717_10108607
1309 Ga0070717_10171078
1310 Ga0070717_10220687
1311 Ga0070717_10314866
1312 Ga0070717_10436755
1313 Ga0075365_10026433
1314 Ga0075365_10068707
1315 Ga0075368_10087693
1316 Ga0075363_100050938
1317 Ga0075364_10097475
1318 Ga0075364_10227900
1319 Ga0070715_10075192
1320 Ga0070715_10337078
1321 Ga0070716_100020885
1322 Ga0070716_100023415
1323 Ga0070716_100067732
1324 Ga0070716_100193397
1325 Ga0070716_100216756
1326 Ga0070716_100302612
1327 Ga0070716_100671693
1328 Ga0070712_100000117
1329 Ga0070712_100001433
1330 Ga0070712_100060003
1331 Ga0070712_100085354
1332 Ga0070712_100192019
1333 Ga0070712_100216154
1334 Ga0075362_10000281
1335 Ga0075362_10317791
1336 Ga0075367_10021802
1337 Ga0075367_10034626
1338 Ga0075366_10000367
1339 Ga0097621_100000058
1340 Ga0097621_100000214
1341 Ga0097621_100002700
1342 Ga0097621_100096277
1343 Ga0097621_100112189
1344 Ga0097621_100154053
1345 Ga0068871_100000167
1346 Ga0068871_100001129
1347 Ga0068871_100033834
1348 Ga0068871_100094064
1349 Ga0068871_100232613
1350 Ga0068871_100500600
1351 Ga0075428_100041624
1352 Ga0075428_100177918
1353 Ga0075428_100460585
1354 Ga0075430_100038683
1355 Ga0075430_100048471
1356 Ga0075430_100697451
1357 Ga0075431_100000068
1358 Ga0075431_100269302
1359 Ga0075431_100434565
1360 Ga0075431_100512925
1361 Ga0075431_100715897
1362 Ga0075431_100744691
1363 Ga0075431_100810987
1364 Ga0075433_10022035
1365 Ga0075433_10074838
1366 Ga0075433_10100418
1367 Ga0075433_10147954
1368 Ga0075433_10921779
1369 Ga0075433_10975567
1370 Ga0075434_100011129
1371 Ga0075434_100078897
1372 Ga0075434_100139032
1373 Ga0075434_100294114
1374 Ga0075434_100535245
1375 Ga0075429_100000340
1376 Ga0075429_100030110
1377 Ga0075429_100160664
1378 Ga0068865_100293594
1379 Ga0075436_100012092
1380 Ga0075436_100094035
1381 Ga0075436_100129329
1382 Ga0075436_100304465
1383 Ga0097620_100001850
1384 Ga0097620_100003598
1385 Ga0097620_100008916
1386 Ga0097620_100012850
1387 Ga0097620_100328225
1388 Ga0097620_101309049
1389 Ga0075435_100026673
1390 Ga0075435_100066652
1391 Ga0099794_10195183
1392 Ga0099795_10106782
1393 Ga0105240_10076862
1394 Ga0105240_10115522
1395 Ga0105240_10156926
1396 Ga0111539_10000594
1397 Ga0111539_10051539
1398 Ga0111539_10209694
1399 Ga0111539_12166290
1400 Ga0105245_10008717
1401 Ga0105245_10277975
1402 Ga0105245_11158046
1403 Ga0105247_10131199
1404 Ga0105247_10277664
1405 Ga0114129_10001988
1406 Ga0114129_10043115
1407 Ga0114129_10102611
1408 Ga0114129_10116598
1409 Ga0114129_10126576
1410 Ga0114129_10137126
1411 Ga0114129_10499207
1412 Ga0114129_10957685
1413 Ga0105243_10087448
1414 Ga0105243_11438335
1415 Ga0105241_10029168
1416 Ga0105241_10042322
1417 Ga0105241_10126627
1418 Ga0105241_10316689
1419 Ga0105241_10461648
1420 Ga0105242_10013831
1421 Ga0105242_10132852
1422 Ga0105242_10572270
1423 Ga0105242_10743336
1424 Ga0105242_10809000
1425 Ga0105248_10014941
1426 Ga0105248_10069290
1427 Ga0105248_10082685
1428 Ga0105248_10089677
1429 Ga0105248_10091875
1430 Ga0105248_10173639
1431 Ga0105248_10258773
1432 Ga0105248_10519462
1433 Ga0105237_10040678
1434 Ga0105237_10191521
1435 Ga0105237_10417674
1436 Ga0105237_10733999
1437 Ga0105238_10006322
1438 Ga0105238_11352553
1439 Ga0105249_10420134
1440 Ga0105239_10007920
1441 Ga0105239_10044315
1442 Ga0105239_10233069
1443 Ga0105239_10543099
1444 Ga0105246_10091183
1445 Ga0157373_10043823
1446 Ga0157371_10037588
1447 Ga0157370_10181120
1448 Ga0157369_10000592
1449 Ga0157369_10000794
1450 Ga0157369_10079290
1451 Ga0157369_10654845
1452 Ga0157369_10806255
1453 Ga0157369_10882658
1454 Ga0157374_10000181
1455 Ga0157374_10145719
1456 Ga0157374_10155817
1457 Ga0157374_10939060
1458 Ga0157378_10000429
1459 Ga0157378_10000680
1460 Ga0157378_10002074
1461 Ga0157378_10005249
1462 Ga0157378_10063848
1463 Ga0157378_10110691
1464 Ga0157378_10145631
1465 Ga0163162_10126222
1466 Ga0163162_10157427
1467 Ga0163162_10202660
1468 Ga0163162_10244102
1469 Ga0163162_10520870
1470 Ga0163162_10577872
1471 Ga0157372_10001790
1472 Ga0157372_10004416
1473 Ga0157372_10005439
1474 Ga0157372_10039482
1475 Ga0157372_10046271
1476 Ga0157372_10314946
1477 Ga0157372_10849705
1478 Ga0157372_11086871
1479 Ga0157372_11108930
1480 Ga0157375_10045058
1481 Ga0157375_10159235
1482 Ga0157375_10188103
1483 Ga0157375_10692285
1484 Ga0157375_11327355
1485 Ga0163163_10007167
1486 Ga0163163_10200487
1487 Ga0163163_10522474
1488 Ga0157380_10004649
1489 Ga0157380_10075487
1490 Ga0157380_10938989
1491 Ga0182008_10021755
1492 Ga0157377_10080770
1493 Ga0157377_10081733
1494 Ga0157379_10005240
1495 Ga0157379_10107467
1496 Ga0157379_10395246
1497 Ga0157376_10017528
1498 Ga0157376_10084529
1499 Ga0157376_10085534
1500 Ga0182007_10031543
1501 Ga0182005_1029456
1502 Ga0163161_10031147
1503 Ga0184601_125905
1504 Ga0184600_138855
1505 Ga0184603_148376
1506 Ga0206356_10627380
1507 Ga0206356_10816522
1508 Ga0206349_1885320
1509 Ga0206355_1123533
1510 Ga0206352_10589987
1511 Ga0206352_10614394
1512 Ga0206350_10869449
1513 Ga0206354_10872379
1514 Ga0206353_11757009
1515 Ga0213876_10038282
1516 Ga0224712_10150682
1517 Ga0224712_10308664
1518 Ga0224570_100361
1519 Ga0247553_109522
1520 Ga0228600_1003986
1521 Ga0224572_1004119
1522 Ga0224572_1010950
1523 Ga0224572_1016643
1524 Ga0224572_1020018
1525 Ga0224572_1020278
1526 Ga0228598_1008363
1527 Ga0228598_1009848
1528 Ga0207656_10035109
1529 Ga0207653_10042422
1530 Ga0207692_10027459
1531 Ga0207692_10241923
1532 Ga0207642_10256328
1533 Ga0207688_10176572
1534 Ga0207680_10205149
1535 Ga0207680_10218296
1536 Ga0207647_10002148
1537 Ga0207647_10005640
1538 Ga0207647_10456588
1539 Ga0207685_10040547
1540 Ga0207699_10049464
1541 Ga0207699_10074388
1542 Ga0207699_10323092
1543 Ga0207699_10350058
1544 Ga0207699_10355958
1545 Ga0207699_10388545
1546 Ga0207699_10571628
1547 Ga0207699_10864199
1548 Ga0207643_10048132
1549 Ga0207643_10268506
1550 Ga0207684_10000081
1551 Ga0207684_10001840
1552 Ga0207684_10009103
1553 Ga0207684_10031814
1554 Ga0207684_10384666
1555 Ga0207684_10677768
1556 Ga0207654_10114778
1557 Ga0207654_10814068
1558 Ga0207707_10001674
1559 Ga0207707_10075858
1560 Ga0207707_10097311
1561 Ga0207707_10130031
1562 Ga0207707_10448517
1563 Ga0207695_10057707
1564 Ga0207695_10153914
1565 Ga0207695_10174828
1566 Ga0207695_10265838
1567 Ga0207671_10205819
1568 Ga0207671_10255870
1569 Ga0207693_10000158
1570 Ga0207693_10034140
1571 Ga0207693_10064231
1572 Ga0207693_10147713
1573 Ga0207663_10000394
1574 Ga0207663_10032188
1575 Ga0207663_10078668
1576 Ga0207663_10342332
1577 Ga0207660_10278503
1578 Ga0207660_10320270
1579 Ga0207662_10037374
1580 Ga0207662_10053551
1581 Ga0207657_10015325
1582 Ga0207657_10294081
1583 Ga0207649_10073936
1584 Ga0207652_10012797
1585 Ga0207652_10146437
1586 Ga0207652_10294892
1587 Ga0207652_10452483
1588 Ga0207652_10703205
1589 Ga0207652_10860311
1590 Ga0207646_10005419
1591 Ga0207646_10006067
1592 Ga0207646_10007260
1593 Ga0207646_10012725
1594 Ga0207646_10027006
1595 Ga0207646_10029369
1596 Ga0207646_10061824
1597 Ga0207646_10329529
1598 Ga0207681_10124784
1599 Ga0207681_10654007
1600 Ga0207694_10019688
1601 Ga0207694_10168890
1602 Ga0207694_10276720
1603 Ga0207650_10040781
1604 Ga0207659_10049386
1605 Ga0207687_10262754
1606 Ga0207700_10000129
1607 Ga0207700_10042548
1608 Ga0207700_10070767
1609 Ga0207700_10103724
1610 Ga0207700_10104341
1611 Ga0207700_10134610
1612 Ga0207700_10159435
1613 Ga0207700_10164803
1614 Ga0207700_10190305
1615 Ga0207700_10485981
1616 Ga0207700_10692195
1617 Ga0207700_10730549
1618 Ga0207664_10000284
1619 Ga0207664_10005601
1620 Ga0207664_10079142
1621 Ga0207664_10095160
1622 Ga0207664_10176736
1623 Ga0207664_10179871
1624 Ga0207664_10352848
1625 Ga0207664_10360630
1626 Ga0207664_10416860
1627 Ga0207664_10485638
1628 Ga0207690_10154126
1629 Ga0207690_10179007
1630 Ga0207690_10561174
1631 Ga0207706_10095400
1632 Ga0207706_10224285
1633 Ga0207706_10421886
1634 Ga0207706_10568231
1635 Ga0207686_10175518
1636 Ga0207686_10578883
1637 Ga0207709_10013097
1638 Ga0207709_10921136
1639 Ga0207670_10060699
1640 Ga0207670_10093078
1641 Ga0207670_10100911
1642 Ga0207670_10329914
1643 Ga0207669_10071781
1644 Ga0207704_10024694
1645 Ga0207704_10118716
1646 Ga0207704_10252014
1647 Ga0207665_10001257
1648 Ga0207665_10015257
1649 Ga0207665_10069495
1650 Ga0207665_10270620
1651 Ga0207665_10341024
1652 Ga0207665_10611546
1653 Ga0207691_10002633
1654 Ga0207691_10071410
1655 Ga0207711_10011482
1656 Ga0207711_10107485
1657 Ga0207711_10167404
1658 Ga0207711_10313318
1659 Ga0207711_10321193
1660 Ga0207711_10515005
1661 Ga0207711_10742413
1662 Ga0207689_10006279
1663 Ga0207689_10007004
1664 Ga0207689_10021498
1665 Ga0207689_10374078
1666 Ga0207689_10405171
1667 Ga0207661_10008597
1668 Ga0207661_10018914
1669 Ga0207661_10461724
1670 Ga0207667_10001950
1671 Ga0207667_10007869
1672 Ga0207667_10315714
1673 Ga0207667_10336764
1674 Ga0207651_10006530
1675 Ga0207651_10071608
1676 Ga0207668_10477673
1677 Ga0207640_10011254
1678 Ga0207640_10016852
1679 Ga0207640_10185949
1680 Ga0207640_11077433
1681 Ga0207658_10412664
1682 Ga0207677_10010884
1683 Ga0207677_10011184
1684 Ga0207677_10011507
1685 Ga0207703_10006387
1686 Ga0207703_10017744
1687 Ga0207703_10032365
1688 Ga0207703_10126285
1689 Ga0207639_10205272
1690 Ga0207639_10226049
1691 Ga0207639_10246600
1692 Ga0207639_10636652
1693 Ga0207639_11129248
1694 Ga0207678_10022374
1695 Ga0207678_10305917
1696 Ga0207708_10019652
1697 Ga0207708_10069636
1698 Ga0207702_10000962
1699 Ga0207702_10000989
1700 Ga0207702_10007050
1701 Ga0207702_10037565
1702 Ga0207702_10788659
1703 Ga0207641_10020452
1704 Ga0207641_10044390
1705 Ga0207641_10131116
1706 Ga0207641_10141495
1707 Ga0207641_10446599
1708 Ga0207648_10000621
1709 Ga0207648_10022238
1710 Ga0207648_10120701
1711 Ga0207676_10016801
1712 Ga0207676_10077228
1713 Ga0207676_10470759
1714 Ga0207674_10000867
1715 Ga0207674_10010008
1716 Ga0207674_10134956
1717 Ga0207674_10245849
1718 Ga0207674_10314628
1719 Ga0207674_11213828
1720 Ga0207675_100018660
1721 Ga0207683_10084756
1722 Ga0207683_10547133
1723 Ga0207698_10584979
1724 Ga0207698_11052493
1725 Ga0209588_1097025
1726 Ga0209813_10040724
1727 Ga0209813_10066202
1728 Ga0207428_10000041
1729 Ga0207428_10000275
1730 Ga0207428_10058904
1731 Ga0207428_10204447
1732 Ga0265356_1000604
1733 Ga0265356_1005173
1734 Ga0268265_10042525
1735 Ga0268265_10046839
1736 Ga0268265_10243619
1737 Ga0268265_10960392
1738 Ga0268264_10118544
1739 Ga0268264_10144353
1740 Ga0268264_10238210
1741 Ga0268264_10318059
1742 Ga0265338_10010883
1743 Ga0265338_10025739
1744 Ga0265338_10106886
1745 Ga0265338_10118254
1746 Ga0265338_10247136
1747 Ga0265338_10294286
1748 Ga0265762_1000985
1749 Ga0265762_1017137
1750 Ga0265762_1035894
1751 Ga0265762_1045518
1752 Ga0265767_114267
1753 Ga0265765_1001211
1754 Ga0265764_105869
1755 Ga0265761_104905
1756 Ga0265761_109430
1757 Ga0265761_109653
1758 Ga0265771_1012144
1759 Ga0265760_10000937
1760 Ga0265760_10001736
1761 Ga0265760_10009110
1762 Ga0265760_10035082
1763 Ga0265760_10035745
1764 Ga0265760_10052458
1765 Ga0265760_10100738
1766 Ga0265328_10026747
1767 Ga0265325_10006060
1768 Ga0265329_10175700
1769 Ga0265339_10008297
1770 Ga0265339_10050165
1771 Ga0265339_10075038
1772 Ga0265316_10019366
1773 Ga0265316_10153007
1774 Ga0307408_100359352
1775 Ga0265314_10026201
1776 Ga0265314_10162857
1777 Ga0265314_10202793
1778 Ga0316576_10064560
1779 Ga0316578_10061306
1780 Ga0316577_10000601
1781 Ga0316053_112410
1782 Ga0316212_1021929
1783 Ga0373926_0010630
1784 Ga0373926_0045658
1785 Ga0373928_0108807
1786 Ga0373934_0085175
1787 Ga0373923_0038046
1788 Ga0373923_0053782
1789 Ga0373923_0543593
1790 Ga0373936_0007952
1791 Ga0373936_0058037
1792 Ga0373945_0001372
1793 Ga0373945_0165827
1794 Ga0373953_0012564
1795 Ga0373954_0011546
1796 Ga0373956_0302832
1797 Ga0373943_0000120
1798 Ga0373943_0045811
1799 Ga0373946_0081654
1800 Ga0373955_0510756
1801 Ga0316574_0110316
1802 Ga0316574_0164241
1803 Ga0373924_0169766
1804 Ga0373924_0186782
1805 Ga0373931_0142443
1806 Ga0373935_0000522
1807 Ga0373935_0087515
1808 Ga0373927_0000062
1809 Ga0373927_0405003
1810 Ga0373933_0085855
1811 Ga0373933_0494220
1812 Ga0373933_0526703
1813 Ga0373947_0002314
1814 Ga0373947_0050692
1815 Ga0373947_0385304
1816 Ga0373937_0053682
1817 Ga0373937_0119810
1818 Ga0373937_0200567
1819 Ga0373937_0996617
1820 Ga0373937_1099845
1821 Ga0265778_043107
1822 Ga0265778_051187
1823 Ga0265778_053004
1824 Ga0265778_053804
1825 Ga0316582_0066874
1826 Ga0316582_0200621
1827 Ga0316584_0449160
1828 Ga0373925_0039043
1829 Ga0436365_0750672
1830 Ga0436365_0901241
1831 Ga0436365_0993814
1832 Ga0453683_0193623
1833 Ga0466966_0150104
1834 Ga0466961_0137896
1835 Ga0466961_0359016
1836 Ga0466963_0047151
1837 Ga0466964_0254808
1838 Ga0466971_0076486
1839 Ga0466957_0245495
1840 Ga0466959_0114973
1841 Ga0466959_0464586
1842 Ga0466959_0685535
1843 Ga0451576_0181316
1844 Ga0451576_0267497
1845 Ga0451576_0566645
1846 Ga0451576_0750609
1847 Ga0466958_0456214
1848 Ga0466967_0005791
1849 Ga0466967_0419735
1850 Ga0495629_0005749
1851 Ga0495651_0565337
1852 Ga0495580_0009994
1853 Ga0495580_0016836
1854 Ga0495580_0042692
1855 Ga0495580_0118118
1856 Ga0495580_0183100
1857 Ga0495580_0191137
1858 Ga0495580_0374468
1859 Ga0495582_0075957
1860 Ga0495662_0368296
1861 Ga0495664_0128957
1862 Ga0495594_0041367
1863 Ga0495628_0084490
1864 Ga0495630_0386161
1865 Ga0495665_0036666
1866 Ga0495665_0324789
1867 Ga0495640_0400585
1868 Ga0495587_0076648
1869 Ga0495621_0091896
1870 Ga0495645_0157460
1871 Ga0495667_0134397
1872 Ga0495635_0157070
1873 Ga0495635_0543856
1874 Ga0495588_0522562
1875 Ga0495657_0223993
1876 Ga0495657_0357040
1877 Ga0495599_0392878
1878 Ga0495623_0038268
1879 Ga0495623_0072214
1880 Ga0495623_0151350
1881 Ga0495623_0377821
1882 Ga0495669_0123006
1883 Ga0495624_0129430
1884 Ga0495624_0161273
1885 Ga0495600_0037963
1886 Ga0495604_0192502
1887 Ga0495674_0007407
1888 Ga0495674_0352148
1889 Ga0495674_0620847
1890 Ga0495672_0000913
1891 Ga0495680_0466195
1892 Ga0495675_0148498
1893 Ga0495675_0423458
1894 Ga0495602_0126162
1895 Ga0495602_0468993
1896 Ga0495614_0159220
1897 Ga0496100_0046426
1898 Ga0496100_0474121
1899 Ga0496101_0069925
1900 Ga0496102_0002080
1901 Ga0496102_0812085
1902 Ga0496103_0036041
1903 Ga0496103_0108811
1904 Ga0496104_0023678
1905 Ga0496104_0079480
1906 Ga0496104_0120200
1907 Ga0496104_0339199
1908 Ga0496104_0427338
1909 Ga0496105_0292993
1910 Ga0496105_0531737
1911 Ga0496105_0728469
1912 Ga0496106_0061196
1913 Ga0496106_0188037
1914 Ga0496107_0169793
1915 Ga0496108_0040547
1916 Ga0496108_0266153
1917 Ga0496109_1017819
1918 Ga0496110_0113142
1919 Ga0496111_0092455
1920 Ga0496112_0001114
1921 Ga0496112_0002004
1922 Ga0496112_0035410
1923 Ga0496112_0151319
1924 Ga0496112_0190132
1925 Ga0496112_0428782
1926 Ga0496113_0051332
1927 Ga0496113_0101182
1928 Ga0496113_0591309
1929 Ga0496114_0293785
1930 Ga0496115_0054981
1931 Ga0496115_0178775
1932 Ga0501291_017803
1933 Ga0501294_010505
1934 Ga0501297_011707
1935 Ga0501298_002952
1936 Ga0501301_005965
1937 Ga0501032_0183160
1938 Ga0501033_0382225
1939 Ga0501036_0677804
1940 Ga0501036_0795681
1941 Ga0501038_0068246
1942 Ga0501039_0348759
1943 Ga0501040_0108766
1944 Ga0501048_0048405
1945 Ga0501048_0673244
1946 Ga0501071_0086416
1947 Ga0501071_1003467
1948 Ga0501072_0156715
1949 Ga0501072_0763666
1950 Ga0501074_0154850
1951 Ga0501075_0187856
1952 Ga0501075_0319619
1953 Ga0501075_0414302
1954 Ga0501076_0001228
1955 Ga0501077_0792186
1956 Ga0501257_169945
1957 Ga0501079_0210230
1958 Ga0501080_0120457
1959 Ga0501081_0144580
1960 Ga0501081_0482464
1961 Ga0501083_0389818
1962 Ga0501035_0628743
1963 Ga0501045_0061368
1964 nmdc:mga03683_28667_c1
1965 nmdc:mga03n38_51735_c1
1966 nmdc:mga03n38_84975_c1
1967 nmdc:mga00v17_147142_c1
1968 nmdc:mga00v17_149537_c1
1969 nmdc:mga00v17_334036_c1
1970 nmdc:mga00v17_9694_c1
1971 nmdc:mga0yw44_11427_c1
1972 nmdc:mga0k408_182_c1
1973 nmdc:mga06z11_27669_c1
1974 nmdc:mga06z11_528728_c1
1975 nmdc:mga06z11_726815_c1
1976 nmdc:mga06z11_7564_c1
1977 nmdc:mga04h51_20597_c1
1978 nmdc:mga07m45_233158_c1
1979 nmdc:mga07m45_24324_c1
1980 nmdc:mga05p37_102551_c1
1981 nmdc:mga05p37_111978_c1
1982 nmdc:mga05p37_186901_c1
1983 nmdc:mga05p37_209263_c2
1984 nmdc:mga05p37_25947_c1
1985 nmdc:mga05p37_261661_c1
1986 nmdc:mga05p37_276941_c1
1987 nmdc:mga05p37_41819_c1
1988 nmdc:mga05p37_511961_c1
1989 nmdc:mga05p37_83677_c1
1990 nmdc:mga09592_133886_c1
1991 nmdc:mga09592_15944_c1
1992 nmdc:mga09592_22740_c1
1993 nmdc:mga09592_469_c1
1994 nmdc:mga09592_6307_c1
1995 nmdc:mga0qj67_42830_c1
1996 nmdc:mga0qj67_54471_c1
1997 nmdc:mga0qj67_999860_c1
1998 nmdc:mga06r32_1189786_c1
1999 nmdc:mga06r32_209913_c1
2000 nmdc:mga06r32_243590_c1
2001 nmdc:mga06r32_277455_c1
2002 nmdc:mga06r32_3704_c1
2003 nmdc:mga06r32_497697_c1
2004 nmdc:mga08y16_1210895_c1
2005 nmdc:mga08y16_2217_c1
2006 nmdc:mga08y16_93220_c1
2007 nmdc:mga0n895_318543_c1
2008 nmdc:mga0n895_405695_c1
2009 nmdc:mga0n895_546683_c1
2010 nmdc:mga0n895_867412_c1
2011 nmdc:mga0rr50_23013_c1
2012 nmdc:mga0rr50_277418_c1
2013 nmdc:mga0rr50_405662_c1
2014 nmdc:mga08x19_10096_c1
2015 nmdc:mga08x19_101960_c1
2016 nmdc:mga08x19_107610_c1
2017 nmdc:mga08x19_18051_c1
2018 nmdc:mga0a205_218639_c1
2019 nmdc:mga0a205_63371_c1
2020 nmdc:mga0a205_670946_c1
2021 nmdc:mga0a205_72213_c1
2022 nmdc:mga0a205_829624_c1
2023 Ga0495601_0017230
2024 Ga0495601_0142788
2025 Ga0495601_0355100
2026 Ga0500588_0170093
2027 Ga0500590_176738
2028 Ga0501084_0127183
2029 Ga0501084_0508330
2030 Ga0587066_022077
2031 Ga0587070_091793
2032 Ga0587073_0133613
2033 Ga0587083_0127223
2034 Ga0587085_078525
2035 Ga0587088_063155
2036 Ga0587090_051561
2037 Ga0587091_103118
2038 Ga0587094_054531
2039 Ga0587113_022974
2040 Ga0587128_070954
2041 Ga0587128_089401
2042 Ga0587067_095536
2043 Ga0587068_099442
2044 Ga0587076_094883
2045 Ga0587078_032194
2046 Ga0587114_052490
2047 Ga0501082_0779620
2048 Ga0501082_0840708
2049 Ga0466962_0113791
2050 Ga0530510_0045990
2051 Ga0530510_0343135
2052 Ga0530510_0694816

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21095

CarD_C

CarD, C-terminal domain

93

179

0.98

PF02559

CarD_TRCF_RID

CarD-like/TRCF RID domain

27

86

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kim-assembly1.cif.gz_M mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor 0.8606 8 165
7kim-assembly1.cif.gz_M mycobacterium tuberculosis wt rnap transcription closed promoter complex with whib7 transcription factor 0.8492 8 165
4xls-assembly2.cif.gz_N crystal structure of t. aquaticus transcription initiation complex with card containing upstream fork promoter. 0.8422 8 165
4xlr-assembly1.cif.gz_M crystal structure of t.aquaticus transcription initiation complex with card containing bubble promoter and rna 0.839 8 163
8hvr-assembly1.cif.gz_H cryo-em structure of afsr-dependent transcription activation complex with afss promoter 0.8278 8 164
ID Description Score Start End Superfamily
4kbmB01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9343 8 65 2.40.10.170
4kbmB01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9032 8 65 2.40.10.170
af_K7MX79_225_393_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8819 27 55 2.120.10.80
af_F1Q9Z1_251_388_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8724 21 47 3.90.70.10
4kbmB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain 0.8496 67 165 1.20.58.1290
ID Description Score Start End GO Terms
AF-A0A7X8IBF4-F1-model_v4 CarD family transcriptional regulator 0.944 8 88 GO:0009303
AF-A0A3E0P0Z8-F1-model_v4 CarD family transcriptional regulator 0.942 8 167 GO:0009303
AF-A0A3M1VQQ5-F1-model_v4 CarD family transcriptional regulator 0.9379 9 167 GO:0009303
AF-W7ZMV4-F1-model_v4 deleted 0.9373 8 80
AF-A0A259J447-F1-model_v4 deleted 0.9367 9 82

Map