F488278
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 523 | 2034 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100035428|Ga0070698_1000354283 |
| Length | 262 |
| Sequence | VSGHPGIPVLQDREDVNADVSTSLAAAEASQLVLPSYERPVGLHPPLDFDGYRSTALRHPKHPLVLLPHRLTEVTGPLLGDGLIMPTDSDLTTQHGGEPQGQRIILSGRVLDSDGRPVPDTLIEIWQTNAAGRYRHWREHHPAPLDPNFDGIGRAITDPAGRYRFVTIQPGAYPWGNHYNAWRPAHIHFSLFGRAFTQRLVTQMYFPGDPLLPLDPIFNSVPDEKARQRLIAAFDLELTQPEWALGYHWDIVLRGRDATVFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 139 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 148 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 149 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 239 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 272 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 277 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 278 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 279 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 280 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 281 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 282 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 283 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 284 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 285 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 286 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 287 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 442 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 444 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 445 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 446 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 449 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 450 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 451 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 452 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 453 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 454 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 455 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 456 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 457 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 458 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 459 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 460 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 461 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 462 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 463 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 464 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 465 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 466 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 467 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 468 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 469 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 470 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 471 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 472 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 473 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 474 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 475 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 476 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 477 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 478 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 479 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 480 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 481 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 482 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 483 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 484 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 485 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 486 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 487 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 488 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 489 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 490 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 491 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 492 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 493 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 494 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 495 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 496 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 497 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 498 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 499 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 500 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 501 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 502 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 503 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 504 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 505 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 506 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 507 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 508 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 509 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 510 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 511 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 512 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 513 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 514 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 515 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 516 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 517 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 518 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 519 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 520 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 521 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 522 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 523 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.15 |
| Metatranscriptomes | 1.47 |
| Isolates | 7.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.82 |
| Nodule | 1.38 |
| Rhizoplane | 5.21 |
| Rhizosphere | 83.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070698_100035428 | 3300005471 | Bacteria | 5162 |
| 2 | RicEn_FSXC49909_b1 | 2010549000 | Bacteria | 785 |
| 3 | JGI25162J39368_1000054 | 3300002737 | Bacteria | 147779 |
| 4 | JGI25162J39368_1000898 | 3300002737 | Bacteria | 19383 |
| 5 | JGI25163J39215_1000269 | 3300002771 | Bacteria | 18376 |
| 6 | JGI25163J39215_1000348 | 3300002771 | Bacteria | 15338 |
| 7 | JGI25164J39214_1000029 | 3300002772 | Bacteria | 147779 |
| 8 | JGI25164J39214_1000492 | 3300002772 | Bacteria | 19394 |
| 9 | JGI25406J46586_10040029 | 3300003203 | Bacteria | 1665 |
| 10 | JGI25165J46597_1000111 | 3300003214 | Bacteria | 147779 |
| 11 | JGI25165J46597_1000934 | 3300003214 | Bacteria | 20070 |
| 12 | Ga0055538_1000082 | 3300003751 | Bacteria | 84434 |
| 13 | Ga0055539_1000121 | 3300003752 | Bacteria | 84434 |
| 14 | Ga0055533_1000129 | 3300003756 | Bacteria | 84434 |
| 15 | Ga0055532_1000104 | 3300003758 | Bacteria | 91442 |
| 16 | Ga0055525_1000167 | 3300003759 | Bacteria | 84434 |
| 17 | Ga0055535_1011188 | 3300003761 | Bacteria | 1432 |
| 18 | Ga0055536_1000043 | 3300003781 | Bacteria | 124663 |
| 19 | Ga0055530_10000031 | 3300003791 | Bacteria | 122117 |
| 20 | Ga0055530_10012647 | 3300003791 | Bacteria | 2929 |
| 21 | Ga0055540_1000230 | 3300003792 | Bacteria | 51911 |
| 22 | Ga0055541_1000081 | 3300003841 | Bacteria | 84434 |
| 23 | Ga0065714_10067038 | 3300005288 | Bacteria | 5970 |
| 24 | Ga0065714_10105108 | 3300005288 | Bacteria | 1572 |
| 25 | Ga0065704_10013836 | 3300005289 | Bacteria | 1840 |
| 26 | Ga0065712_10075189 | 3300005290 | Bacteria | 3914 |
| 27 | Ga0065712_10236500 | 3300005290 | Bacteria | 996 |
| 28 | Ga0070658_10019937 | 3300005327 | Bacteria | 5372 |
| 29 | Ga0070658_10201648 | 3300005327 | Bacteria | 1679 |
| 30 | Ga0070676_10195870 | 3300005328 | Bacteria | 1322 |
| 31 | Ga0070683_100009609 | 3300005329 | Bacteria | 8281 |
| 32 | Ga0070683_100014648 | 3300005329 | Bacteria | 6867 |
| 33 | Ga0070683_100094011 | 3300005329 | Bacteria | 2817 |
| 34 | Ga0070690_100065637 | 3300005330 | Bacteria | 2347 |
| 35 | Ga0070670_100001105 | 3300005331 | Bacteria | 21435 |
| 36 | Ga0068869_100011134 | 3300005334 | Bacteria | 5894 |
| 37 | Ga0070666_10030938 | 3300005335 | Bacteria | 3530 |
| 38 | Ga0070680_100012295 | 3300005336 | Bacteria | 6647 |
| 39 | Ga0070680_100077510 | 3300005336 | Bacteria | 2737 |
| 40 | Ga0070682_100037829 | 3300005337 | Bacteria | 2956 |
| 41 | Ga0070682_100052820 | 3300005337 | Bacteria | 2544 |
| 42 | Ga0068868_100001991 | 3300005338 | Bacteria | 14039 |
| 43 | Ga0068868_100027562 | 3300005338 | Bacteria | 4334 |
| 44 | Ga0070660_100023571 | 3300005339 | Bacteria | 4560 |
| 45 | Ga0070660_100029658 | 3300005339 | Bacteria | 4102 |
| 46 | Ga0070689_100049302 | 3300005340 | Bacteria | 3250 |
| 47 | Ga0070691_10104061 | 3300005341 | Bacteria | 1413 |
| 48 | Ga0070661_100000238 | 3300005344 | Bacteria | 45456 |
| 49 | Ga0070661_100013386 | 3300005344 | Bacteria | 5758 |
| 50 | Ga0070661_100071326 | 3300005344 | Bacteria | 2556 |
| 51 | Ga0070692_10004915 | 3300005345 | Bacteria | 5630 |
| 52 | Ga0070692_10037485 | 3300005345 | Bacteria | 2465 |
| 53 | Ga0070675_100010129 | 3300005354 | Bacteria | 7353 |
| 54 | Ga0070675_100011148 | 3300005354 | Bacteria | 7033 |
| 55 | Ga0070675_100225662 | 3300005354 | Bacteria | 1633 |
| 56 | Ga0070671_100099650 | 3300005355 | Bacteria | 2437 |
| 57 | Ga0070659_100026111 | 3300005366 | Bacteria | 4493 |
| 58 | Ga0070667_100111973 | 3300005367 | Bacteria | 2367 |
| 59 | Ga0070703_10013256 | 3300005406 | Bacteria | 2341 |
| 60 | Ga0070709_10000165 | 3300005434 | Bacteria | 41860 |
| 61 | Ga0070709_10045199 | 3300005434 | Bacteria | 2731 |
| 62 | Ga0070709_10076782 | 3300005434 | Bacteria | 2170 |
| 63 | Ga0070714_100000318 | 3300005435 | Bacteria | 36459 |
| 64 | Ga0070714_100000491 | 3300005435 | Bacteria | 28628 |
| 65 | Ga0070714_100009563 | 3300005435 | Bacteria | 7629 |
| 66 | Ga0070714_100300400 | 3300005435 | Bacteria | 1496 |
| 67 | Ga0070713_100001888 | 3300005436 | Bacteria | 13519 |
| 68 | Ga0070713_100099934 | 3300005436 | Bacteria | 2510 |
| 69 | Ga0070713_100411201 | 3300005436 | Bacteria | 1265 |
| 70 | Ga0070710_10000171 | 3300005437 | Bacteria | 29726 |
| 71 | Ga0070710_10034420 | 3300005437 | Bacteria | 2756 |
| 72 | Ga0070701_10138883 | 3300005438 | Bacteria | 1387 |
| 73 | Ga0070711_100000158 | 3300005439 | Bacteria | 36681 |
| 74 | Ga0070711_100309139 | 3300005439 | Bacteria | 1259 |
| 75 | Ga0070705_100111868 | 3300005440 | Bacteria | 1746 |
| 76 | Ga0070700_100143178 | 3300005441 | Bacteria | 1627 |
| 77 | Ga0070708_100001234 | 3300005445 | Bacteria | 19676 |
| 78 | Ga0070708_100030905 | 3300005445 | Bacteria | 4632 |
| 79 | Ga0070708_100044212 | 3300005445 | Bacteria | 3916 |
| 80 | Ga0070708_100440245 | 3300005445 | Bacteria | 1229 |
| 81 | Ga0070663_100052924 | 3300005455 | Bacteria | 2897 |
| 82 | Ga0070663_100312069 | 3300005455 | Bacteria | 1262 |
| 83 | Ga0070678_100013597 | 3300005456 | Bacteria | 5111 |
| 84 | Ga0070662_100021530 | 3300005457 | Bacteria | 4403 |
| 85 | Ga0070681_10047709 | 3300005458 | Bacteria | 4282 |
| 86 | Ga0070681_10183344 | 3300005458 | Bacteria | 2014 |
| 87 | Ga0070706_100002363 | 3300005467 | Bacteria | 19041 |
| 88 | Ga0070706_100020520 | 3300005467 | Bacteria | 6089 |
| 89 | Ga0070706_100029550 | 3300005467 | Bacteria | 5049 |
| 90 | Ga0070706_100087323 | 3300005467 | Bacteria | 2891 |
| 91 | Ga0070706_100138562 | 3300005467 | Bacteria | 2271 |
| 92 | Ga0070706_100394203 | 3300005467 | Bacteria | 1289 |
| 93 | Ga0070706_100706871 | 3300005467 | Bacteria | 934 |
| 94 | Ga0070707_100000043 | 3300005468 | Bacteria | 108893 |
| 95 | Ga0070707_100002621 | 3300005468 | Bacteria | 17098 |
| 96 | Ga0070707_100020775 | 3300005468 | Bacteria | 6198 |
| 97 | Ga0070698_100000072 | 3300005471 | Bacteria | 75715 |
| 98 | Ga0070698_100000309 | 3300005471 | Bacteria | 49509 |
| 99 | Ga0070698_100013936 | 3300005471 | Bacteria | 8503 |
| 100 | Ga0070698_100014678 | 3300005471 | Bacteria | 8273 |
| 101 | Ga0070698_100036356 | 3300005471 | Bacteria | 5088 |
| 102 | Ga0070698_100092722 | 3300005471 | Bacteria | 3001 |
| 103 | Ga0070698_100134816 | 3300005471 | Bacteria | 2423 |
| 104 | Ga0070698_100180439 | 3300005471 | Bacteria | 2050 |
| 105 | Ga0070699_100000327 | 3300005518 | Bacteria | 45983 |
| 106 | Ga0070699_100000511 | 3300005518 | Bacteria | 36777 |
| 107 | Ga0070699_100026940 | 3300005518 | Bacteria | 4957 |
| 108 | Ga0070699_100046052 | 3300005518 | Bacteria | 3774 |
| 109 | Ga0070679_100611638 | 3300005530 | Bacteria | 1033 |
| 110 | Ga0070684_100009019 | 3300005535 | Bacteria | 7836 |
| 111 | Ga0070684_100016988 | 3300005535 | Bacteria | 5963 |
| 112 | Ga0070684_100069498 | 3300005535 | Bacteria | 3097 |
| 113 | Ga0070684_100688748 | 3300005535 | Bacteria | 952 |
| 114 | Ga0070697_100005337 | 3300005536 | Bacteria | 9880 |
| 115 | Ga0070697_100016026 | 3300005536 | Bacteria | 5893 |
| 116 | Ga0070697_100048744 | 3300005536 | Bacteria | 3435 |
| 117 | Ga0070697_100127541 | 3300005536 | Bacteria | 2132 |
| 118 | Ga0068853_100146938 | 3300005539 | Bacteria | 2119 |
| 119 | Ga0070672_100108524 | 3300005543 | Bacteria | 2260 |
| 120 | Ga0070672_100145396 | 3300005543 | Bacteria | 1959 |
| 121 | Ga0070672_100435153 | 3300005543 | Bacteria | 1128 |
| 122 | Ga0070695_100095391 | 3300005545 | Bacteria | 1993 |
| 123 | Ga0070696_100013244 | 3300005546 | Bacteria | 5534 |
| 124 | Ga0070693_100096109 | 3300005547 | Bacteria | 1795 |
| 125 | Ga0070665_100003764 | 3300005548 | Bacteria | 16053 |
| 126 | Ga0070665_100122001 | 3300005548 | Bacteria | 2608 |
| 127 | Ga0070704_100128359 | 3300005549 | Bacteria | 1960 |
| 128 | Ga0068855_100022092 | 3300005563 | Bacteria | 7627 |
| 129 | Ga0070664_100000233 | 3300005564 | Bacteria | 39884 |
| 130 | Ga0070664_100001873 | 3300005564 | Bacteria | 16883 |
| 131 | Ga0070664_100031400 | 3300005564 | Bacteria | 4438 |
| 132 | Ga0070664_100159109 | 3300005564 | Bacteria | 1997 |
| 133 | Ga0068854_100010679 | 3300005578 | Bacteria | 5961 |
| 134 | Ga0068854_100260934 | 3300005578 | Bacteria | 1387 |
| 135 | Ga0068856_100018845 | 3300005614 | Bacteria | 6692 |
| 136 | Ga0068856_100486766 | 3300005614 | Bacteria | 1255 |
| 137 | Ga0070702_100024285 | 3300005615 | Bacteria | 3232 |
| 138 | Ga0070702_100037783 | 3300005615 | Bacteria | 2683 |
| 139 | Ga0068852_100185902 | 3300005616 | Bacteria | 1957 |
| 140 | Ga0068852_100639550 | 3300005616 | Bacteria | 1070 |
| 141 | Ga0068859_100272285 | 3300005617 | Bacteria | 1785 |
| 142 | Ga0068864_100352665 | 3300005618 | Bacteria | 1388 |
| 143 | Ga0068866_10059537 | 3300005718 | Bacteria | 1977 |
| 144 | Ga0068861_100343950 | 3300005719 | Bacteria | 1306 |
| 145 | Ga0068870_10340566 | 3300005840 | Bacteria | 959 |
| 146 | Ga0068863_100129348 | 3300005841 | Bacteria | 2410 |
| 147 | Ga0068863_100161810 | 3300005841 | Bacteria | 2145 |
| 148 | Ga0068858_100205390 | 3300005842 | Bacteria | 1864 |
| 149 | Ga0068862_100084635 | 3300005844 | Bacteria | 2755 |
| 150 | Ga0068862_100168792 | 3300005844 | Bacteria | 1958 |
| 151 | Ga0081455_10051524 | 3300005937 | Bacteria | 3530 |
| 152 | Ga0081538_10002736 | 3300005981 | Bacteria | 16933 |
| 153 | Ga0081538_10031123 | 3300005981 | Bacteria | 3607 |
| 154 | Ga0081538_10047439 | 3300005981 | Bacteria | 2634 |
| 155 | Ga0081540_1000058 | 3300005983 | Bacteria | 120635 |
| 156 | Ga0081540_1035917 | 3300005983 | Bacteria | 2651 |
| 157 | Ga0081539_10004989 | 3300005985 | Bacteria | 14032 |
| 158 | Ga0081539_10063447 | 3300005985 | Bacteria | 2016 |
| 159 | Ga0081539_10077649 | 3300005985 | Bacteria | 1755 |
| 160 | Ga0070717_10010134 | 3300006028 | Bacteria | 7097 |
| 161 | Ga0070717_10042228 | 3300006028 | Bacteria | 3719 |
| 162 | Ga0070717_10124015 | 3300006028 | Bacteria | 2216 |
| 163 | Ga0070717_10426270 | 3300006028 | Bacteria | 1193 |
| 164 | Ga0075364_10069297 | 3300006051 | Bacteria | 2320 |
| 165 | Ga0075364_10085457 | 3300006051 | Bacteria | 2089 |
| 166 | Ga0075432_10106405 | 3300006058 | Bacteria | 1041 |
| 167 | Ga0070715_10035075 | 3300006163 | Bacteria | 2061 |
| 168 | Ga0070715_10041047 | 3300006163 | Bacteria | 1937 |
| 169 | Ga0070715_10059314 | 3300006163 | Bacteria | 1673 |
| 170 | Ga0070715_10267315 | 3300006163 | Bacteria | 901 |
| 171 | Ga0070716_100000117 | 3300006173 | Bacteria | 31350 |
| 172 | Ga0070716_100083695 | 3300006173 | Bacteria | 1911 |
| 173 | Ga0070712_100000698 | 3300006175 | Bacteria | 19829 |
| 174 | Ga0070712_100092217 | 3300006175 | Bacteria | 2221 |
| 175 | Ga0070712_100208782 | 3300006175 | Bacteria | 1539 |
| 176 | Ga0070712_100233212 | 3300006175 | Bacteria | 1463 |
| 177 | Ga0075362_10050309 | 3300006177 | Bacteria | 1863 |
| 178 | Ga0075362_10118949 | 3300006177 | Bacteria | 1249 |
| 179 | Ga0075369_10022141 | 3300006186 | Bacteria | 2619 |
| 180 | Ga0097621_100114765 | 3300006237 | Bacteria | 2279 |
| 181 | Ga0075430_100000242 | 3300006846 | Bacteria | 37737 |
| 182 | Ga0075433_10021690 | 3300006852 | Bacteria | 5387 |
| 183 | Ga0075433_10023853 | 3300006852 | Bacteria | 5155 |
| 184 | Ga0075433_10077482 | 3300006852 | Bacteria | 2928 |
| 185 | Ga0075434_100241998 | 3300006871 | Bacteria | 1824 |
| 186 | Ga0075434_100322222 | 3300006871 | Bacteria | 1566 |
| 187 | Ga0075434_100357969 | 3300006871 | Bacteria | 1480 |
| 188 | Ga0075429_100200583 | 3300006880 | Bacteria | 1748 |
| 189 | Ga0068865_100120726 | 3300006881 | Bacteria | 1948 |
| 190 | Ga0068865_100169640 | 3300006881 | Bacteria | 1672 |
| 191 | Ga0075436_100007086 | 3300006914 | Bacteria | 7675 |
| 192 | Ga0075436_100094554 | 3300006914 | Bacteria | 2078 |
| 193 | Ga0075436_100111279 | 3300006914 | Bacteria | 1912 |
| 194 | Ga0097620_100272279 | 3300006931 | Bacteria | 1785 |
| 195 | Ga0079104_1000090 | 3300006946 | Bacteria | 132824 |
| 196 | Ga0075435_100102834 | 3300007076 | Bacteria | 2369 |
| 197 | Ga0075435_100120359 | 3300007076 | Bacteria | 2190 |
| 198 | Ga0075435_100181404 | 3300007076 | Bacteria | 1779 |
| 199 | Ga0105251_10003475 | 3300009011 | Bacteria | 11417 |
| 200 | Ga0105251_10035329 | 3300009011 | Bacteria | 2467 |
| 201 | Ga0105244_10005915 | 3300009036 | Bacteria | 8025 |
| 202 | Ga0105244_10006512 | 3300009036 | Bacteria | 7536 |
| 203 | Ga0105244_10023824 | 3300009036 | Bacteria | 3349 |
| 204 | Ga0105244_10150148 | 3300009036 | Bacteria | 1117 |
| 205 | Ga0105244_10159899 | 3300009036 | Bacteria | 1076 |
| 206 | Ga0105250_10000118 | 3300009092 | Bacteria | 71419 |
| 207 | Ga0105250_10006019 | 3300009092 | Bacteria | 5347 |
| 208 | Ga0105240_10206032 | 3300009093 | Bacteria | 2302 |
| 209 | Ga0111539_10010281 | 3300009094 | Bacteria | 11779 |
| 210 | Ga0111539_10021897 | 3300009094 | Bacteria | 7858 |
| 211 | Ga0111539_10089795 | 3300009094 | Bacteria | 3611 |
| 212 | Ga0105245_10003051 | 3300009098 | Bacteria | 14988 |
| 213 | Ga0105245_10014691 | 3300009098 | Bacteria | 6817 |
| 214 | Ga0105245_10844323 | 3300009098 | Bacteria | 956 |
| 215 | Ga0114129_10025453 | 3300009147 | Bacteria | 8387 |
| 216 | Ga0114129_10057100 | 3300009147 | Bacteria | 5465 |
| 217 | Ga0114129_10100917 | 3300009147 | Bacteria | 3993 |
| 218 | Ga0114129_10144111 | 3300009147 | Bacteria | 3264 |
| 219 | Ga0105243_10001057 | 3300009148 | Bacteria | 25197 |
| 220 | Ga0105243_10044066 | 3300009148 | Bacteria | 3498 |
| 221 | Ga0105243_10065747 | 3300009148 | Bacteria | 2914 |
| 222 | Ga0105241_10221796 | 3300009174 | Bacteria | 1590 |
| 223 | Ga0105242_10000719 | 3300009176 | Bacteria | 25890 |
| 224 | Ga0105248_10303828 | 3300009177 | Bacteria | 1797 |
| 225 | Ga0105237_10005805 | 3300009545 | Bacteria | 13845 |
| 226 | Ga0105237_10661472 | 3300009545 | Bacteria | 1051 |
| 227 | Ga0105237_10840213 | 3300009545 | Bacteria | 925 |
| 228 | Ga0105249_10041983 | 3300009553 | Bacteria | 4159 |
| 229 | Ga0105249_10044788 | 3300009553 | Bacteria | 4023 |
| 230 | Ga0105249_10099711 | 3300009553 | Bacteria | 2730 |
| 231 | Ga0105239_10107507 | 3300010375 | Bacteria | 3091 |
| 232 | Ga0105239_10659537 | 3300010375 | Bacteria | 1195 |
| 233 | Ga0105246_10003807 | 3300011119 | Bacteria | 9144 |
| 234 | Ga0157341_1000951 | 3300012494 | Bacteria | 1626 |
| 235 | Ga0157373_10023566 | 3300013100 | Bacteria | 4461 |
| 236 | Ga0157371_10000281 | 3300013102 | Bacteria | 68624 |
| 237 | Ga0157371_10000795 | 3300013102 | Bacteria | 36211 |
| 238 | Ga0157371_10112028 | 3300013102 | Bacteria | 1937 |
| 239 | Ga0157370_10028864 | 3300013104 | Bacteria | 5454 |
| 240 | Ga0157370_10044828 | 3300013104 | Bacteria | 4247 |
| 241 | Ga0157370_10055729 | 3300013104 | Bacteria | 3764 |
| 242 | Ga0157370_10130059 | 3300013104 | Bacteria | 2349 |
| 243 | Ga0157370_10189187 | 3300013104 | Bacteria | 1911 |
| 244 | Ga0157370_10316657 | 3300013104 | Bacteria | 1440 |
| 245 | Ga0157370_10435631 | 3300013104 | Bacteria | 1205 |
| 246 | Ga0157369_10003643 | 3300013105 | Bacteria | 18275 |
| 247 | Ga0157369_10046415 | 3300013105 | Bacteria | 4721 |
| 248 | Ga0157369_10249186 | 3300013105 | Bacteria | 1854 |
| 249 | Ga0157374_10029085 | 3300013296 | Bacteria | 4998 |
| 250 | Ga0157378_10199580 | 3300013297 | Bacteria | 1892 |
| 251 | Ga0157378_10403033 | 3300013297 | Bacteria | 1348 |
| 252 | Ga0163162_10075157 | 3300013306 | Bacteria | 3439 |
| 253 | Ga0163162_10147706 | 3300013306 | Bacteria | 2468 |
| 254 | Ga0157372_10058127 | 3300013307 | Bacteria | 4322 |
| 255 | Ga0157372_10567437 | 3300013307 | Bacteria | 1323 |
| 256 | Ga0157372_10572220 | 3300013307 | Bacteria | 1317 |
| 257 | Ga0157375_10012550 | 3300013308 | Bacteria | 7520 |
| 258 | Ga0157375_10029601 | 3300013308 | Bacteria | 5153 |
| 259 | Ga0163163_10033119 | 3300014325 | Bacteria | 4997 |
| 260 | Ga0163163_10142794 | 3300014325 | Bacteria | 2436 |
| 261 | Ga0182008_10000138 | 3300014497 | Bacteria | 55773 |
| 262 | Ga0182008_10001875 | 3300014497 | Bacteria | 13682 |
| 263 | Ga0182008_10013562 | 3300014497 | Bacteria | 4285 |
| 264 | Ga0182008_10030510 | 3300014497 | Bacteria | 2717 |
| 265 | Ga0182008_10035864 | 3300014497 | Bacteria | 2482 |
| 266 | Ga0157377_10000891 | 3300014745 | Bacteria | 12460 |
| 267 | Ga0157377_10028128 | 3300014745 | Bacteria | 3024 |
| 268 | Ga0157377_10198172 | 3300014745 | Bacteria | 1273 |
| 269 | Ga0157379_10242291 | 3300014968 | Bacteria | 1635 |
| 270 | Ga0157376_10067112 | 3300014969 | Bacteria | 3034 |
| 271 | Ga0182006_1000816 | 3300015261 | Bacteria | 20884 |
| 272 | Ga0182006_1024437 | 3300015261 | Bacteria | 2492 |
| 273 | Ga0163161_10054201 | 3300017792 | Bacteria | 2910 |
| 274 | Ga0163161_10353522 | 3300017792 | Bacteria | 1168 |
| 275 | Ga0163161_10715418 | 3300017792 | Bacteria | 835 |
| 276 | Ga0197907_11173906 | 3300020069 | Bacteria | 1975 |
| 277 | Ga0206356_10219634 | 3300020070 | Bacteria | 1678 |
| 278 | Ga0206356_11376920 | 3300020070 | Bacteria | 2615 |
| 279 | Ga0206349_1693199 | 3300020075 | Bacteria | 1306 |
| 280 | Ga0206355_1544356 | 3300020076 | Bacteria | 1252 |
| 281 | Ga0206351_10449033 | 3300020077 | Bacteria | 1207 |
| 282 | Ga0206351_10726113 | 3300020077 | Bacteria | 1739 |
| 283 | Ga0206352_10696447 | 3300020078 | Bacteria | 1142 |
| 284 | Ga0206350_10260968 | 3300020080 | Bacteria | 1238 |
| 285 | Ga0206350_10760667 | 3300020080 | Bacteria | 3399 |
| 286 | Ga0206354_11479794 | 3300020081 | Bacteria | 1559 |
| 287 | Ga0206353_11923273 | 3300020082 | Bacteria | 3064 |
| 288 | Ga0213874_10100649 | 3300021377 | Bacteria | 960 |
| 289 | Ga0213875_10000817 | 3300021388 | Bacteria | 23214 |
| 290 | Ga0213875_10002595 | 3300021388 | Bacteria | 10743 |
| 291 | Ga0213875_10027419 | 3300021388 | Bacteria | 2710 |
| 292 | Ga0213875_10052067 | 3300021388 | Bacteria | 1917 |
| 293 | Ga0224712_10019502 | 3300022467 | Bacteria | 2288 |
| 294 | Ga0224712_10022965 | 3300022467 | Bacteria | 2158 |
| 295 | Ga0228600_1004353 | 3300024123 | Bacteria | 1032 |
| 296 | Ga0224572_1017256 | 3300024225 | Bacteria | 1385 |
| 297 | Ga0228598_1014646 | 3300024227 | Bacteria | 1551 |
| 298 | Ga0209435_100841 | 3300025206 | Bacteria | 4812 |
| 299 | Ga0209760_100015 | 3300025207 | Bacteria | 176281 |
| 300 | Ga0209760_100047 | 3300025207 | Bacteria | 107520 |
| 301 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 302 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 303 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 304 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 305 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 306 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 307 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 308 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 309 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 310 | Ga0209437_108916 | 3300025233 | Bacteria | 1586 |
| 311 | Ga0209258_100250 | 3300025242 | Bacteria | 97656 |
| 312 | Ga0209646_1000263 | 3300025246 | Bacteria | 51493 |
| 313 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 314 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 315 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 316 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 317 | Ga0209676_1002060 | 3300025292 | Bacteria | 15666 |
| 318 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 319 | Ga0209050_1001134 | 3300025298 | Bacteria | 32080 |
| 320 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 321 | Ga0209051_1044678 | 3300025303 | Bacteria | 1541 |
| 322 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 323 | Ga0207696_1000111 | 3300025711 | Bacteria | 155243 |
| 324 | Ga0207655_1000435 | 3300025728 | Bacteria | 55875 |
| 325 | Ga0207655_1002832 | 3300025728 | Bacteria | 13434 |
| 326 | Ga0207655_1009325 | 3300025728 | Bacteria | 6107 |
| 327 | Ga0207713_1000564 | 3300025735 | Bacteria | 36882 |
| 328 | Ga0207713_1003370 | 3300025735 | Bacteria | 10952 |
| 329 | Ga0207713_1009675 | 3300025735 | Bacteria | 5404 |
| 330 | Ga0207713_1018905 | 3300025735 | Bacteria | 3393 |
| 331 | Ga0207692_10000417 | 3300025898 | Bacteria | 14917 |
| 332 | Ga0207692_10103992 | 3300025898 | Bacteria | 1564 |
| 333 | Ga0207688_10011847 | 3300025901 | Bacteria | 4746 |
| 334 | Ga0207647_10034782 | 3300025904 | Bacteria | 3214 |
| 335 | Ga0207685_10028209 | 3300025905 | Bacteria | 1974 |
| 336 | Ga0207699_10000393 | 3300025906 | Bacteria | 22711 |
| 337 | Ga0207699_10112412 | 3300025906 | Bacteria | 1748 |
| 338 | Ga0207699_10126686 | 3300025906 | Bacteria | 1659 |
| 339 | Ga0207699_10226281 | 3300025906 | Bacteria | 1279 |
| 340 | Ga0207699_10301820 | 3300025906 | Bacteria | 1118 |
| 341 | Ga0207699_10332698 | 3300025906 | Bacteria | 1068 |
| 342 | Ga0207699_10514777 | 3300025906 | Bacteria | 865 |
| 343 | Ga0207645_10140641 | 3300025907 | Bacteria | 1573 |
| 344 | Ga0207643_10052734 | 3300025908 | Bacteria | 2310 |
| 345 | Ga0207705_10370421 | 3300025909 | Bacteria | 1105 |
| 346 | Ga0207684_10025263 | 3300025910 | Bacteria | 5063 |
| 347 | Ga0207684_10060661 | 3300025910 | Bacteria | 3212 |
| 348 | Ga0207684_10122794 | 3300025910 | Bacteria | 2227 |
| 349 | Ga0207684_10295409 | 3300025910 | Bacteria | 1397 |
| 350 | Ga0207684_10310995 | 3300025910 | Bacteria | 1358 |
| 351 | Ga0207684_10449500 | 3300025910 | Bacteria | 1106 |
| 352 | Ga0207707_10125403 | 3300025912 | Bacteria | 2245 |
| 353 | Ga0207695_10155316 | 3300025913 | Bacteria | 2223 |
| 354 | Ga0207671_10000436 | 3300025914 | Bacteria | 57399 |
| 355 | Ga0207693_10000436 | 3300025915 | Bacteria | 38097 |
| 356 | Ga0207693_10069329 | 3300025915 | Bacteria | 2759 |
| 357 | Ga0207693_10100193 | 3300025915 | Bacteria | 2271 |
| 358 | Ga0207693_10195353 | 3300025915 | Bacteria | 1592 |
| 359 | Ga0207693_10212783 | 3300025915 | Bacteria | 1519 |
| 360 | Ga0207693_10320537 | 3300025915 | Bacteria | 1213 |
| 361 | Ga0207663_10000849 | 3300025916 | Bacteria | 13884 |
| 362 | Ga0207663_10017821 | 3300025916 | Bacteria | 3965 |
| 363 | Ga0207660_10026126 | 3300025917 | Bacteria | 3974 |
| 364 | Ga0207662_10009010 | 3300025918 | Bacteria | 5480 |
| 365 | Ga0207657_10046321 | 3300025919 | Bacteria | 3809 |
| 366 | Ga0207657_10063273 | 3300025919 | Bacteria | 3164 |
| 367 | Ga0207657_10265307 | 3300025919 | Bacteria | 1366 |
| 368 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 369 | Ga0207649_10046235 | 3300025920 | Bacteria | 2673 |
| 370 | Ga0207652_10043512 | 3300025921 | Bacteria | 3823 |
| 371 | Ga0207652_10191547 | 3300025921 | Bacteria | 1839 |
| 372 | Ga0207646_10000300 | 3300025922 | Bacteria | 67365 |
| 373 | Ga0207646_10000647 | 3300025922 | Bacteria | 45144 |
| 374 | Ga0207646_10182531 | 3300025922 | Bacteria | 1895 |
| 375 | Ga0207650_10000688 | 3300025925 | Bacteria | 26557 |
| 376 | Ga0207650_10427121 | 3300025925 | Bacteria | 1100 |
| 377 | Ga0207659_10006861 | 3300025926 | Bacteria | 7003 |
| 378 | Ga0207659_10128556 | 3300025926 | Bacteria | 1952 |
| 379 | Ga0207687_10019067 | 3300025927 | Bacteria | 4540 |
| 380 | Ga0207700_10000029 | 3300025928 | Bacteria | 132615 |
| 381 | Ga0207700_10018831 | 3300025928 | Bacteria | 4651 |
| 382 | Ga0207700_10062583 | 3300025928 | Bacteria | 2827 |
| 383 | Ga0207700_10145287 | 3300025928 | Bacteria | 1954 |
| 384 | Ga0207700_10442423 | 3300025928 | Bacteria | 1144 |
| 385 | Ga0207664_10000110 | 3300025929 | Bacteria | 72637 |
| 386 | Ga0207664_10000648 | 3300025929 | Bacteria | 24123 |
| 387 | Ga0207664_10021467 | 3300025929 | Bacteria | 4803 |
| 388 | Ga0207664_10049721 | 3300025929 | Bacteria | 3302 |
| 389 | Ga0207664_10063647 | 3300025929 | Bacteria | 2948 |
| 390 | Ga0207664_10077660 | 3300025929 | Bacteria | 2691 |
| 391 | Ga0207664_10245979 | 3300025929 | Bacteria | 1559 |
| 392 | Ga0207664_10882095 | 3300025929 | Bacteria | 804 |
| 393 | Ga0207690_10017709 | 3300025932 | Bacteria | 4356 |
| 394 | Ga0207706_10031850 | 3300025933 | Bacteria | 4697 |
| 395 | Ga0207706_10110318 | 3300025933 | Bacteria | 2420 |
| 396 | Ga0207706_10153622 | 3300025933 | Bacteria | 2025 |
| 397 | Ga0207686_10005841 | 3300025934 | Bacteria | 6603 |
| 398 | Ga0207686_10426664 | 3300025934 | Bacteria | 1015 |
| 399 | Ga0207709_10000278 | 3300025935 | Bacteria | 59633 |
| 400 | Ga0207709_10115951 | 3300025935 | Bacteria | 1800 |
| 401 | Ga0207670_10055126 | 3300025936 | Bacteria | 2685 |
| 402 | Ga0207670_10117159 | 3300025936 | Bacteria | 1930 |
| 403 | Ga0207704_10017174 | 3300025938 | Bacteria | 3743 |
| 404 | Ga0207665_10000373 | 3300025939 | Bacteria | 31019 |
| 405 | Ga0207665_10181310 | 3300025939 | Bacteria | 1525 |
| 406 | Ga0207691_10015140 | 3300025940 | Bacteria | 7338 |
| 407 | Ga0207691_10083715 | 3300025940 | Bacteria | 2864 |
| 408 | Ga0207691_10342843 | 3300025940 | Bacteria | 1279 |
| 409 | Ga0207711_10073195 | 3300025941 | Bacteria | 2978 |
| 410 | Ga0207689_10005561 | 3300025942 | Bacteria | 11253 |
| 411 | Ga0207689_10013438 | 3300025942 | Bacteria | 6990 |
| 412 | Ga0207661_10052643 | 3300025944 | Bacteria | 3253 |
| 413 | Ga0207661_10132814 | 3300025944 | Bacteria | 2135 |
| 414 | Ga0207661_10138350 | 3300025944 | Bacteria | 2093 |
| 415 | Ga0207661_10180206 | 3300025944 | Bacteria | 1845 |
| 416 | Ga0207661_10413065 | 3300025944 | Bacteria | 1225 |
| 417 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 418 | Ga0207679_10002012 | 3300025945 | Bacteria | 12619 |
| 419 | Ga0207679_10029241 | 3300025945 | Bacteria | 3835 |
| 420 | Ga0207667_10211282 | 3300025949 | Bacteria | 1989 |
| 421 | Ga0207667_10261825 | 3300025949 | Bacteria | 1768 |
| 422 | Ga0207651_10131438 | 3300025960 | Bacteria | 1917 |
| 423 | Ga0207712_10049637 | 3300025961 | Bacteria | 2925 |
| 424 | Ga0207712_10157878 | 3300025961 | Bacteria | 1759 |
| 425 | Ga0207668_10120500 | 3300025972 | Bacteria | 1986 |
| 426 | Ga0207677_10004672 | 3300026023 | Bacteria | 7378 |
| 427 | Ga0207677_10040589 | 3300026023 | Bacteria | 3069 |
| 428 | Ga0207703_10170951 | 3300026035 | Bacteria | 1911 |
| 429 | Ga0207703_10416909 | 3300026035 | Bacteria | 1249 |
| 430 | Ga0207639_10261275 | 3300026041 | Bacteria | 1514 |
| 431 | Ga0207678_10016455 | 3300026067 | Bacteria | 6493 |
| 432 | Ga0207678_10032732 | 3300026067 | Bacteria | 4531 |
| 433 | Ga0207678_10075576 | 3300026067 | Bacteria | 2886 |
| 434 | Ga0207678_10082743 | 3300026067 | Bacteria | 2746 |
| 435 | Ga0207678_10108638 | 3300026067 | Bacteria | 2366 |
| 436 | Ga0207708_10000996 | 3300026075 | Bacteria | 21178 |
| 437 | Ga0207708_10007569 | 3300026075 | Bacteria | 8034 |
| 438 | Ga0207708_10182793 | 3300026075 | Bacteria | 1665 |
| 439 | Ga0207702_10013428 | 3300026078 | Bacteria | 6808 |
| 440 | Ga0207702_10458040 | 3300026078 | Bacteria | 1238 |
| 441 | Ga0207702_10490259 | 3300026078 | Bacteria | 1197 |
| 442 | Ga0207702_10873376 | 3300026078 | Bacteria | 891 |
| 443 | Ga0207641_10334723 | 3300026088 | Bacteria | 1439 |
| 444 | Ga0207676_10515891 | 3300026095 | Bacteria | 1137 |
| 445 | Ga0207674_10006879 | 3300026116 | Bacteria | 13328 |
| 446 | Ga0207674_10016534 | 3300026116 | Bacteria | 8071 |
| 447 | Ga0207674_10090524 | 3300026116 | Bacteria | 3051 |
| 448 | Ga0207675_100007636 | 3300026118 | Bacteria | 10214 |
| 449 | Ga0207675_100093909 | 3300026118 | Bacteria | 2822 |
| 450 | Ga0207675_100569009 | 3300026118 | Bacteria | 1134 |
| 451 | Ga0207683_10056035 | 3300026121 | Bacteria | 3457 |
| 452 | Ga0207698_10134046 | 3300026142 | Bacteria | 2122 |
| 453 | Ga0207698_10352174 | 3300026142 | Bacteria | 1391 |
| 454 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 455 | Ga0207428_10000812 | 3300027907 | Bacteria | 35326 |
| 456 | Ga0207428_10004869 | 3300027907 | Bacteria | 12659 |
| 457 | Ga0207428_10039803 | 3300027907 | Bacteria | 3816 |
| 458 | Ga0207428_10068592 | 3300027907 | Bacteria | 2789 |
| 459 | Ga0207428_10346945 | 3300027907 | Bacteria | 1093 |
| 460 | Ga0268266_10007082 | 3300028379 | Bacteria | 10182 |
| 461 | Ga0268266_10075054 | 3300028379 | Bacteria | 2937 |
| 462 | Ga0265338_10006561 | 3300028800 | Bacteria | 14771 |
| 463 | Ga0265338_10007488 | 3300028800 | Bacteria | 13527 |
| 464 | Ga0307408_100142179 | 3300031548 | Bacteria | 1885 |
| 465 | Ga0307405_10003598 | 3300031731 | Bacteria | 7157 |
| 466 | Ga0307405_10157063 | 3300031731 | Bacteria | 1606 |
| 467 | Ga0307405_10543652 | 3300031731 | Bacteria | 939 |
| 468 | Ga0307413_10108739 | 3300031824 | Bacteria | 1851 |
| 469 | Ga0307410_10022469 | 3300031852 | Bacteria | 3900 |
| 470 | Ga0307410_10172960 | 3300031852 | Bacteria | 1629 |
| 471 | Ga0307406_10084601 | 3300031901 | Bacteria | 2118 |
| 472 | Ga0307406_10178130 | 3300031901 | Bacteria | 1545 |
| 473 | Ga0307407_10030629 | 3300031903 | Bacteria | 2904 |
| 474 | Ga0307407_10206786 | 3300031903 | Bacteria | 1319 |
| 475 | Ga0307412_10049010 | 3300031911 | Bacteria | 2781 |
| 476 | Ga0307412_10236064 | 3300031911 | Bacteria | 1411 |
| 477 | Ga0307412_10704490 | 3300031911 | Bacteria | 867 |
| 478 | Ga0307409_100015263 | 3300031995 | Bacteria | 5034 |
| 479 | Ga0307409_100021793 | 3300031995 | Bacteria | 4402 |
| 480 | Ga0307409_100071849 | 3300031995 | Bacteria | 2753 |
| 481 | Ga0307409_100120183 | 3300031995 | Bacteria | 2223 |
| 482 | Ga0307416_100091653 | 3300032002 | Bacteria | 2611 |
| 483 | Ga0307416_100102301 | 3300032002 | Bacteria | 2497 |
| 484 | Ga0307416_100176671 | 3300032002 | Bacteria | 1996 |
| 485 | Ga0307416_100238620 | 3300032002 | Bacteria | 1759 |
| 486 | Ga0307414_10180218 | 3300032004 | Bacteria | 1698 |
| 487 | Ga0307411_10024540 | 3300032005 | Bacteria | 3596 |
| 488 | Ga0307415_100006263 | 3300032126 | Bacteria | 6393 |
| 489 | Ga0307415_100030121 | 3300032126 | Bacteria | 3478 |
| 490 | Ga0307415_100048505 | 3300032126 | Bacteria | 2866 |
| 491 | Ga0307415_100075844 | 3300032126 | Bacteria | 2381 |
| 492 | Ga0307415_100090373 | 3300032126 | Bacteria | 2215 |
| 493 | Ga0307415_100490796 | 3300032126 | Bacteria | 1071 |
| 494 | Ga0316214_1001620 | 3300033545 | Bacteria | 2662 |
| 495 | Ga0373938_0013766 | 3300034957 | Bacteria | 1541 |
| 496 | Ga0373926_0003618 | 3300035083 | Bacteria | 5017 |
| 497 | Ga0373926_0003710 | 3300035083 | Bacteria | 4966 |
| 498 | Ga0373934_0000109 | 3300035086 | Bacteria | 29409 |
| 499 | Ga0373934_0022882 | 3300035086 | Bacteria | 2412 |
| 500 | Ga0373944_0001446 | 3300035089 | Bacteria | 5993 |
| 501 | Ga0373944_0004430 | 3300035089 | Bacteria | 3657 |
| 502 | Ga0373923_0011379 | 3300035111 | Bacteria | 3261 |
| 503 | Ga0373936_0001004 | 3300035113 | Bacteria | 10072 |
| 504 | Ga0373936_0004893 | 3300035113 | Bacteria | 5049 |
| 505 | Ga0373939_0003160 | 3300035114 | Bacteria | 3872 |
| 506 | Ga0373945_0000108 | 3300035116 | Bacteria | 19713 |
| 507 | Ga0373945_0003095 | 3300035116 | Bacteria | 5223 |
| 508 | Ga0373953_0000026 | 3300035117 | Bacteria | 40030 |
| 509 | Ga0373954_0010979 | 3300035118 | Bacteria | 4006 |
| 510 | Ga0373954_0024558 | 3300035118 | Bacteria | 2748 |
| 511 | Ga0373956_0136421 | 3300035119 | Bacteria | 1151 |
| 512 | Ga0373957_0000038 | 3300035120 | Bacteria | 34200 |
| 513 | Ga0373957_0003809 | 3300035120 | Bacteria | 4520 |
| 514 | Ga0373957_0021745 | 3300035120 | Bacteria | 2280 |
| 515 | Ga0373943_0003488 | 3300035170 | Bacteria | 7161 |
| 516 | Ga0373943_0024808 | 3300035170 | Bacteria | 2798 |
| 517 | Ga0373946_0000230 | 3300035171 | Bacteria | 17527 |
| 518 | Ga0373946_0003046 | 3300035171 | Bacteria | 5938 |
| 519 | Ga0373946_0146904 | 3300035171 | Bacteria | 1097 |
| 520 | Ga0373955_0000231 | 3300035172 | Bacteria | 23261 |
| 521 | Ga0373955_0006961 | 3300035172 | Bacteria | 5174 |
| 522 | Ga0373942_0013079 | 3300035207 | Bacteria | 1990 |
| 523 | Ga0373961_0008464 | 3300035241 | Bacteria | 2502 |
| 524 | Ga0373924_0000552 | 3300035410 | Bacteria | 11501 |
| 525 | Ga0373924_0002765 | 3300035410 | Bacteria | 5921 |
| 526 | Ga0373924_0039585 | 3300035410 | Bacteria | 1926 |
| 527 | Ga0373931_0028944 | 3300035691 | Bacteria | 2840 |
| 528 | Ga0373931_0242866 | 3300035691 | Bacteria | 1092 |
| 529 | Ga0373935_0001927 | 3300035692 | Bacteria | 11668 |
| 530 | Ga0373935_0023072 | 3300035692 | Bacteria | 3821 |
| 531 | Ga0373927_0004889 | 3300035695 | Bacteria | 9311 |
| 532 | Ga0373927_0007315 | 3300035695 | Bacteria | 7481 |
| 533 | Ga0373927_0065039 | 3300035695 | Bacteria | 2359 |
| 534 | Ga0373933_0000839 | 3300035724 | Bacteria | 18804 |
| 535 | Ga0373933_0055048 | 3300035724 | Bacteria | 2385 |
| 536 | Ga0373933_0240244 | 3300035724 | Bacteria | 1165 |
| 537 | Ga0373933_0286178 | 3300035724 | Bacteria | 1065 |
| 538 | Ga0373947_0018091 | 3300035725 | Bacteria | 4054 |
| 539 | Ga0373947_0113656 | 3300035725 | Bacteria | 1713 |
| 540 | Ga0373937_0000138 | 3300036401 | Bacteria | 70068 |
| 541 | Ga0373937_0088273 | 3300036401 | Bacteria | 2870 |
| 542 | Ga0373937_0094483 | 3300036401 | Bacteria | 2772 |
| 543 | Ga0373937_0099086 | 3300036401 | Bacteria | 2703 |
| 544 | Ga0373937_0117684 | 3300036401 | Bacteria | 2475 |
| 545 | Ga0372808_006474 | 3300036459 | Bacteria | 1579 |
| 546 | Ga0373925_0000699 | 3300037068 | Bacteria | 31424 |
| 547 | Ga0373925_0008741 | 3300037068 | Bacteria | 7377 |
| 548 | Ga0373925_0045005 | 3300037068 | Bacteria | 3277 |
| 549 | Ga0373925_0186342 | 3300037068 | Bacteria | 1645 |
| 550 | Ga0395900_0135703 | 3300037418 | Bacteria | 2521 |
| 551 | Ga0395898_0115475 | 3300037466 | Bacteria | 2572 |
| 552 | Ga0436364_0151261 | 3300037853 | Bacteria | 9936 |
| 553 | Ga0436364_0207639 | 3300037853 | Bacteria | 28695 |
| 554 | Ga0436364_0232843 | 3300037853 | Bacteria | 50861 |
| 555 | Ga0436364_0754028 | 3300037853 | Bacteria | 2027 |
| 556 | Ga0436364_0795184 | 3300037853 | Bacteria | 4769 |
| 557 | Ga0436364_1116138 | 3300037853 | Bacteria | 3248 |
| 558 | Ga0436364_1223164 | 3300037853 | Bacteria | 2827 |
| 559 | Ga0395901_0048266 | 3300038443 | Bacteria | 4421 |
| 560 | Ga0436365_0054221 | 3300039437 | Bacteria | 2082 |
| 561 | Ga0436361_0657470 | 3300039447 | Bacteria | 903 |
| 562 | Ga0439447_007210 | 3300041407 | Bacteria | 3546 |
| 563 | Ga0439466_0001571 | 3300041411 | Bacteria | 8922 |
| 564 | Ga0439466_0001845 | 3300041411 | Bacteria | 8316 |
| 565 | Ga0439466_0025576 | 3300041411 | Bacteria | 2060 |
| 566 | Ga0451853_2100055 | 3300041512 | Bacteria | 907 |
| 567 | Ga0439448_0095320 | 3300042005 | Bacteria | 1008 |
| 568 | Ga0439448_0103761 | 3300042005 | Bacteria | 968 |
| 569 | Ga0439432_000245 | 3300042006 | Bacteria | 19526 |
| 570 | Ga0439452_002580 | 3300042010 | Bacteria | 6640 |
| 571 | Ga0439452_009166 | 3300042010 | Bacteria | 2930 |
| 572 | Ga0439463_001106 | 3300042016 | Bacteria | 7250 |
| 573 | Ga0439463_028790 | 3300042016 | Bacteria | 1400 |
| 574 | Ga0450922_003435 | 3300042124 | Bacteria | 1459 |
| 575 | Ga0450905_036016 | 3300042142 | Bacteria | 775 |
| 576 | Ga0450907_005187 | 3300042146 | Bacteria | 2205 |
| 577 | Ga0450910_000560 | 3300042147 | Bacteria | 4412 |
| 578 | Ga0439444_0070726 | 3300042437 | Bacteria | 746 |
| 579 | Ga0439464_0055042 | 3300042439 | Bacteria | 1157 |
| 580 | Ga0439460_0033491 | 3300042461 | Bacteria | 1476 |
| 581 | Ga0439440_0040338 | 3300042993 | Bacteria | 1136 |
| 582 | Ga0466963_0017103 | 3300044694 | Bacteria | 4517 |
| 583 | Ga0466964_0211351 | 3300044706 | Bacteria | 937 |
| 584 | Ga0466957_0189130 | 3300044842 | Bacteria | 1348 |
| 585 | Ga0466959_0027665 | 3300045049 | Bacteria | 4205 |
| 586 | Ga0466958_0074021 | 3300045836 | Bacteria | 2087 |
| 587 | Ga0466958_0105241 | 3300045836 | Bacteria | 1758 |
| 588 | Ga0466967_0039747 | 3300045976 | Bacteria | 4046 |
| 589 | Ga0466967_0194952 | 3300045976 | Bacteria | 1916 |
| 590 | Ga0495617_001821 | 3300046452 | Bacteria | 9074 |
| 591 | Ga0495617_021565 | 3300046452 | Bacteria | 2175 |
| 592 | Ga0495627_001278 | 3300046453 | Bacteria | 15487 |
| 593 | Ga0495592_0000041 | 3300046454 | Bacteria | 123431 |
| 594 | Ga0495592_0078539 | 3300046454 | Bacteria | 2390 |
| 595 | Ga0495592_0084568 | 3300046454 | Bacteria | 2289 |
| 596 | Ga0495603_0023997 | 3300046455 | Bacteria | 3689 |
| 597 | Ga0495603_0064612 | 3300046455 | Bacteria | 2157 |
| 598 | Ga0495590_0002024 | 3300046457 | Bacteria | 8523 |
| 599 | Ga0495590_0009714 | 3300046457 | Bacteria | 3646 |
| 600 | Ga0495591_001556 | 3300046458 | Bacteria | 14002 |
| 601 | Ga0495591_017215 | 3300046458 | Bacteria | 2490 |
| 602 | Ga0495629_0012281 | 3300046459 | Bacteria | 6203 |
| 603 | Ga0495638_0006808 | 3300046460 | Bacteria | 8254 |
| 604 | Ga0495638_0007153 | 3300046460 | Bacteria | 8040 |
| 605 | Ga0495638_0028702 | 3300046460 | Bacteria | 3590 |
| 606 | Ga0495641_0008055 | 3300046461 | Bacteria | 6480 |
| 607 | Ga0495651_0000018 | 3300046462 | Bacteria | 123195 |
| 608 | Ga0495651_0006316 | 3300046462 | Bacteria | 9065 |
| 609 | Ga0495651_0029577 | 3300046462 | Bacteria | 4272 |
| 610 | Ga0495651_0076090 | 3300046462 | Bacteria | 2543 |
| 611 | Ga0495653_0003023 | 3300046463 | Bacteria | 13488 |
| 612 | Ga0495653_0010353 | 3300046463 | Bacteria | 7627 |
| 613 | Ga0495653_0020353 | 3300046463 | Bacteria | 5380 |
| 614 | Ga0495653_0032425 | 3300046463 | Bacteria | 4147 |
| 615 | Ga0495653_0125368 | 3300046463 | Bacteria | 1824 |
| 616 | Ga0495653_0385863 | 3300046463 | Bacteria | 893 |
| 617 | Ga0495650_0003766 | 3300046471 | Bacteria | 10820 |
| 618 | Ga0495650_0004163 | 3300046471 | Bacteria | 10061 |
| 619 | Ga0495650_0016994 | 3300046471 | Bacteria | 3659 |
| 620 | Ga0495580_0021796 | 3300046472 | Bacteria | 4724 |
| 621 | Ga0495582_0006199 | 3300046473 | Bacteria | 6660 |
| 622 | Ga0495582_0136741 | 3300046473 | Bacteria | 1387 |
| 623 | Ga0495605_0003165 | 3300046474 | Bacteria | 9894 |
| 624 | Ga0495605_0010478 | 3300046474 | Bacteria | 5184 |
| 625 | Ga0495639_0000474 | 3300046475 | Bacteria | 19141 |
| 626 | Ga0495639_0032642 | 3300046475 | Bacteria | 2323 |
| 627 | Ga0495662_0000516 | 3300046476 | Bacteria | 17630 |
| 628 | Ga0495662_0004052 | 3300046476 | Bacteria | 7377 |
| 629 | Ga0495664_0001298 | 3300046477 | Bacteria | 13086 |
| 630 | Ga0495664_0007339 | 3300046477 | Bacteria | 6119 |
| 631 | Ga0495584_0005764 | 3300046491 | Bacteria | 6533 |
| 632 | Ga0495584_0012853 | 3300046491 | Bacteria | 4272 |
| 633 | Ga0495584_0028491 | 3300046491 | Bacteria | 2830 |
| 634 | Ga0495584_0047417 | 3300046491 | Bacteria | 2166 |
| 635 | Ga0495585_0006356 | 3300046492 | Bacteria | 7339 |
| 636 | Ga0495585_0017597 | 3300046492 | Bacteria | 4128 |
| 637 | Ga0495585_0054742 | 3300046492 | Bacteria | 2205 |
| 638 | Ga0495594_0005447 | 3300046499 | Bacteria | 6542 |
| 639 | Ga0495596_0001019 | 3300046500 | Bacteria | 16647 |
| 640 | Ga0495607_0005334 | 3300046501 | Bacteria | 9236 |
| 641 | Ga0495607_0012168 | 3300046501 | Bacteria | 5689 |
| 642 | Ga0495607_0033438 | 3300046501 | Bacteria | 3128 |
| 643 | Ga0495606_0009252 | 3300046507 | Bacteria | 8364 |
| 644 | Ga0495606_0012613 | 3300046507 | Bacteria | 6757 |
| 645 | Ga0495606_0052496 | 3300046507 | Bacteria | 2650 |
| 646 | Ga0495606_0192222 | 3300046507 | Bacteria | 1169 |
| 647 | Ga0495608_0000039 | 3300046511 | Bacteria | 123195 |
| 648 | Ga0495608_0014158 | 3300046511 | Bacteria | 5533 |
| 649 | Ga0495608_0087404 | 3300046511 | Bacteria | 2019 |
| 650 | Ga0495610_0004508 | 3300046512 | Bacteria | 10261 |
| 651 | Ga0495610_0018167 | 3300046512 | Bacteria | 3979 |
| 652 | Ga0495610_0036524 | 3300046512 | Bacteria | 2509 |
| 653 | Ga0495616_0003008 | 3300046513 | Bacteria | 10938 |
| 654 | Ga0495616_0020999 | 3300046513 | Bacteria | 3545 |
| 655 | Ga0495616_0029325 | 3300046513 | Bacteria | 2906 |
| 656 | Ga0495618_0006968 | 3300046514 | Bacteria | 6847 |
| 657 | Ga0495618_0011419 | 3300046514 | Bacteria | 5386 |
| 658 | Ga0495618_0027293 | 3300046514 | Bacteria | 3555 |
| 659 | Ga0495618_0115763 | 3300046514 | Bacteria | 1716 |
| 660 | Ga0495620_0027062 | 3300046515 | Bacteria | 2688 |
| 661 | Ga0495620_0077855 | 3300046515 | Bacteria | 1345 |
| 662 | Ga0495628_0000219 | 3300046516 | Bacteria | 50121 |
| 663 | Ga0495628_0060553 | 3300046516 | Bacteria | 2970 |
| 664 | Ga0495628_0066063 | 3300046516 | Bacteria | 2827 |
| 665 | Ga0495630_0010651 | 3300046517 | Bacteria | 6636 |
| 666 | Ga0495630_0020684 | 3300046517 | Bacteria | 4854 |
| 667 | Ga0495630_0124467 | 3300046517 | Bacteria | 1956 |
| 668 | Ga0495631_0001618 | 3300046518 | Bacteria | 13460 |
| 669 | Ga0495632_0005336 | 3300046519 | Bacteria | 8522 |
| 670 | Ga0495632_0067573 | 3300046519 | Bacteria | 1723 |
| 671 | Ga0495637_0002281 | 3300046520 | Bacteria | 10629 |
| 672 | Ga0495637_0012132 | 3300046520 | Bacteria | 4126 |
| 673 | Ga0495637_0021286 | 3300046520 | Bacteria | 2975 |
| 674 | Ga0495637_0042922 | 3300046520 | Bacteria | 1932 |
| 675 | Ga0495643_0008330 | 3300046522 | Bacteria | 6576 |
| 676 | Ga0495643_0010743 | 3300046522 | Bacteria | 5623 |
| 677 | Ga0495644_0001628 | 3300046523 | Bacteria | 9152 |
| 678 | Ga0495644_0002235 | 3300046523 | Bacteria | 7743 |
| 679 | Ga0495644_0046263 | 3300046523 | Bacteria | 1635 |
| 680 | Ga0495648_0007519 | 3300046524 | Bacteria | 8712 |
| 681 | Ga0495648_0033872 | 3300046524 | Bacteria | 3331 |
| 682 | Ga0495648_0065028 | 3300046524 | Bacteria | 2146 |
| 683 | Ga0495666_0006631 | 3300046526 | Bacteria | 5821 |
| 684 | Ga0495666_0022579 | 3300046526 | Bacteria | 3115 |
| 685 | Ga0495666_0026794 | 3300046526 | Bacteria | 2838 |
| 686 | Ga0495642_0000428 | 3300046528 | Bacteria | 22248 |
| 687 | Ga0495652_0000092 | 3300046529 | Bacteria | 96258 |
| 688 | Ga0495652_0037800 | 3300046529 | Bacteria | 4185 |
| 689 | Ga0495652_0045158 | 3300046529 | Bacteria | 3790 |
| 690 | Ga0495652_0068985 | 3300046529 | Bacteria | 2961 |
| 691 | Ga0495652_0188511 | 3300046529 | Bacteria | 1576 |
| 692 | Ga0495654_0007588 | 3300046530 | Bacteria | 6043 |
| 693 | Ga0495654_0043981 | 3300046530 | Bacteria | 2211 |
| 694 | Ga0495654_0046945 | 3300046530 | Bacteria | 2124 |
| 695 | Ga0495665_0000931 | 3300046531 | Bacteria | 15431 |
| 696 | Ga0495640_0003021 | 3300046533 | Bacteria | 13541 |
| 697 | Ga0495640_0053602 | 3300046533 | Bacteria | 2765 |
| 698 | Ga0495640_0088024 | 3300046533 | Bacteria | 2053 |
| 699 | Ga0495586_0020777 | 3300046535 | Bacteria | 3497 |
| 700 | Ga0495586_0091452 | 3300046535 | Bacteria | 1681 |
| 701 | Ga0495586_0133961 | 3300046535 | Bacteria | 1388 |
| 702 | Ga0495586_0356496 | 3300046535 | Bacteria | 840 |
| 703 | Ga0495587_0000034 | 3300046536 | Bacteria | 123432 |
| 704 | Ga0495587_0004722 | 3300046536 | Bacteria | 8939 |
| 705 | Ga0495587_0013395 | 3300046536 | Bacteria | 5155 |
| 706 | Ga0495587_0018099 | 3300046536 | Bacteria | 4369 |
| 707 | Ga0495587_0123893 | 3300046536 | Bacteria | 1479 |
| 708 | Ga0495597_0028272 | 3300046542 | Bacteria | 2566 |
| 709 | Ga0495597_0034605 | 3300046542 | Bacteria | 2282 |
| 710 | Ga0495597_0210960 | 3300046542 | Bacteria | 774 |
| 711 | Ga0495645_0027269 | 3300046543 | Bacteria | 4148 |
| 712 | Ga0495645_0076341 | 3300046543 | Bacteria | 2411 |
| 713 | Ga0495645_0160390 | 3300046543 | Bacteria | 1555 |
| 714 | Ga0495622_0045856 | 3300046557 | Bacteria | 2031 |
| 715 | Ga0495622_0058486 | 3300046557 | Bacteria | 1785 |
| 716 | Ga0495633_0021998 | 3300046558 | Bacteria | 3180 |
| 717 | Ga0495667_0000150 | 3300046559 | Bacteria | 47612 |
| 718 | Ga0495667_0006215 | 3300046559 | Bacteria | 8090 |
| 719 | Ga0495667_0040918 | 3300046559 | Bacteria | 3074 |
| 720 | Ga0495667_0053657 | 3300046559 | Bacteria | 2654 |
| 721 | Ga0495667_0113671 | 3300046559 | Bacteria | 1749 |
| 722 | Ga0495668_0002481 | 3300046616 | Bacteria | 15151 |
| 723 | Ga0495668_0011313 | 3300046616 | Bacteria | 5352 |
| 724 | Ga0495634_0007167 | 3300046642 | Bacteria | 8407 |
| 725 | Ga0495634_0019820 | 3300046642 | Bacteria | 4774 |
| 726 | Ga0495635_0000138 | 3300046663 | Bacteria | 44247 |
| 727 | Ga0495635_0058140 | 3300046663 | Bacteria | 2660 |
| 728 | Ga0495635_0417361 | 3300046663 | Bacteria | 890 |
| 729 | Ga0495661_0002061 | 3300046665 | Bacteria | 15772 |
| 730 | Ga0495661_0024627 | 3300046665 | Bacteria | 3896 |
| 731 | Ga0495661_0033827 | 3300046665 | Bacteria | 3221 |
| 732 | Ga0495661_0253666 | 3300046665 | Bacteria | 897 |
| 733 | Ga0495588_0050781 | 3300046674 | Bacteria | 2134 |
| 734 | Ga0495657_0000247 | 3300046675 | Bacteria | 49117 |
| 735 | Ga0495657_0024301 | 3300046675 | Bacteria | 4319 |
| 736 | Ga0495657_0025714 | 3300046675 | Bacteria | 4177 |
| 737 | Ga0495657_0071500 | 3300046675 | Bacteria | 2264 |
| 738 | Ga0495599_0000108 | 3300046678 | Bacteria | 56078 |
| 739 | Ga0495599_0024326 | 3300046678 | Bacteria | 3787 |
| 740 | Ga0495599_0036727 | 3300046678 | Bacteria | 3077 |
| 741 | Ga0495623_0000287 | 3300046679 | Bacteria | 32946 |
| 742 | Ga0495623_0037083 | 3300046679 | Bacteria | 3122 |
| 743 | Ga0495623_0107845 | 3300046679 | Bacteria | 1691 |
| 744 | Ga0495646_0010019 | 3300046680 | Bacteria | 6025 |
| 745 | Ga0495646_0015574 | 3300046680 | Bacteria | 4824 |
| 746 | Ga0495646_0029848 | 3300046680 | Bacteria | 3405 |
| 747 | Ga0495646_0032537 | 3300046680 | Bacteria | 3245 |
| 748 | Ga0495646_0032903 | 3300046680 | Bacteria | 3224 |
| 749 | Ga0495658_0006740 | 3300046683 | Bacteria | 5649 |
| 750 | Ga0495613_0029608 | 3300046689 | Bacteria | 4069 |
| 751 | Ga0495613_0062281 | 3300046689 | Bacteria | 2730 |
| 752 | Ga0495624_0011849 | 3300046690 | Bacteria | 5981 |
| 753 | Ga0495624_0021948 | 3300046690 | Bacteria | 4227 |
| 754 | Ga0495671_0005316 | 3300046692 | Bacteria | 7558 |
| 755 | Ga0495671_0014377 | 3300046692 | Bacteria | 4262 |
| 756 | Ga0495671_0024497 | 3300046692 | Bacteria | 3142 |
| 757 | Ga0495671_0030848 | 3300046692 | Bacteria | 2742 |
| 758 | Ga0495671_0035610 | 3300046692 | Bacteria | 2526 |
| 759 | Ga0495649_0005895 | 3300046694 | Bacteria | 7688 |
| 760 | Ga0495649_0040098 | 3300046694 | Bacteria | 2566 |
| 761 | Ga0495649_0278842 | 3300046694 | Bacteria | 854 |
| 762 | Ga0495589_0056156 | 3300046794 | Bacteria | 1938 |
| 763 | Ga0495600_0008104 | 3300046809 | Bacteria | 6444 |
| 764 | Ga0495600_0018909 | 3300046809 | Bacteria | 4396 |
| 765 | Ga0495600_0025206 | 3300046809 | Bacteria | 3832 |
| 766 | Ga0495600_0043831 | 3300046809 | Bacteria | 2918 |
| 767 | Ga0495600_0078534 | 3300046809 | Bacteria | 2155 |
| 768 | Ga0495660_0034921 | 3300046810 | Bacteria | 2811 |
| 769 | Ga0495660_0035259 | 3300046810 | Bacteria | 2796 |
| 770 | Ga0495660_0041381 | 3300046810 | Bacteria | 2551 |
| 771 | Ga0495581_0000404 | 3300047315 | Bacteria | 21732 |
| 772 | Ga0495604_0000039 | 3300047317 | Bacteria | 123431 |
| 773 | Ga0495604_0014132 | 3300047317 | Bacteria | 6366 |
| 774 | Ga0495604_0042395 | 3300047317 | Bacteria | 3566 |
| 775 | Ga0495604_0054659 | 3300047317 | Bacteria | 3080 |
| 776 | Ga0495674_0000235 | 3300047319 | Bacteria | 46762 |
| 777 | Ga0495674_0032287 | 3300047319 | Bacteria | 4749 |
| 778 | Ga0495674_0069294 | 3300047319 | Bacteria | 3050 |
| 779 | Ga0495674_0119497 | 3300047319 | Bacteria | 2227 |
| 780 | Ga0495674_0220167 | 3300047319 | Bacteria | 1569 |
| 781 | Ga0495672_0006489 | 3300047320 | Bacteria | 9046 |
| 782 | Ga0495672_0011761 | 3300047320 | Bacteria | 6155 |
| 783 | Ga0495672_0021657 | 3300047320 | Bacteria | 4189 |
| 784 | Ga0495672_0025137 | 3300047320 | Bacteria | 3819 |
| 785 | Ga0495672_0035999 | 3300047320 | Bacteria | 3043 |
| 786 | Ga0495676_0009006 | 3300047321 | Bacteria | 9108 |
| 787 | Ga0495680_0000028 | 3300047322 | Bacteria | 112865 |
| 788 | Ga0495680_0022902 | 3300047322 | Bacteria | 5201 |
| 789 | Ga0495680_0067062 | 3300047322 | Bacteria | 2744 |
| 790 | Ga0495680_0067307 | 3300047322 | Bacteria | 2738 |
| 791 | Ga0495680_0089168 | 3300047322 | Bacteria | 2315 |
| 792 | Ga0495680_0093239 | 3300047322 | Bacteria | 2254 |
| 793 | Ga0495680_0131031 | 3300047322 | Bacteria | 1842 |
| 794 | Ga0495683_0001139 | 3300047323 | Bacteria | 18304 |
| 795 | Ga0495683_0003272 | 3300047323 | Bacteria | 9466 |
| 796 | Ga0495687_011902 | 3300047443 | Bacteria | 4644 |
| 797 | Ga0495675_0000355 | 3300047444 | Bacteria | 32066 |
| 798 | Ga0495675_0025159 | 3300047444 | Bacteria | 3796 |
| 799 | Ga0495675_0062657 | 3300047444 | Bacteria | 2354 |
| 800 | Ga0495673_0002014 | 3300047469 | Bacteria | 14940 |
| 801 | Ga0495673_0006091 | 3300047469 | Bacteria | 7162 |
| 802 | Ga0495673_0033665 | 3300047469 | Bacteria | 2375 |
| 803 | Ga0495681_0001437 | 3300047470 | Bacteria | 17881 |
| 804 | Ga0495681_0004955 | 3300047470 | Bacteria | 8985 |
| 805 | Ga0495681_0008404 | 3300047470 | Bacteria | 6480 |
| 806 | Ga0495681_0041839 | 3300047470 | Bacteria | 2222 |
| 807 | Ga0495684_0000154 | 3300047471 | Bacteria | 50763 |
| 808 | Ga0495684_0031991 | 3300047471 | Bacteria | 4038 |
| 809 | Ga0495686_0011501 | 3300047472 | Bacteria | 6233 |
| 810 | Ga0495686_0063105 | 3300047472 | Bacteria | 2296 |
| 811 | Ga0495593_0007879 | 3300047673 | Bacteria | 6201 |
| 812 | Ga0495593_0047235 | 3300047673 | Bacteria | 2290 |
| 813 | Ga0495593_0053990 | 3300047673 | Bacteria | 2119 |
| 814 | Ga0495602_0000043 | 3300048088 | Bacteria | 123431 |
| 815 | Ga0495602_0047998 | 3300048088 | Bacteria | 3842 |
| 816 | Ga0495602_0095634 | 3300048088 | Bacteria | 2452 |
| 817 | Ga0495614_0040246 | 3300048089 | Bacteria | 2006 |
| 818 | Ga0495626_0001346 | 3300048091 | Bacteria | 19873 |
| 819 | Ga0495626_0002001 | 3300048091 | Bacteria | 15031 |
| 820 | Ga0495626_0004960 | 3300048091 | Bacteria | 7980 |
| 821 | Ga0495626_0020224 | 3300048091 | Bacteria | 3319 |
| 822 | Ga0496100_0075070 | 3300048903 | Bacteria | 2266 |
| 823 | Ga0496100_0195252 | 3300048903 | Bacteria | 1472 |
| 824 | Ga0496100_0250681 | 3300048903 | Bacteria | 1309 |
| 825 | Ga0496101_0026411 | 3300048904 | Bacteria | 4037 |
| 826 | Ga0496101_0093592 | 3300048904 | Bacteria | 2239 |
| 827 | Ga0496102_0007449 | 3300048905 | Bacteria | 9353 |
| 828 | Ga0496103_0079345 | 3300048906 | Bacteria | 2062 |
| 829 | Ga0496104_0005365 | 3300048907 | Bacteria | 11220 |
| 830 | Ga0496104_0131346 | 3300048907 | Bacteria | 2405 |
| 831 | Ga0496105_0076305 | 3300048908 | Bacteria | 2767 |
| 832 | Ga0496105_0172308 | 3300048908 | Bacteria | 1774 |
| 833 | Ga0496105_0190167 | 3300048908 | Bacteria | 1679 |
| 834 | Ga0496106_0015803 | 3300048909 | Bacteria | 5583 |
| 835 | Ga0496107_0236872 | 3300048910 | Bacteria | 1358 |
| 836 | Ga0496107_0323519 | 3300048910 | Bacteria | 1147 |
| 837 | Ga0496108_0009911 | 3300048911 | Bacteria | 7723 |
| 838 | Ga0496108_0191706 | 3300048911 | Bacteria | 1771 |
| 839 | Ga0496108_0368036 | 3300048911 | Bacteria | 1255 |
| 840 | Ga0496109_0117152 | 3300048912 | Bacteria | 2479 |
| 841 | Ga0496109_0258255 | 3300048912 | Bacteria | 1641 |
| 842 | Ga0496110_0057350 | 3300048913 | Bacteria | 3428 |
| 843 | Ga0496110_0342610 | 3300048913 | Bacteria | 1361 |
| 844 | Ga0496111_0042240 | 3300048914 | Bacteria | 3273 |
| 845 | Ga0496111_0129812 | 3300048914 | Bacteria | 1864 |
| 846 | Ga0496112_0119785 | 3300048915 | Bacteria | 2602 |
| 847 | Ga0496112_0121149 | 3300048915 | Bacteria | 2585 |
| 848 | Ga0496112_0431751 | 3300048915 | Bacteria | 1255 |
| 849 | Ga0496112_0498617 | 3300048915 | Bacteria | 1153 |
| 850 | Ga0496113_0121646 | 3300048916 | Bacteria | 2041 |
| 851 | Ga0496113_0123556 | 3300048916 | Bacteria | 2025 |
| 852 | Ga0496113_0223781 | 3300048916 | Bacteria | 1500 |
| 853 | Ga0496114_0054914 | 3300048917 | Bacteria | 3321 |
| 854 | Ga0496115_0036854 | 3300048918 | Bacteria | 3873 |
| 855 | Ga0496115_0061608 | 3300048918 | Bacteria | 3025 |
| 856 | Ga0496116_0000126 | 3300048919 | Bacteria | 160425 |
| 857 | Ga0496117_0000950 | 3300048920 | Bacteria | 44286 |
| 858 | Ga0496117_0028769 | 3300048920 | Bacteria | 4297 |
| 859 | Ga0496118_0055353 | 3300048921 | Bacteria | 2994 |
| 860 | Ga0496119_0035855 | 3300048922 | Bacteria | 3243 |
| 861 | Ga0496119_0115723 | 3300048922 | Bacteria | 1481 |
| 862 | Ga0496119_0197243 | 3300048922 | Bacteria | 1044 |
| 863 | Ga0496121_0000142 | 3300048924 | Bacteria | 160072 |
| 864 | Ga0496122_0060191 | 3300048925 | Bacteria | 2798 |
| 865 | Ga0496123_0011472 | 3300048926 | Bacteria | 7676 |
| 866 | Ga0496123_0092143 | 3300048926 | Bacteria | 1794 |
| 867 | Ga0496124_0115771 | 3300048927 | Bacteria | 2150 |
| 868 | Ga0496126_0004789 | 3300048929 | Bacteria | 15903 |
| 869 | Ga0496126_0013912 | 3300048929 | Bacteria | 8163 |
| 870 | Ga0496126_0167728 | 3300048929 | Bacteria | 1873 |
| 871 | Ga0496126_0287593 | 3300048929 | Bacteria | 1360 |
| 872 | Ga0495678_011256 | 3300049459 | Bacteria | 4293 |
| 873 | Ga0495678_013240 | 3300049459 | Bacteria | 3880 |
| 874 | Ga0501031_0051723 | 3300049568 | Bacteria | 2676 |
| 875 | Ga0501031_0183172 | 3300049568 | Bacteria | 1368 |
| 876 | Ga0501037_0072516 | 3300049573 | Bacteria | 2504 |
| 877 | Ga0501038_0194556 | 3300049574 | Bacteria | 1630 |
| 878 | Ga0501039_0006861 | 3300049575 | Bacteria | 8663 |
| 879 | Ga0501040_0000259 | 3300049576 | Bacteria | 30940 |
| 880 | Ga0501040_0256415 | 3300049576 | Bacteria | 1248 |
| 881 | Ga0501041_0000491 | 3300049577 | Bacteria | 20231 |
| 882 | Ga0501042_0001520 | 3300049578 | Bacteria | 13731 |
| 883 | Ga0501042_0070913 | 3300049578 | Bacteria | 2493 |
| 884 | Ga0501043_0015672 | 3300049579 | Bacteria | 5941 |
| 885 | Ga0501046_0000713 | 3300049580 | Bacteria | 32092 |
| 886 | Ga0501047_0322907 | 3300049581 | Bacteria | 1383 |
| 887 | Ga0501048_0002303 | 3300049582 | Bacteria | 14567 |
| 888 | Ga0501068_0071819 | 3300049584 | Bacteria | 2113 |
| 889 | Ga0501069_0044365 | 3300049585 | Bacteria | 2461 |
| 890 | Ga0501070_0417698 | 3300049586 | Bacteria | 1084 |
| 891 | Ga0501071_0017040 | 3300049587 | Bacteria | 5004 |
| 892 | Ga0501072_0012113 | 3300049588 | Bacteria | 6587 |
| 893 | Ga0501073_0221522 | 3300049589 | Bacteria | 1307 |
| 894 | Ga0501075_0000854 | 3300049591 | Bacteria | 19222 |
| 895 | Ga0501075_0255294 | 3300049591 | Bacteria | 1336 |
| 896 | Ga0501076_0001606 | 3300049592 | Bacteria | 15222 |
| 897 | Ga0501077_0036972 | 3300049593 | Bacteria | 3110 |
| 898 | Ga0501079_0000169 | 3300049741 | Bacteria | 36466 |
| 899 | Ga0501079_0485785 | 3300049741 | Bacteria | 971 |
| 900 | Ga0501080_0046817 | 3300049742 | Bacteria | 4026 |
| 901 | Ga0501081_0000098 | 3300049743 | Bacteria | 36248 |
| 902 | Ga0501081_0187380 | 3300049743 | Bacteria | 1498 |
| 903 | Ga0501035_0135651 | 3300049822 | Bacteria | 2143 |
| 904 | Ga0501044_0034624 | 3300049823 | Bacteria | 5295 |
| 905 | Ga0501045_0000786 | 3300049824 | Bacteria | 20411 |
| 906 | nmdc:mga03683_126482_c1 | 3300050489 | Bacteria | 1140 |
| 907 | nmdc:mga05p37_18612_c1 | 3300050507 | Bacteria | 8394 |
| 908 | nmdc:mga05p37_38629_c1 | 3300050507 | Bacteria | 5856 |
| 909 | nmdc:mga05p37_70517_c1 | 3300050507 | Bacteria | 4298 |
| 910 | nmdc:mga05p37_7776_c1 | 3300050507 | Bacteria | 12660 |
| 911 | nmdc:mga0qj67_38929_c1 | 3300050509 | Bacteria | 3732 |
| 912 | nmdc:mga06r32_132293_c1 | 3300050510 | Bacteria | 2468 |
| 913 | nmdc:mga08y16_17674_c1 | 3300050511 | Bacteria | 7512 |
| 914 | nmdc:mga08y16_247542_c1 | 3300050511 | Bacteria | 1842 |
| 915 | nmdc:mga08y16_293788_c1 | 3300050511 | Bacteria | 1675 |
| 916 | nmdc:mga08y16_77951_c1 | 3300050511 | Bacteria | 3455 |
| 917 | nmdc:mga08y16_89210_c1 | 3300050511 | Bacteria | 3213 |
| 918 | nmdc:mga0n895_26402_c1 | 3300050512 | Bacteria | 5499 |
| 919 | nmdc:mga0n895_6961_c1 | 3300050512 | Bacteria | 9652 |
| 920 | nmdc:mga0rr50_147025_c1 | 3300050513 | Bacteria | 1901 |
| 921 | nmdc:mga0rr50_62244_c1 | 3300050513 | Bacteria | 2814 |
| 922 | nmdc:mga0rr50_78829_c1 | 3300050513 | Bacteria | 2536 |
| 923 | nmdc:mga08x19_11539_c1 | 3300050514 | Bacteria | 5318 |
| 924 | nmdc:mga08x19_2303_c1 | 3300050514 | Bacteria | 11606 |
| 925 | nmdc:mga0a205_2379_c1 | 3300050515 | Bacteria | 16569 |
| 926 | nmdc:mga0a205_30481_c1 | 3300050515 | Bacteria | 5165 |
| 927 | Ga0495601_0022434 | 3300053077 | Bacteria | 3874 |
| 928 | Ga0495601_0169459 | 3300053077 | Bacteria | 1427 |
| 929 | Ga0495601_0375338 | 3300053077 | Bacteria | 923 |
| 930 | Ga0495612_0020306 | 3300053078 | Bacteria | 2662 |
| 931 | Ga0495595_0018766 | 3300053084 | Bacteria | 2992 |
| 932 | Ga0495595_0030064 | 3300053084 | Bacteria | 2434 |
| 933 | Ga0495619_0056692 | 3300053085 | Bacteria | 2598 |
| 934 | Ga0495619_0063108 | 3300053085 | Bacteria | 2467 |
| 935 | Ga0500559_0007699 | 3300053136 | Bacteria | 4755 |
| 936 | Ga0501084_0006102 | 3300054114 | Bacteria | 9907 |
| 937 | Ga0590071_021000 | 3300059421 | Bacteria | 1538 |
| 938 | Ga0590074_005145 | 3300059423 | Bacteria | 2161 |
| 939 | Ga0590075_003397 | 3300059424 | Bacteria | 3790 |
| 940 | Ga0590077_004808 | 3300059426 | Bacteria | 2763 |
| 941 | Ga0501082_0001871 | 3300060353 | Bacteria | 18521 |
| 942 | Ga0530510_0141306 | 3300061734 | Bacteria | 1774 |
| 943 | 2511265945 | 2511231006 | Bacteria | 6794709 |
| 944 | 2511279114 | 2511231008 | Bacteria | 6624100 |
| 945 | 2511294909 | 2511231011 | Bacteria | 6149768 |
| 946 | 2511302970 | 2511231012 | Bacteria | 6738011 |
| 947 | 2511313718 | 2511231014 | Bacteria | 6462302 |
| 948 | 2511320391 | 2511231015 | Bacteria | 6598026 |
| 949 | 2511324095 | 2511231016 | Bacteria | 6704427 |
| 950 | 2511330550 | 2511231017 | Bacteria | 6503007 |
| 951 | 2511336621 | 2511231018 | Bacteria | 6436256 |
| 952 | 2511344045 | 2511231019 | Bacteria | 6520662 |
| 953 | 2511353297 | 2511231020 | Bacteria | 6115223 |
| 954 | 2511355184 | 2511231021 | Bacteria | 7302637 |
| 955 | 2511823330 | 2511231156 | Bacteria | 6845832 |
| 956 | 2512326395 | 2512047018 | Bacteria | 6663241 |
| 957 | 2555668298 | 2554235341 | Bacteria | 6867980 |
| 958 | 2583790721 | 2582580891 | Bacteria | 6800976 |
| 959 | 2597856513 | 2597489887 | Bacteria | 6666321 |
| 960 | 2597862623 | 2597489888 | Bacteria | 6179543 |
| 961 | 2599355299 | 2599185160 | Bacteria | 6844013 |
| 962 | 2599360878 | 2599185161 | Bacteria | 6960462 |
| 963 | 2599367200 | 2599185162 | Bacteria | 6957254 |
| 964 | 2599373990 | 2599185163 | Bacteria | 6995158 |
| 965 | 2599380405 | 2599185164 | Bacteria | 6841688 |
| 966 | 2599386852 | 2599185165 | Bacteria | 6843250 |
| 967 | 2599392848 | 2599185166 | Bacteria | 6959206 |
| 968 | 2599404615 | 2599185168 | Bacteria | 6997636 |
| 969 | 2599462133 | 2599185181 | Bacteria | 6844519 |
| 970 | 2599466824 | 2599185182 | Bacteria | 6883168 |
| 971 | 2599483234 | 2599185185 | Bacteria | 6652270 |
| 972 | 2599490775 | 2599185186 | Bacteria | 6831633 |
| 973 | 2599805133 | 2599185257 | Bacteria | 6492581 |
| 974 | 2600214755 | 2599185356 | Bacteria | 6843884 |
| 975 | 2600363843 | 2600254931 | Bacteria | 6734225 |
| 976 | 2601774540 | 2600255313 | Bacteria | 6842543 |
| 977 | 2643845291 | 2643221565 | Bacteria | 6216018 |
| 978 | 2643952056 | 2643221589 | Bacteria | 6250934 |
| 979 | 2644024185 | 2643221602 | Bacteria | 6249926 |
| 980 | 2671097901 | 2667528171 | Bacteria | 6900659 |
| 981 | 2671768133 | 2671180172 | Bacteria | 6495783 |
| 982 | 2723247506 | 2721755607 | Bacteria | 5841722 |
| 983 | 2739198627 | 2738543004 | Bacteria | 6381073 |
| 984 | 2739256612 | 2738543015 | Bacteria | 6750701 |
| 985 | 2743735929 | 2740892503 | Bacteria | 6855563 |
| 986 | 2774136108 | 2773857673 | Bacteria | 6513460 |
| 987 | 2784260181 | 2784132063 | Bacteria | 6262788 |
| 988 | 2819702985 | 2818991464 | Bacteria | 6907494 |
| 989 | 2834029307 | 2834028612 | Bacteria | 6354979 |
| 990 | 2837186548 | 2837183177 | Bacteria | 4637169 |
| 991 | 2844668820 | 2844665904 | Bacteria | 6817974 |
| 992 | 2852658594 | 2852657418 | Bacteria | 6472974 |
| 993 | 2860340391 | 2860339153 | Bacteria | 6846989 |
| 994 | 2880231973 | 2880230671 | Bacteria | 6140320 |
| 995 | 2904521013 | 2904518522 | Bacteria | 6068986 |
| 996 | 2904551645 | 2904550169 | Bacteria | 6221258 |
| 997 | 2917072065 | 2917070673 | Bacteria | 6868303 |
| 998 | 2919458049 | 2919456309 | Bacteria | 6586567 |
| 999 | 2923154939 | 2923153595 | Bacteria | 6870622 |
| 1000 | 2931399704 | 2931396565 | Bacteria | 7251677 |
| 1001 | 2935354237 | 2935353572 | Unclassified | 6955622 |
| 1002 | 2939637819 | 2939636861 | Bacteria | 6297853 |
| 1003 | 2945929256 | 2945928738 | Bacteria | 6053221 |
| 1004 | 2945961578 | 2945961074 | Bacteria | 7342064 |
| 1005 | 2947236140 | 2947233263 | Bacteria | 6439278 |
| 1006 | 2984291092 | 2984286254 | Bacteria | 6702062 |
| 1007 | 3007512678 | 3007511990 | Bacteria | 6481491 |
| 1008 | 3007855917 | 3007855910 | Bacteria | 5637581 |
| 1009 | 3007863458 | 3007861166 | Bacteria | 6045338 |
| 1010 | 637318660 | 637000220 | Bacteria | 7074893 |
| 1011 | 8015689171 | 8015687852 | Bacteria | 6613826 |
| 1012 | 8055772291 | 8055770955 | Bacteria | 6827675 |
| 1013 | 8056127348 | 8056125926 | Bacteria | 6228218 |
| 1014 | 8056149500 | 8056148874 | Bacteria | 6479865 |
| 1015 | 8056164665 | 8056161164 | Bacteria | 6106669 |
| 1016 | 8056180314 | 8056177738 | Bacteria | 6748268 |
| 1017 | 8056569969 | 8056569372 | Bacteria | 5997322 |
| 1018 | Ga0070698_100035428 | |||
| 1019 | RicEn_FSXC49909_b1 | |||
| 1020 | JGI25162J39368_1000054 | |||
| 1021 | JGI25162J39368_1000898 | |||
| 1022 | JGI25163J39215_1000269 | |||
| 1023 | JGI25163J39215_1000348 | |||
| 1024 | JGI25164J39214_1000029 | |||
| 1025 | JGI25164J39214_1000492 | |||
| 1026 | JGI25406J46586_10040029 | |||
| 1027 | JGI25165J46597_1000111 | |||
| 1028 | JGI25165J46597_1000934 | |||
| 1029 | Ga0055538_1000082 | |||
| 1030 | Ga0055539_1000121 | |||
| 1031 | Ga0055533_1000129 | |||
| 1032 | Ga0055532_1000104 | |||
| 1033 | Ga0055525_1000167 | |||
| 1034 | Ga0055535_1011188 | |||
| 1035 | Ga0055536_1000043 | |||
| 1036 | Ga0055530_10000031 | |||
| 1037 | Ga0055530_10012647 | |||
| 1038 | Ga0055540_1000230 | |||
| 1039 | Ga0055541_1000081 | |||
| 1040 | Ga0065714_10067038 | |||
| 1041 | Ga0065714_10105108 | |||
| 1042 | Ga0065704_10013836 | |||
| 1043 | Ga0065712_10075189 | |||
| 1044 | Ga0065712_10236500 | |||
| 1045 | Ga0070658_10019937 | |||
| 1046 | Ga0070658_10201648 | |||
| 1047 | Ga0070676_10195870 | |||
| 1048 | Ga0070683_100009609 | |||
| 1049 | Ga0070683_100014648 | |||
| 1050 | Ga0070683_100094011 | |||
| 1051 | Ga0070690_100065637 | |||
| 1052 | Ga0070670_100001105 | |||
| 1053 | Ga0068869_100011134 | |||
| 1054 | Ga0070666_10030938 | |||
| 1055 | Ga0070680_100012295 | |||
| 1056 | Ga0070680_100077510 | |||
| 1057 | Ga0070682_100037829 | |||
| 1058 | Ga0070682_100052820 | |||
| 1059 | Ga0068868_100001991 | |||
| 1060 | Ga0068868_100027562 | |||
| 1061 | Ga0070660_100023571 | |||
| 1062 | Ga0070660_100029658 | |||
| 1063 | Ga0070689_100049302 | |||
| 1064 | Ga0070691_10104061 | |||
| 1065 | Ga0070661_100000238 | |||
| 1066 | Ga0070661_100013386 | |||
| 1067 | Ga0070661_100071326 | |||
| 1068 | Ga0070692_10004915 | |||
| 1069 | Ga0070692_10037485 | |||
| 1070 | Ga0070675_100010129 | |||
| 1071 | Ga0070675_100011148 | |||
| 1072 | Ga0070675_100225662 | |||
| 1073 | Ga0070671_100099650 | |||
| 1074 | Ga0070659_100026111 | |||
| 1075 | Ga0070667_100111973 | |||
| 1076 | Ga0070703_10013256 | |||
| 1077 | Ga0070709_10000165 | |||
| 1078 | Ga0070709_10045199 | |||
| 1079 | Ga0070709_10076782 | |||
| 1080 | Ga0070714_100000318 | |||
| 1081 | Ga0070714_100000491 | |||
| 1082 | Ga0070714_100009563 | |||
| 1083 | Ga0070714_100300400 | |||
| 1084 | Ga0070713_100001888 | |||
| 1085 | Ga0070713_100099934 | |||
| 1086 | Ga0070713_100411201 | |||
| 1087 | Ga0070710_10000171 | |||
| 1088 | Ga0070710_10034420 | |||
| 1089 | Ga0070701_10138883 | |||
| 1090 | Ga0070711_100000158 | |||
| 1091 | Ga0070711_100309139 | |||
| 1092 | Ga0070705_100111868 | |||
| 1093 | Ga0070700_100143178 | |||
| 1094 | Ga0070708_100001234 | |||
| 1095 | Ga0070708_100030905 | |||
| 1096 | Ga0070708_100044212 | |||
| 1097 | Ga0070708_100440245 | |||
| 1098 | Ga0070663_100052924 | |||
| 1099 | Ga0070663_100312069 | |||
| 1100 | Ga0070678_100013597 | |||
| 1101 | Ga0070662_100021530 | |||
| 1102 | Ga0070681_10047709 | |||
| 1103 | Ga0070681_10183344 | |||
| 1104 | Ga0070706_100002363 | |||
| 1105 | Ga0070706_100020520 | |||
| 1106 | Ga0070706_100029550 | |||
| 1107 | Ga0070706_100087323 | |||
| 1108 | Ga0070706_100138562 | |||
| 1109 | Ga0070706_100394203 | |||
| 1110 | Ga0070706_100706871 | |||
| 1111 | Ga0070707_100000043 | |||
| 1112 | Ga0070707_100002621 | |||
| 1113 | Ga0070707_100020775 | |||
| 1114 | Ga0070698_100000072 | |||
| 1115 | Ga0070698_100000309 | |||
| 1116 | Ga0070698_100013936 | |||
| 1117 | Ga0070698_100014678 | |||
| 1118 | Ga0070698_100036356 | |||
| 1119 | Ga0070698_100092722 | |||
| 1120 | Ga0070698_100134816 | |||
| 1121 | Ga0070698_100180439 | |||
| 1122 | Ga0070699_100000327 | |||
| 1123 | Ga0070699_100000511 | |||
| 1124 | Ga0070699_100026940 | |||
| 1125 | Ga0070699_100046052 | |||
| 1126 | Ga0070679_100611638 | |||
| 1127 | Ga0070684_100009019 | |||
| 1128 | Ga0070684_100016988 | |||
| 1129 | Ga0070684_100069498 | |||
| 1130 | Ga0070684_100688748 | |||
| 1131 | Ga0070697_100005337 | |||
| 1132 | Ga0070697_100016026 | |||
| 1133 | Ga0070697_100048744 | |||
| 1134 | Ga0070697_100127541 | |||
| 1135 | Ga0068853_100146938 | |||
| 1136 | Ga0070672_100108524 | |||
| 1137 | Ga0070672_100145396 | |||
| 1138 | Ga0070672_100435153 | |||
| 1139 | Ga0070695_100095391 | |||
| 1140 | Ga0070696_100013244 | |||
| 1141 | Ga0070693_100096109 | |||
| 1142 | Ga0070665_100003764 | |||
| 1143 | Ga0070665_100122001 | |||
| 1144 | Ga0070704_100128359 | |||
| 1145 | Ga0068855_100022092 | |||
| 1146 | Ga0070664_100000233 | |||
| 1147 | Ga0070664_100001873 | |||
| 1148 | Ga0070664_100031400 | |||
| 1149 | Ga0070664_100159109 | |||
| 1150 | Ga0068854_100010679 | |||
| 1151 | Ga0068854_100260934 | |||
| 1152 | Ga0068856_100018845 | |||
| 1153 | Ga0068856_100486766 | |||
| 1154 | Ga0070702_100024285 | |||
| 1155 | Ga0070702_100037783 | |||
| 1156 | Ga0068852_100185902 | |||
| 1157 | Ga0068852_100639550 | |||
| 1158 | Ga0068859_100272285 | |||
| 1159 | Ga0068864_100352665 | |||
| 1160 | Ga0068866_10059537 | |||
| 1161 | Ga0068861_100343950 | |||
| 1162 | Ga0068870_10340566 | |||
| 1163 | Ga0068863_100129348 | |||
| 1164 | Ga0068863_100161810 | |||
| 1165 | Ga0068858_100205390 | |||
| 1166 | Ga0068862_100084635 | |||
| 1167 | Ga0068862_100168792 | |||
| 1168 | Ga0081455_10051524 | |||
| 1169 | Ga0081538_10002736 | |||
| 1170 | Ga0081538_10031123 | |||
| 1171 | Ga0081538_10047439 | |||
| 1172 | Ga0081540_1000058 | |||
| 1173 | Ga0081540_1035917 | |||
| 1174 | Ga0081539_10004989 | |||
| 1175 | Ga0081539_10063447 | |||
| 1176 | Ga0081539_10077649 | |||
| 1177 | Ga0070717_10010134 | |||
| 1178 | Ga0070717_10042228 | |||
| 1179 | Ga0070717_10124015 | |||
| 1180 | Ga0070717_10426270 | |||
| 1181 | Ga0075364_10069297 | |||
| 1182 | Ga0075364_10085457 | |||
| 1183 | Ga0075432_10106405 | |||
| 1184 | Ga0070715_10035075 | |||
| 1185 | Ga0070715_10041047 | |||
| 1186 | Ga0070715_10059314 | |||
| 1187 | Ga0070715_10267315 | |||
| 1188 | Ga0070716_100000117 | |||
| 1189 | Ga0070716_100083695 | |||
| 1190 | Ga0070712_100000698 | |||
| 1191 | Ga0070712_100092217 | |||
| 1192 | Ga0070712_100208782 | |||
| 1193 | Ga0070712_100233212 | |||
| 1194 | Ga0075362_10050309 | |||
| 1195 | Ga0075362_10118949 | |||
| 1196 | Ga0075369_10022141 | |||
| 1197 | Ga0097621_100114765 | |||
| 1198 | Ga0075430_100000242 | |||
| 1199 | Ga0075433_10021690 | |||
| 1200 | Ga0075433_10023853 | |||
| 1201 | Ga0075433_10077482 | |||
| 1202 | Ga0075434_100241998 | |||
| 1203 | Ga0075434_100322222 | |||
| 1204 | Ga0075434_100357969 | |||
| 1205 | Ga0075429_100200583 | |||
| 1206 | Ga0068865_100120726 | |||
| 1207 | Ga0068865_100169640 | |||
| 1208 | Ga0075436_100007086 | |||
| 1209 | Ga0075436_100094554 | |||
| 1210 | Ga0075436_100111279 | |||
| 1211 | Ga0097620_100272279 | |||
| 1212 | Ga0079104_1000090 | |||
| 1213 | Ga0075435_100102834 | |||
| 1214 | Ga0075435_100120359 | |||
| 1215 | Ga0075435_100181404 | |||
| 1216 | Ga0105251_10003475 | |||
| 1217 | Ga0105251_10035329 | |||
| 1218 | Ga0105244_10005915 | |||
| 1219 | Ga0105244_10006512 | |||
| 1220 | Ga0105244_10023824 | |||
| 1221 | Ga0105244_10150148 | |||
| 1222 | Ga0105244_10159899 | |||
| 1223 | Ga0105250_10000118 | |||
| 1224 | Ga0105250_10006019 | |||
| 1225 | Ga0105240_10206032 | |||
| 1226 | Ga0111539_10010281 | |||
| 1227 | Ga0111539_10021897 | |||
| 1228 | Ga0111539_10089795 | |||
| 1229 | Ga0105245_10003051 | |||
| 1230 | Ga0105245_10014691 | |||
| 1231 | Ga0105245_10844323 | |||
| 1232 | Ga0114129_10025453 | |||
| 1233 | Ga0114129_10057100 | |||
| 1234 | Ga0114129_10100917 | |||
| 1235 | Ga0114129_10144111 | |||
| 1236 | Ga0105243_10001057 | |||
| 1237 | Ga0105243_10044066 | |||
| 1238 | Ga0105243_10065747 | |||
| 1239 | Ga0105241_10221796 | |||
| 1240 | Ga0105242_10000719 | |||
| 1241 | Ga0105248_10303828 | |||
| 1242 | Ga0105237_10005805 | |||
| 1243 | Ga0105237_10661472 | |||
| 1244 | Ga0105237_10840213 | |||
| 1245 | Ga0105249_10041983 | |||
| 1246 | Ga0105249_10044788 | |||
| 1247 | Ga0105249_10099711 | |||
| 1248 | Ga0105239_10107507 | |||
| 1249 | Ga0105239_10659537 | |||
| 1250 | Ga0105246_10003807 | |||
| 1251 | Ga0157341_1000951 | |||
| 1252 | Ga0157373_10023566 | |||
| 1253 | Ga0157371_10000281 | |||
| 1254 | Ga0157371_10000795 | |||
| 1255 | Ga0157371_10112028 | |||
| 1256 | Ga0157370_10028864 | |||
| 1257 | Ga0157370_10044828 | |||
| 1258 | Ga0157370_10055729 | |||
| 1259 | Ga0157370_10130059 | |||
| 1260 | Ga0157370_10189187 | |||
| 1261 | Ga0157370_10316657 | |||
| 1262 | Ga0157370_10435631 | |||
| 1263 | Ga0157369_10003643 | |||
| 1264 | Ga0157369_10046415 | |||
| 1265 | Ga0157369_10249186 | |||
| 1266 | Ga0157374_10029085 | |||
| 1267 | Ga0157378_10199580 | |||
| 1268 | Ga0157378_10403033 | |||
| 1269 | Ga0163162_10075157 | |||
| 1270 | Ga0163162_10147706 | |||
| 1271 | Ga0157372_10058127 | |||
| 1272 | Ga0157372_10567437 | |||
| 1273 | Ga0157372_10572220 | |||
| 1274 | Ga0157375_10012550 | |||
| 1275 | Ga0157375_10029601 | |||
| 1276 | Ga0163163_10033119 | |||
| 1277 | Ga0163163_10142794 | |||
| 1278 | Ga0182008_10000138 | |||
| 1279 | Ga0182008_10001875 | |||
| 1280 | Ga0182008_10013562 | |||
| 1281 | Ga0182008_10030510 | |||
| 1282 | Ga0182008_10035864 | |||
| 1283 | Ga0157377_10000891 | |||
| 1284 | Ga0157377_10028128 | |||
| 1285 | Ga0157377_10198172 | |||
| 1286 | Ga0157379_10242291 | |||
| 1287 | Ga0157376_10067112 | |||
| 1288 | Ga0182006_1000816 | |||
| 1289 | Ga0182006_1024437 | |||
| 1290 | Ga0163161_10054201 | |||
| 1291 | Ga0163161_10353522 | |||
| 1292 | Ga0163161_10715418 | |||
| 1293 | Ga0197907_11173906 | |||
| 1294 | Ga0206356_10219634 | |||
| 1295 | Ga0206356_11376920 | |||
| 1296 | Ga0206349_1693199 | |||
| 1297 | Ga0206355_1544356 | |||
| 1298 | Ga0206351_10449033 | |||
| 1299 | Ga0206351_10726113 | |||
| 1300 | Ga0206352_10696447 | |||
| 1301 | Ga0206350_10260968 | |||
| 1302 | Ga0206350_10760667 | |||
| 1303 | Ga0206354_11479794 | |||
| 1304 | Ga0206353_11923273 | |||
| 1305 | Ga0213874_10100649 | |||
| 1306 | Ga0213875_10000817 | |||
| 1307 | Ga0213875_10002595 | |||
| 1308 | Ga0213875_10027419 | |||
| 1309 | Ga0213875_10052067 | |||
| 1310 | Ga0224712_10019502 | |||
| 1311 | Ga0224712_10022965 | |||
| 1312 | Ga0228600_1004353 | |||
| 1313 | Ga0224572_1017256 | |||
| 1314 | Ga0228598_1014646 | |||
| 1315 | Ga0209435_100841 | |||
| 1316 | Ga0209760_100015 | |||
| 1317 | Ga0209760_100047 | |||
| 1318 | Ga0209784_100015 | |||
| 1319 | Ga0209566_100012 | |||
| 1320 | Ga0209674_100027 | |||
| 1321 | Ga0209147_100019 | |||
| 1322 | Ga0209563_100031 | |||
| 1323 | Ga0207427_100001 | |||
| 1324 | Ga0207427_100029 | |||
| 1325 | Ga0209437_100003 | |||
| 1326 | Ga0209437_100009 | |||
| 1327 | Ga0209437_108916 | |||
| 1328 | Ga0209258_100250 | |||
| 1329 | Ga0209646_1000263 | |||
| 1330 | Ga0209677_100016 | |||
| 1331 | Ga0209233_1000007 | |||
| 1332 | Ga0209233_1000032 | |||
| 1333 | Ga0209676_1000080 | |||
| 1334 | Ga0209676_1002060 | |||
| 1335 | Ga0209050_1000117 | |||
| 1336 | Ga0209050_1001134 | |||
| 1337 | Ga0209051_1000077 | |||
| 1338 | Ga0209051_1044678 | |||
| 1339 | Ga0207696_1000083 | |||
| 1340 | Ga0207696_1000111 | |||
| 1341 | Ga0207655_1000435 | |||
| 1342 | Ga0207655_1002832 | |||
| 1343 | Ga0207655_1009325 | |||
| 1344 | Ga0207713_1000564 | |||
| 1345 | Ga0207713_1003370 | |||
| 1346 | Ga0207713_1009675 | |||
| 1347 | Ga0207713_1018905 | |||
| 1348 | Ga0207692_10000417 | |||
| 1349 | Ga0207692_10103992 | |||
| 1350 | Ga0207688_10011847 | |||
| 1351 | Ga0207647_10034782 | |||
| 1352 | Ga0207685_10028209 | |||
| 1353 | Ga0207699_10000393 | |||
| 1354 | Ga0207699_10112412 | |||
| 1355 | Ga0207699_10126686 | |||
| 1356 | Ga0207699_10226281 | |||
| 1357 | Ga0207699_10301820 | |||
| 1358 | Ga0207699_10332698 | |||
| 1359 | Ga0207699_10514777 | |||
| 1360 | Ga0207645_10140641 | |||
| 1361 | Ga0207643_10052734 | |||
| 1362 | Ga0207705_10370421 | |||
| 1363 | Ga0207684_10025263 | |||
| 1364 | Ga0207684_10060661 | |||
| 1365 | Ga0207684_10122794 | |||
| 1366 | Ga0207684_10295409 | |||
| 1367 | Ga0207684_10310995 | |||
| 1368 | Ga0207684_10449500 | |||
| 1369 | Ga0207707_10125403 | |||
| 1370 | Ga0207695_10155316 | |||
| 1371 | Ga0207671_10000436 | |||
| 1372 | Ga0207693_10000436 | |||
| 1373 | Ga0207693_10069329 | |||
| 1374 | Ga0207693_10100193 | |||
| 1375 | Ga0207693_10195353 | |||
| 1376 | Ga0207693_10212783 | |||
| 1377 | Ga0207693_10320537 | |||
| 1378 | Ga0207663_10000849 | |||
| 1379 | Ga0207663_10017821 | |||
| 1380 | Ga0207660_10026126 | |||
| 1381 | Ga0207662_10009010 | |||
| 1382 | Ga0207657_10046321 | |||
| 1383 | Ga0207657_10063273 | |||
| 1384 | Ga0207657_10265307 | |||
| 1385 | Ga0207649_10000002 | |||
| 1386 | Ga0207649_10046235 | |||
| 1387 | Ga0207652_10043512 | |||
| 1388 | Ga0207652_10191547 | |||
| 1389 | Ga0207646_10000300 | |||
| 1390 | Ga0207646_10000647 | |||
| 1391 | Ga0207646_10182531 | |||
| 1392 | Ga0207650_10000688 | |||
| 1393 | Ga0207650_10427121 | |||
| 1394 | Ga0207659_10006861 | |||
| 1395 | Ga0207659_10128556 | |||
| 1396 | Ga0207687_10019067 | |||
| 1397 | Ga0207700_10000029 | |||
| 1398 | Ga0207700_10018831 | |||
| 1399 | Ga0207700_10062583 | |||
| 1400 | Ga0207700_10145287 | |||
| 1401 | Ga0207700_10442423 | |||
| 1402 | Ga0207664_10000110 | |||
| 1403 | Ga0207664_10000648 | |||
| 1404 | Ga0207664_10021467 | |||
| 1405 | Ga0207664_10049721 | |||
| 1406 | Ga0207664_10063647 | |||
| 1407 | Ga0207664_10077660 | |||
| 1408 | Ga0207664_10245979 | |||
| 1409 | Ga0207664_10882095 | |||
| 1410 | Ga0207690_10017709 | |||
| 1411 | Ga0207706_10031850 | |||
| 1412 | Ga0207706_10110318 | |||
| 1413 | Ga0207706_10153622 | |||
| 1414 | Ga0207686_10005841 | |||
| 1415 | Ga0207686_10426664 | |||
| 1416 | Ga0207709_10000278 | |||
| 1417 | Ga0207709_10115951 | |||
| 1418 | Ga0207670_10055126 | |||
| 1419 | Ga0207670_10117159 | |||
| 1420 | Ga0207704_10017174 | |||
| 1421 | Ga0207665_10000373 | |||
| 1422 | Ga0207665_10181310 | |||
| 1423 | Ga0207691_10015140 | |||
| 1424 | Ga0207691_10083715 | |||
| 1425 | Ga0207691_10342843 | |||
| 1426 | Ga0207711_10073195 | |||
| 1427 | Ga0207689_10005561 | |||
| 1428 | Ga0207689_10013438 | |||
| 1429 | Ga0207661_10052643 | |||
| 1430 | Ga0207661_10132814 | |||
| 1431 | Ga0207661_10138350 | |||
| 1432 | Ga0207661_10180206 | |||
| 1433 | Ga0207661_10413065 | |||
| 1434 | Ga0207679_10000006 | |||
| 1435 | Ga0207679_10002012 | |||
| 1436 | Ga0207679_10029241 | |||
| 1437 | Ga0207667_10211282 | |||
| 1438 | Ga0207667_10261825 | |||
| 1439 | Ga0207651_10131438 | |||
| 1440 | Ga0207712_10049637 | |||
| 1441 | Ga0207712_10157878 | |||
| 1442 | Ga0207668_10120500 | |||
| 1443 | Ga0207677_10004672 | |||
| 1444 | Ga0207677_10040589 | |||
| 1445 | Ga0207703_10170951 | |||
| 1446 | Ga0207703_10416909 | |||
| 1447 | Ga0207639_10261275 | |||
| 1448 | Ga0207678_10016455 | |||
| 1449 | Ga0207678_10032732 | |||
| 1450 | Ga0207678_10075576 | |||
| 1451 | Ga0207678_10082743 | |||
| 1452 | Ga0207678_10108638 | |||
| 1453 | Ga0207708_10000996 | |||
| 1454 | Ga0207708_10007569 | |||
| 1455 | Ga0207708_10182793 | |||
| 1456 | Ga0207702_10013428 | |||
| 1457 | Ga0207702_10458040 | |||
| 1458 | Ga0207702_10490259 | |||
| 1459 | Ga0207702_10873376 | |||
| 1460 | Ga0207641_10334723 | |||
| 1461 | Ga0207676_10515891 | |||
| 1462 | Ga0207674_10006879 | |||
| 1463 | Ga0207674_10016534 | |||
| 1464 | Ga0207674_10090524 | |||
| 1465 | Ga0207675_100007636 | |||
| 1466 | Ga0207675_100093909 | |||
| 1467 | Ga0207675_100569009 | |||
| 1468 | Ga0207683_10056035 | |||
| 1469 | Ga0207698_10134046 | |||
| 1470 | Ga0207698_10352174 | |||
| 1471 | Ga0209281_1000013 | |||
| 1472 | Ga0207428_10000812 | |||
| 1473 | Ga0207428_10004869 | |||
| 1474 | Ga0207428_10039803 | |||
| 1475 | Ga0207428_10068592 | |||
| 1476 | Ga0207428_10346945 | |||
| 1477 | Ga0268266_10007082 | |||
| 1478 | Ga0268266_10075054 | |||
| 1479 | Ga0265338_10006561 | |||
| 1480 | Ga0265338_10007488 | |||
| 1481 | Ga0307408_100142179 | |||
| 1482 | Ga0307405_10003598 | |||
| 1483 | Ga0307405_10157063 | |||
| 1484 | Ga0307405_10543652 | |||
| 1485 | Ga0307413_10108739 | |||
| 1486 | Ga0307410_10022469 | |||
| 1487 | Ga0307410_10172960 | |||
| 1488 | Ga0307406_10084601 | |||
| 1489 | Ga0307406_10178130 | |||
| 1490 | Ga0307407_10030629 | |||
| 1491 | Ga0307407_10206786 | |||
| 1492 | Ga0307412_10049010 | |||
| 1493 | Ga0307412_10236064 | |||
| 1494 | Ga0307412_10704490 | |||
| 1495 | Ga0307409_100015263 | |||
| 1496 | Ga0307409_100021793 | |||
| 1497 | Ga0307409_100071849 | |||
| 1498 | Ga0307409_100120183 | |||
| 1499 | Ga0307416_100091653 | |||
| 1500 | Ga0307416_100102301 | |||
| 1501 | Ga0307416_100176671 | |||
| 1502 | Ga0307416_100238620 | |||
| 1503 | Ga0307414_10180218 | |||
| 1504 | Ga0307411_10024540 | |||
| 1505 | Ga0307415_100006263 | |||
| 1506 | Ga0307415_100030121 | |||
| 1507 | Ga0307415_100048505 | |||
| 1508 | Ga0307415_100075844 | |||
| 1509 | Ga0307415_100090373 | |||
| 1510 | Ga0307415_100490796 | |||
| 1511 | Ga0316214_1001620 | |||
| 1512 | Ga0373938_0013766 | |||
| 1513 | Ga0373926_0003618 | |||
| 1514 | Ga0373926_0003710 | |||
| 1515 | Ga0373934_0000109 | |||
| 1516 | Ga0373934_0022882 | |||
| 1517 | Ga0373944_0001446 | |||
| 1518 | Ga0373944_0004430 | |||
| 1519 | Ga0373923_0011379 | |||
| 1520 | Ga0373936_0001004 | |||
| 1521 | Ga0373936_0004893 | |||
| 1522 | Ga0373939_0003160 | |||
| 1523 | Ga0373945_0000108 | |||
| 1524 | Ga0373945_0003095 | |||
| 1525 | Ga0373953_0000026 | |||
| 1526 | Ga0373954_0010979 | |||
| 1527 | Ga0373954_0024558 | |||
| 1528 | Ga0373956_0136421 | |||
| 1529 | Ga0373957_0000038 | |||
| 1530 | Ga0373957_0003809 | |||
| 1531 | Ga0373957_0021745 | |||
| 1532 | Ga0373943_0003488 | |||
| 1533 | Ga0373943_0024808 | |||
| 1534 | Ga0373946_0000230 | |||
| 1535 | Ga0373946_0003046 | |||
| 1536 | Ga0373946_0146904 | |||
| 1537 | Ga0373955_0000231 | |||
| 1538 | Ga0373955_0006961 | |||
| 1539 | Ga0373942_0013079 | |||
| 1540 | Ga0373961_0008464 | |||
| 1541 | Ga0373924_0000552 | |||
| 1542 | Ga0373924_0002765 | |||
| 1543 | Ga0373924_0039585 | |||
| 1544 | Ga0373931_0028944 | |||
| 1545 | Ga0373931_0242866 | |||
| 1546 | Ga0373935_0001927 | |||
| 1547 | Ga0373935_0023072 | |||
| 1548 | Ga0373927_0004889 | |||
| 1549 | Ga0373927_0007315 | |||
| 1550 | Ga0373927_0065039 | |||
| 1551 | Ga0373933_0000839 | |||
| 1552 | Ga0373933_0055048 | |||
| 1553 | Ga0373933_0240244 | |||
| 1554 | Ga0373933_0286178 | |||
| 1555 | Ga0373947_0018091 | |||
| 1556 | Ga0373947_0113656 | |||
| 1557 | Ga0373937_0000138 | |||
| 1558 | Ga0373937_0088273 | |||
| 1559 | Ga0373937_0094483 | |||
| 1560 | Ga0373937_0099086 | |||
| 1561 | Ga0373937_0117684 | |||
| 1562 | Ga0372808_006474 | |||
| 1563 | Ga0373925_0000699 | |||
| 1564 | Ga0373925_0008741 | |||
| 1565 | Ga0373925_0045005 | |||
| 1566 | Ga0373925_0186342 | |||
| 1567 | Ga0395900_0135703 | |||
| 1568 | Ga0395898_0115475 | |||
| 1569 | Ga0436364_0151261 | |||
| 1570 | Ga0436364_0207639 | |||
| 1571 | Ga0436364_0232843 | |||
| 1572 | Ga0436364_0754028 | |||
| 1573 | Ga0436364_0795184 | |||
| 1574 | Ga0436364_1116138 | |||
| 1575 | Ga0436364_1223164 | |||
| 1576 | Ga0395901_0048266 | |||
| 1577 | Ga0436365_0054221 | |||
| 1578 | Ga0436361_0657470 | |||
| 1579 | Ga0439447_007210 | |||
| 1580 | Ga0439466_0001571 | |||
| 1581 | Ga0439466_0001845 | |||
| 1582 | Ga0439466_0025576 | |||
| 1583 | Ga0451853_2100055 | |||
| 1584 | Ga0439448_0095320 | |||
| 1585 | Ga0439448_0103761 | |||
| 1586 | Ga0439432_000245 | |||
| 1587 | Ga0439452_002580 | |||
| 1588 | Ga0439452_009166 | |||
| 1589 | Ga0439463_001106 | |||
| 1590 | Ga0439463_028790 | |||
| 1591 | Ga0450922_003435 | |||
| 1592 | Ga0450905_036016 | |||
| 1593 | Ga0450907_005187 | |||
| 1594 | Ga0450910_000560 | |||
| 1595 | Ga0439444_0070726 | |||
| 1596 | Ga0439464_0055042 | |||
| 1597 | Ga0439460_0033491 | |||
| 1598 | Ga0439440_0040338 | |||
| 1599 | Ga0466963_0017103 | |||
| 1600 | Ga0466964_0211351 | |||
| 1601 | Ga0466957_0189130 | |||
| 1602 | Ga0466959_0027665 | |||
| 1603 | Ga0466958_0074021 | |||
| 1604 | Ga0466958_0105241 | |||
| 1605 | Ga0466967_0039747 | |||
| 1606 | Ga0466967_0194952 | |||
| 1607 | Ga0495617_001821 | |||
| 1608 | Ga0495617_021565 | |||
| 1609 | Ga0495627_001278 | |||
| 1610 | Ga0495592_0000041 | |||
| 1611 | Ga0495592_0078539 | |||
| 1612 | Ga0495592_0084568 | |||
| 1613 | Ga0495603_0023997 | |||
| 1614 | Ga0495603_0064612 | |||
| 1615 | Ga0495590_0002024 | |||
| 1616 | Ga0495590_0009714 | |||
| 1617 | Ga0495591_001556 | |||
| 1618 | Ga0495591_017215 | |||
| 1619 | Ga0495629_0012281 | |||
| 1620 | Ga0495638_0006808 | |||
| 1621 | Ga0495638_0007153 | |||
| 1622 | Ga0495638_0028702 | |||
| 1623 | Ga0495641_0008055 | |||
| 1624 | Ga0495651_0000018 | |||
| 1625 | Ga0495651_0006316 | |||
| 1626 | Ga0495651_0029577 | |||
| 1627 | Ga0495651_0076090 | |||
| 1628 | Ga0495653_0003023 | |||
| 1629 | Ga0495653_0010353 | |||
| 1630 | Ga0495653_0020353 | |||
| 1631 | Ga0495653_0032425 | |||
| 1632 | Ga0495653_0125368 | |||
| 1633 | Ga0495653_0385863 | |||
| 1634 | Ga0495650_0003766 | |||
| 1635 | Ga0495650_0004163 | |||
| 1636 | Ga0495650_0016994 | |||
| 1637 | Ga0495580_0021796 | |||
| 1638 | Ga0495582_0006199 | |||
| 1639 | Ga0495582_0136741 | |||
| 1640 | Ga0495605_0003165 | |||
| 1641 | Ga0495605_0010478 | |||
| 1642 | Ga0495639_0000474 | |||
| 1643 | Ga0495639_0032642 | |||
| 1644 | Ga0495662_0000516 | |||
| 1645 | Ga0495662_0004052 | |||
| 1646 | Ga0495664_0001298 | |||
| 1647 | Ga0495664_0007339 | |||
| 1648 | Ga0495584_0005764 | |||
| 1649 | Ga0495584_0012853 | |||
| 1650 | Ga0495584_0028491 | |||
| 1651 | Ga0495584_0047417 | |||
| 1652 | Ga0495585_0006356 | |||
| 1653 | Ga0495585_0017597 | |||
| 1654 | Ga0495585_0054742 | |||
| 1655 | Ga0495594_0005447 | |||
| 1656 | Ga0495596_0001019 | |||
| 1657 | Ga0495607_0005334 | |||
| 1658 | Ga0495607_0012168 | |||
| 1659 | Ga0495607_0033438 | |||
| 1660 | Ga0495606_0009252 | |||
| 1661 | Ga0495606_0012613 | |||
| 1662 | Ga0495606_0052496 | |||
| 1663 | Ga0495606_0192222 | |||
| 1664 | Ga0495608_0000039 | |||
| 1665 | Ga0495608_0014158 | |||
| 1666 | Ga0495608_0087404 | |||
| 1667 | Ga0495610_0004508 | |||
| 1668 | Ga0495610_0018167 | |||
| 1669 | Ga0495610_0036524 | |||
| 1670 | Ga0495616_0003008 | |||
| 1671 | Ga0495616_0020999 | |||
| 1672 | Ga0495616_0029325 | |||
| 1673 | Ga0495618_0006968 | |||
| 1674 | Ga0495618_0011419 | |||
| 1675 | Ga0495618_0027293 | |||
| 1676 | Ga0495618_0115763 | |||
| 1677 | Ga0495620_0027062 | |||
| 1678 | Ga0495620_0077855 | |||
| 1679 | Ga0495628_0000219 | |||
| 1680 | Ga0495628_0060553 | |||
| 1681 | Ga0495628_0066063 | |||
| 1682 | Ga0495630_0010651 | |||
| 1683 | Ga0495630_0020684 | |||
| 1684 | Ga0495630_0124467 | |||
| 1685 | Ga0495631_0001618 | |||
| 1686 | Ga0495632_0005336 | |||
| 1687 | Ga0495632_0067573 | |||
| 1688 | Ga0495637_0002281 | |||
| 1689 | Ga0495637_0012132 | |||
| 1690 | Ga0495637_0021286 | |||
| 1691 | Ga0495637_0042922 | |||
| 1692 | Ga0495643_0008330 | |||
| 1693 | Ga0495643_0010743 | |||
| 1694 | Ga0495644_0001628 | |||
| 1695 | Ga0495644_0002235 | |||
| 1696 | Ga0495644_0046263 | |||
| 1697 | Ga0495648_0007519 | |||
| 1698 | Ga0495648_0033872 | |||
| 1699 | Ga0495648_0065028 | |||
| 1700 | Ga0495666_0006631 | |||
| 1701 | Ga0495666_0022579 | |||
| 1702 | Ga0495666_0026794 | |||
| 1703 | Ga0495642_0000428 | |||
| 1704 | Ga0495652_0000092 | |||
| 1705 | Ga0495652_0037800 | |||
| 1706 | Ga0495652_0045158 | |||
| 1707 | Ga0495652_0068985 | |||
| 1708 | Ga0495652_0188511 | |||
| 1709 | Ga0495654_0007588 | |||
| 1710 | Ga0495654_0043981 | |||
| 1711 | Ga0495654_0046945 | |||
| 1712 | Ga0495665_0000931 | |||
| 1713 | Ga0495640_0003021 | |||
| 1714 | Ga0495640_0053602 | |||
| 1715 | Ga0495640_0088024 | |||
| 1716 | Ga0495586_0020777 | |||
| 1717 | Ga0495586_0091452 | |||
| 1718 | Ga0495586_0133961 | |||
| 1719 | Ga0495586_0356496 | |||
| 1720 | Ga0495587_0000034 | |||
| 1721 | Ga0495587_0004722 | |||
| 1722 | Ga0495587_0013395 | |||
| 1723 | Ga0495587_0018099 | |||
| 1724 | Ga0495587_0123893 | |||
| 1725 | Ga0495597_0028272 | |||
| 1726 | Ga0495597_0034605 | |||
| 1727 | Ga0495597_0210960 | |||
| 1728 | Ga0495645_0027269 | |||
| 1729 | Ga0495645_0076341 | |||
| 1730 | Ga0495645_0160390 | |||
| 1731 | Ga0495622_0045856 | |||
| 1732 | Ga0495622_0058486 | |||
| 1733 | Ga0495633_0021998 | |||
| 1734 | Ga0495667_0000150 | |||
| 1735 | Ga0495667_0006215 | |||
| 1736 | Ga0495667_0040918 | |||
| 1737 | Ga0495667_0053657 | |||
| 1738 | Ga0495667_0113671 | |||
| 1739 | Ga0495668_0002481 | |||
| 1740 | Ga0495668_0011313 | |||
| 1741 | Ga0495634_0007167 | |||
| 1742 | Ga0495634_0019820 | |||
| 1743 | Ga0495635_0000138 | |||
| 1744 | Ga0495635_0058140 | |||
| 1745 | Ga0495635_0417361 | |||
| 1746 | Ga0495661_0002061 | |||
| 1747 | Ga0495661_0024627 | |||
| 1748 | Ga0495661_0033827 | |||
| 1749 | Ga0495661_0253666 | |||
| 1750 | Ga0495588_0050781 | |||
| 1751 | Ga0495657_0000247 | |||
| 1752 | Ga0495657_0024301 | |||
| 1753 | Ga0495657_0025714 | |||
| 1754 | Ga0495657_0071500 | |||
| 1755 | Ga0495599_0000108 | |||
| 1756 | Ga0495599_0024326 | |||
| 1757 | Ga0495599_0036727 | |||
| 1758 | Ga0495623_0000287 | |||
| 1759 | Ga0495623_0037083 | |||
| 1760 | Ga0495623_0107845 | |||
| 1761 | Ga0495646_0010019 | |||
| 1762 | Ga0495646_0015574 | |||
| 1763 | Ga0495646_0029848 | |||
| 1764 | Ga0495646_0032537 | |||
| 1765 | Ga0495646_0032903 | |||
| 1766 | Ga0495658_0006740 | |||
| 1767 | Ga0495613_0029608 | |||
| 1768 | Ga0495613_0062281 | |||
| 1769 | Ga0495624_0011849 | |||
| 1770 | Ga0495624_0021948 | |||
| 1771 | Ga0495671_0005316 | |||
| 1772 | Ga0495671_0014377 | |||
| 1773 | Ga0495671_0024497 | |||
| 1774 | Ga0495671_0030848 | |||
| 1775 | Ga0495671_0035610 | |||
| 1776 | Ga0495649_0005895 | |||
| 1777 | Ga0495649_0040098 | |||
| 1778 | Ga0495649_0278842 | |||
| 1779 | Ga0495589_0056156 | |||
| 1780 | Ga0495600_0008104 | |||
| 1781 | Ga0495600_0018909 | |||
| 1782 | Ga0495600_0025206 | |||
| 1783 | Ga0495600_0043831 | |||
| 1784 | Ga0495600_0078534 | |||
| 1785 | Ga0495660_0034921 | |||
| 1786 | Ga0495660_0035259 | |||
| 1787 | Ga0495660_0041381 | |||
| 1788 | Ga0495581_0000404 | |||
| 1789 | Ga0495604_0000039 | |||
| 1790 | Ga0495604_0014132 | |||
| 1791 | Ga0495604_0042395 | |||
| 1792 | Ga0495604_0054659 | |||
| 1793 | Ga0495674_0000235 | |||
| 1794 | Ga0495674_0032287 | |||
| 1795 | Ga0495674_0069294 | |||
| 1796 | Ga0495674_0119497 | |||
| 1797 | Ga0495674_0220167 | |||
| 1798 | Ga0495672_0006489 | |||
| 1799 | Ga0495672_0011761 | |||
| 1800 | Ga0495672_0021657 | |||
| 1801 | Ga0495672_0025137 | |||
| 1802 | Ga0495672_0035999 | |||
| 1803 | Ga0495676_0009006 | |||
| 1804 | Ga0495680_0000028 | |||
| 1805 | Ga0495680_0022902 | |||
| 1806 | Ga0495680_0067062 | |||
| 1807 | Ga0495680_0067307 | |||
| 1808 | Ga0495680_0089168 | |||
| 1809 | Ga0495680_0093239 | |||
| 1810 | Ga0495680_0131031 | |||
| 1811 | Ga0495683_0001139 | |||
| 1812 | Ga0495683_0003272 | |||
| 1813 | Ga0495687_011902 | |||
| 1814 | Ga0495675_0000355 | |||
| 1815 | Ga0495675_0025159 | |||
| 1816 | Ga0495675_0062657 | |||
| 1817 | Ga0495673_0002014 | |||
| 1818 | Ga0495673_0006091 | |||
| 1819 | Ga0495673_0033665 | |||
| 1820 | Ga0495681_0001437 | |||
| 1821 | Ga0495681_0004955 | |||
| 1822 | Ga0495681_0008404 | |||
| 1823 | Ga0495681_0041839 | |||
| 1824 | Ga0495684_0000154 | |||
| 1825 | Ga0495684_0031991 | |||
| 1826 | Ga0495686_0011501 | |||
| 1827 | Ga0495686_0063105 | |||
| 1828 | Ga0495593_0007879 | |||
| 1829 | Ga0495593_0047235 | |||
| 1830 | Ga0495593_0053990 | |||
| 1831 | Ga0495602_0000043 | |||
| 1832 | Ga0495602_0047998 | |||
| 1833 | Ga0495602_0095634 | |||
| 1834 | Ga0495614_0040246 | |||
| 1835 | Ga0495626_0001346 | |||
| 1836 | Ga0495626_0002001 | |||
| 1837 | Ga0495626_0004960 | |||
| 1838 | Ga0495626_0020224 | |||
| 1839 | Ga0496100_0075070 | |||
| 1840 | Ga0496100_0195252 | |||
| 1841 | Ga0496100_0250681 | |||
| 1842 | Ga0496101_0026411 | |||
| 1843 | Ga0496101_0093592 | |||
| 1844 | Ga0496102_0007449 | |||
| 1845 | Ga0496103_0079345 | |||
| 1846 | Ga0496104_0005365 | |||
| 1847 | Ga0496104_0131346 | |||
| 1848 | Ga0496105_0076305 | |||
| 1849 | Ga0496105_0172308 | |||
| 1850 | Ga0496105_0190167 | |||
| 1851 | Ga0496106_0015803 | |||
| 1852 | Ga0496107_0236872 | |||
| 1853 | Ga0496107_0323519 | |||
| 1854 | Ga0496108_0009911 | |||
| 1855 | Ga0496108_0191706 | |||
| 1856 | Ga0496108_0368036 | |||
| 1857 | Ga0496109_0117152 | |||
| 1858 | Ga0496109_0258255 | |||
| 1859 | Ga0496110_0057350 | |||
| 1860 | Ga0496110_0342610 | |||
| 1861 | Ga0496111_0042240 | |||
| 1862 | Ga0496111_0129812 | |||
| 1863 | Ga0496112_0119785 | |||
| 1864 | Ga0496112_0121149 | |||
| 1865 | Ga0496112_0431751 | |||
| 1866 | Ga0496112_0498617 | |||
| 1867 | Ga0496113_0121646 | |||
| 1868 | Ga0496113_0123556 | |||
| 1869 | Ga0496113_0223781 | |||
| 1870 | Ga0496114_0054914 | |||
| 1871 | Ga0496115_0036854 | |||
| 1872 | Ga0496115_0061608 | |||
| 1873 | Ga0496116_0000126 | |||
| 1874 | Ga0496117_0000950 | |||
| 1875 | Ga0496117_0028769 | |||
| 1876 | Ga0496118_0055353 | |||
| 1877 | Ga0496119_0035855 | |||
| 1878 | Ga0496119_0115723 | |||
| 1879 | Ga0496119_0197243 | |||
| 1880 | Ga0496121_0000142 | |||
| 1881 | Ga0496122_0060191 | |||
| 1882 | Ga0496123_0011472 | |||
| 1883 | Ga0496123_0092143 | |||
| 1884 | Ga0496124_0115771 | |||
| 1885 | Ga0496126_0004789 | |||
| 1886 | Ga0496126_0013912 | |||
| 1887 | Ga0496126_0167728 | |||
| 1888 | Ga0496126_0287593 | |||
| 1889 | Ga0495678_011256 | |||
| 1890 | Ga0495678_013240 | |||
| 1891 | Ga0501031_0051723 | |||
| 1892 | Ga0501031_0183172 | |||
| 1893 | Ga0501037_0072516 | |||
| 1894 | Ga0501038_0194556 | |||
| 1895 | Ga0501039_0006861 | |||
| 1896 | Ga0501040_0000259 | |||
| 1897 | Ga0501040_0256415 | |||
| 1898 | Ga0501041_0000491 | |||
| 1899 | Ga0501042_0001520 | |||
| 1900 | Ga0501042_0070913 | |||
| 1901 | Ga0501043_0015672 | |||
| 1902 | Ga0501046_0000713 | |||
| 1903 | Ga0501047_0322907 | |||
| 1904 | Ga0501048_0002303 | |||
| 1905 | Ga0501068_0071819 | |||
| 1906 | Ga0501069_0044365 | |||
| 1907 | Ga0501070_0417698 | |||
| 1908 | Ga0501071_0017040 | |||
| 1909 | Ga0501072_0012113 | |||
| 1910 | Ga0501073_0221522 | |||
| 1911 | Ga0501075_0000854 | |||
| 1912 | Ga0501075_0255294 | |||
| 1913 | Ga0501076_0001606 | |||
| 1914 | Ga0501077_0036972 | |||
| 1915 | Ga0501079_0000169 | |||
| 1916 | Ga0501079_0485785 | |||
| 1917 | Ga0501080_0046817 | |||
| 1918 | Ga0501081_0000098 | |||
| 1919 | Ga0501081_0187380 | |||
| 1920 | Ga0501035_0135651 | |||
| 1921 | Ga0501044_0034624 | |||
| 1922 | Ga0501045_0000786 | |||
| 1923 | nmdc:mga03683_126482_c1 | |||
| 1924 | nmdc:mga05p37_18612_c1 | |||
| 1925 | nmdc:mga05p37_38629_c1 | |||
| 1926 | nmdc:mga05p37_70517_c1 | |||
| 1927 | nmdc:mga05p37_7776_c1 | |||
| 1928 | nmdc:mga0qj67_38929_c1 | |||
| 1929 | nmdc:mga06r32_132293_c1 | |||
| 1930 | nmdc:mga08y16_17674_c1 | |||
| 1931 | nmdc:mga08y16_247542_c1 | |||
| 1932 | nmdc:mga08y16_293788_c1 | |||
| 1933 | nmdc:mga08y16_77951_c1 | |||
| 1934 | nmdc:mga08y16_89210_c1 | |||
| 1935 | nmdc:mga0n895_26402_c1 | |||
| 1936 | nmdc:mga0n895_6961_c1 | |||
| 1937 | nmdc:mga0rr50_147025_c1 | |||
| 1938 | nmdc:mga0rr50_62244_c1 | |||
| 1939 | nmdc:mga0rr50_78829_c1 | |||
| 1940 | nmdc:mga08x19_11539_c1 | |||
| 1941 | nmdc:mga08x19_2303_c1 | |||
| 1942 | nmdc:mga0a205_2379_c1 | |||
| 1943 | nmdc:mga0a205_30481_c1 | |||
| 1944 | Ga0495601_0022434 | |||
| 1945 | Ga0495601_0169459 | |||
| 1946 | Ga0495601_0375338 | |||
| 1947 | Ga0495612_0020306 | |||
| 1948 | Ga0495595_0018766 | |||
| 1949 | Ga0495595_0030064 | |||
| 1950 | Ga0495619_0056692 | |||
| 1951 | Ga0495619_0063108 | |||
| 1952 | Ga0500559_0007699 | |||
| 1953 | Ga0501084_0006102 | |||
| 1954 | Ga0590071_021000 | |||
| 1955 | Ga0590074_005145 | |||
| 1956 | Ga0590075_003397 | |||
| 1957 | Ga0590077_004808 | |||
| 1958 | Ga0501082_0001871 | |||
| 1959 | Ga0530510_0141306 | |||
| 1960 | 2511265945 | |||
| 1961 | 2511279114 | |||
| 1962 | 2511294909 | |||
| 1963 | 2511302970 | |||
| 1964 | 2511313718 | |||
| 1965 | 2511320391 | |||
| 1966 | 2511324095 | |||
| 1967 | 2511330550 | |||
| 1968 | 2511336621 | |||
| 1969 | 2511344045 | |||
| 1970 | 2511353297 | |||
| 1971 | 2511355184 | |||
| 1972 | 2511823330 | |||
| 1973 | 2512326395 | |||
| 1974 | 2555668298 | |||
| 1975 | 2583790721 | |||
| 1976 | 2597856513 | |||
| 1977 | 2597862623 | |||
| 1978 | 2599355299 | |||
| 1979 | 2599360878 | |||
| 1980 | 2599367200 | |||
| 1981 | 2599373990 | |||
| 1982 | 2599380405 | |||
| 1983 | 2599386852 | |||
| 1984 | 2599392848 | |||
| 1985 | 2599404615 | |||
| 1986 | 2599462133 | |||
| 1987 | 2599466824 | |||
| 1988 | 2599483234 | |||
| 1989 | 2599490775 | |||
| 1990 | 2599805133 | |||
| 1991 | 2600214755 | |||
| 1992 | 2600363843 | |||
| 1993 | 2601774540 | |||
| 1994 | 2643845291 | |||
| 1995 | 2643952056 | |||
| 1996 | 2644024185 | |||
| 1997 | 2671097901 | |||
| 1998 | 2671768133 | |||
| 1999 | 2723247506 | |||
| 2000 | 2739198627 | |||
| 2001 | 2739256612 | |||
| 2002 | 2743735929 | |||
| 2003 | 2774136108 | |||
| 2004 | 2784260181 | |||
| 2005 | 2819702985 | |||
| 2006 | 2834029307 | |||
| 2007 | 2837186548 | |||
| 2008 | 2844668820 | |||
| 2009 | 2852658594 | |||
| 2010 | 2860340391 | |||
| 2011 | 2880231973 | |||
| 2012 | 2904521013 | |||
| 2013 | 2904551645 | |||
| 2014 | 2917072065 | |||
| 2015 | 2919458049 | |||
| 2016 | 2923154939 | |||
| 2017 | 2931399704 | |||
| 2018 | 2935354237 | |||
| 2019 | 2939637819 | |||
| 2020 | 2945929256 | |||
| 2021 | 2945961578 | |||
| 2022 | 2947236140 | |||
| 2023 | 2984291092 | |||
| 2024 | 3007512678 | |||
| 2025 | 3007855917 | |||
| 2026 | 3007863458 | |||
| 2027 | 637318660 | |||
| 2028 | 8015689171 | |||
| 2029 | 8055772291 | |||
| 2030 | 8056127348 | |||
| 2031 | 8056149500 | |||
| 2032 | 8056164665 | |||
| 2033 | 8056180314 | |||
| 2034 | 8056569969 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1eo9-assembly1.cif.gz_A | crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 | 0.829 | 48 | 230 |
| 2bux-assembly1.cif.gz_A | crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h | 0.8252 | 47 | 230 |
| 2bum-assembly1.cif.gz_A | crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 | 0.8209 | 47 | 230 |
| 4ilt-assembly2.cif.gz_B | structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e | 0.8155 | 47 | 225 |
| 3lkt-assembly1.cif.gz_A | tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis | 0.7977 | 48 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4iltA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8015 | 47 | 225 | 2.60.130.10 |
| 1ykkA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7993 | 48 | 223 | 2.60.130.10 |
| 1eo2B00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7678 | 23 | 234 | 2.60.130.10 |
| 4iltA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7495 | 47 | 225 | 2.60.130.10 |
| 3hhyA02 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7273 | 72 | 225 | 2.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I1MKP1-F1-model_v4 | Protocatechuate 3,4-dioxygenase subunit beta | 0.9162 | 59 | 229 |
GO:0008199
GO:0016702 |
| AF-A0A1C9ICQ1-F1-model_v4 | Protocatechuate dioxygenase beta subunit | 0.9161 | 59 | 215 |
GO:0008199
GO:0016702 |
| AF-A0A2S1M315-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.909 | 124 | 220 |
GO:0008199
GO:0016702 |
| AF-A4L382-F1-model_v4 | Protocatechuate 3,4-dioxygenase beta subunit | 0.9045 | 103 | 219 |
GO:0008199
GO:0016702 |
| AF-A4L686-F1-model_v4 | Protocatechuate 3,4-dioxygenase beta subunit | 0.8989 | 101 | 220 |
GO:0008199
GO:0016702 |