F488278

General Info

Members Datasets Scaffolds Average Seq Length
1017 523 2034 239

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100035428|Ga0070698_1000354283
Length 262
Sequence VSGHPGIPVLQDREDVNADVSTSLAAAEASQLVLPSYERPVGLHPPLDFDGYRSTALRHPKHPLVLLPHRLTEVTGPLLGDGLIMPTDSDLTTQHGGEPQGQRIILSGRVLDSDGRPVPDTLIEIWQTNAAGRYRHWREHHPAPLDPNFDGIGRAITDPAGRYRFVTIQPGAYPWGNHYNAWRPAHIHFSLFGRAFTQRLVTQMYFPGDPLLPLDPIFNSVPDEKARQRLIAAFDLELTQPEWALGYHWDIVLRGRDATVFE

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
148 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
149 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
150 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
151 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
277 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
278 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
279 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
280 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
281 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
282 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
285 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
297 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
366 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
370 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
417 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
418 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
425 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
433 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
434 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
435 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
436 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
437 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
438 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
439 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
440 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
441 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
444 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
445 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
446 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
449 2511231006 Pseudomonas sp. GM17 Isolate Nodule
450 2511231008 Pseudomonas sp. GM21 Isolate Nodule
451 2511231011 Pseudomonas sp. GM30 Isolate Nodule
452 2511231012 Pseudomonas sp. GM33 Isolate Nodule
453 2511231014 Pseudomonas sp. GM48 Isolate Nodule
454 2511231015 Pseudomonas sp. GM49 Isolate Nodule
455 2511231016 Pseudomonas sp. GM50 Isolate Nodule
456 2511231017 Pseudomonas sp. GM55 Isolate Nodule
457 2511231018 Pseudomonas sp. GM60 Isolate Nodule
458 2511231019 Pseudomonas sp. GM67 Isolate Nodule
459 2511231020 Pseudomonas sp. GM74 Isolate Nodule
460 2511231021 Pseudomonas sp. GM78 Isolate Nodule
461 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
462 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
463 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
464 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
465 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
466 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
467 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
468 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
469 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
470 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
471 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
472 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
473 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
474 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
475 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
476 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
477 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
478 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
479 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
480 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
481 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
482 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
483 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
484 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
485 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
486 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
487 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
488 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
489 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
490 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
491 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
492 2773857673 Pseudomonas sp. 443 Isolate Unclassified
493 2784132063 Pseudomonas sp. 424 Isolate Unclassified
494 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
495 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
496 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
497 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
498 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
499 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
500 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
501 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
502 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
503 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
504 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
505 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
506 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
507 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
508 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
509 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
510 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
511 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
512 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
513 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
514 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
515 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
516 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
517 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
518 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
519 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
520 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
521 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
522 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
523 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.15
Metatranscriptomes 1.47
Isolates 7.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 1.38
Rhizoplane 5.21
Rhizosphere 83.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100035428 3300005471 Bacteria 5162
2 RicEn_FSXC49909_b1 2010549000 Bacteria 785
3 JGI25162J39368_1000054 3300002737 Bacteria 147779
4 JGI25162J39368_1000898 3300002737 Bacteria 19383
5 JGI25163J39215_1000269 3300002771 Bacteria 18376
6 JGI25163J39215_1000348 3300002771 Bacteria 15338
7 JGI25164J39214_1000029 3300002772 Bacteria 147779
8 JGI25164J39214_1000492 3300002772 Bacteria 19394
9 JGI25406J46586_10040029 3300003203 Bacteria 1665
10 JGI25165J46597_1000111 3300003214 Bacteria 147779
11 JGI25165J46597_1000934 3300003214 Bacteria 20070
12 Ga0055538_1000082 3300003751 Bacteria 84434
13 Ga0055539_1000121 3300003752 Bacteria 84434
14 Ga0055533_1000129 3300003756 Bacteria 84434
15 Ga0055532_1000104 3300003758 Bacteria 91442
16 Ga0055525_1000167 3300003759 Bacteria 84434
17 Ga0055535_1011188 3300003761 Bacteria 1432
18 Ga0055536_1000043 3300003781 Bacteria 124663
19 Ga0055530_10000031 3300003791 Bacteria 122117
20 Ga0055530_10012647 3300003791 Bacteria 2929
21 Ga0055540_1000230 3300003792 Bacteria 51911
22 Ga0055541_1000081 3300003841 Bacteria 84434
23 Ga0065714_10067038 3300005288 Bacteria 5970
24 Ga0065714_10105108 3300005288 Bacteria 1572
25 Ga0065704_10013836 3300005289 Bacteria 1840
26 Ga0065712_10075189 3300005290 Bacteria 3914
27 Ga0065712_10236500 3300005290 Bacteria 996
28 Ga0070658_10019937 3300005327 Bacteria 5372
29 Ga0070658_10201648 3300005327 Bacteria 1679
30 Ga0070676_10195870 3300005328 Bacteria 1322
31 Ga0070683_100009609 3300005329 Bacteria 8281
32 Ga0070683_100014648 3300005329 Bacteria 6867
33 Ga0070683_100094011 3300005329 Bacteria 2817
34 Ga0070690_100065637 3300005330 Bacteria 2347
35 Ga0070670_100001105 3300005331 Bacteria 21435
36 Ga0068869_100011134 3300005334 Bacteria 5894
37 Ga0070666_10030938 3300005335 Bacteria 3530
38 Ga0070680_100012295 3300005336 Bacteria 6647
39 Ga0070680_100077510 3300005336 Bacteria 2737
40 Ga0070682_100037829 3300005337 Bacteria 2956
41 Ga0070682_100052820 3300005337 Bacteria 2544
42 Ga0068868_100001991 3300005338 Bacteria 14039
43 Ga0068868_100027562 3300005338 Bacteria 4334
44 Ga0070660_100023571 3300005339 Bacteria 4560
45 Ga0070660_100029658 3300005339 Bacteria 4102
46 Ga0070689_100049302 3300005340 Bacteria 3250
47 Ga0070691_10104061 3300005341 Bacteria 1413
48 Ga0070661_100000238 3300005344 Bacteria 45456
49 Ga0070661_100013386 3300005344 Bacteria 5758
50 Ga0070661_100071326 3300005344 Bacteria 2556
51 Ga0070692_10004915 3300005345 Bacteria 5630
52 Ga0070692_10037485 3300005345 Bacteria 2465
53 Ga0070675_100010129 3300005354 Bacteria 7353
54 Ga0070675_100011148 3300005354 Bacteria 7033
55 Ga0070675_100225662 3300005354 Bacteria 1633
56 Ga0070671_100099650 3300005355 Bacteria 2437
57 Ga0070659_100026111 3300005366 Bacteria 4493
58 Ga0070667_100111973 3300005367 Bacteria 2367
59 Ga0070703_10013256 3300005406 Bacteria 2341
60 Ga0070709_10000165 3300005434 Bacteria 41860
61 Ga0070709_10045199 3300005434 Bacteria 2731
62 Ga0070709_10076782 3300005434 Bacteria 2170
63 Ga0070714_100000318 3300005435 Bacteria 36459
64 Ga0070714_100000491 3300005435 Bacteria 28628
65 Ga0070714_100009563 3300005435 Bacteria 7629
66 Ga0070714_100300400 3300005435 Bacteria 1496
67 Ga0070713_100001888 3300005436 Bacteria 13519
68 Ga0070713_100099934 3300005436 Bacteria 2510
69 Ga0070713_100411201 3300005436 Bacteria 1265
70 Ga0070710_10000171 3300005437 Bacteria 29726
71 Ga0070710_10034420 3300005437 Bacteria 2756
72 Ga0070701_10138883 3300005438 Bacteria 1387
73 Ga0070711_100000158 3300005439 Bacteria 36681
74 Ga0070711_100309139 3300005439 Bacteria 1259
75 Ga0070705_100111868 3300005440 Bacteria 1746
76 Ga0070700_100143178 3300005441 Bacteria 1627
77 Ga0070708_100001234 3300005445 Bacteria 19676
78 Ga0070708_100030905 3300005445 Bacteria 4632
79 Ga0070708_100044212 3300005445 Bacteria 3916
80 Ga0070708_100440245 3300005445 Bacteria 1229
81 Ga0070663_100052924 3300005455 Bacteria 2897
82 Ga0070663_100312069 3300005455 Bacteria 1262
83 Ga0070678_100013597 3300005456 Bacteria 5111
84 Ga0070662_100021530 3300005457 Bacteria 4403
85 Ga0070681_10047709 3300005458 Bacteria 4282
86 Ga0070681_10183344 3300005458 Bacteria 2014
87 Ga0070706_100002363 3300005467 Bacteria 19041
88 Ga0070706_100020520 3300005467 Bacteria 6089
89 Ga0070706_100029550 3300005467 Bacteria 5049
90 Ga0070706_100087323 3300005467 Bacteria 2891
91 Ga0070706_100138562 3300005467 Bacteria 2271
92 Ga0070706_100394203 3300005467 Bacteria 1289
93 Ga0070706_100706871 3300005467 Bacteria 934
94 Ga0070707_100000043 3300005468 Bacteria 108893
95 Ga0070707_100002621 3300005468 Bacteria 17098
96 Ga0070707_100020775 3300005468 Bacteria 6198
97 Ga0070698_100000072 3300005471 Bacteria 75715
98 Ga0070698_100000309 3300005471 Bacteria 49509
99 Ga0070698_100013936 3300005471 Bacteria 8503
100 Ga0070698_100014678 3300005471 Bacteria 8273
101 Ga0070698_100036356 3300005471 Bacteria 5088
102 Ga0070698_100092722 3300005471 Bacteria 3001
103 Ga0070698_100134816 3300005471 Bacteria 2423
104 Ga0070698_100180439 3300005471 Bacteria 2050
105 Ga0070699_100000327 3300005518 Bacteria 45983
106 Ga0070699_100000511 3300005518 Bacteria 36777
107 Ga0070699_100026940 3300005518 Bacteria 4957
108 Ga0070699_100046052 3300005518 Bacteria 3774
109 Ga0070679_100611638 3300005530 Bacteria 1033
110 Ga0070684_100009019 3300005535 Bacteria 7836
111 Ga0070684_100016988 3300005535 Bacteria 5963
112 Ga0070684_100069498 3300005535 Bacteria 3097
113 Ga0070684_100688748 3300005535 Bacteria 952
114 Ga0070697_100005337 3300005536 Bacteria 9880
115 Ga0070697_100016026 3300005536 Bacteria 5893
116 Ga0070697_100048744 3300005536 Bacteria 3435
117 Ga0070697_100127541 3300005536 Bacteria 2132
118 Ga0068853_100146938 3300005539 Bacteria 2119
119 Ga0070672_100108524 3300005543 Bacteria 2260
120 Ga0070672_100145396 3300005543 Bacteria 1959
121 Ga0070672_100435153 3300005543 Bacteria 1128
122 Ga0070695_100095391 3300005545 Bacteria 1993
123 Ga0070696_100013244 3300005546 Bacteria 5534
124 Ga0070693_100096109 3300005547 Bacteria 1795
125 Ga0070665_100003764 3300005548 Bacteria 16053
126 Ga0070665_100122001 3300005548 Bacteria 2608
127 Ga0070704_100128359 3300005549 Bacteria 1960
128 Ga0068855_100022092 3300005563 Bacteria 7627
129 Ga0070664_100000233 3300005564 Bacteria 39884
130 Ga0070664_100001873 3300005564 Bacteria 16883
131 Ga0070664_100031400 3300005564 Bacteria 4438
132 Ga0070664_100159109 3300005564 Bacteria 1997
133 Ga0068854_100010679 3300005578 Bacteria 5961
134 Ga0068854_100260934 3300005578 Bacteria 1387
135 Ga0068856_100018845 3300005614 Bacteria 6692
136 Ga0068856_100486766 3300005614 Bacteria 1255
137 Ga0070702_100024285 3300005615 Bacteria 3232
138 Ga0070702_100037783 3300005615 Bacteria 2683
139 Ga0068852_100185902 3300005616 Bacteria 1957
140 Ga0068852_100639550 3300005616 Bacteria 1070
141 Ga0068859_100272285 3300005617 Bacteria 1785
142 Ga0068864_100352665 3300005618 Bacteria 1388
143 Ga0068866_10059537 3300005718 Bacteria 1977
144 Ga0068861_100343950 3300005719 Bacteria 1306
145 Ga0068870_10340566 3300005840 Bacteria 959
146 Ga0068863_100129348 3300005841 Bacteria 2410
147 Ga0068863_100161810 3300005841 Bacteria 2145
148 Ga0068858_100205390 3300005842 Bacteria 1864
149 Ga0068862_100084635 3300005844 Bacteria 2755
150 Ga0068862_100168792 3300005844 Bacteria 1958
151 Ga0081455_10051524 3300005937 Bacteria 3530
152 Ga0081538_10002736 3300005981 Bacteria 16933
153 Ga0081538_10031123 3300005981 Bacteria 3607
154 Ga0081538_10047439 3300005981 Bacteria 2634
155 Ga0081540_1000058 3300005983 Bacteria 120635
156 Ga0081540_1035917 3300005983 Bacteria 2651
157 Ga0081539_10004989 3300005985 Bacteria 14032
158 Ga0081539_10063447 3300005985 Bacteria 2016
159 Ga0081539_10077649 3300005985 Bacteria 1755
160 Ga0070717_10010134 3300006028 Bacteria 7097
161 Ga0070717_10042228 3300006028 Bacteria 3719
162 Ga0070717_10124015 3300006028 Bacteria 2216
163 Ga0070717_10426270 3300006028 Bacteria 1193
164 Ga0075364_10069297 3300006051 Bacteria 2320
165 Ga0075364_10085457 3300006051 Bacteria 2089
166 Ga0075432_10106405 3300006058 Bacteria 1041
167 Ga0070715_10035075 3300006163 Bacteria 2061
168 Ga0070715_10041047 3300006163 Bacteria 1937
169 Ga0070715_10059314 3300006163 Bacteria 1673
170 Ga0070715_10267315 3300006163 Bacteria 901
171 Ga0070716_100000117 3300006173 Bacteria 31350
172 Ga0070716_100083695 3300006173 Bacteria 1911
173 Ga0070712_100000698 3300006175 Bacteria 19829
174 Ga0070712_100092217 3300006175 Bacteria 2221
175 Ga0070712_100208782 3300006175 Bacteria 1539
176 Ga0070712_100233212 3300006175 Bacteria 1463
177 Ga0075362_10050309 3300006177 Bacteria 1863
178 Ga0075362_10118949 3300006177 Bacteria 1249
179 Ga0075369_10022141 3300006186 Bacteria 2619
180 Ga0097621_100114765 3300006237 Bacteria 2279
181 Ga0075430_100000242 3300006846 Bacteria 37737
182 Ga0075433_10021690 3300006852 Bacteria 5387
183 Ga0075433_10023853 3300006852 Bacteria 5155
184 Ga0075433_10077482 3300006852 Bacteria 2928
185 Ga0075434_100241998 3300006871 Bacteria 1824
186 Ga0075434_100322222 3300006871 Bacteria 1566
187 Ga0075434_100357969 3300006871 Bacteria 1480
188 Ga0075429_100200583 3300006880 Bacteria 1748
189 Ga0068865_100120726 3300006881 Bacteria 1948
190 Ga0068865_100169640 3300006881 Bacteria 1672
191 Ga0075436_100007086 3300006914 Bacteria 7675
192 Ga0075436_100094554 3300006914 Bacteria 2078
193 Ga0075436_100111279 3300006914 Bacteria 1912
194 Ga0097620_100272279 3300006931 Bacteria 1785
195 Ga0079104_1000090 3300006946 Bacteria 132824
196 Ga0075435_100102834 3300007076 Bacteria 2369
197 Ga0075435_100120359 3300007076 Bacteria 2190
198 Ga0075435_100181404 3300007076 Bacteria 1779
199 Ga0105251_10003475 3300009011 Bacteria 11417
200 Ga0105251_10035329 3300009011 Bacteria 2467
201 Ga0105244_10005915 3300009036 Bacteria 8025
202 Ga0105244_10006512 3300009036 Bacteria 7536
203 Ga0105244_10023824 3300009036 Bacteria 3349
204 Ga0105244_10150148 3300009036 Bacteria 1117
205 Ga0105244_10159899 3300009036 Bacteria 1076
206 Ga0105250_10000118 3300009092 Bacteria 71419
207 Ga0105250_10006019 3300009092 Bacteria 5347
208 Ga0105240_10206032 3300009093 Bacteria 2302
209 Ga0111539_10010281 3300009094 Bacteria 11779
210 Ga0111539_10021897 3300009094 Bacteria 7858
211 Ga0111539_10089795 3300009094 Bacteria 3611
212 Ga0105245_10003051 3300009098 Bacteria 14988
213 Ga0105245_10014691 3300009098 Bacteria 6817
214 Ga0105245_10844323 3300009098 Bacteria 956
215 Ga0114129_10025453 3300009147 Bacteria 8387
216 Ga0114129_10057100 3300009147 Bacteria 5465
217 Ga0114129_10100917 3300009147 Bacteria 3993
218 Ga0114129_10144111 3300009147 Bacteria 3264
219 Ga0105243_10001057 3300009148 Bacteria 25197
220 Ga0105243_10044066 3300009148 Bacteria 3498
221 Ga0105243_10065747 3300009148 Bacteria 2914
222 Ga0105241_10221796 3300009174 Bacteria 1590
223 Ga0105242_10000719 3300009176 Bacteria 25890
224 Ga0105248_10303828 3300009177 Bacteria 1797
225 Ga0105237_10005805 3300009545 Bacteria 13845
226 Ga0105237_10661472 3300009545 Bacteria 1051
227 Ga0105237_10840213 3300009545 Bacteria 925
228 Ga0105249_10041983 3300009553 Bacteria 4159
229 Ga0105249_10044788 3300009553 Bacteria 4023
230 Ga0105249_10099711 3300009553 Bacteria 2730
231 Ga0105239_10107507 3300010375 Bacteria 3091
232 Ga0105239_10659537 3300010375 Bacteria 1195
233 Ga0105246_10003807 3300011119 Bacteria 9144
234 Ga0157341_1000951 3300012494 Bacteria 1626
235 Ga0157373_10023566 3300013100 Bacteria 4461
236 Ga0157371_10000281 3300013102 Bacteria 68624
237 Ga0157371_10000795 3300013102 Bacteria 36211
238 Ga0157371_10112028 3300013102 Bacteria 1937
239 Ga0157370_10028864 3300013104 Bacteria 5454
240 Ga0157370_10044828 3300013104 Bacteria 4247
241 Ga0157370_10055729 3300013104 Bacteria 3764
242 Ga0157370_10130059 3300013104 Bacteria 2349
243 Ga0157370_10189187 3300013104 Bacteria 1911
244 Ga0157370_10316657 3300013104 Bacteria 1440
245 Ga0157370_10435631 3300013104 Bacteria 1205
246 Ga0157369_10003643 3300013105 Bacteria 18275
247 Ga0157369_10046415 3300013105 Bacteria 4721
248 Ga0157369_10249186 3300013105 Bacteria 1854
249 Ga0157374_10029085 3300013296 Bacteria 4998
250 Ga0157378_10199580 3300013297 Bacteria 1892
251 Ga0157378_10403033 3300013297 Bacteria 1348
252 Ga0163162_10075157 3300013306 Bacteria 3439
253 Ga0163162_10147706 3300013306 Bacteria 2468
254 Ga0157372_10058127 3300013307 Bacteria 4322
255 Ga0157372_10567437 3300013307 Bacteria 1323
256 Ga0157372_10572220 3300013307 Bacteria 1317
257 Ga0157375_10012550 3300013308 Bacteria 7520
258 Ga0157375_10029601 3300013308 Bacteria 5153
259 Ga0163163_10033119 3300014325 Bacteria 4997
260 Ga0163163_10142794 3300014325 Bacteria 2436
261 Ga0182008_10000138 3300014497 Bacteria 55773
262 Ga0182008_10001875 3300014497 Bacteria 13682
263 Ga0182008_10013562 3300014497 Bacteria 4285
264 Ga0182008_10030510 3300014497 Bacteria 2717
265 Ga0182008_10035864 3300014497 Bacteria 2482
266 Ga0157377_10000891 3300014745 Bacteria 12460
267 Ga0157377_10028128 3300014745 Bacteria 3024
268 Ga0157377_10198172 3300014745 Bacteria 1273
269 Ga0157379_10242291 3300014968 Bacteria 1635
270 Ga0157376_10067112 3300014969 Bacteria 3034
271 Ga0182006_1000816 3300015261 Bacteria 20884
272 Ga0182006_1024437 3300015261 Bacteria 2492
273 Ga0163161_10054201 3300017792 Bacteria 2910
274 Ga0163161_10353522 3300017792 Bacteria 1168
275 Ga0163161_10715418 3300017792 Bacteria 835
276 Ga0197907_11173906 3300020069 Bacteria 1975
277 Ga0206356_10219634 3300020070 Bacteria 1678
278 Ga0206356_11376920 3300020070 Bacteria 2615
279 Ga0206349_1693199 3300020075 Bacteria 1306
280 Ga0206355_1544356 3300020076 Bacteria 1252
281 Ga0206351_10449033 3300020077 Bacteria 1207
282 Ga0206351_10726113 3300020077 Bacteria 1739
283 Ga0206352_10696447 3300020078 Bacteria 1142
284 Ga0206350_10260968 3300020080 Bacteria 1238
285 Ga0206350_10760667 3300020080 Bacteria 3399
286 Ga0206354_11479794 3300020081 Bacteria 1559
287 Ga0206353_11923273 3300020082 Bacteria 3064
288 Ga0213874_10100649 3300021377 Bacteria 960
289 Ga0213875_10000817 3300021388 Bacteria 23214
290 Ga0213875_10002595 3300021388 Bacteria 10743
291 Ga0213875_10027419 3300021388 Bacteria 2710
292 Ga0213875_10052067 3300021388 Bacteria 1917
293 Ga0224712_10019502 3300022467 Bacteria 2288
294 Ga0224712_10022965 3300022467 Bacteria 2158
295 Ga0228600_1004353 3300024123 Bacteria 1032
296 Ga0224572_1017256 3300024225 Bacteria 1385
297 Ga0228598_1014646 3300024227 Bacteria 1551
298 Ga0209435_100841 3300025206 Bacteria 4812
299 Ga0209760_100015 3300025207 Bacteria 176281
300 Ga0209760_100047 3300025207 Bacteria 107520
301 Ga0209784_100015 3300025224 Bacteria 482117
302 Ga0209566_100012 3300025225 Bacteria 482281
303 Ga0209674_100027 3300025226 Bacteria 482281
304 Ga0209147_100019 3300025229 Bacteria 482139
305 Ga0209563_100031 3300025230 Bacteria 482281
306 Ga0207427_100001 3300025231 Bacteria 1410763
307 Ga0207427_100029 3300025231 Bacteria 376678
308 Ga0209437_100003 3300025233 Bacteria 1517827
309 Ga0209437_100009 3300025233 Bacteria 915954
310 Ga0209437_108916 3300025233 Bacteria 1586
311 Ga0209258_100250 3300025242 Bacteria 97656
312 Ga0209646_1000263 3300025246 Bacteria 51493
313 Ga0209677_100016 3300025253 Bacteria 482117
314 Ga0209233_1000007 3300025261 Bacteria 1411234
315 Ga0209233_1000032 3300025261 Bacteria 623596
316 Ga0209676_1000080 3300025292 Bacteria 287400
317 Ga0209676_1002060 3300025292 Bacteria 15666
318 Ga0209050_1000117 3300025298 Bacteria 202979
319 Ga0209050_1001134 3300025298 Bacteria 32080
320 Ga0209051_1000077 3300025303 Bacteria 202959
321 Ga0209051_1044678 3300025303 Bacteria 1541
322 Ga0207696_1000083 3300025711 Bacteria 197352
323 Ga0207696_1000111 3300025711 Bacteria 155243
324 Ga0207655_1000435 3300025728 Bacteria 55875
325 Ga0207655_1002832 3300025728 Bacteria 13434
326 Ga0207655_1009325 3300025728 Bacteria 6107
327 Ga0207713_1000564 3300025735 Bacteria 36882
328 Ga0207713_1003370 3300025735 Bacteria 10952
329 Ga0207713_1009675 3300025735 Bacteria 5404
330 Ga0207713_1018905 3300025735 Bacteria 3393
331 Ga0207692_10000417 3300025898 Bacteria 14917
332 Ga0207692_10103992 3300025898 Bacteria 1564
333 Ga0207688_10011847 3300025901 Bacteria 4746
334 Ga0207647_10034782 3300025904 Bacteria 3214
335 Ga0207685_10028209 3300025905 Bacteria 1974
336 Ga0207699_10000393 3300025906 Bacteria 22711
337 Ga0207699_10112412 3300025906 Bacteria 1748
338 Ga0207699_10126686 3300025906 Bacteria 1659
339 Ga0207699_10226281 3300025906 Bacteria 1279
340 Ga0207699_10301820 3300025906 Bacteria 1118
341 Ga0207699_10332698 3300025906 Bacteria 1068
342 Ga0207699_10514777 3300025906 Bacteria 865
343 Ga0207645_10140641 3300025907 Bacteria 1573
344 Ga0207643_10052734 3300025908 Bacteria 2310
345 Ga0207705_10370421 3300025909 Bacteria 1105
346 Ga0207684_10025263 3300025910 Bacteria 5063
347 Ga0207684_10060661 3300025910 Bacteria 3212
348 Ga0207684_10122794 3300025910 Bacteria 2227
349 Ga0207684_10295409 3300025910 Bacteria 1397
350 Ga0207684_10310995 3300025910 Bacteria 1358
351 Ga0207684_10449500 3300025910 Bacteria 1106
352 Ga0207707_10125403 3300025912 Bacteria 2245
353 Ga0207695_10155316 3300025913 Bacteria 2223
354 Ga0207671_10000436 3300025914 Bacteria 57399
355 Ga0207693_10000436 3300025915 Bacteria 38097
356 Ga0207693_10069329 3300025915 Bacteria 2759
357 Ga0207693_10100193 3300025915 Bacteria 2271
358 Ga0207693_10195353 3300025915 Bacteria 1592
359 Ga0207693_10212783 3300025915 Bacteria 1519
360 Ga0207693_10320537 3300025915 Bacteria 1213
361 Ga0207663_10000849 3300025916 Bacteria 13884
362 Ga0207663_10017821 3300025916 Bacteria 3965
363 Ga0207660_10026126 3300025917 Bacteria 3974
364 Ga0207662_10009010 3300025918 Bacteria 5480
365 Ga0207657_10046321 3300025919 Bacteria 3809
366 Ga0207657_10063273 3300025919 Bacteria 3164
367 Ga0207657_10265307 3300025919 Bacteria 1366
368 Ga0207649_10000002 3300025920 Bacteria 498633
369 Ga0207649_10046235 3300025920 Bacteria 2673
370 Ga0207652_10043512 3300025921 Bacteria 3823
371 Ga0207652_10191547 3300025921 Bacteria 1839
372 Ga0207646_10000300 3300025922 Bacteria 67365
373 Ga0207646_10000647 3300025922 Bacteria 45144
374 Ga0207646_10182531 3300025922 Bacteria 1895
375 Ga0207650_10000688 3300025925 Bacteria 26557
376 Ga0207650_10427121 3300025925 Bacteria 1100
377 Ga0207659_10006861 3300025926 Bacteria 7003
378 Ga0207659_10128556 3300025926 Bacteria 1952
379 Ga0207687_10019067 3300025927 Bacteria 4540
380 Ga0207700_10000029 3300025928 Bacteria 132615
381 Ga0207700_10018831 3300025928 Bacteria 4651
382 Ga0207700_10062583 3300025928 Bacteria 2827
383 Ga0207700_10145287 3300025928 Bacteria 1954
384 Ga0207700_10442423 3300025928 Bacteria 1144
385 Ga0207664_10000110 3300025929 Bacteria 72637
386 Ga0207664_10000648 3300025929 Bacteria 24123
387 Ga0207664_10021467 3300025929 Bacteria 4803
388 Ga0207664_10049721 3300025929 Bacteria 3302
389 Ga0207664_10063647 3300025929 Bacteria 2948
390 Ga0207664_10077660 3300025929 Bacteria 2691
391 Ga0207664_10245979 3300025929 Bacteria 1559
392 Ga0207664_10882095 3300025929 Bacteria 804
393 Ga0207690_10017709 3300025932 Bacteria 4356
394 Ga0207706_10031850 3300025933 Bacteria 4697
395 Ga0207706_10110318 3300025933 Bacteria 2420
396 Ga0207706_10153622 3300025933 Bacteria 2025
397 Ga0207686_10005841 3300025934 Bacteria 6603
398 Ga0207686_10426664 3300025934 Bacteria 1015
399 Ga0207709_10000278 3300025935 Bacteria 59633
400 Ga0207709_10115951 3300025935 Bacteria 1800
401 Ga0207670_10055126 3300025936 Bacteria 2685
402 Ga0207670_10117159 3300025936 Bacteria 1930
403 Ga0207704_10017174 3300025938 Bacteria 3743
404 Ga0207665_10000373 3300025939 Bacteria 31019
405 Ga0207665_10181310 3300025939 Bacteria 1525
406 Ga0207691_10015140 3300025940 Bacteria 7338
407 Ga0207691_10083715 3300025940 Bacteria 2864
408 Ga0207691_10342843 3300025940 Bacteria 1279
409 Ga0207711_10073195 3300025941 Bacteria 2978
410 Ga0207689_10005561 3300025942 Bacteria 11253
411 Ga0207689_10013438 3300025942 Bacteria 6990
412 Ga0207661_10052643 3300025944 Bacteria 3253
413 Ga0207661_10132814 3300025944 Bacteria 2135
414 Ga0207661_10138350 3300025944 Bacteria 2093
415 Ga0207661_10180206 3300025944 Bacteria 1845
416 Ga0207661_10413065 3300025944 Bacteria 1225
417 Ga0207679_10000006 3300025945 Bacteria 498868
418 Ga0207679_10002012 3300025945 Bacteria 12619
419 Ga0207679_10029241 3300025945 Bacteria 3835
420 Ga0207667_10211282 3300025949 Bacteria 1989
421 Ga0207667_10261825 3300025949 Bacteria 1768
422 Ga0207651_10131438 3300025960 Bacteria 1917
423 Ga0207712_10049637 3300025961 Bacteria 2925
424 Ga0207712_10157878 3300025961 Bacteria 1759
425 Ga0207668_10120500 3300025972 Bacteria 1986
426 Ga0207677_10004672 3300026023 Bacteria 7378
427 Ga0207677_10040589 3300026023 Bacteria 3069
428 Ga0207703_10170951 3300026035 Bacteria 1911
429 Ga0207703_10416909 3300026035 Bacteria 1249
430 Ga0207639_10261275 3300026041 Bacteria 1514
431 Ga0207678_10016455 3300026067 Bacteria 6493
432 Ga0207678_10032732 3300026067 Bacteria 4531
433 Ga0207678_10075576 3300026067 Bacteria 2886
434 Ga0207678_10082743 3300026067 Bacteria 2746
435 Ga0207678_10108638 3300026067 Bacteria 2366
436 Ga0207708_10000996 3300026075 Bacteria 21178
437 Ga0207708_10007569 3300026075 Bacteria 8034
438 Ga0207708_10182793 3300026075 Bacteria 1665
439 Ga0207702_10013428 3300026078 Bacteria 6808
440 Ga0207702_10458040 3300026078 Bacteria 1238
441 Ga0207702_10490259 3300026078 Bacteria 1197
442 Ga0207702_10873376 3300026078 Bacteria 891
443 Ga0207641_10334723 3300026088 Bacteria 1439
444 Ga0207676_10515891 3300026095 Bacteria 1137
445 Ga0207674_10006879 3300026116 Bacteria 13328
446 Ga0207674_10016534 3300026116 Bacteria 8071
447 Ga0207674_10090524 3300026116 Bacteria 3051
448 Ga0207675_100007636 3300026118 Bacteria 10214
449 Ga0207675_100093909 3300026118 Bacteria 2822
450 Ga0207675_100569009 3300026118 Bacteria 1134
451 Ga0207683_10056035 3300026121 Bacteria 3457
452 Ga0207698_10134046 3300026142 Bacteria 2122
453 Ga0207698_10352174 3300026142 Bacteria 1391
454 Ga0209281_1000013 3300027111 Bacteria 653449
455 Ga0207428_10000812 3300027907 Bacteria 35326
456 Ga0207428_10004869 3300027907 Bacteria 12659
457 Ga0207428_10039803 3300027907 Bacteria 3816
458 Ga0207428_10068592 3300027907 Bacteria 2789
459 Ga0207428_10346945 3300027907 Bacteria 1093
460 Ga0268266_10007082 3300028379 Bacteria 10182
461 Ga0268266_10075054 3300028379 Bacteria 2937
462 Ga0265338_10006561 3300028800 Bacteria 14771
463 Ga0265338_10007488 3300028800 Bacteria 13527
464 Ga0307408_100142179 3300031548 Bacteria 1885
465 Ga0307405_10003598 3300031731 Bacteria 7157
466 Ga0307405_10157063 3300031731 Bacteria 1606
467 Ga0307405_10543652 3300031731 Bacteria 939
468 Ga0307413_10108739 3300031824 Bacteria 1851
469 Ga0307410_10022469 3300031852 Bacteria 3900
470 Ga0307410_10172960 3300031852 Bacteria 1629
471 Ga0307406_10084601 3300031901 Bacteria 2118
472 Ga0307406_10178130 3300031901 Bacteria 1545
473 Ga0307407_10030629 3300031903 Bacteria 2904
474 Ga0307407_10206786 3300031903 Bacteria 1319
475 Ga0307412_10049010 3300031911 Bacteria 2781
476 Ga0307412_10236064 3300031911 Bacteria 1411
477 Ga0307412_10704490 3300031911 Bacteria 867
478 Ga0307409_100015263 3300031995 Bacteria 5034
479 Ga0307409_100021793 3300031995 Bacteria 4402
480 Ga0307409_100071849 3300031995 Bacteria 2753
481 Ga0307409_100120183 3300031995 Bacteria 2223
482 Ga0307416_100091653 3300032002 Bacteria 2611
483 Ga0307416_100102301 3300032002 Bacteria 2497
484 Ga0307416_100176671 3300032002 Bacteria 1996
485 Ga0307416_100238620 3300032002 Bacteria 1759
486 Ga0307414_10180218 3300032004 Bacteria 1698
487 Ga0307411_10024540 3300032005 Bacteria 3596
488 Ga0307415_100006263 3300032126 Bacteria 6393
489 Ga0307415_100030121 3300032126 Bacteria 3478
490 Ga0307415_100048505 3300032126 Bacteria 2866
491 Ga0307415_100075844 3300032126 Bacteria 2381
492 Ga0307415_100090373 3300032126 Bacteria 2215
493 Ga0307415_100490796 3300032126 Bacteria 1071
494 Ga0316214_1001620 3300033545 Bacteria 2662
495 Ga0373938_0013766 3300034957 Bacteria 1541
496 Ga0373926_0003618 3300035083 Bacteria 5017
497 Ga0373926_0003710 3300035083 Bacteria 4966
498 Ga0373934_0000109 3300035086 Bacteria 29409
499 Ga0373934_0022882 3300035086 Bacteria 2412
500 Ga0373944_0001446 3300035089 Bacteria 5993
501 Ga0373944_0004430 3300035089 Bacteria 3657
502 Ga0373923_0011379 3300035111 Bacteria 3261
503 Ga0373936_0001004 3300035113 Bacteria 10072
504 Ga0373936_0004893 3300035113 Bacteria 5049
505 Ga0373939_0003160 3300035114 Bacteria 3872
506 Ga0373945_0000108 3300035116 Bacteria 19713
507 Ga0373945_0003095 3300035116 Bacteria 5223
508 Ga0373953_0000026 3300035117 Bacteria 40030
509 Ga0373954_0010979 3300035118 Bacteria 4006
510 Ga0373954_0024558 3300035118 Bacteria 2748
511 Ga0373956_0136421 3300035119 Bacteria 1151
512 Ga0373957_0000038 3300035120 Bacteria 34200
513 Ga0373957_0003809 3300035120 Bacteria 4520
514 Ga0373957_0021745 3300035120 Bacteria 2280
515 Ga0373943_0003488 3300035170 Bacteria 7161
516 Ga0373943_0024808 3300035170 Bacteria 2798
517 Ga0373946_0000230 3300035171 Bacteria 17527
518 Ga0373946_0003046 3300035171 Bacteria 5938
519 Ga0373946_0146904 3300035171 Bacteria 1097
520 Ga0373955_0000231 3300035172 Bacteria 23261
521 Ga0373955_0006961 3300035172 Bacteria 5174
522 Ga0373942_0013079 3300035207 Bacteria 1990
523 Ga0373961_0008464 3300035241 Bacteria 2502
524 Ga0373924_0000552 3300035410 Bacteria 11501
525 Ga0373924_0002765 3300035410 Bacteria 5921
526 Ga0373924_0039585 3300035410 Bacteria 1926
527 Ga0373931_0028944 3300035691 Bacteria 2840
528 Ga0373931_0242866 3300035691 Bacteria 1092
529 Ga0373935_0001927 3300035692 Bacteria 11668
530 Ga0373935_0023072 3300035692 Bacteria 3821
531 Ga0373927_0004889 3300035695 Bacteria 9311
532 Ga0373927_0007315 3300035695 Bacteria 7481
533 Ga0373927_0065039 3300035695 Bacteria 2359
534 Ga0373933_0000839 3300035724 Bacteria 18804
535 Ga0373933_0055048 3300035724 Bacteria 2385
536 Ga0373933_0240244 3300035724 Bacteria 1165
537 Ga0373933_0286178 3300035724 Bacteria 1065
538 Ga0373947_0018091 3300035725 Bacteria 4054
539 Ga0373947_0113656 3300035725 Bacteria 1713
540 Ga0373937_0000138 3300036401 Bacteria 70068
541 Ga0373937_0088273 3300036401 Bacteria 2870
542 Ga0373937_0094483 3300036401 Bacteria 2772
543 Ga0373937_0099086 3300036401 Bacteria 2703
544 Ga0373937_0117684 3300036401 Bacteria 2475
545 Ga0372808_006474 3300036459 Bacteria 1579
546 Ga0373925_0000699 3300037068 Bacteria 31424
547 Ga0373925_0008741 3300037068 Bacteria 7377
548 Ga0373925_0045005 3300037068 Bacteria 3277
549 Ga0373925_0186342 3300037068 Bacteria 1645
550 Ga0395900_0135703 3300037418 Bacteria 2521
551 Ga0395898_0115475 3300037466 Bacteria 2572
552 Ga0436364_0151261 3300037853 Bacteria 9936
553 Ga0436364_0207639 3300037853 Bacteria 28695
554 Ga0436364_0232843 3300037853 Bacteria 50861
555 Ga0436364_0754028 3300037853 Bacteria 2027
556 Ga0436364_0795184 3300037853 Bacteria 4769
557 Ga0436364_1116138 3300037853 Bacteria 3248
558 Ga0436364_1223164 3300037853 Bacteria 2827
559 Ga0395901_0048266 3300038443 Bacteria 4421
560 Ga0436365_0054221 3300039437 Bacteria 2082
561 Ga0436361_0657470 3300039447 Bacteria 903
562 Ga0439447_007210 3300041407 Bacteria 3546
563 Ga0439466_0001571 3300041411 Bacteria 8922
564 Ga0439466_0001845 3300041411 Bacteria 8316
565 Ga0439466_0025576 3300041411 Bacteria 2060
566 Ga0451853_2100055 3300041512 Bacteria 907
567 Ga0439448_0095320 3300042005 Bacteria 1008
568 Ga0439448_0103761 3300042005 Bacteria 968
569 Ga0439432_000245 3300042006 Bacteria 19526
570 Ga0439452_002580 3300042010 Bacteria 6640
571 Ga0439452_009166 3300042010 Bacteria 2930
572 Ga0439463_001106 3300042016 Bacteria 7250
573 Ga0439463_028790 3300042016 Bacteria 1400
574 Ga0450922_003435 3300042124 Bacteria 1459
575 Ga0450905_036016 3300042142 Bacteria 775
576 Ga0450907_005187 3300042146 Bacteria 2205
577 Ga0450910_000560 3300042147 Bacteria 4412
578 Ga0439444_0070726 3300042437 Bacteria 746
579 Ga0439464_0055042 3300042439 Bacteria 1157
580 Ga0439460_0033491 3300042461 Bacteria 1476
581 Ga0439440_0040338 3300042993 Bacteria 1136
582 Ga0466963_0017103 3300044694 Bacteria 4517
583 Ga0466964_0211351 3300044706 Bacteria 937
584 Ga0466957_0189130 3300044842 Bacteria 1348
585 Ga0466959_0027665 3300045049 Bacteria 4205
586 Ga0466958_0074021 3300045836 Bacteria 2087
587 Ga0466958_0105241 3300045836 Bacteria 1758
588 Ga0466967_0039747 3300045976 Bacteria 4046
589 Ga0466967_0194952 3300045976 Bacteria 1916
590 Ga0495617_001821 3300046452 Bacteria 9074
591 Ga0495617_021565 3300046452 Bacteria 2175
592 Ga0495627_001278 3300046453 Bacteria 15487
593 Ga0495592_0000041 3300046454 Bacteria 123431
594 Ga0495592_0078539 3300046454 Bacteria 2390
595 Ga0495592_0084568 3300046454 Bacteria 2289
596 Ga0495603_0023997 3300046455 Bacteria 3689
597 Ga0495603_0064612 3300046455 Bacteria 2157
598 Ga0495590_0002024 3300046457 Bacteria 8523
599 Ga0495590_0009714 3300046457 Bacteria 3646
600 Ga0495591_001556 3300046458 Bacteria 14002
601 Ga0495591_017215 3300046458 Bacteria 2490
602 Ga0495629_0012281 3300046459 Bacteria 6203
603 Ga0495638_0006808 3300046460 Bacteria 8254
604 Ga0495638_0007153 3300046460 Bacteria 8040
605 Ga0495638_0028702 3300046460 Bacteria 3590
606 Ga0495641_0008055 3300046461 Bacteria 6480
607 Ga0495651_0000018 3300046462 Bacteria 123195
608 Ga0495651_0006316 3300046462 Bacteria 9065
609 Ga0495651_0029577 3300046462 Bacteria 4272
610 Ga0495651_0076090 3300046462 Bacteria 2543
611 Ga0495653_0003023 3300046463 Bacteria 13488
612 Ga0495653_0010353 3300046463 Bacteria 7627
613 Ga0495653_0020353 3300046463 Bacteria 5380
614 Ga0495653_0032425 3300046463 Bacteria 4147
615 Ga0495653_0125368 3300046463 Bacteria 1824
616 Ga0495653_0385863 3300046463 Bacteria 893
617 Ga0495650_0003766 3300046471 Bacteria 10820
618 Ga0495650_0004163 3300046471 Bacteria 10061
619 Ga0495650_0016994 3300046471 Bacteria 3659
620 Ga0495580_0021796 3300046472 Bacteria 4724
621 Ga0495582_0006199 3300046473 Bacteria 6660
622 Ga0495582_0136741 3300046473 Bacteria 1387
623 Ga0495605_0003165 3300046474 Bacteria 9894
624 Ga0495605_0010478 3300046474 Bacteria 5184
625 Ga0495639_0000474 3300046475 Bacteria 19141
626 Ga0495639_0032642 3300046475 Bacteria 2323
627 Ga0495662_0000516 3300046476 Bacteria 17630
628 Ga0495662_0004052 3300046476 Bacteria 7377
629 Ga0495664_0001298 3300046477 Bacteria 13086
630 Ga0495664_0007339 3300046477 Bacteria 6119
631 Ga0495584_0005764 3300046491 Bacteria 6533
632 Ga0495584_0012853 3300046491 Bacteria 4272
633 Ga0495584_0028491 3300046491 Bacteria 2830
634 Ga0495584_0047417 3300046491 Bacteria 2166
635 Ga0495585_0006356 3300046492 Bacteria 7339
636 Ga0495585_0017597 3300046492 Bacteria 4128
637 Ga0495585_0054742 3300046492 Bacteria 2205
638 Ga0495594_0005447 3300046499 Bacteria 6542
639 Ga0495596_0001019 3300046500 Bacteria 16647
640 Ga0495607_0005334 3300046501 Bacteria 9236
641 Ga0495607_0012168 3300046501 Bacteria 5689
642 Ga0495607_0033438 3300046501 Bacteria 3128
643 Ga0495606_0009252 3300046507 Bacteria 8364
644 Ga0495606_0012613 3300046507 Bacteria 6757
645 Ga0495606_0052496 3300046507 Bacteria 2650
646 Ga0495606_0192222 3300046507 Bacteria 1169
647 Ga0495608_0000039 3300046511 Bacteria 123195
648 Ga0495608_0014158 3300046511 Bacteria 5533
649 Ga0495608_0087404 3300046511 Bacteria 2019
650 Ga0495610_0004508 3300046512 Bacteria 10261
651 Ga0495610_0018167 3300046512 Bacteria 3979
652 Ga0495610_0036524 3300046512 Bacteria 2509
653 Ga0495616_0003008 3300046513 Bacteria 10938
654 Ga0495616_0020999 3300046513 Bacteria 3545
655 Ga0495616_0029325 3300046513 Bacteria 2906
656 Ga0495618_0006968 3300046514 Bacteria 6847
657 Ga0495618_0011419 3300046514 Bacteria 5386
658 Ga0495618_0027293 3300046514 Bacteria 3555
659 Ga0495618_0115763 3300046514 Bacteria 1716
660 Ga0495620_0027062 3300046515 Bacteria 2688
661 Ga0495620_0077855 3300046515 Bacteria 1345
662 Ga0495628_0000219 3300046516 Bacteria 50121
663 Ga0495628_0060553 3300046516 Bacteria 2970
664 Ga0495628_0066063 3300046516 Bacteria 2827
665 Ga0495630_0010651 3300046517 Bacteria 6636
666 Ga0495630_0020684 3300046517 Bacteria 4854
667 Ga0495630_0124467 3300046517 Bacteria 1956
668 Ga0495631_0001618 3300046518 Bacteria 13460
669 Ga0495632_0005336 3300046519 Bacteria 8522
670 Ga0495632_0067573 3300046519 Bacteria 1723
671 Ga0495637_0002281 3300046520 Bacteria 10629
672 Ga0495637_0012132 3300046520 Bacteria 4126
673 Ga0495637_0021286 3300046520 Bacteria 2975
674 Ga0495637_0042922 3300046520 Bacteria 1932
675 Ga0495643_0008330 3300046522 Bacteria 6576
676 Ga0495643_0010743 3300046522 Bacteria 5623
677 Ga0495644_0001628 3300046523 Bacteria 9152
678 Ga0495644_0002235 3300046523 Bacteria 7743
679 Ga0495644_0046263 3300046523 Bacteria 1635
680 Ga0495648_0007519 3300046524 Bacteria 8712
681 Ga0495648_0033872 3300046524 Bacteria 3331
682 Ga0495648_0065028 3300046524 Bacteria 2146
683 Ga0495666_0006631 3300046526 Bacteria 5821
684 Ga0495666_0022579 3300046526 Bacteria 3115
685 Ga0495666_0026794 3300046526 Bacteria 2838
686 Ga0495642_0000428 3300046528 Bacteria 22248
687 Ga0495652_0000092 3300046529 Bacteria 96258
688 Ga0495652_0037800 3300046529 Bacteria 4185
689 Ga0495652_0045158 3300046529 Bacteria 3790
690 Ga0495652_0068985 3300046529 Bacteria 2961
691 Ga0495652_0188511 3300046529 Bacteria 1576
692 Ga0495654_0007588 3300046530 Bacteria 6043
693 Ga0495654_0043981 3300046530 Bacteria 2211
694 Ga0495654_0046945 3300046530 Bacteria 2124
695 Ga0495665_0000931 3300046531 Bacteria 15431
696 Ga0495640_0003021 3300046533 Bacteria 13541
697 Ga0495640_0053602 3300046533 Bacteria 2765
698 Ga0495640_0088024 3300046533 Bacteria 2053
699 Ga0495586_0020777 3300046535 Bacteria 3497
700 Ga0495586_0091452 3300046535 Bacteria 1681
701 Ga0495586_0133961 3300046535 Bacteria 1388
702 Ga0495586_0356496 3300046535 Bacteria 840
703 Ga0495587_0000034 3300046536 Bacteria 123432
704 Ga0495587_0004722 3300046536 Bacteria 8939
705 Ga0495587_0013395 3300046536 Bacteria 5155
706 Ga0495587_0018099 3300046536 Bacteria 4369
707 Ga0495587_0123893 3300046536 Bacteria 1479
708 Ga0495597_0028272 3300046542 Bacteria 2566
709 Ga0495597_0034605 3300046542 Bacteria 2282
710 Ga0495597_0210960 3300046542 Bacteria 774
711 Ga0495645_0027269 3300046543 Bacteria 4148
712 Ga0495645_0076341 3300046543 Bacteria 2411
713 Ga0495645_0160390 3300046543 Bacteria 1555
714 Ga0495622_0045856 3300046557 Bacteria 2031
715 Ga0495622_0058486 3300046557 Bacteria 1785
716 Ga0495633_0021998 3300046558 Bacteria 3180
717 Ga0495667_0000150 3300046559 Bacteria 47612
718 Ga0495667_0006215 3300046559 Bacteria 8090
719 Ga0495667_0040918 3300046559 Bacteria 3074
720 Ga0495667_0053657 3300046559 Bacteria 2654
721 Ga0495667_0113671 3300046559 Bacteria 1749
722 Ga0495668_0002481 3300046616 Bacteria 15151
723 Ga0495668_0011313 3300046616 Bacteria 5352
724 Ga0495634_0007167 3300046642 Bacteria 8407
725 Ga0495634_0019820 3300046642 Bacteria 4774
726 Ga0495635_0000138 3300046663 Bacteria 44247
727 Ga0495635_0058140 3300046663 Bacteria 2660
728 Ga0495635_0417361 3300046663 Bacteria 890
729 Ga0495661_0002061 3300046665 Bacteria 15772
730 Ga0495661_0024627 3300046665 Bacteria 3896
731 Ga0495661_0033827 3300046665 Bacteria 3221
732 Ga0495661_0253666 3300046665 Bacteria 897
733 Ga0495588_0050781 3300046674 Bacteria 2134
734 Ga0495657_0000247 3300046675 Bacteria 49117
735 Ga0495657_0024301 3300046675 Bacteria 4319
736 Ga0495657_0025714 3300046675 Bacteria 4177
737 Ga0495657_0071500 3300046675 Bacteria 2264
738 Ga0495599_0000108 3300046678 Bacteria 56078
739 Ga0495599_0024326 3300046678 Bacteria 3787
740 Ga0495599_0036727 3300046678 Bacteria 3077
741 Ga0495623_0000287 3300046679 Bacteria 32946
742 Ga0495623_0037083 3300046679 Bacteria 3122
743 Ga0495623_0107845 3300046679 Bacteria 1691
744 Ga0495646_0010019 3300046680 Bacteria 6025
745 Ga0495646_0015574 3300046680 Bacteria 4824
746 Ga0495646_0029848 3300046680 Bacteria 3405
747 Ga0495646_0032537 3300046680 Bacteria 3245
748 Ga0495646_0032903 3300046680 Bacteria 3224
749 Ga0495658_0006740 3300046683 Bacteria 5649
750 Ga0495613_0029608 3300046689 Bacteria 4069
751 Ga0495613_0062281 3300046689 Bacteria 2730
752 Ga0495624_0011849 3300046690 Bacteria 5981
753 Ga0495624_0021948 3300046690 Bacteria 4227
754 Ga0495671_0005316 3300046692 Bacteria 7558
755 Ga0495671_0014377 3300046692 Bacteria 4262
756 Ga0495671_0024497 3300046692 Bacteria 3142
757 Ga0495671_0030848 3300046692 Bacteria 2742
758 Ga0495671_0035610 3300046692 Bacteria 2526
759 Ga0495649_0005895 3300046694 Bacteria 7688
760 Ga0495649_0040098 3300046694 Bacteria 2566
761 Ga0495649_0278842 3300046694 Bacteria 854
762 Ga0495589_0056156 3300046794 Bacteria 1938
763 Ga0495600_0008104 3300046809 Bacteria 6444
764 Ga0495600_0018909 3300046809 Bacteria 4396
765 Ga0495600_0025206 3300046809 Bacteria 3832
766 Ga0495600_0043831 3300046809 Bacteria 2918
767 Ga0495600_0078534 3300046809 Bacteria 2155
768 Ga0495660_0034921 3300046810 Bacteria 2811
769 Ga0495660_0035259 3300046810 Bacteria 2796
770 Ga0495660_0041381 3300046810 Bacteria 2551
771 Ga0495581_0000404 3300047315 Bacteria 21732
772 Ga0495604_0000039 3300047317 Bacteria 123431
773 Ga0495604_0014132 3300047317 Bacteria 6366
774 Ga0495604_0042395 3300047317 Bacteria 3566
775 Ga0495604_0054659 3300047317 Bacteria 3080
776 Ga0495674_0000235 3300047319 Bacteria 46762
777 Ga0495674_0032287 3300047319 Bacteria 4749
778 Ga0495674_0069294 3300047319 Bacteria 3050
779 Ga0495674_0119497 3300047319 Bacteria 2227
780 Ga0495674_0220167 3300047319 Bacteria 1569
781 Ga0495672_0006489 3300047320 Bacteria 9046
782 Ga0495672_0011761 3300047320 Bacteria 6155
783 Ga0495672_0021657 3300047320 Bacteria 4189
784 Ga0495672_0025137 3300047320 Bacteria 3819
785 Ga0495672_0035999 3300047320 Bacteria 3043
786 Ga0495676_0009006 3300047321 Bacteria 9108
787 Ga0495680_0000028 3300047322 Bacteria 112865
788 Ga0495680_0022902 3300047322 Bacteria 5201
789 Ga0495680_0067062 3300047322 Bacteria 2744
790 Ga0495680_0067307 3300047322 Bacteria 2738
791 Ga0495680_0089168 3300047322 Bacteria 2315
792 Ga0495680_0093239 3300047322 Bacteria 2254
793 Ga0495680_0131031 3300047322 Bacteria 1842
794 Ga0495683_0001139 3300047323 Bacteria 18304
795 Ga0495683_0003272 3300047323 Bacteria 9466
796 Ga0495687_011902 3300047443 Bacteria 4644
797 Ga0495675_0000355 3300047444 Bacteria 32066
798 Ga0495675_0025159 3300047444 Bacteria 3796
799 Ga0495675_0062657 3300047444 Bacteria 2354
800 Ga0495673_0002014 3300047469 Bacteria 14940
801 Ga0495673_0006091 3300047469 Bacteria 7162
802 Ga0495673_0033665 3300047469 Bacteria 2375
803 Ga0495681_0001437 3300047470 Bacteria 17881
804 Ga0495681_0004955 3300047470 Bacteria 8985
805 Ga0495681_0008404 3300047470 Bacteria 6480
806 Ga0495681_0041839 3300047470 Bacteria 2222
807 Ga0495684_0000154 3300047471 Bacteria 50763
808 Ga0495684_0031991 3300047471 Bacteria 4038
809 Ga0495686_0011501 3300047472 Bacteria 6233
810 Ga0495686_0063105 3300047472 Bacteria 2296
811 Ga0495593_0007879 3300047673 Bacteria 6201
812 Ga0495593_0047235 3300047673 Bacteria 2290
813 Ga0495593_0053990 3300047673 Bacteria 2119
814 Ga0495602_0000043 3300048088 Bacteria 123431
815 Ga0495602_0047998 3300048088 Bacteria 3842
816 Ga0495602_0095634 3300048088 Bacteria 2452
817 Ga0495614_0040246 3300048089 Bacteria 2006
818 Ga0495626_0001346 3300048091 Bacteria 19873
819 Ga0495626_0002001 3300048091 Bacteria 15031
820 Ga0495626_0004960 3300048091 Bacteria 7980
821 Ga0495626_0020224 3300048091 Bacteria 3319
822 Ga0496100_0075070 3300048903 Bacteria 2266
823 Ga0496100_0195252 3300048903 Bacteria 1472
824 Ga0496100_0250681 3300048903 Bacteria 1309
825 Ga0496101_0026411 3300048904 Bacteria 4037
826 Ga0496101_0093592 3300048904 Bacteria 2239
827 Ga0496102_0007449 3300048905 Bacteria 9353
828 Ga0496103_0079345 3300048906 Bacteria 2062
829 Ga0496104_0005365 3300048907 Bacteria 11220
830 Ga0496104_0131346 3300048907 Bacteria 2405
831 Ga0496105_0076305 3300048908 Bacteria 2767
832 Ga0496105_0172308 3300048908 Bacteria 1774
833 Ga0496105_0190167 3300048908 Bacteria 1679
834 Ga0496106_0015803 3300048909 Bacteria 5583
835 Ga0496107_0236872 3300048910 Bacteria 1358
836 Ga0496107_0323519 3300048910 Bacteria 1147
837 Ga0496108_0009911 3300048911 Bacteria 7723
838 Ga0496108_0191706 3300048911 Bacteria 1771
839 Ga0496108_0368036 3300048911 Bacteria 1255
840 Ga0496109_0117152 3300048912 Bacteria 2479
841 Ga0496109_0258255 3300048912 Bacteria 1641
842 Ga0496110_0057350 3300048913 Bacteria 3428
843 Ga0496110_0342610 3300048913 Bacteria 1361
844 Ga0496111_0042240 3300048914 Bacteria 3273
845 Ga0496111_0129812 3300048914 Bacteria 1864
846 Ga0496112_0119785 3300048915 Bacteria 2602
847 Ga0496112_0121149 3300048915 Bacteria 2585
848 Ga0496112_0431751 3300048915 Bacteria 1255
849 Ga0496112_0498617 3300048915 Bacteria 1153
850 Ga0496113_0121646 3300048916 Bacteria 2041
851 Ga0496113_0123556 3300048916 Bacteria 2025
852 Ga0496113_0223781 3300048916 Bacteria 1500
853 Ga0496114_0054914 3300048917 Bacteria 3321
854 Ga0496115_0036854 3300048918 Bacteria 3873
855 Ga0496115_0061608 3300048918 Bacteria 3025
856 Ga0496116_0000126 3300048919 Bacteria 160425
857 Ga0496117_0000950 3300048920 Bacteria 44286
858 Ga0496117_0028769 3300048920 Bacteria 4297
859 Ga0496118_0055353 3300048921 Bacteria 2994
860 Ga0496119_0035855 3300048922 Bacteria 3243
861 Ga0496119_0115723 3300048922 Bacteria 1481
862 Ga0496119_0197243 3300048922 Bacteria 1044
863 Ga0496121_0000142 3300048924 Bacteria 160072
864 Ga0496122_0060191 3300048925 Bacteria 2798
865 Ga0496123_0011472 3300048926 Bacteria 7676
866 Ga0496123_0092143 3300048926 Bacteria 1794
867 Ga0496124_0115771 3300048927 Bacteria 2150
868 Ga0496126_0004789 3300048929 Bacteria 15903
869 Ga0496126_0013912 3300048929 Bacteria 8163
870 Ga0496126_0167728 3300048929 Bacteria 1873
871 Ga0496126_0287593 3300048929 Bacteria 1360
872 Ga0495678_011256 3300049459 Bacteria 4293
873 Ga0495678_013240 3300049459 Bacteria 3880
874 Ga0501031_0051723 3300049568 Bacteria 2676
875 Ga0501031_0183172 3300049568 Bacteria 1368
876 Ga0501037_0072516 3300049573 Bacteria 2504
877 Ga0501038_0194556 3300049574 Bacteria 1630
878 Ga0501039_0006861 3300049575 Bacteria 8663
879 Ga0501040_0000259 3300049576 Bacteria 30940
880 Ga0501040_0256415 3300049576 Bacteria 1248
881 Ga0501041_0000491 3300049577 Bacteria 20231
882 Ga0501042_0001520 3300049578 Bacteria 13731
883 Ga0501042_0070913 3300049578 Bacteria 2493
884 Ga0501043_0015672 3300049579 Bacteria 5941
885 Ga0501046_0000713 3300049580 Bacteria 32092
886 Ga0501047_0322907 3300049581 Bacteria 1383
887 Ga0501048_0002303 3300049582 Bacteria 14567
888 Ga0501068_0071819 3300049584 Bacteria 2113
889 Ga0501069_0044365 3300049585 Bacteria 2461
890 Ga0501070_0417698 3300049586 Bacteria 1084
891 Ga0501071_0017040 3300049587 Bacteria 5004
892 Ga0501072_0012113 3300049588 Bacteria 6587
893 Ga0501073_0221522 3300049589 Bacteria 1307
894 Ga0501075_0000854 3300049591 Bacteria 19222
895 Ga0501075_0255294 3300049591 Bacteria 1336
896 Ga0501076_0001606 3300049592 Bacteria 15222
897 Ga0501077_0036972 3300049593 Bacteria 3110
898 Ga0501079_0000169 3300049741 Bacteria 36466
899 Ga0501079_0485785 3300049741 Bacteria 971
900 Ga0501080_0046817 3300049742 Bacteria 4026
901 Ga0501081_0000098 3300049743 Bacteria 36248
902 Ga0501081_0187380 3300049743 Bacteria 1498
903 Ga0501035_0135651 3300049822 Bacteria 2143
904 Ga0501044_0034624 3300049823 Bacteria 5295
905 Ga0501045_0000786 3300049824 Bacteria 20411
906 nmdc:mga03683_126482_c1 3300050489 Bacteria 1140
907 nmdc:mga05p37_18612_c1 3300050507 Bacteria 8394
908 nmdc:mga05p37_38629_c1 3300050507 Bacteria 5856
909 nmdc:mga05p37_70517_c1 3300050507 Bacteria 4298
910 nmdc:mga05p37_7776_c1 3300050507 Bacteria 12660
911 nmdc:mga0qj67_38929_c1 3300050509 Bacteria 3732
912 nmdc:mga06r32_132293_c1 3300050510 Bacteria 2468
913 nmdc:mga08y16_17674_c1 3300050511 Bacteria 7512
914 nmdc:mga08y16_247542_c1 3300050511 Bacteria 1842
915 nmdc:mga08y16_293788_c1 3300050511 Bacteria 1675
916 nmdc:mga08y16_77951_c1 3300050511 Bacteria 3455
917 nmdc:mga08y16_89210_c1 3300050511 Bacteria 3213
918 nmdc:mga0n895_26402_c1 3300050512 Bacteria 5499
919 nmdc:mga0n895_6961_c1 3300050512 Bacteria 9652
920 nmdc:mga0rr50_147025_c1 3300050513 Bacteria 1901
921 nmdc:mga0rr50_62244_c1 3300050513 Bacteria 2814
922 nmdc:mga0rr50_78829_c1 3300050513 Bacteria 2536
923 nmdc:mga08x19_11539_c1 3300050514 Bacteria 5318
924 nmdc:mga08x19_2303_c1 3300050514 Bacteria 11606
925 nmdc:mga0a205_2379_c1 3300050515 Bacteria 16569
926 nmdc:mga0a205_30481_c1 3300050515 Bacteria 5165
927 Ga0495601_0022434 3300053077 Bacteria 3874
928 Ga0495601_0169459 3300053077 Bacteria 1427
929 Ga0495601_0375338 3300053077 Bacteria 923
930 Ga0495612_0020306 3300053078 Bacteria 2662
931 Ga0495595_0018766 3300053084 Bacteria 2992
932 Ga0495595_0030064 3300053084 Bacteria 2434
933 Ga0495619_0056692 3300053085 Bacteria 2598
934 Ga0495619_0063108 3300053085 Bacteria 2467
935 Ga0500559_0007699 3300053136 Bacteria 4755
936 Ga0501084_0006102 3300054114 Bacteria 9907
937 Ga0590071_021000 3300059421 Bacteria 1538
938 Ga0590074_005145 3300059423 Bacteria 2161
939 Ga0590075_003397 3300059424 Bacteria 3790
940 Ga0590077_004808 3300059426 Bacteria 2763
941 Ga0501082_0001871 3300060353 Bacteria 18521
942 Ga0530510_0141306 3300061734 Bacteria 1774
943 2511265945 2511231006 Bacteria 6794709
944 2511279114 2511231008 Bacteria 6624100
945 2511294909 2511231011 Bacteria 6149768
946 2511302970 2511231012 Bacteria 6738011
947 2511313718 2511231014 Bacteria 6462302
948 2511320391 2511231015 Bacteria 6598026
949 2511324095 2511231016 Bacteria 6704427
950 2511330550 2511231017 Bacteria 6503007
951 2511336621 2511231018 Bacteria 6436256
952 2511344045 2511231019 Bacteria 6520662
953 2511353297 2511231020 Bacteria 6115223
954 2511355184 2511231021 Bacteria 7302637
955 2511823330 2511231156 Bacteria 6845832
956 2512326395 2512047018 Bacteria 6663241
957 2555668298 2554235341 Bacteria 6867980
958 2583790721 2582580891 Bacteria 6800976
959 2597856513 2597489887 Bacteria 6666321
960 2597862623 2597489888 Bacteria 6179543
961 2599355299 2599185160 Bacteria 6844013
962 2599360878 2599185161 Bacteria 6960462
963 2599367200 2599185162 Bacteria 6957254
964 2599373990 2599185163 Bacteria 6995158
965 2599380405 2599185164 Bacteria 6841688
966 2599386852 2599185165 Bacteria 6843250
967 2599392848 2599185166 Bacteria 6959206
968 2599404615 2599185168 Bacteria 6997636
969 2599462133 2599185181 Bacteria 6844519
970 2599466824 2599185182 Bacteria 6883168
971 2599483234 2599185185 Bacteria 6652270
972 2599490775 2599185186 Bacteria 6831633
973 2599805133 2599185257 Bacteria 6492581
974 2600214755 2599185356 Bacteria 6843884
975 2600363843 2600254931 Bacteria 6734225
976 2601774540 2600255313 Bacteria 6842543
977 2643845291 2643221565 Bacteria 6216018
978 2643952056 2643221589 Bacteria 6250934
979 2644024185 2643221602 Bacteria 6249926
980 2671097901 2667528171 Bacteria 6900659
981 2671768133 2671180172 Bacteria 6495783
982 2723247506 2721755607 Bacteria 5841722
983 2739198627 2738543004 Bacteria 6381073
984 2739256612 2738543015 Bacteria 6750701
985 2743735929 2740892503 Bacteria 6855563
986 2774136108 2773857673 Bacteria 6513460
987 2784260181 2784132063 Bacteria 6262788
988 2819702985 2818991464 Bacteria 6907494
989 2834029307 2834028612 Bacteria 6354979
990 2837186548 2837183177 Bacteria 4637169
991 2844668820 2844665904 Bacteria 6817974
992 2852658594 2852657418 Bacteria 6472974
993 2860340391 2860339153 Bacteria 6846989
994 2880231973 2880230671 Bacteria 6140320
995 2904521013 2904518522 Bacteria 6068986
996 2904551645 2904550169 Bacteria 6221258
997 2917072065 2917070673 Bacteria 6868303
998 2919458049 2919456309 Bacteria 6586567
999 2923154939 2923153595 Bacteria 6870622
1000 2931399704 2931396565 Bacteria 7251677
1001 2935354237 2935353572 Unclassified 6955622
1002 2939637819 2939636861 Bacteria 6297853
1003 2945929256 2945928738 Bacteria 6053221
1004 2945961578 2945961074 Bacteria 7342064
1005 2947236140 2947233263 Bacteria 6439278
1006 2984291092 2984286254 Bacteria 6702062
1007 3007512678 3007511990 Bacteria 6481491
1008 3007855917 3007855910 Bacteria 5637581
1009 3007863458 3007861166 Bacteria 6045338
1010 637318660 637000220 Bacteria 7074893
1011 8015689171 8015687852 Bacteria 6613826
1012 8055772291 8055770955 Bacteria 6827675
1013 8056127348 8056125926 Bacteria 6228218
1014 8056149500 8056148874 Bacteria 6479865
1015 8056164665 8056161164 Bacteria 6106669
1016 8056180314 8056177738 Bacteria 6748268
1017 8056569969 8056569372 Bacteria 5997322
1018 Ga0070698_100035428
1019 RicEn_FSXC49909_b1
1020 JGI25162J39368_1000054
1021 JGI25162J39368_1000898
1022 JGI25163J39215_1000269
1023 JGI25163J39215_1000348
1024 JGI25164J39214_1000029
1025 JGI25164J39214_1000492
1026 JGI25406J46586_10040029
1027 JGI25165J46597_1000111
1028 JGI25165J46597_1000934
1029 Ga0055538_1000082
1030 Ga0055539_1000121
1031 Ga0055533_1000129
1032 Ga0055532_1000104
1033 Ga0055525_1000167
1034 Ga0055535_1011188
1035 Ga0055536_1000043
1036 Ga0055530_10000031
1037 Ga0055530_10012647
1038 Ga0055540_1000230
1039 Ga0055541_1000081
1040 Ga0065714_10067038
1041 Ga0065714_10105108
1042 Ga0065704_10013836
1043 Ga0065712_10075189
1044 Ga0065712_10236500
1045 Ga0070658_10019937
1046 Ga0070658_10201648
1047 Ga0070676_10195870
1048 Ga0070683_100009609
1049 Ga0070683_100014648
1050 Ga0070683_100094011
1051 Ga0070690_100065637
1052 Ga0070670_100001105
1053 Ga0068869_100011134
1054 Ga0070666_10030938
1055 Ga0070680_100012295
1056 Ga0070680_100077510
1057 Ga0070682_100037829
1058 Ga0070682_100052820
1059 Ga0068868_100001991
1060 Ga0068868_100027562
1061 Ga0070660_100023571
1062 Ga0070660_100029658
1063 Ga0070689_100049302
1064 Ga0070691_10104061
1065 Ga0070661_100000238
1066 Ga0070661_100013386
1067 Ga0070661_100071326
1068 Ga0070692_10004915
1069 Ga0070692_10037485
1070 Ga0070675_100010129
1071 Ga0070675_100011148
1072 Ga0070675_100225662
1073 Ga0070671_100099650
1074 Ga0070659_100026111
1075 Ga0070667_100111973
1076 Ga0070703_10013256
1077 Ga0070709_10000165
1078 Ga0070709_10045199
1079 Ga0070709_10076782
1080 Ga0070714_100000318
1081 Ga0070714_100000491
1082 Ga0070714_100009563
1083 Ga0070714_100300400
1084 Ga0070713_100001888
1085 Ga0070713_100099934
1086 Ga0070713_100411201
1087 Ga0070710_10000171
1088 Ga0070710_10034420
1089 Ga0070701_10138883
1090 Ga0070711_100000158
1091 Ga0070711_100309139
1092 Ga0070705_100111868
1093 Ga0070700_100143178
1094 Ga0070708_100001234
1095 Ga0070708_100030905
1096 Ga0070708_100044212
1097 Ga0070708_100440245
1098 Ga0070663_100052924
1099 Ga0070663_100312069
1100 Ga0070678_100013597
1101 Ga0070662_100021530
1102 Ga0070681_10047709
1103 Ga0070681_10183344
1104 Ga0070706_100002363
1105 Ga0070706_100020520
1106 Ga0070706_100029550
1107 Ga0070706_100087323
1108 Ga0070706_100138562
1109 Ga0070706_100394203
1110 Ga0070706_100706871
1111 Ga0070707_100000043
1112 Ga0070707_100002621
1113 Ga0070707_100020775
1114 Ga0070698_100000072
1115 Ga0070698_100000309
1116 Ga0070698_100013936
1117 Ga0070698_100014678
1118 Ga0070698_100036356
1119 Ga0070698_100092722
1120 Ga0070698_100134816
1121 Ga0070698_100180439
1122 Ga0070699_100000327
1123 Ga0070699_100000511
1124 Ga0070699_100026940
1125 Ga0070699_100046052
1126 Ga0070679_100611638
1127 Ga0070684_100009019
1128 Ga0070684_100016988
1129 Ga0070684_100069498
1130 Ga0070684_100688748
1131 Ga0070697_100005337
1132 Ga0070697_100016026
1133 Ga0070697_100048744
1134 Ga0070697_100127541
1135 Ga0068853_100146938
1136 Ga0070672_100108524
1137 Ga0070672_100145396
1138 Ga0070672_100435153
1139 Ga0070695_100095391
1140 Ga0070696_100013244
1141 Ga0070693_100096109
1142 Ga0070665_100003764
1143 Ga0070665_100122001
1144 Ga0070704_100128359
1145 Ga0068855_100022092
1146 Ga0070664_100000233
1147 Ga0070664_100001873
1148 Ga0070664_100031400
1149 Ga0070664_100159109
1150 Ga0068854_100010679
1151 Ga0068854_100260934
1152 Ga0068856_100018845
1153 Ga0068856_100486766
1154 Ga0070702_100024285
1155 Ga0070702_100037783
1156 Ga0068852_100185902
1157 Ga0068852_100639550
1158 Ga0068859_100272285
1159 Ga0068864_100352665
1160 Ga0068866_10059537
1161 Ga0068861_100343950
1162 Ga0068870_10340566
1163 Ga0068863_100129348
1164 Ga0068863_100161810
1165 Ga0068858_100205390
1166 Ga0068862_100084635
1167 Ga0068862_100168792
1168 Ga0081455_10051524
1169 Ga0081538_10002736
1170 Ga0081538_10031123
1171 Ga0081538_10047439
1172 Ga0081540_1000058
1173 Ga0081540_1035917
1174 Ga0081539_10004989
1175 Ga0081539_10063447
1176 Ga0081539_10077649
1177 Ga0070717_10010134
1178 Ga0070717_10042228
1179 Ga0070717_10124015
1180 Ga0070717_10426270
1181 Ga0075364_10069297
1182 Ga0075364_10085457
1183 Ga0075432_10106405
1184 Ga0070715_10035075
1185 Ga0070715_10041047
1186 Ga0070715_10059314
1187 Ga0070715_10267315
1188 Ga0070716_100000117
1189 Ga0070716_100083695
1190 Ga0070712_100000698
1191 Ga0070712_100092217
1192 Ga0070712_100208782
1193 Ga0070712_100233212
1194 Ga0075362_10050309
1195 Ga0075362_10118949
1196 Ga0075369_10022141
1197 Ga0097621_100114765
1198 Ga0075430_100000242
1199 Ga0075433_10021690
1200 Ga0075433_10023853
1201 Ga0075433_10077482
1202 Ga0075434_100241998
1203 Ga0075434_100322222
1204 Ga0075434_100357969
1205 Ga0075429_100200583
1206 Ga0068865_100120726
1207 Ga0068865_100169640
1208 Ga0075436_100007086
1209 Ga0075436_100094554
1210 Ga0075436_100111279
1211 Ga0097620_100272279
1212 Ga0079104_1000090
1213 Ga0075435_100102834
1214 Ga0075435_100120359
1215 Ga0075435_100181404
1216 Ga0105251_10003475
1217 Ga0105251_10035329
1218 Ga0105244_10005915
1219 Ga0105244_10006512
1220 Ga0105244_10023824
1221 Ga0105244_10150148
1222 Ga0105244_10159899
1223 Ga0105250_10000118
1224 Ga0105250_10006019
1225 Ga0105240_10206032
1226 Ga0111539_10010281
1227 Ga0111539_10021897
1228 Ga0111539_10089795
1229 Ga0105245_10003051
1230 Ga0105245_10014691
1231 Ga0105245_10844323
1232 Ga0114129_10025453
1233 Ga0114129_10057100
1234 Ga0114129_10100917
1235 Ga0114129_10144111
1236 Ga0105243_10001057
1237 Ga0105243_10044066
1238 Ga0105243_10065747
1239 Ga0105241_10221796
1240 Ga0105242_10000719
1241 Ga0105248_10303828
1242 Ga0105237_10005805
1243 Ga0105237_10661472
1244 Ga0105237_10840213
1245 Ga0105249_10041983
1246 Ga0105249_10044788
1247 Ga0105249_10099711
1248 Ga0105239_10107507
1249 Ga0105239_10659537
1250 Ga0105246_10003807
1251 Ga0157341_1000951
1252 Ga0157373_10023566
1253 Ga0157371_10000281
1254 Ga0157371_10000795
1255 Ga0157371_10112028
1256 Ga0157370_10028864
1257 Ga0157370_10044828
1258 Ga0157370_10055729
1259 Ga0157370_10130059
1260 Ga0157370_10189187
1261 Ga0157370_10316657
1262 Ga0157370_10435631
1263 Ga0157369_10003643
1264 Ga0157369_10046415
1265 Ga0157369_10249186
1266 Ga0157374_10029085
1267 Ga0157378_10199580
1268 Ga0157378_10403033
1269 Ga0163162_10075157
1270 Ga0163162_10147706
1271 Ga0157372_10058127
1272 Ga0157372_10567437
1273 Ga0157372_10572220
1274 Ga0157375_10012550
1275 Ga0157375_10029601
1276 Ga0163163_10033119
1277 Ga0163163_10142794
1278 Ga0182008_10000138
1279 Ga0182008_10001875
1280 Ga0182008_10013562
1281 Ga0182008_10030510
1282 Ga0182008_10035864
1283 Ga0157377_10000891
1284 Ga0157377_10028128
1285 Ga0157377_10198172
1286 Ga0157379_10242291
1287 Ga0157376_10067112
1288 Ga0182006_1000816
1289 Ga0182006_1024437
1290 Ga0163161_10054201
1291 Ga0163161_10353522
1292 Ga0163161_10715418
1293 Ga0197907_11173906
1294 Ga0206356_10219634
1295 Ga0206356_11376920
1296 Ga0206349_1693199
1297 Ga0206355_1544356
1298 Ga0206351_10449033
1299 Ga0206351_10726113
1300 Ga0206352_10696447
1301 Ga0206350_10260968
1302 Ga0206350_10760667
1303 Ga0206354_11479794
1304 Ga0206353_11923273
1305 Ga0213874_10100649
1306 Ga0213875_10000817
1307 Ga0213875_10002595
1308 Ga0213875_10027419
1309 Ga0213875_10052067
1310 Ga0224712_10019502
1311 Ga0224712_10022965
1312 Ga0228600_1004353
1313 Ga0224572_1017256
1314 Ga0228598_1014646
1315 Ga0209435_100841
1316 Ga0209760_100015
1317 Ga0209760_100047
1318 Ga0209784_100015
1319 Ga0209566_100012
1320 Ga0209674_100027
1321 Ga0209147_100019
1322 Ga0209563_100031
1323 Ga0207427_100001
1324 Ga0207427_100029
1325 Ga0209437_100003
1326 Ga0209437_100009
1327 Ga0209437_108916
1328 Ga0209258_100250
1329 Ga0209646_1000263
1330 Ga0209677_100016
1331 Ga0209233_1000007
1332 Ga0209233_1000032
1333 Ga0209676_1000080
1334 Ga0209676_1002060
1335 Ga0209050_1000117
1336 Ga0209050_1001134
1337 Ga0209051_1000077
1338 Ga0209051_1044678
1339 Ga0207696_1000083
1340 Ga0207696_1000111
1341 Ga0207655_1000435
1342 Ga0207655_1002832
1343 Ga0207655_1009325
1344 Ga0207713_1000564
1345 Ga0207713_1003370
1346 Ga0207713_1009675
1347 Ga0207713_1018905
1348 Ga0207692_10000417
1349 Ga0207692_10103992
1350 Ga0207688_10011847
1351 Ga0207647_10034782
1352 Ga0207685_10028209
1353 Ga0207699_10000393
1354 Ga0207699_10112412
1355 Ga0207699_10126686
1356 Ga0207699_10226281
1357 Ga0207699_10301820
1358 Ga0207699_10332698
1359 Ga0207699_10514777
1360 Ga0207645_10140641
1361 Ga0207643_10052734
1362 Ga0207705_10370421
1363 Ga0207684_10025263
1364 Ga0207684_10060661
1365 Ga0207684_10122794
1366 Ga0207684_10295409
1367 Ga0207684_10310995
1368 Ga0207684_10449500
1369 Ga0207707_10125403
1370 Ga0207695_10155316
1371 Ga0207671_10000436
1372 Ga0207693_10000436
1373 Ga0207693_10069329
1374 Ga0207693_10100193
1375 Ga0207693_10195353
1376 Ga0207693_10212783
1377 Ga0207693_10320537
1378 Ga0207663_10000849
1379 Ga0207663_10017821
1380 Ga0207660_10026126
1381 Ga0207662_10009010
1382 Ga0207657_10046321
1383 Ga0207657_10063273
1384 Ga0207657_10265307
1385 Ga0207649_10000002
1386 Ga0207649_10046235
1387 Ga0207652_10043512
1388 Ga0207652_10191547
1389 Ga0207646_10000300
1390 Ga0207646_10000647
1391 Ga0207646_10182531
1392 Ga0207650_10000688
1393 Ga0207650_10427121
1394 Ga0207659_10006861
1395 Ga0207659_10128556
1396 Ga0207687_10019067
1397 Ga0207700_10000029
1398 Ga0207700_10018831
1399 Ga0207700_10062583
1400 Ga0207700_10145287
1401 Ga0207700_10442423
1402 Ga0207664_10000110
1403 Ga0207664_10000648
1404 Ga0207664_10021467
1405 Ga0207664_10049721
1406 Ga0207664_10063647
1407 Ga0207664_10077660
1408 Ga0207664_10245979
1409 Ga0207664_10882095
1410 Ga0207690_10017709
1411 Ga0207706_10031850
1412 Ga0207706_10110318
1413 Ga0207706_10153622
1414 Ga0207686_10005841
1415 Ga0207686_10426664
1416 Ga0207709_10000278
1417 Ga0207709_10115951
1418 Ga0207670_10055126
1419 Ga0207670_10117159
1420 Ga0207704_10017174
1421 Ga0207665_10000373
1422 Ga0207665_10181310
1423 Ga0207691_10015140
1424 Ga0207691_10083715
1425 Ga0207691_10342843
1426 Ga0207711_10073195
1427 Ga0207689_10005561
1428 Ga0207689_10013438
1429 Ga0207661_10052643
1430 Ga0207661_10132814
1431 Ga0207661_10138350
1432 Ga0207661_10180206
1433 Ga0207661_10413065
1434 Ga0207679_10000006
1435 Ga0207679_10002012
1436 Ga0207679_10029241
1437 Ga0207667_10211282
1438 Ga0207667_10261825
1439 Ga0207651_10131438
1440 Ga0207712_10049637
1441 Ga0207712_10157878
1442 Ga0207668_10120500
1443 Ga0207677_10004672
1444 Ga0207677_10040589
1445 Ga0207703_10170951
1446 Ga0207703_10416909
1447 Ga0207639_10261275
1448 Ga0207678_10016455
1449 Ga0207678_10032732
1450 Ga0207678_10075576
1451 Ga0207678_10082743
1452 Ga0207678_10108638
1453 Ga0207708_10000996
1454 Ga0207708_10007569
1455 Ga0207708_10182793
1456 Ga0207702_10013428
1457 Ga0207702_10458040
1458 Ga0207702_10490259
1459 Ga0207702_10873376
1460 Ga0207641_10334723
1461 Ga0207676_10515891
1462 Ga0207674_10006879
1463 Ga0207674_10016534
1464 Ga0207674_10090524
1465 Ga0207675_100007636
1466 Ga0207675_100093909
1467 Ga0207675_100569009
1468 Ga0207683_10056035
1469 Ga0207698_10134046
1470 Ga0207698_10352174
1471 Ga0209281_1000013
1472 Ga0207428_10000812
1473 Ga0207428_10004869
1474 Ga0207428_10039803
1475 Ga0207428_10068592
1476 Ga0207428_10346945
1477 Ga0268266_10007082
1478 Ga0268266_10075054
1479 Ga0265338_10006561
1480 Ga0265338_10007488
1481 Ga0307408_100142179
1482 Ga0307405_10003598
1483 Ga0307405_10157063
1484 Ga0307405_10543652
1485 Ga0307413_10108739
1486 Ga0307410_10022469
1487 Ga0307410_10172960
1488 Ga0307406_10084601
1489 Ga0307406_10178130
1490 Ga0307407_10030629
1491 Ga0307407_10206786
1492 Ga0307412_10049010
1493 Ga0307412_10236064
1494 Ga0307412_10704490
1495 Ga0307409_100015263
1496 Ga0307409_100021793
1497 Ga0307409_100071849
1498 Ga0307409_100120183
1499 Ga0307416_100091653
1500 Ga0307416_100102301
1501 Ga0307416_100176671
1502 Ga0307416_100238620
1503 Ga0307414_10180218
1504 Ga0307411_10024540
1505 Ga0307415_100006263
1506 Ga0307415_100030121
1507 Ga0307415_100048505
1508 Ga0307415_100075844
1509 Ga0307415_100090373
1510 Ga0307415_100490796
1511 Ga0316214_1001620
1512 Ga0373938_0013766
1513 Ga0373926_0003618
1514 Ga0373926_0003710
1515 Ga0373934_0000109
1516 Ga0373934_0022882
1517 Ga0373944_0001446
1518 Ga0373944_0004430
1519 Ga0373923_0011379
1520 Ga0373936_0001004
1521 Ga0373936_0004893
1522 Ga0373939_0003160
1523 Ga0373945_0000108
1524 Ga0373945_0003095
1525 Ga0373953_0000026
1526 Ga0373954_0010979
1527 Ga0373954_0024558
1528 Ga0373956_0136421
1529 Ga0373957_0000038
1530 Ga0373957_0003809
1531 Ga0373957_0021745
1532 Ga0373943_0003488
1533 Ga0373943_0024808
1534 Ga0373946_0000230
1535 Ga0373946_0003046
1536 Ga0373946_0146904
1537 Ga0373955_0000231
1538 Ga0373955_0006961
1539 Ga0373942_0013079
1540 Ga0373961_0008464
1541 Ga0373924_0000552
1542 Ga0373924_0002765
1543 Ga0373924_0039585
1544 Ga0373931_0028944
1545 Ga0373931_0242866
1546 Ga0373935_0001927
1547 Ga0373935_0023072
1548 Ga0373927_0004889
1549 Ga0373927_0007315
1550 Ga0373927_0065039
1551 Ga0373933_0000839
1552 Ga0373933_0055048
1553 Ga0373933_0240244
1554 Ga0373933_0286178
1555 Ga0373947_0018091
1556 Ga0373947_0113656
1557 Ga0373937_0000138
1558 Ga0373937_0088273
1559 Ga0373937_0094483
1560 Ga0373937_0099086
1561 Ga0373937_0117684
1562 Ga0372808_006474
1563 Ga0373925_0000699
1564 Ga0373925_0008741
1565 Ga0373925_0045005
1566 Ga0373925_0186342
1567 Ga0395900_0135703
1568 Ga0395898_0115475
1569 Ga0436364_0151261
1570 Ga0436364_0207639
1571 Ga0436364_0232843
1572 Ga0436364_0754028
1573 Ga0436364_0795184
1574 Ga0436364_1116138
1575 Ga0436364_1223164
1576 Ga0395901_0048266
1577 Ga0436365_0054221
1578 Ga0436361_0657470
1579 Ga0439447_007210
1580 Ga0439466_0001571
1581 Ga0439466_0001845
1582 Ga0439466_0025576
1583 Ga0451853_2100055
1584 Ga0439448_0095320
1585 Ga0439448_0103761
1586 Ga0439432_000245
1587 Ga0439452_002580
1588 Ga0439452_009166
1589 Ga0439463_001106
1590 Ga0439463_028790
1591 Ga0450922_003435
1592 Ga0450905_036016
1593 Ga0450907_005187
1594 Ga0450910_000560
1595 Ga0439444_0070726
1596 Ga0439464_0055042
1597 Ga0439460_0033491
1598 Ga0439440_0040338
1599 Ga0466963_0017103
1600 Ga0466964_0211351
1601 Ga0466957_0189130
1602 Ga0466959_0027665
1603 Ga0466958_0074021
1604 Ga0466958_0105241
1605 Ga0466967_0039747
1606 Ga0466967_0194952
1607 Ga0495617_001821
1608 Ga0495617_021565
1609 Ga0495627_001278
1610 Ga0495592_0000041
1611 Ga0495592_0078539
1612 Ga0495592_0084568
1613 Ga0495603_0023997
1614 Ga0495603_0064612
1615 Ga0495590_0002024
1616 Ga0495590_0009714
1617 Ga0495591_001556
1618 Ga0495591_017215
1619 Ga0495629_0012281
1620 Ga0495638_0006808
1621 Ga0495638_0007153
1622 Ga0495638_0028702
1623 Ga0495641_0008055
1624 Ga0495651_0000018
1625 Ga0495651_0006316
1626 Ga0495651_0029577
1627 Ga0495651_0076090
1628 Ga0495653_0003023
1629 Ga0495653_0010353
1630 Ga0495653_0020353
1631 Ga0495653_0032425
1632 Ga0495653_0125368
1633 Ga0495653_0385863
1634 Ga0495650_0003766
1635 Ga0495650_0004163
1636 Ga0495650_0016994
1637 Ga0495580_0021796
1638 Ga0495582_0006199
1639 Ga0495582_0136741
1640 Ga0495605_0003165
1641 Ga0495605_0010478
1642 Ga0495639_0000474
1643 Ga0495639_0032642
1644 Ga0495662_0000516
1645 Ga0495662_0004052
1646 Ga0495664_0001298
1647 Ga0495664_0007339
1648 Ga0495584_0005764
1649 Ga0495584_0012853
1650 Ga0495584_0028491
1651 Ga0495584_0047417
1652 Ga0495585_0006356
1653 Ga0495585_0017597
1654 Ga0495585_0054742
1655 Ga0495594_0005447
1656 Ga0495596_0001019
1657 Ga0495607_0005334
1658 Ga0495607_0012168
1659 Ga0495607_0033438
1660 Ga0495606_0009252
1661 Ga0495606_0012613
1662 Ga0495606_0052496
1663 Ga0495606_0192222
1664 Ga0495608_0000039
1665 Ga0495608_0014158
1666 Ga0495608_0087404
1667 Ga0495610_0004508
1668 Ga0495610_0018167
1669 Ga0495610_0036524
1670 Ga0495616_0003008
1671 Ga0495616_0020999
1672 Ga0495616_0029325
1673 Ga0495618_0006968
1674 Ga0495618_0011419
1675 Ga0495618_0027293
1676 Ga0495618_0115763
1677 Ga0495620_0027062
1678 Ga0495620_0077855
1679 Ga0495628_0000219
1680 Ga0495628_0060553
1681 Ga0495628_0066063
1682 Ga0495630_0010651
1683 Ga0495630_0020684
1684 Ga0495630_0124467
1685 Ga0495631_0001618
1686 Ga0495632_0005336
1687 Ga0495632_0067573
1688 Ga0495637_0002281
1689 Ga0495637_0012132
1690 Ga0495637_0021286
1691 Ga0495637_0042922
1692 Ga0495643_0008330
1693 Ga0495643_0010743
1694 Ga0495644_0001628
1695 Ga0495644_0002235
1696 Ga0495644_0046263
1697 Ga0495648_0007519
1698 Ga0495648_0033872
1699 Ga0495648_0065028
1700 Ga0495666_0006631
1701 Ga0495666_0022579
1702 Ga0495666_0026794
1703 Ga0495642_0000428
1704 Ga0495652_0000092
1705 Ga0495652_0037800
1706 Ga0495652_0045158
1707 Ga0495652_0068985
1708 Ga0495652_0188511
1709 Ga0495654_0007588
1710 Ga0495654_0043981
1711 Ga0495654_0046945
1712 Ga0495665_0000931
1713 Ga0495640_0003021
1714 Ga0495640_0053602
1715 Ga0495640_0088024
1716 Ga0495586_0020777
1717 Ga0495586_0091452
1718 Ga0495586_0133961
1719 Ga0495586_0356496
1720 Ga0495587_0000034
1721 Ga0495587_0004722
1722 Ga0495587_0013395
1723 Ga0495587_0018099
1724 Ga0495587_0123893
1725 Ga0495597_0028272
1726 Ga0495597_0034605
1727 Ga0495597_0210960
1728 Ga0495645_0027269
1729 Ga0495645_0076341
1730 Ga0495645_0160390
1731 Ga0495622_0045856
1732 Ga0495622_0058486
1733 Ga0495633_0021998
1734 Ga0495667_0000150
1735 Ga0495667_0006215
1736 Ga0495667_0040918
1737 Ga0495667_0053657
1738 Ga0495667_0113671
1739 Ga0495668_0002481
1740 Ga0495668_0011313
1741 Ga0495634_0007167
1742 Ga0495634_0019820
1743 Ga0495635_0000138
1744 Ga0495635_0058140
1745 Ga0495635_0417361
1746 Ga0495661_0002061
1747 Ga0495661_0024627
1748 Ga0495661_0033827
1749 Ga0495661_0253666
1750 Ga0495588_0050781
1751 Ga0495657_0000247
1752 Ga0495657_0024301
1753 Ga0495657_0025714
1754 Ga0495657_0071500
1755 Ga0495599_0000108
1756 Ga0495599_0024326
1757 Ga0495599_0036727
1758 Ga0495623_0000287
1759 Ga0495623_0037083
1760 Ga0495623_0107845
1761 Ga0495646_0010019
1762 Ga0495646_0015574
1763 Ga0495646_0029848
1764 Ga0495646_0032537
1765 Ga0495646_0032903
1766 Ga0495658_0006740
1767 Ga0495613_0029608
1768 Ga0495613_0062281
1769 Ga0495624_0011849
1770 Ga0495624_0021948
1771 Ga0495671_0005316
1772 Ga0495671_0014377
1773 Ga0495671_0024497
1774 Ga0495671_0030848
1775 Ga0495671_0035610
1776 Ga0495649_0005895
1777 Ga0495649_0040098
1778 Ga0495649_0278842
1779 Ga0495589_0056156
1780 Ga0495600_0008104
1781 Ga0495600_0018909
1782 Ga0495600_0025206
1783 Ga0495600_0043831
1784 Ga0495600_0078534
1785 Ga0495660_0034921
1786 Ga0495660_0035259
1787 Ga0495660_0041381
1788 Ga0495581_0000404
1789 Ga0495604_0000039
1790 Ga0495604_0014132
1791 Ga0495604_0042395
1792 Ga0495604_0054659
1793 Ga0495674_0000235
1794 Ga0495674_0032287
1795 Ga0495674_0069294
1796 Ga0495674_0119497
1797 Ga0495674_0220167
1798 Ga0495672_0006489
1799 Ga0495672_0011761
1800 Ga0495672_0021657
1801 Ga0495672_0025137
1802 Ga0495672_0035999
1803 Ga0495676_0009006
1804 Ga0495680_0000028
1805 Ga0495680_0022902
1806 Ga0495680_0067062
1807 Ga0495680_0067307
1808 Ga0495680_0089168
1809 Ga0495680_0093239
1810 Ga0495680_0131031
1811 Ga0495683_0001139
1812 Ga0495683_0003272
1813 Ga0495687_011902
1814 Ga0495675_0000355
1815 Ga0495675_0025159
1816 Ga0495675_0062657
1817 Ga0495673_0002014
1818 Ga0495673_0006091
1819 Ga0495673_0033665
1820 Ga0495681_0001437
1821 Ga0495681_0004955
1822 Ga0495681_0008404
1823 Ga0495681_0041839
1824 Ga0495684_0000154
1825 Ga0495684_0031991
1826 Ga0495686_0011501
1827 Ga0495686_0063105
1828 Ga0495593_0007879
1829 Ga0495593_0047235
1830 Ga0495593_0053990
1831 Ga0495602_0000043
1832 Ga0495602_0047998
1833 Ga0495602_0095634
1834 Ga0495614_0040246
1835 Ga0495626_0001346
1836 Ga0495626_0002001
1837 Ga0495626_0004960
1838 Ga0495626_0020224
1839 Ga0496100_0075070
1840 Ga0496100_0195252
1841 Ga0496100_0250681
1842 Ga0496101_0026411
1843 Ga0496101_0093592
1844 Ga0496102_0007449
1845 Ga0496103_0079345
1846 Ga0496104_0005365
1847 Ga0496104_0131346
1848 Ga0496105_0076305
1849 Ga0496105_0172308
1850 Ga0496105_0190167
1851 Ga0496106_0015803
1852 Ga0496107_0236872
1853 Ga0496107_0323519
1854 Ga0496108_0009911
1855 Ga0496108_0191706
1856 Ga0496108_0368036
1857 Ga0496109_0117152
1858 Ga0496109_0258255
1859 Ga0496110_0057350
1860 Ga0496110_0342610
1861 Ga0496111_0042240
1862 Ga0496111_0129812
1863 Ga0496112_0119785
1864 Ga0496112_0121149
1865 Ga0496112_0431751
1866 Ga0496112_0498617
1867 Ga0496113_0121646
1868 Ga0496113_0123556
1869 Ga0496113_0223781
1870 Ga0496114_0054914
1871 Ga0496115_0036854
1872 Ga0496115_0061608
1873 Ga0496116_0000126
1874 Ga0496117_0000950
1875 Ga0496117_0028769
1876 Ga0496118_0055353
1877 Ga0496119_0035855
1878 Ga0496119_0115723
1879 Ga0496119_0197243
1880 Ga0496121_0000142
1881 Ga0496122_0060191
1882 Ga0496123_0011472
1883 Ga0496123_0092143
1884 Ga0496124_0115771
1885 Ga0496126_0004789
1886 Ga0496126_0013912
1887 Ga0496126_0167728
1888 Ga0496126_0287593
1889 Ga0495678_011256
1890 Ga0495678_013240
1891 Ga0501031_0051723
1892 Ga0501031_0183172
1893 Ga0501037_0072516
1894 Ga0501038_0194556
1895 Ga0501039_0006861
1896 Ga0501040_0000259
1897 Ga0501040_0256415
1898 Ga0501041_0000491
1899 Ga0501042_0001520
1900 Ga0501042_0070913
1901 Ga0501043_0015672
1902 Ga0501046_0000713
1903 Ga0501047_0322907
1904 Ga0501048_0002303
1905 Ga0501068_0071819
1906 Ga0501069_0044365
1907 Ga0501070_0417698
1908 Ga0501071_0017040
1909 Ga0501072_0012113
1910 Ga0501073_0221522
1911 Ga0501075_0000854
1912 Ga0501075_0255294
1913 Ga0501076_0001606
1914 Ga0501077_0036972
1915 Ga0501079_0000169
1916 Ga0501079_0485785
1917 Ga0501080_0046817
1918 Ga0501081_0000098
1919 Ga0501081_0187380
1920 Ga0501035_0135651
1921 Ga0501044_0034624
1922 Ga0501045_0000786
1923 nmdc:mga03683_126482_c1
1924 nmdc:mga05p37_18612_c1
1925 nmdc:mga05p37_38629_c1
1926 nmdc:mga05p37_70517_c1
1927 nmdc:mga05p37_7776_c1
1928 nmdc:mga0qj67_38929_c1
1929 nmdc:mga06r32_132293_c1
1930 nmdc:mga08y16_17674_c1
1931 nmdc:mga08y16_247542_c1
1932 nmdc:mga08y16_293788_c1
1933 nmdc:mga08y16_77951_c1
1934 nmdc:mga08y16_89210_c1
1935 nmdc:mga0n895_26402_c1
1936 nmdc:mga0n895_6961_c1
1937 nmdc:mga0rr50_147025_c1
1938 nmdc:mga0rr50_62244_c1
1939 nmdc:mga0rr50_78829_c1
1940 nmdc:mga08x19_11539_c1
1941 nmdc:mga08x19_2303_c1
1942 nmdc:mga0a205_2379_c1
1943 nmdc:mga0a205_30481_c1
1944 Ga0495601_0022434
1945 Ga0495601_0169459
1946 Ga0495601_0375338
1947 Ga0495612_0020306
1948 Ga0495595_0018766
1949 Ga0495595_0030064
1950 Ga0495619_0056692
1951 Ga0495619_0063108
1952 Ga0500559_0007699
1953 Ga0501084_0006102
1954 Ga0590071_021000
1955 Ga0590074_005145
1956 Ga0590075_003397
1957 Ga0590077_004808
1958 Ga0501082_0001871
1959 Ga0530510_0141306
1960 2511265945
1961 2511279114
1962 2511294909
1963 2511302970
1964 2511313718
1965 2511320391
1966 2511324095
1967 2511330550
1968 2511336621
1969 2511344045
1970 2511353297
1971 2511355184
1972 2511823330
1973 2512326395
1974 2555668298
1975 2583790721
1976 2597856513
1977 2597862623
1978 2599355299
1979 2599360878
1980 2599367200
1981 2599373990
1982 2599380405
1983 2599386852
1984 2599392848
1985 2599404615
1986 2599462133
1987 2599466824
1988 2599483234
1989 2599490775
1990 2599805133
1991 2600214755
1992 2600363843
1993 2601774540
1994 2643845291
1995 2643952056
1996 2644024185
1997 2671097901
1998 2671768133
1999 2723247506
2000 2739198627
2001 2739256612
2002 2743735929
2003 2774136108
2004 2784260181
2005 2819702985
2006 2834029307
2007 2837186548
2008 2844668820
2009 2852658594
2010 2860340391
2011 2880231973
2012 2904521013
2013 2904551645
2014 2917072065
2015 2919458049
2016 2923154939
2017 2931399704
2018 2935354237
2019 2939637819
2020 2945929256
2021 2945961578
2022 2947236140
2023 2984291092
2024 3007512678
2025 3007855917
2026 3007863458
2027 637318660
2028 8015689171
2029 8055772291
2030 8056127348
2031 8056149500
2032 8056164665
2033 8056180314
2034 8056569969

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

74

255

0.97

PF12391

PCDO_beta_N

Protocatechuate 3,4-dioxygenase beta subunit N terminal

37

70

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.829 48 230
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.8252 47 230
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8209 47 230
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8155 47 225
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.7977 48 226
ID Description Score Start End Superfamily
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8015 47 225 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7993 48 223 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7678 23 234 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7495 47 225 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7273 72 225 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A2I1MKP1-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9162 59 229 GO:0008199
GO:0016702
AF-A0A1C9ICQ1-F1-model_v4 Protocatechuate dioxygenase beta subunit 0.9161 59 215 GO:0008199
GO:0016702
AF-A0A2S1M315-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.909 124 220 GO:0008199
GO:0016702
AF-A4L382-F1-model_v4 Protocatechuate 3,4-dioxygenase beta subunit 0.9045 103 219 GO:0008199
GO:0016702
AF-A4L686-F1-model_v4 Protocatechuate 3,4-dioxygenase beta subunit 0.8989 101 220 GO:0008199
GO:0016702

Map