F488175

General Info

Members Datasets Scaffolds Average Seq Length
1012 400 1012 208

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0034467|Ga0466963_0034467_1316_2086
Length 256
Sequence LKIAIDGLSSSAPVDDPVFTGVAMYQRAIVYWMPACAGHEQSEEGGGAVIKIWGRNTSSNVQKVMWAVGEMGLPHQRIDIGGPFGKNREPAYLAMNPNGLVPTLEEADGFLLWESNSIVRYLAAKHKSAELEPPDPHARGRASQWMDWQLSVCGPAITPVFWGLIRTPPEKRDHAAIEAGKKNTTAAMLMVDEQLAKTAYLAGDAFSYGDIPVGIMAYRYRQLVPERPALKNFERWYAAISGRQAFKDQVGAVPLT

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
395 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 9.88
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10023897 3300001990 Bacteria 1937
2 JGI24743J22301_10000589 3300001991 Bacteria 4389
3 JGI24738J21930_10011323 3300002075 Bacteria 1963
4 JGI24742J22300_10000606 3300002244 Bacteria 5393
5 JGI25404J52841_10004866 3300003659 Bacteria 2754
6 Ga0058862_12191086 3300004803 Bacteria 762
7 Ga0065707_10160974 3300005295 Bacteria 1563
8 Ga0070658_10120406 3300005327 Bacteria 2181
9 Ga0070658_10210450 3300005327 Bacteria 1642
10 Ga0070658_10485900 3300005327 Bacteria 1066
11 Ga0070683_100011408 3300005329 Bacteria 7681
12 Ga0070683_100040594 3300005329 Bacteria 4280
13 Ga0070683_100311639 3300005329 Bacteria 1497
14 Ga0070690_100015826 3300005330 Bacteria 4506
15 Ga0070690_100556198 3300005330 Bacteria 866
16 Ga0070670_100028487 3300005331 Bacteria 4807
17 Ga0070670_100071135 3300005331 Bacteria 2986
18 Ga0068869_100216323 3300005334 Bacteria 1517
19 Ga0070666_10088544 3300005335 Bacteria 2124
20 Ga0070666_10398149 3300005335 Bacteria 990
21 Ga0070680_100001118 3300005336 Bacteria 19276
22 Ga0070680_100109890 3300005336 Bacteria 2294
23 Ga0070682_100022863 3300005337 Bacteria 3708
24 Ga0070682_100605448 3300005337 Bacteria 866
25 Ga0068868_100009632 3300005338 Bacteria 6968
26 Ga0068868_100353123 3300005338 Bacteria 1260
27 Ga0070660_100195675 3300005339 Bacteria 1639
28 Ga0070660_100478208 3300005339 Bacteria 1035
29 Ga0070660_100522540 3300005339 Bacteria 989
30 Ga0070689_100001113 3300005340 Bacteria 16894
31 Ga0070689_100194769 3300005340 Bacteria 1652
32 Ga0070691_10005401 3300005341 Bacteria 5812
33 Ga0070687_100199493 3300005343 Bacteria 1211
34 Ga0070687_100211035 3300005343 Bacteria 1183
35 Ga0070661_100135873 3300005344 Bacteria 1850
36 Ga0070661_100881023 3300005344 Unclassified 738
37 Ga0070692_10022160 3300005345 Bacteria 3101
38 Ga0070668_100113320 3300005347 Bacteria 2160
39 Ga0070669_100140181 3300005353 Unclassified 1863
40 Ga0070669_100206839 3300005353 Bacteria 1547
41 Ga0070675_100018009 3300005354 Bacteria 5622
42 Ga0070675_100445561 3300005354 Bacteria 1161
43 Ga0070671_100010831 3300005355 Bacteria 7316
44 Ga0070674_100018571 3300005356 Bacteria 4400
45 Ga0070674_100026532 3300005356 Bacteria 3786
46 Ga0070673_100003804 3300005364 Bacteria 9468
47 Ga0070673_100227319 3300005364 Bacteria 1617
48 Ga0070673_100520815 3300005364 Bacteria 1078
49 Ga0070673_100954090 3300005364 Bacteria 797
50 Ga0070688_100005939 3300005365 Bacteria 6468
51 Ga0070688_100028550 3300005365 Bacteria 3332
52 Ga0070688_100051339 3300005365 Bacteria 2572
53 Ga0070659_100124649 3300005366 Bacteria 2090
54 Ga0070659_100410292 3300005366 Bacteria 1144
55 Ga0070659_100994151 3300005366 Bacteria 736
56 Ga0070667_100029214 3300005367 Bacteria 4593
57 Ga0070703_10010838 3300005406 Bacteria 2572
58 Ga0070709_10011931 3300005434 Bacteria 4854
59 Ga0070709_10159441 3300005434 Bacteria 1567
60 Ga0070709_10935785 3300005434 Bacteria 687
61 Ga0070714_100003288 3300005435 Bacteria 12043
62 Ga0070714_100058344 3300005435 Bacteria 3306
63 Ga0070714_100206856 3300005435 Bacteria 1797
64 Ga0070714_100309305 3300005435 Bacteria 1475
65 Ga0070714_100665610 3300005435 Bacteria 1003
66 Ga0070713_100022225 3300005436 Bacteria 4898
67 Ga0070713_100108922 3300005436 Bacteria 2412
68 Ga0070713_100125140 3300005436 Bacteria 2260
69 Ga0070713_100586417 3300005436 Bacteria 1058
70 Ga0070710_10047384 3300005437 Bacteria 2397
71 Ga0070711_100028231 3300005439 Bacteria 3691
72 Ga0070711_100036765 3300005439 Bacteria 3282
73 Ga0070711_100080849 3300005439 Bacteria 2315
74 Ga0070711_100142841 3300005439 Bacteria 1796
75 Ga0070705_100054251 3300005440 Bacteria 2350
76 Ga0070705_100189603 3300005440 Bacteria 1400
77 Ga0070700_100066485 3300005441 Bacteria 2288
78 Ga0070700_100712784 3300005441 Bacteria 799
79 Ga0070694_100074074 3300005444 Bacteria 2353
80 Ga0070694_100585525 3300005444 Bacteria 897
81 Ga0070708_100218484 3300005445 Bacteria 1787
82 Ga0070663_100086303 3300005455 Bacteria 2317
83 Ga0070663_100358866 3300005455 Bacteria 1182
84 Ga0070678_100025730 3300005456 Bacteria 3966
85 Ga0070678_100033430 3300005456 Bacteria 3571
86 Ga0070678_100376024 3300005456 Bacteria 1228
87 Ga0070662_100019278 3300005457 Bacteria 4630
88 Ga0070681_10523966 3300005458 Bacteria 1098
89 Ga0070681_11030727 3300005458 Bacteria 743
90 Ga0068867_100019113 3300005459 Bacteria 4879
91 Ga0068867_100725869 3300005459 Bacteria 879
92 Ga0068867_100886910 3300005459 Bacteria 802
93 Ga0070685_10008870 3300005466 Bacteria 5185
94 Ga0070707_100101717 3300005468 Bacteria 2785
95 Ga0070698_100012347 3300005471 Bacteria 9045
96 Ga0070698_100807164 3300005471 Bacteria 882
97 Ga0070699_100123881 3300005518 Bacteria 2274
98 Ga0070699_100573922 3300005518 Bacteria 1027
99 Ga0070699_101090168 3300005518 Bacteria 732
100 Ga0070679_100023849 3300005530 Bacteria 5994
101 Ga0070684_100004629 3300005535 Bacteria 10494
102 Ga0070684_100110848 3300005535 Bacteria 2460
103 Ga0070684_100165021 3300005535 Bacteria 2010
104 Ga0070684_100436286 3300005535 Bacteria 1210
105 Ga0070697_100036459 3300005536 Bacteria 3973
106 Ga0070697_100140324 3300005536 Unclassified 2032
107 Ga0070697_100666805 3300005536 Bacteria 916
108 Ga0068853_100328104 3300005539 Bacteria 1420
109 Ga0070672_100014289 3300005543 Bacteria 5624
110 Ga0070686_100015033 3300005544 Bacteria 4474
111 Ga0070686_100122087 3300005544 Bacteria 1790
112 Ga0070686_100489299 3300005544 Bacteria 953
113 Ga0070695_100052568 3300005545 Bacteria 2618
114 Ga0070695_100545741 3300005545 Bacteria 903
115 Ga0070693_100359509 3300005547 Bacteria 999
116 Ga0070665_100176983 3300005548 Bacteria 2134
117 Ga0070665_100295067 3300005548 Bacteria 1624
118 Ga0070665_100374217 3300005548 Bacteria 1431
119 Ga0070665_100525754 3300005548 Bacteria 1195
120 Ga0070665_100681923 3300005548 Bacteria 1041
121 Ga0070665_100836225 3300005548 Bacteria 934
122 Ga0070704_100001250 3300005549 Bacteria 13398
123 Ga0070704_100377119 3300005549 Bacteria 1204
124 Ga0070704_100543519 3300005549 Bacteria 1014
125 Ga0070704_100807306 3300005549 Bacteria 839
126 Ga0068855_100126004 3300005563 Bacteria 2928
127 Ga0068855_100472019 3300005563 Bacteria 1367
128 Ga0068855_100762977 3300005563 Bacteria 1031
129 Ga0070664_100024037 3300005564 Bacteria 5037
130 Ga0070664_100118550 3300005564 Bacteria 2315
131 Ga0070664_100171265 3300005564 Bacteria 1926
132 Ga0068854_100016650 3300005578 Bacteria 4905
133 Ga0068856_100001606 3300005614 Bacteria 23628
134 Ga0068856_100016444 3300005614 Bacteria 7159
135 Ga0068856_100210294 3300005614 Bacteria 1960
136 Ga0068856_100502094 3300005614 Bacteria 1234
137 Ga0070702_100008194 3300005615 Bacteria 5047
138 Ga0068852_100001045 3300005616 Bacteria 18230
139 Ga0068859_100025009 3300005617 Bacteria 5993
140 Ga0068859_100335208 3300005617 Bacteria 1607
141 Ga0068859_100792025 3300005617 Bacteria 1036
142 Ga0068864_100001978 3300005618 Bacteria 16866
143 Ga0068866_10011518 3300005718 Bacteria 3828
144 Ga0068851_10025091 3300005834 Bacteria 2922
145 Ga0068870_10014577 3300005840 Bacteria 3714
146 Ga0068863_100019233 3300005841 Bacteria 6535
147 Ga0068858_100022418 3300005842 Bacteria 5894
148 Ga0068858_100116932 3300005842 Bacteria 2492
149 Ga0068858_100184675 3300005842 Bacteria 1969
150 Ga0068860_100054877 3300005843 Bacteria 3787
151 Ga0068860_101087720 3300005843 Bacteria 819
152 Ga0068862_100024602 3300005844 Bacteria 5054
153 Ga0068862_100059517 3300005844 Bacteria 3280
154 Ga0068862_100283175 3300005844 Bacteria 1520
155 Ga0068862_100617918 3300005844 Bacteria 1042
156 Ga0081455_10001354 3300005937 Bacteria 30285
157 Ga0081455_10300774 3300005937 Bacteria 1151
158 Ga0081538_10034525 3300005981 Bacteria 3342
159 Ga0081538_10150658 3300005981 Bacteria 1054
160 Ga0081540_1001046 3300005983 Bacteria 24692
161 Ga0081540_1002282 3300005983 Bacteria 15746
162 Ga0081540_1003104 3300005983 Bacteria 13307
163 Ga0081540_1100145 3300005983 Bacteria 1250
164 Ga0081539_10003208 3300005985 Bacteria 20654
165 Ga0070717_10247489 3300006028 Bacteria 1574
166 Ga0070717_10349049 3300006028 Bacteria 1323
167 Ga0075365_10004171 3300006038 Bacteria 7608
168 Ga0075365_10009965 3300006038 Bacteria 5502
169 Ga0075365_10011665 3300006038 Bacteria 5178
170 Ga0075365_10208576 3300006038 Bacteria 1370
171 Ga0075365_10247488 3300006038 Bacteria 1252
172 Ga0075365_10352560 3300006038 Bacteria 1037
173 Ga0075365_10572926 3300006038 Bacteria 798
174 Ga0075368_10012897 3300006042 Bacteria 3061
175 Ga0075368_10018094 3300006042 Bacteria 2644
176 Ga0075368_10086403 3300006042 Bacteria 1280
177 Ga0075363_100009278 3300006048 Bacteria 4621
178 Ga0075363_100025914 3300006048 Bacteria 2995
179 Ga0075364_10100398 3300006051 Bacteria 1926
180 Ga0075364_10124588 3300006051 Bacteria 1726
181 Ga0075364_10260995 3300006051 Bacteria 1178
182 Ga0070715_10005759 3300006163 Bacteria 4163
183 Ga0070716_100016606 3300006173 Bacteria 3803
184 Ga0070712_100052161 3300006175 Bacteria 2851
185 Ga0070712_100076048 3300006175 Bacteria 2417
186 Ga0070712_100579723 3300006175 Bacteria 948
187 Ga0075362_10003444 3300006177 Bacteria 5528
188 Ga0075367_10002008 3300006178 Bacteria 9074
189 Ga0075367_10013529 3300006178 Bacteria 4390
190 Ga0075367_10039306 3300006178 Bacteria 2758
191 Ga0075367_10312623 3300006178 Bacteria 989
192 Ga0097621_100020748 3300006237 Bacteria 5068
193 Ga0075370_10038028 3300006353 Bacteria 2708
194 Ga0075370_10108901 3300006353 Bacteria 1608
195 Ga0068871_100016774 3300006358 Bacteria 5527
196 Ga0068871_100892732 3300006358 Bacteria 823
197 Ga0075428_100000617 3300006844 Bacteria 36390
198 Ga0075428_100062074 3300006844 Bacteria 4092
199 Ga0075428_100082995 3300006844 Bacteria 3496
200 Ga0075428_100194841 3300006844 Bacteria 2191
201 Ga0075428_100378884 3300006844 Bacteria 1517
202 Ga0075428_100532816 3300006844 Bacteria 1256
203 Ga0075428_100578115 3300006844 Bacteria 1201
204 Ga0075430_100045690 3300006846 Bacteria 3699
205 Ga0075431_100073995 3300006847 Bacteria 3515
206 Ga0075431_100108855 3300006847 Bacteria 2860
207 Ga0075431_100171298 3300006847 Bacteria 2230
208 Ga0075431_100820232 3300006847 Bacteria 903
209 Ga0075431_100883641 3300006847 Bacteria 864
210 Ga0075433_10043573 3300006852 Bacteria 3896
211 Ga0075433_10622550 3300006852 Bacteria 947
212 Ga0075434_100070901 3300006871 Bacteria 3475
213 Ga0075434_100103915 3300006871 Bacteria 2850
214 Ga0075434_100131094 3300006871 Bacteria 2526
215 Ga0075434_100540835 3300006871 Bacteria 1185
216 Ga0075434_100622901 3300006871 Bacteria 1098
217 Ga0075434_100811838 3300006871 Bacteria 951
218 Ga0075434_100992981 3300006871 Bacteria 853
219 Ga0075434_101018597 3300006871 Bacteria 842
220 Ga0075429_100000081 3300006880 Bacteria 49207
221 Ga0075429_100271902 3300006880 Bacteria 1484
222 Ga0075429_100430352 3300006880 Bacteria 1156
223 Ga0068865_100174258 3300006881 Bacteria 1652
224 Ga0075436_100004004 3300006914 Bacteria 10108
225 Ga0075436_100004115 3300006914 Bacteria 9977
226 Ga0075436_100090088 3300006914 Bacteria 2132
227 Ga0075436_100129957 3300006914 Bacteria 1766
228 Ga0097620_100025009 3300006931 Bacteria 5993
229 Ga0097620_100335219 3300006931 Bacteria 1607
230 Ga0097620_100792112 3300006931 Bacteria 1036
231 Ga0075435_100275497 3300007076 Bacteria 1436
232 Ga0075435_100316413 3300007076 Bacteria 1336
233 Ga0075435_100667463 3300007076 Bacteria 903
234 Ga0075435_100694013 3300007076 Bacteria 885
235 Ga0099794_10011365 3300007265 Bacteria 3809
236 Ga0099794_10017902 3300007265 Bacteria 3167
237 Ga0099794_10019828 3300007265 Bacteria 3036
238 Ga0099795_10059973 3300007788 Bacteria 1409
239 Ga0105251_10019995 3300009011 Bacteria 3524
240 Ga0105250_10036971 3300009092 Bacteria 1959
241 Ga0105240_10012327 3300009093 Bacteria 11807
242 Ga0105240_10215904 3300009093 Bacteria 2238
243 Ga0105240_10744984 3300009093 Bacteria 1066
244 Ga0111539_10089724 3300009094 Bacteria 3612
245 Ga0111539_10109039 3300009094 Bacteria 3249
246 Ga0111539_10150665 3300009094 Bacteria 2722
247 Ga0111539_10229442 3300009094 Bacteria 2162
248 Ga0111539_10286824 3300009094 Bacteria 1916
249 Ga0111539_10565452 3300009094 Bacteria 1324
250 Ga0111539_10577925 3300009094 Bacteria 1309
251 Ga0111539_10578423 3300009094 Bacteria 1308
252 Ga0111539_11212562 3300009094 Bacteria 876
253 Ga0105245_10051077 3300009098 Bacteria 3707
254 Ga0105245_10231631 3300009098 Bacteria 1787
255 Ga0105245_11406078 3300009098 Bacteria 748
256 Ga0114129_10002113 3300009147 Bacteria 27369
257 Ga0114129_10011617 3300009147 Bacteria 12537
258 Ga0114129_10048513 3300009147 Bacteria 5966
259 Ga0114129_10221243 3300009147 Bacteria 2554
260 Ga0114129_10349571 3300009147 Bacteria 1959
261 Ga0114129_11039546 3300009147 Bacteria 1029
262 Ga0114129_11487948 3300009147 Bacteria 832
263 Ga0114129_11489605 3300009147 Bacteria 832
264 Ga0114129_11987904 3300009147 Bacteria 703
265 Ga0105243_10440664 3300009148 Bacteria 1220
266 Ga0105243_10605780 3300009148 Bacteria 1055
267 Ga0105243_11436345 3300009148 Bacteria 711
268 Ga0105241_10521919 3300009174 Bacteria 1062
269 Ga0105242_10028336 3300009176 Bacteria 4458
270 Ga0105242_10349934 3300009176 Bacteria 1364
271 Ga0105248_10623085 3300009177 Bacteria 1217
272 Ga0105237_10028064 3300009545 Bacteria 5734
273 Ga0105237_10141603 3300009545 Bacteria 2399
274 Ga0105238_10037417 3300009551 Bacteria 4933
275 Ga0105238_10154909 3300009551 Bacteria 2267
276 Ga0105238_10160965 3300009551 Bacteria 2220
277 Ga0105238_10345146 3300009551 Bacteria 1477
278 Ga0105238_10459267 3300009551 Bacteria 1271
279 Ga0105238_10563447 3300009551 Unclassified 1144
280 Ga0105249_10015086 3300009553 Bacteria 6835
281 Ga0105249_10579958 3300009553 Bacteria 1175
282 Ga0105249_10672243 3300009553 Bacteria 1094
283 Ga0099796_10010230 3300010159 Bacteria 2572
284 Ga0099796_10023258 3300010159 Bacteria 1933
285 Ga0105239_10031952 3300010375 Bacteria 5784
286 Ga0105239_10188702 3300010375 Bacteria 2307
287 Ga0105239_10308693 3300010375 Bacteria 1783
288 Ga0105239_10522002 3300010375 Bacteria 1351
289 Ga0105239_11216837 3300010375 Bacteria 868
290 Ga0157373_10093120 3300013100 Bacteria 2122
291 Ga0157370_10980725 3300013104 Bacteria 765
292 Ga0157369_10011724 3300013105 Bacteria 9953
293 Ga0157369_10158993 3300013105 Bacteria 2386
294 Ga0157369_10541407 3300013105 Bacteria 1204
295 Ga0157374_10083923 3300013296 Bacteria 3027
296 Ga0157374_10298170 3300013296 Bacteria 1594
297 Ga0157374_10369049 3300013296 Bacteria 1428
298 Ga0157374_10720035 3300013296 Bacteria 1012
299 Ga0157372_10018682 3300013307 Bacteria 7458
300 Ga0157372_10088796 3300013307 Bacteria 3510
301 Ga0157372_10245304 3300013307 Bacteria 2079
302 Ga0157372_10277978 3300013307 Bacteria 1947
303 Ga0157375_10009835 3300013308 Bacteria 8410
304 Ga0157375_10796818 3300013308 Bacteria 1094
305 Ga0163163_10303939 3300014325 Bacteria 1648
306 Ga0163163_10372967 3300014325 Bacteria 1484
307 Ga0163163_10390837 3300014325 Bacteria 1449
308 Ga0157380_10405511 3300014326 Bacteria 1295
309 Ga0157380_10710931 3300014326 Bacteria 1011
310 Ga0157380_11157619 3300014326 Bacteria 815
311 Ga0157377_10004874 3300014745 Bacteria 6241
312 Ga0157379_10027886 3300014968 Bacteria 5026
313 Ga0157379_10659050 3300014968 Bacteria 980
314 Ga0157376_10135733 3300014969 Bacteria 2201
315 Ga0163161_10120185 3300017792 Bacteria 1973
316 Ga0163161_10780922 3300017792 Bacteria 801
317 Ga0213872_10021062 3300021361 Bacteria 3002
318 Ga0213876_10077341 3300021384 Bacteria 1758
319 Ga0213876_10099408 3300021384 Bacteria 1542
320 Ga0213876_10101010 3300021384 Bacteria 1529
321 Ga0213875_10000053 3300021388 Bacteria 141791
322 Ga0213875_10158083 3300021388 Bacteria 1063
323 Ga0224572_1004891 3300024225 Bacteria 2363
324 Ga0228598_1000876 3300024227 Bacteria 6507
325 Ga0228598_1020313 3300024227 Bacteria 1308
326 Ga0207426_1013129 3300025302 Bacteria 3084
327 Ga0207426_1056002 3300025302 Bacteria 1152
328 Ga0207697_10030261 3300025315 Bacteria 2215
329 Ga0207697_10032524 3300025315 Bacteria 2135
330 Ga0207656_10016209 3300025321 Bacteria 2899
331 Ga0207656_10247897 3300025321 Bacteria 872
332 Ga0207692_10226083 3300025898 Bacteria 1111
333 Ga0207642_10013018 3300025899 Bacteria 3021
334 Ga0207688_10003415 3300025901 Bacteria 8665
335 Ga0207680_10008657 3300025903 Bacteria 5010
336 Ga0207680_10402985 3300025903 Bacteria 967
337 Ga0207647_10064910 3300025904 Bacteria 2217
338 Ga0207685_10031288 3300025905 Bacteria 1904
339 Ga0207685_10102199 3300025905 Bacteria 1227
340 Ga0207699_10014408 3300025906 Bacteria 4075
341 Ga0207699_10316086 3300025906 Bacteria 1094
342 Ga0207645_10048865 3300025907 Bacteria 2702
343 Ga0207645_10049992 3300025907 Bacteria 2670
344 Ga0207645_10398827 3300025907 Bacteria 925
345 Ga0207643_10005672 3300025908 Bacteria 6678
346 Ga0207705_10213428 3300025909 Bacteria 1464
347 Ga0207705_10241045 3300025909 Unclassified 1377
348 Ga0207684_10096437 3300025910 Bacteria 2524
349 Ga0207707_10004277 3300025912 Bacteria 12633
350 Ga0207707_10379776 3300025912 Bacteria 1215
351 Ga0207707_10490182 3300025912 Bacteria 1049
352 Ga0207695_10026716 3300025913 Bacteria 6440
353 Ga0207695_11051143 3300025913 Bacteria 694
354 Ga0207671_10077285 3300025914 Bacteria 2492
355 Ga0207671_10214673 3300025914 Bacteria 1506
356 Ga0207693_10002485 3300025915 Bacteria 16030
357 Ga0207693_10041146 3300025915 Bacteria 3639
358 Ga0207693_10063092 3300025915 Bacteria 2903
359 Ga0207693_10185616 3300025915 Bacteria 1637
360 Ga0207693_10226341 3300025915 Bacteria 1469
361 Ga0207693_10284764 3300025915 Bacteria 1295
362 Ga0207693_10458723 3300025915 Unclassified 996
363 Ga0207663_10045292 3300025916 Bacteria 2705
364 Ga0207663_10080623 3300025916 Bacteria 2129
365 Ga0207663_10118085 3300025916 Bacteria 1811
366 Ga0207660_10008666 3300025917 Bacteria 6579
367 Ga0207660_10328117 3300025917 Bacteria 1223
368 Ga0207662_10290993 3300025918 Bacteria 1083
369 Ga0207662_10313530 3300025918 Bacteria 1046
370 Ga0207657_10100027 3300025919 Bacteria 2408
371 Ga0207657_10554022 3300025919 Bacteria 899
372 Ga0207649_10007883 3300025920 Bacteria 5794
373 Ga0207649_10189617 3300025920 Bacteria 1445
374 Ga0207652_10083726 3300025921 Bacteria 2793
375 Ga0207652_10648679 3300025921 Unclassified 944
376 Ga0207652_10655105 3300025921 Bacteria 939
377 Ga0207646_10268358 3300025922 Bacteria 1542
378 Ga0207681_10118776 3300025923 Unclassified 1936
379 Ga0207694_10129583 3300025924 Bacteria 2021
380 Ga0207694_10290493 3300025924 Bacteria 1344
381 Ga0207694_10499360 3300025924 Bacteria 1019
382 Ga0207650_10031312 3300025925 Bacteria 3840
383 Ga0207650_10071529 3300025925 Bacteria 2609
384 Ga0207650_10149991 3300025925 Bacteria 1839
385 Ga0207659_10298422 3300025926 Bacteria 1322
386 Ga0207659_10309531 3300025926 Bacteria 1300
387 Ga0207659_10552690 3300025926 Bacteria 979
388 Ga0207687_10006331 3300025927 Bacteria 7824
389 Ga0207687_10067357 3300025927 Bacteria 2547
390 Ga0207687_10263202 3300025927 Bacteria 1376
391 Ga0207700_10013689 3300025928 Bacteria 5289
392 Ga0207700_10078066 3300025928 Bacteria 2574
393 Ga0207700_10153148 3300025928 Bacteria 1907
394 Ga0207700_10178347 3300025928 Bacteria 1777
395 Ga0207700_10225900 3300025928 Bacteria 1589
396 Ga0207700_10308481 3300025928 Bacteria 1368
397 Ga0207700_10334744 3300025928 Bacteria 1315
398 Ga0207664_10033479 3300025929 Bacteria 3948
399 Ga0207664_10333892 3300025929 Bacteria 1339
400 Ga0207664_10456388 3300025929 Bacteria 1141
401 Ga0207644_10016623 3300025931 Bacteria 4953
402 Ga0207644_10023230 3300025931 Bacteria 4244
403 Ga0207644_10038217 3300025931 Bacteria 3380
404 Ga0207644_10525956 3300025931 Bacteria 977
405 Ga0207690_10018700 3300025932 Bacteria 4251
406 Ga0207690_10104102 3300025932 Bacteria 2033
407 Ga0207706_10038206 3300025933 Bacteria 4258
408 Ga0207670_10017680 3300025936 Bacteria 4313
409 Ga0207670_10020641 3300025936 Bacteria 4052
410 Ga0207669_10005520 3300025937 Bacteria 5683
411 Ga0207669_10286357 3300025937 Bacteria 1245
412 Ga0207669_10471956 3300025937 Bacteria 998
413 Ga0207669_10740924 3300025937 Bacteria 811
414 Ga0207665_10004102 3300025939 Bacteria 9717
415 Ga0207665_10067219 3300025939 Bacteria 2440
416 Ga0207665_10097939 3300025939 Bacteria 2042
417 Ga0207665_10855171 3300025939 Bacteria 720
418 Ga0207691_10001627 3300025940 Bacteria 22294
419 Ga0207691_10250595 3300025940 Bacteria 1528
420 Ga0207711_10101018 3300025941 Bacteria 2552
421 Ga0207711_10227872 3300025941 Bacteria 1706
422 Ga0207711_10472488 3300025941 Bacteria 1168
423 Ga0207689_10007012 3300025942 Bacteria 9907
424 Ga0207661_10026523 3300025944 Bacteria 4415
425 Ga0207661_10106947 3300025944 Bacteria 2359
426 Ga0207679_10015638 3300025945 Bacteria 5020
427 Ga0207679_10081985 3300025945 Bacteria 2468
428 Ga0207679_10230954 3300025945 Bacteria 1562
429 Ga0207667_10055984 3300025949 Bacteria 4144
430 Ga0207667_10062848 3300025949 Bacteria 3881
431 Ga0207667_10118214 3300025949 Bacteria 2732
432 Ga0207667_10744060 3300025949 Bacteria 980
433 Ga0207651_10135996 3300025960 Bacteria 1890
434 Ga0207651_10269391 3300025960 Bacteria 1402
435 Ga0207712_10234008 3300025961 Bacteria 1476
436 Ga0207668_10007545 3300025972 Bacteria 6475
437 Ga0207640_10019201 3300025981 Bacteria 4034
438 Ga0207640_10341830 3300025981 Bacteria 1199
439 Ga0207640_10529856 3300025981 Bacteria 986
440 Ga0207658_10096845 3300025986 Bacteria 2302
441 Ga0207658_10802301 3300025986 Bacteria 855
442 Ga0207677_10126300 3300026023 Bacteria 1934
443 Ga0207677_10391944 3300026023 Bacteria 1175
444 Ga0207677_10667069 3300026023 Bacteria 919
445 Ga0207703_10167640 3300026035 Bacteria 1929
446 Ga0207703_10525085 3300026035 Bacteria 1114
447 Ga0207703_10686420 3300026035 Bacteria 973
448 Ga0207639_10158101 3300026041 Bacteria 1906
449 Ga0207678_10020051 3300026067 Bacteria 5874
450 Ga0207678_10334683 3300026067 Bacteria 1304
451 Ga0207678_10370403 3300026067 Bacteria 1237
452 Ga0207708_10001502 3300026075 Bacteria 17383
453 Ga0207708_10152108 3300026075 Bacteria 1823
454 Ga0207708_10896307 3300026075 Bacteria 767
455 Ga0207702_10064733 3300026078 Bacteria 3129
456 Ga0207702_11400396 3300026078 Bacteria 693
457 Ga0207648_10006668 3300026089 Bacteria 11454
458 Ga0207648_10074077 3300026089 Bacteria 2967
459 Ga0207648_10278555 3300026089 Bacteria 1495
460 Ga0207648_10710169 3300026089 Bacteria 932
461 Ga0207676_10018586 3300026095 Bacteria 5056
462 Ga0207675_100013475 3300026118 Bacteria 7630
463 Ga0207675_100260100 3300026118 Bacteria 1682
464 Ga0207683_10012333 3300026121 Bacteria 7294
465 Ga0207683_10076816 3300026121 Bacteria 2957
466 Ga0207683_10547128 3300026121 Bacteria 1070
467 Ga0207698_10127091 3300026142 Bacteria 2170
468 Ga0207698_10678084 3300026142 Bacteria 1024
469 Ga0209179_1011531 3300027512 Bacteria 1568
470 Ga0209588_1010903 3300027671 Bacteria 2738
471 Ga0209588_1027516 3300027671 Bacteria 1809
472 Ga0209813_10003719 3300027866 Bacteria 3594
473 Ga0207428_10049012 3300027907 Bacteria 3386
474 Ga0268266_10095158 3300028379 Bacteria 2616
475 Ga0268266_10286712 3300028379 Bacteria 1532
476 Ga0268266_10449037 3300028379 Bacteria 1225
477 Ga0268266_10494120 3300028379 Bacteria 1168
478 Ga0268266_10760726 3300028379 Bacteria 935
479 Ga0268265_10011597 3300028380 Bacteria 5959
480 Ga0268265_10597576 3300028380 Bacteria 1054
481 Ga0268264_10858049 3300028381 Bacteria 910
482 Ga0265334_10012318 3300028573 Bacteria 3595
483 Ga0265338_10151314 3300028800 Bacteria 1802
484 Ga0265763_1007016 3300030763 Bacteria 980
485 Ga0265763_1008412 3300030763 Bacteria 921
486 Ga0265773_1006882 3300031018 Bacteria 872
487 Ga0265332_10006574 3300031238 Bacteria 5271
488 Ga0265325_10002317 3300031241 Bacteria 12919
489 Ga0265329_10070499 3300031242 Bacteria 1106
490 Ga0265340_10015062 3300031247 Bacteria 4025
491 Ga0265339_10000078 3300031249 Bacteria 83767
492 Ga0265339_10019601 3300031249 Bacteria 3968
493 Ga0265331_10154151 3300031250 Bacteria 1043
494 Ga0265316_10228627 3300031344 Bacteria 1370
495 Ga0265313_10003528 3300031595 Bacteria 12614
496 Ga0265314_10022239 3300031711 Bacteria 4859
497 Ga0265342_10002635 3300031712 Bacteria 15340
498 Ga0316578_10268499 3300031728 Bacteria 1022
499 Ga0373926_0022219 3300035083 Bacteria 2201
500 Ga0373929_0111511 3300035085 Bacteria 700
501 Ga0373944_0024358 3300035089 Bacteria 1773
502 Ga0373952_0114059 3300035092 Bacteria 726
503 Ga0373923_0002771 3300035111 Bacteria 5477
504 Ga0373923_0078977 3300035111 Bacteria 1425
505 Ga0373936_0003979 3300035113 Bacteria 5569
506 Ga0373936_0010496 3300035113 Bacteria 3495
507 Ga0373936_0104241 3300035113 Bacteria 1199
508 Ga0373939_0069327 3300035114 Bacteria 1144
509 Ga0373945_0001064 3300035116 Bacteria 8252
510 Ga0373945_0005949 3300035116 Bacteria 3917
511 Ga0373953_0004294 3300035117 Bacteria 4530
512 Ga0373954_0000906 3300035118 Bacteria 11525
513 Ga0373954_0002609 3300035118 Bacteria 7586
514 Ga0373954_0058587 3300035118 Bacteria 1814
515 Ga0373956_0000029 3300035119 Bacteria 45843
516 Ga0373956_0033037 3300035119 Bacteria 2273
517 Ga0373956_0339949 3300035119 Bacteria 715
518 Ga0373957_0010530 3300035120 Bacteria 3060
519 Ga0373957_0015261 3300035120 Bacteria 2641
520 Ga0373960_0014720 3300035121 Bacteria 1986
521 Ga0373943_0000208 3300035170 Bacteria 24045
522 Ga0373943_0003827 3300035170 Bacteria 6840
523 Ga0373943_0032102 3300035170 Bacteria 2494
524 Ga0373943_0058368 3300035170 Bacteria 1921
525 Ga0373946_0001814 3300035171 Bacteria 7457
526 Ga0373946_0006567 3300035171 Bacteria 4221
527 Ga0373946_0020608 3300035171 Bacteria 2549
528 Ga0373955_0000201 3300035172 Bacteria 24761
529 Ga0373955_0003420 3300035172 Bacteria 6976
530 Ga0373942_0088537 3300035207 Bacteria 930
531 Ga0373942_0185417 3300035207 Unclassified 683
532 Ga0373961_0108448 3300035241 Bacteria 907
533 Ga0373924_0062256 3300035410 Bacteria 1562
534 Ga0373931_0024776 3300035691 Bacteria 3043
535 Ga0373931_0049908 3300035691 Bacteria 2225
536 Ga0373931_0177648 3300035691 Bacteria 1259
537 Ga0373935_0000068 3300035692 Bacteria 43997
538 Ga0373935_0048992 3300035692 Bacteria 2677
539 Ga0373935_0213117 3300035692 Bacteria 1339
540 Ga0373935_0431288 3300035692 Bacteria 950
541 Ga0373927_0005387 3300035695 Bacteria 8840
542 Ga0373927_0006191 3300035695 Bacteria 8171
543 Ga0373927_0026505 3300035695 Bacteria 3788
544 Ga0373927_0028489 3300035695 Bacteria 3643
545 Ga0373927_0039331 3300035695 Bacteria 3069
546 Ga0373927_0067847 3300035695 Bacteria 2308
547 Ga0373927_0179490 3300035695 Bacteria 1389
548 Ga0373927_0331838 3300035695 Bacteria 1002
549 Ga0373933_0002902 3300035724 Bacteria 9577
550 Ga0373933_0003207 3300035724 Bacteria 9130
551 Ga0373933_0534282 3300035724 Bacteria 769
552 Ga0373933_0647813 3300035724 Bacteria 694
553 Ga0373947_0000178 3300035725 Bacteria 34953
554 Ga0373947_0002537 3300035725 Bacteria 10978
555 Ga0373947_0023662 3300035725 Bacteria 3575
556 Ga0373947_0064449 3300035725 Bacteria 2234
557 Ga0373947_0102805 3300035725 Bacteria 1797
558 Ga0373947_0125390 3300035725 Bacteria 1635
559 Ga0373947_0180047 3300035725 Bacteria 1375
560 Ga0373937_0000347 3300036401 Bacteria 43749
561 Ga0373937_0000441 3300036401 Bacteria 38394
562 Ga0373937_0045533 3300036401 Bacteria 4010
563 Ga0373937_0179799 3300036401 Bacteria 1986
564 Ga0373937_0194899 3300036401 Bacteria 1904
565 Ga0373937_0250597 3300036401 Bacteria 1669
566 Ga0316582_0245053 3300036647 Bacteria 1228
567 Ga0373925_0000081 3300037068 Bacteria 102407
568 Ga0373925_0001482 3300037068 Bacteria 20154
569 Ga0373925_0044829 3300037068 Bacteria 3284
570 Ga0373925_0250494 3300037068 Bacteria 1420
571 Ga0373925_0302993 3300037068 Bacteria 1290
572 Ga0373925_0324306 3300037068 Bacteria 1247
573 Ga0373925_0454820 3300037068 Bacteria 1049
574 Ga0373925_0638458 3300037068 Bacteria 877
575 Ga0395899_0014903 3300037312 Bacteria 5930
576 Ga0395899_0096464 3300037312 Bacteria 2138
577 Ga0395900_0008428 3300037418 Bacteria 10605
578 Ga0395900_0011461 3300037418 Bacteria 9075
579 Ga0395900_0143324 3300037418 Bacteria 2445
580 Ga0395900_1067436 3300037418 Bacteria 726
581 Ga0395898_0082166 3300037466 Bacteria 3106
582 Ga0395898_0138981 3300037466 Bacteria 2325
583 Ga0395898_0331558 3300037466 Bacteria 1451
584 Ga0395905_0500874 3300037471 Bacteria 1115
585 Ga0436364_0664195 3300037853 Bacteria 2975
586 Ga0436364_0716542 3300037853 Bacteria 2780
587 Ga0436364_0951864 3300037853 Bacteria 9370
588 Ga0395901_0009788 3300038443 Bacteria 9721
589 Ga0395901_0018877 3300038443 Bacteria 7049
590 Ga0395901_0137101 3300038443 Bacteria 2571
591 Ga0395901_0215568 3300038443 Bacteria 2008
592 Ga0395901_0564087 3300038443 Bacteria 1152
593 Ga0436365_0042743 3300039437 Bacteria 2739
594 Ga0436365_0291537 3300039437 Bacteria 629
595 Ga0436365_1099387 3300039437 Bacteria 3202
596 Ga0436365_1251077 3300039437 Bacteria 937
597 Ga0436365_1336443 3300039437 Bacteria 3131
598 Ga0436365_1383206 3300039437 Bacteria 1820
599 Ga0436360_0291491 3300039438 Bacteria 2024
600 Ga0436360_0775077 3300039438 Bacteria 2194
601 Ga0436360_1307075 3300039438 Bacteria 1174
602 Ga0436361_0424457 3300039447 Bacteria 3406
603 Ga0436361_0687582 3300039447 Bacteria 1439
604 Ga0436361_0914825 3300039447 Bacteria 917
605 Ga0436363_0235431 3300039450 Bacteria 801
606 Ga0436363_0753578 3300039450 Bacteria 884
607 Ga0436363_1012681 3300039450 Bacteria 2233
608 Ga0436363_1455596 3300039450 Bacteria 957
609 Ga0439453_0015398 3300041408 Bacteria 1322
610 Ga0451853_1512202 3300041512 Bacteria 1297
611 Ga0439464_0034921 3300042439 Bacteria 1419
612 Ga0451577_0277536 3300042876 Bacteria 1518
613 Ga0466966_0306725 3300044684 Bacteria 954
614 Ga0466961_0158392 3300044693 Bacteria 1412
615 Ga0466963_0018448 3300044694 Bacteria 4363
616 Ga0466963_0025164 3300044694 Bacteria 3794
617 Ga0466963_0034467 3300044694 Bacteria 3293
618 Ga0466957_0125405 3300044842 Bacteria 1640
619 Ga0466959_0034418 3300045049 Bacteria 3747
620 Ga0466959_0036016 3300045049 Bacteria 3657
621 Ga0451576_0295185 3300045051 Bacteria 1695
622 Ga0451576_0599338 3300045051 Bacteria 1158
623 Ga0466958_0014631 3300045836 Bacteria 4480
624 Ga0466958_0067079 3300045836 Bacteria 2191
625 Ga0466967_0091388 3300045976 Bacteria 2766
626 Ga0466967_0320079 3300045976 Bacteria 1495
627 Ga0466967_0611955 3300045976 Bacteria 1076
628 Ga0495617_118481 3300046452 Bacteria 854
629 Ga0495592_0000196 3300046454 Bacteria 51625
630 Ga0495592_0022021 3300046454 Bacteria 4848
631 Ga0495592_0287452 3300046454 Bacteria 1073
632 Ga0495603_0165172 3300046455 Bacteria 1283
633 Ga0495590_0087493 3300046457 Bacteria 1101
634 Ga0495591_045515 3300046458 Bacteria 1223
635 Ga0495629_0003904 3300046459 Bacteria 11215
636 Ga0495651_0000356 3300046462 Bacteria 35210
637 Ga0495651_0000977 3300046462 Bacteria 22167
638 Ga0495651_0062022 3300046462 Bacteria 2861
639 Ga0495651_0088854 3300046462 Bacteria 2321
640 Ga0495653_0000193 3300046463 Bacteria 49516
641 Ga0495653_0125711 3300046463 Bacteria 1821
642 Ga0495653_0367836 3300046463 Bacteria 921
643 Ga0495580_0091021 3300046472 Bacteria 2123
644 Ga0495582_0022901 3300046473 Bacteria 3417
645 Ga0495582_0034182 3300046473 Bacteria 2795
646 Ga0495582_0212729 3300046473 Bacteria 1105
647 Ga0495639_0045107 3300046475 Bacteria 1994
648 Ga0495662_0060059 3300046476 Bacteria 1836
649 Ga0495662_0080447 3300046476 Bacteria 1584
650 Ga0495662_0142170 3300046476 Bacteria 1181
651 Ga0495662_0242024 3300046476 Bacteria 889
652 Ga0495664_0000016 3300046477 Bacteria 175933
653 Ga0495664_0015488 3300046477 Bacteria 4334
654 Ga0495584_0139415 3300046491 Bacteria 1231
655 Ga0495594_0266148 3300046499 Bacteria 976
656 Ga0495607_0119698 3300046501 Bacteria 1384
657 Ga0495608_0000121 3300046511 Bacteria 56189
658 Ga0495608_0279154 3300046511 Bacteria 1037
659 Ga0495616_0056321 3300046513 Bacteria 1942
660 Ga0495618_0000124 3300046514 Bacteria 56215
661 Ga0495618_0041757 3300046514 Bacteria 2889
662 Ga0495618_0091385 3300046514 Bacteria 1946
663 Ga0495628_0000018 3300046516 Bacteria 169916
664 Ga0495628_0015254 3300046516 Bacteria 6417
665 Ga0495628_0101785 3300046516 Bacteria 2216
666 Ga0495628_0139904 3300046516 Bacteria 1847
667 Ga0495630_0002180 3300046517 Bacteria 13643
668 Ga0495630_0088692 3300046517 Bacteria 2336
669 Ga0495630_0269636 3300046517 Bacteria 1300
670 Ga0495630_0432671 3300046517 Bacteria 1008
671 Ga0495644_0015905 3300046523 Bacteria 2883
672 Ga0495666_0057585 3300046526 Bacteria 1860
673 Ga0495666_0124149 3300046526 Bacteria 1208
674 Ga0495652_0000005 3300046529 Bacteria 524368
675 Ga0495652_0006146 3300046529 Bacteria 11223
676 Ga0495652_0044867 3300046529 Bacteria 3805
677 Ga0495652_0173262 3300046529 Bacteria 1663
678 Ga0495665_0022710 3300046531 Bacteria 3370
679 Ga0495665_0062082 3300046531 Bacteria 1973
680 Ga0495665_0111401 3300046531 Bacteria 1435
681 Ga0495640_0000063 3300046533 Bacteria 60255
682 Ga0495640_0186408 3300046533 Bacteria 1320
683 Ga0495640_0192449 3300046533 Bacteria 1296
684 Ga0495640_0261916 3300046533 Bacteria 1080
685 Ga0495586_0027423 3300046535 Bacteria 3048
686 Ga0495587_0000134 3300046536 Bacteria 56076
687 Ga0495587_0063866 3300046536 Bacteria 2152
688 Ga0495587_0289664 3300046536 Bacteria 917
689 Ga0495598_0000513 3300046537 Bacteria 7181
690 Ga0495598_0085309 3300046537 Bacteria 1020
691 Ga0495621_0066992 3300046539 Bacteria 1315
692 Ga0495645_0000070 3300046543 Bacteria 71823
693 Ga0495645_0006688 3300046543 Bacteria 8009
694 Ga0495645_0042265 3300046543 Bacteria 3323
695 Ga0495645_0225337 3300046543 Bacteria 1258
696 Ga0495633_0126843 3300046558 Bacteria 1181
697 Ga0495667_0000023 3300046559 Bacteria 169343
698 Ga0495667_0258536 3300046559 Bacteria 1108
699 Ga0495667_0321339 3300046559 Bacteria 979
700 Ga0495668_0106349 3300046616 Bacteria 1535
701 Ga0495668_0232391 3300046616 Bacteria 1010
702 Ga0495634_0000241 3300046642 Bacteria 51268
703 Ga0495634_0006515 3300046642 Bacteria 8866
704 Ga0495634_0007380 3300046642 Bacteria 8271
705 Ga0495634_0023797 3300046642 Bacteria 4303
706 Ga0495634_0131184 3300046642 Bacteria 1597
707 Ga0495635_0000045 3300046663 Bacteria 82266
708 Ga0495635_0007866 3300046663 Bacteria 7445
709 Ga0495635_0474966 3300046663 Unclassified 825
710 Ga0495659_0046419 3300046664 Bacteria 1568
711 Ga0495657_0001202 3300046675 Bacteria 22674
712 Ga0495657_0054030 3300046675 Bacteria 2685
713 Ga0495657_0227561 3300046675 Bacteria 1129
714 Ga0495657_0297955 3300046675 Bacteria 962
715 Ga0495599_0000107 3300046678 Bacteria 56178
716 Ga0495599_0016176 3300046678 Bacteria 4630
717 Ga0495599_0271096 3300046678 Bacteria 1030
718 Ga0495623_0000180 3300046679 Bacteria 39869
719 Ga0495623_0290852 3300046679 Bacteria 906
720 Ga0495646_0000027 3300046680 Bacteria 97629
721 Ga0495646_0009489 3300046680 Bacteria 6177
722 Ga0495646_0086248 3300046680 Bacteria 1821
723 Ga0495647_0017526 3300046681 Bacteria 2536
724 Ga0495647_0133894 3300046681 Bacteria 1052
725 Ga0495658_0020639 3300046683 Bacteria 3461
726 Ga0495658_0088488 3300046683 Bacteria 1830
727 Ga0495658_0782518 3300046683 Bacteria 611
728 Ga0495613_0028287 3300046689 Bacteria 4169
729 Ga0495613_0055243 3300046689 Bacteria 2918
730 Ga0495613_0056616 3300046689 Bacteria 2879
731 Ga0495613_0070264 3300046689 Bacteria 2553
732 Ga0495613_0103178 3300046689 Bacteria 2059
733 Ga0495624_0052660 3300046690 Bacteria 2571
734 Ga0495624_0093253 3300046690 Bacteria 1857
735 Ga0495670_0004845 3300046691 Bacteria 6606
736 Ga0495671_0025808 3300046692 Bacteria 3051
737 Ga0495600_0000062 3300046809 Bacteria 61420
738 Ga0495600_0028026 3300046809 Bacteria 3643
739 Ga0495581_0050844 3300047315 Bacteria 2394
740 Ga0495581_0164637 3300047315 Bacteria 1297
741 Ga0495581_0251664 3300047315 Bacteria 1033
742 Ga0495604_0000014 3300047317 Bacteria 205481
743 Ga0495674_0000014 3300047319 Bacteria 241211
744 Ga0495674_0146874 3300047319 Bacteria 1979
745 Ga0495674_0452055 3300047319 Bacteria 1032
746 Ga0495672_0091047 3300047320 Bacteria 1675
747 Ga0495676_0021834 3300047321 Bacteria 5581
748 Ga0495676_0072883 3300047321 Bacteria 2635
749 Ga0495676_0542368 3300047321 Bacteria 761
750 Ga0495680_0000779 3300047322 Bacteria 35728
751 Ga0495680_0199616 3300047322 Bacteria 1435
752 Ga0495680_0274377 3300047322 Bacteria 1190
753 Ga0495680_0326915 3300047322 Bacteria 1072
754 Ga0495675_0000058 3300047444 Bacteria 77587
755 Ga0495675_0074564 3300047444 Bacteria 2138
756 Ga0495675_0222744 3300047444 Bacteria 1141
757 Ga0495684_0000059 3300047471 Bacteria 77947
758 Ga0495684_0023040 3300047471 Bacteria 4790
759 Ga0495684_0032711 3300047471 Bacteria 3994
760 Ga0495593_0005129 3300047673 Bacteria 7741
761 Ga0495593_0006926 3300047673 Bacteria 6638
762 Ga0495593_0092976 3300047673 Bacteria 1552
763 Ga0495593_0249251 3300047673 Bacteria 889
764 Ga0495602_0000017 3300048088 Bacteria 184180
765 Ga0495602_0281844 3300048088 Bacteria 1224
766 Ga0495602_0842122 3300048088 Bacteria 613
767 Ga0496100_0006029 3300048903 Bacteria 6579
768 Ga0496100_0007617 3300048903 Bacteria 5988
769 Ga0496100_0221282 3300048903 Bacteria 1389
770 Ga0496100_0577318 3300048903 Bacteria 871
771 Ga0496100_0704446 3300048903 Bacteria 788
772 Ga0496101_0000879 3300048904 Bacteria 17685
773 Ga0496101_0003104 3300048904 Bacteria 10272
774 Ga0496101_0011363 3300048904 Bacteria 5905
775 Ga0496101_0018180 3300048904 Bacteria 4776
776 Ga0496101_0153974 3300048904 Bacteria 1760
777 Ga0496101_0340027 3300048904 Bacteria 1179
778 Ga0496101_0344962 3300048904 Bacteria 1170
779 Ga0496101_0608082 3300048904 Bacteria 864
780 Ga0496101_0629180 3300048904 Bacteria 848
781 Ga0496102_0008462 3300048905 Bacteria 8821
782 Ga0496102_0011826 3300048905 Bacteria 7533
783 Ga0496102_0024214 3300048905 Bacteria 5396
784 Ga0496102_0037021 3300048905 Bacteria 4400
785 Ga0496102_0069866 3300048905 Bacteria 3224
786 Ga0496102_0576835 3300048905 Bacteria 1048
787 Ga0496102_0717283 3300048905 Bacteria 923
788 Ga0496102_0902813 3300048905 Bacteria 805
789 Ga0496103_0007237 3300048906 Bacteria 6615
790 Ga0496103_0048800 3300048906 Bacteria 2617
791 Ga0496103_0102030 3300048906 Bacteria 1817
792 Ga0496103_0243198 3300048906 Bacteria 1158
793 Ga0496104_0001978 3300048907 Bacteria 17751
794 Ga0496104_0004384 3300048907 Bacteria 12293
795 Ga0496104_0006107 3300048907 Bacteria 10574
796 Ga0496104_0017059 3300048907 Bacteria 6607
797 Ga0496104_0195705 3300048907 Bacteria 1934
798 Ga0496104_0374083 3300048907 Bacteria 1337
799 Ga0496104_0468513 3300048907 Bacteria 1171
800 Ga0496104_0848001 3300048907 Bacteria 819
801 Ga0496104_0990057 3300048907 Bacteria 745
802 Ga0496105_0001999 3300048908 Bacteria 14708
803 Ga0496105_0005181 3300048908 Bacteria 9880
804 Ga0496105_0015753 3300048908 Bacteria 6033
805 Ga0496105_0061405 3300048908 Bacteria 3101
806 Ga0496105_0061711 3300048908 Bacteria 3094
807 Ga0496105_0098553 3300048908 Bacteria 2413
808 Ga0496105_0454318 3300048908 Bacteria 1011
809 Ga0496106_0003496 3300048909 Bacteria 11703
810 Ga0496106_0011510 3300048909 Bacteria 6542
811 Ga0496106_0016650 3300048909 Bacteria 5438
812 Ga0496106_0317869 3300048909 Bacteria 1250
813 Ga0496106_0917103 3300048909 Unclassified 691
814 Ga0496107_0008551 3300048910 Bacteria 7083
815 Ga0496107_0028396 3300048910 Bacteria 3975
816 Ga0496107_0062820 3300048910 Bacteria 2690
817 Ga0496107_0181280 3300048910 Bacteria 1564
818 Ga0496107_0318195 3300048910 Bacteria 1158
819 Ga0496108_0000347 3300048911 Bacteria 39108
820 Ga0496108_0005996 3300048911 Bacteria 9840
821 Ga0496108_0013218 3300048911 Bacteria 6727
822 Ga0496108_0018394 3300048911 Bacteria 5720
823 Ga0496108_0032557 3300048911 Bacteria 4330
824 Ga0496108_0077240 3300048911 Bacteria 2816
825 Ga0496109_0005863 3300048912 Bacteria 10300
826 Ga0496109_0022511 3300048912 Bacteria 5583
827 Ga0496109_0032495 3300048912 Bacteria 4691
828 Ga0496109_0045633 3300048912 Bacteria 3977
829 Ga0496109_0313055 3300048912 Bacteria 1481
830 Ga0496109_0498994 3300048912 Bacteria 1149
831 Ga0496109_0586258 3300048912 Bacteria 1051
832 Ga0496110_0000339 3300048913 Bacteria 31235
833 Ga0496110_0003146 3300048913 Bacteria 12548
834 Ga0496110_0012105 3300048913 Bacteria 7086
835 Ga0496110_0029719 3300048913 Bacteria 4706
836 Ga0496110_0074428 3300048913 Bacteria 3016
837 Ga0496110_0170611 3300048913 Bacteria 1974
838 Ga0496110_0264085 3300048913 Bacteria 1567
839 Ga0496110_0323362 3300048913 Bacteria 1405
840 Ga0496110_0625564 3300048913 Bacteria 975
841 Ga0496111_0001676 3300048914 Bacteria 12899
842 Ga0496111_0009006 3300048914 Bacteria 6640
843 Ga0496111_0017366 3300048914 Bacteria 4975
844 Ga0496111_0021601 3300048914 Bacteria 4497
845 Ga0496111_0720866 3300048914 Bacteria 725
846 Ga0496112_0002294 3300048915 Bacteria 15311
847 Ga0496112_0003807 3300048915 Bacteria 12611
848 Ga0496112_0004698 3300048915 Bacteria 11628
849 Ga0496112_0006289 3300048915 Bacteria 10415
850 Ga0496112_0129178 3300048915 Bacteria 2498
851 Ga0496112_0233439 3300048915 Bacteria 1794
852 Ga0496112_0618357 3300048915 Bacteria 1014
853 Ga0496112_0648060 3300048915 Bacteria 986
854 Ga0496112_0917495 3300048915 Bacteria 797
855 Ga0496113_0069726 3300048916 Bacteria 2671
856 Ga0496113_0075665 3300048916 Bacteria 2570
857 Ga0496113_0114824 3300048916 Bacteria 2100
858 Ga0496113_0132092 3300048916 Bacteria 1960
859 Ga0496113_0280044 3300048916 Bacteria 1333
860 Ga0496114_0110149 3300048917 Bacteria 2358
861 Ga0496115_0018524 3300048918 Bacteria 5348
862 Ga0496115_0055975 3300048918 Bacteria 3169
863 Ga0496115_0060795 3300048918 Bacteria 3045
864 Ga0496115_0257531 3300048918 Bacteria 1435
865 Ga0496115_0316815 3300048918 Bacteria 1276
866 Ga0496115_0826093 3300048918 Bacteria 719
867 Ga0501031_0023742 3300049568 Bacteria 3997
868 Ga0501032_0175050 3300049569 Bacteria 1406
869 Ga0501033_0058028 3300049570 Bacteria 2860
870 Ga0501034_0000891 3300049571 Bacteria 43738
871 Ga0501034_0011745 3300049571 Bacteria 9060
872 Ga0501034_0021303 3300049571 Bacteria 6609
873 Ga0501034_0234213 3300049571 Bacteria 1784
874 Ga0501036_0171303 3300049572 Unclassified 1829
875 Ga0501038_0580131 3300049574 Bacteria 850
876 Ga0501039_0008570 3300049575 Bacteria 7798
877 Ga0501040_0015963 3300049576 Bacteria 4966
878 Ga0501040_0725460 3300049576 Bacteria 719
879 Ga0501041_0033918 3300049577 Bacteria 3089
880 Ga0501042_0006103 3300049578 Bacteria 7807
881 Ga0501042_0291971 3300049578 Bacteria 1178
882 Ga0501043_0016253 3300049579 Bacteria 5837
883 Ga0501043_0059010 3300049579 Bacteria 3011
884 Ga0501046_0124912 3300049580 Unclassified 1955
885 Ga0501046_0266063 3300049580 Bacteria 1258
886 Ga0501047_0610694 3300049581 Bacteria 912
887 Ga0501048_0011307 3300049582 Bacteria 6655
888 Ga0501048_0331171 3300049582 Bacteria 1085
889 Ga0501068_0012440 3300049584 Bacteria 4826
890 Ga0501068_0017211 3300049584 Bacteria 4177
891 Ga0501068_0562319 3300049584 Unclassified 742
892 Ga0501069_0041972 3300049585 Bacteria 2529
893 Ga0501069_0047991 3300049585 Bacteria 2371
894 Ga0501070_0003987 3300049586 Bacteria 12699
895 Ga0501070_0185817 3300049586 Bacteria 1709
896 Ga0501070_0787475 3300049586 Bacteria 747
897 Ga0501071_0007220 3300049587 Bacteria 7269
898 Ga0501071_0671147 3300049587 Bacteria 798
899 Ga0501073_0400560 3300049589 Bacteria 948
900 Ga0501074_0001669 3300049590 Bacteria 15112
901 Ga0501074_0116108 3300049590 Bacteria 1915
902 Ga0501075_0038416 3300049591 Bacteria 3579
903 Ga0501075_0164115 3300049591 Bacteria 1695
904 Ga0501075_0248755 3300049591 Bacteria 1355
905 Ga0501075_0412224 3300049591 Bacteria 1030
906 Ga0501075_0451005 3300049591 Bacteria 981
907 Ga0501076_0019950 3300049592 Bacteria 5128
908 Ga0501076_0166618 3300049592 Bacteria 1796
909 Ga0501077_0038035 3300049593 Bacteria 3063
910 Ga0501079_0142427 3300049741 Bacteria 1867
911 Ga0501079_0299090 3300049741 Bacteria 1259
912 Ga0501080_0049205 3300049742 Bacteria 3924
913 Ga0501080_0306962 3300049742 Bacteria 1438
914 Ga0501081_0533014 3300049743 Bacteria 876
915 Ga0501083_0278715 3300049744 Bacteria 1088
916 Ga0501035_0102447 3300049822 Bacteria 2511
917 Ga0501044_0058411 3300049823 Bacteria 3956
918 Ga0501044_0435136 3300049823 Bacteria 1220
919 Ga0501045_0007001 3300049824 Bacteria 7821
920 nmdc:mga03n38_3932_c1 3300050490 Bacteria 4844
921 nmdc:mga03n38_523875_c1 3300050490 Unclassified 668
922 nmdc:mga0yw44_14371_c1 3300050492 Bacteria 4203
923 nmdc:mga0yw44_155796_c1 3300050492 Bacteria 1493
924 nmdc:mga0yw44_176483_c1 3300050492 Bacteria 1405
925 nmdc:mga0yw44_70420_c1 3300050492 Bacteria 2168
926 nmdc:mga0k408_347576_c1 3300050493 Bacteria 884
927 nmdc:mga06z11_39475_c1 3300050494 Bacteria 2349
928 nmdc:mga06z11_790_c1 3300050494 Bacteria 11561
929 nmdc:mga06z11_9739_c1 3300050494 Bacteria 4060
930 nmdc:mga04h51_7974_c1 3300050495 Bacteria 2818
931 nmdc:mga05p37_13689_c1 3300050507 Bacteria 9722
932 nmdc:mga05p37_182270_c1 3300050507 Bacteria 2554
933 nmdc:mga05p37_463312_c1 3300050507 Bacteria 1464
934 nmdc:mga05p37_51539_c1 3300050507 Bacteria 5061
935 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
936 nmdc:mga09592_276302_c1 3300050508 Bacteria 1457
937 nmdc:mga09592_351191_c1 3300050508 Bacteria 1276
938 nmdc:mga09592_452835_c1 3300050508 Bacteria 1107
939 nmdc:mga09592_551382_c1 3300050508 Bacteria 990
940 nmdc:mga0qj67_69955_c1 3300050509 Bacteria 2799
941 nmdc:mga0qj67_72478_c1 3300050509 Bacteria 2750
942 nmdc:mga06r32_118534_c1 3300050510 Bacteria 2609
943 nmdc:mga06r32_134422_c1 3300050510 Bacteria 2447
944 nmdc:mga06r32_274046_c1 3300050510 Bacteria 1675
945 nmdc:mga06r32_5683_c1 3300050510 Bacteria 11226
946 nmdc:mga06r32_898206_c1 3300050510 Bacteria 842
947 nmdc:mga06r32_899039_c1 3300050510 Bacteria 842
948 nmdc:mga08y16_147315_c1 3300050511 Bacteria 2447
949 nmdc:mga08y16_496710_c1 3300050511 Bacteria 1240
950 nmdc:mga08y16_627756_c1 3300050511 Bacteria 1081
951 nmdc:mga08y16_66523_c1 3300050511 Bacteria 3761
952 nmdc:mga0n895_155498_c1 3300050512 Bacteria 2317
953 nmdc:mga0n895_454272_c1 3300050512 Bacteria 1293
954 nmdc:mga0n895_459658_c1 3300050512 Bacteria 1285
955 nmdc:mga0n895_4873_c1 3300050512 Bacteria 11115
956 nmdc:mga0n895_809489_c1 3300050512 Bacteria 927
957 nmdc:mga0n895_84596_c1 3300050512 Bacteria 3165
958 nmdc:mga0n895_938110_c1 3300050512 Bacteria 849
959 nmdc:mga0n895_98294_c1 3300050512 Bacteria 2934
960 nmdc:mga0rr50_137244_c1 3300050513 Bacteria 1964
961 nmdc:mga0rr50_201279_c1 3300050513 Bacteria 1636
962 nmdc:mga0rr50_294262_c1 3300050513 Bacteria 1357
963 nmdc:mga0rr50_929405_c1 3300050513 Bacteria 741
964 nmdc:mga0rr50_95527_c1 3300050513 Bacteria 2323
965 nmdc:mga08x19_127143_c1 3300050514 Bacteria 1712
966 nmdc:mga08x19_3673_c1 3300050514 Bacteria 9135
967 nmdc:mga08x19_40687_c1 3300050514 Bacteria 2959
968 nmdc:mga08x19_483147_c1 3300050514 Bacteria 873
969 nmdc:mga0a205_25016_c1 3300050515 Bacteria 5684
970 nmdc:mga0a205_342822_c1 3300050515 Bacteria 1362
971 nmdc:mga0a205_394674_c1 3300050515 Bacteria 1247
972 nmdc:mga0a205_534460_c1 3300050515 Bacteria 1028
973 nmdc:mga0sz30_5978_c1 3300050516 Bacteria 3448
974 Ga0495601_0000016 3300053077 Bacteria 207486
975 Ga0495601_0006967 3300053077 Bacteria 6619
976 Ga0495601_0011070 3300053077 Bacteria 5390
977 Ga0495601_0017716 3300053077 Bacteria 4327
978 Ga0495601_0043988 3300053077 Bacteria 2806
979 Ga0495601_0095332 3300053077 Bacteria 1918
980 Ga0495601_0259457 3300053077 Bacteria 1134
981 Ga0495601_0343242 3300053077 Bacteria 971
982 Ga0495612_0000041 3300053078 Bacteria 62752
983 Ga0495612_0008712 3300053078 Bacteria 4114
984 Ga0495612_0097294 3300053078 Bacteria 1251
985 Ga0495612_0222672 3300053078 Bacteria 835
986 Ga0495612_0237305 3300053078 Bacteria 809
987 Ga0495655_0000981 3300053083 Bacteria 4424
988 Ga0495595_0000048 3300053084 Bacteria 60581
989 Ga0495595_0001522 3300053084 Bacteria 9051
990 Ga0495595_0143601 3300053084 Bacteria 1172
991 Ga0495619_0000050 3300053085 Bacteria 101361
992 Ga0495619_0002388 3300053085 Bacteria 12328
993 Ga0495619_0041669 3300053085 Bacteria 3004
994 Ga0495619_0088079 3300053085 Bacteria 2100
995 Ga0495619_0118435 3300053085 Bacteria 1814
996 Ga0495619_0313965 3300053085 Bacteria 1085
997 Ga0495619_0391363 3300053085 Bacteria 960
998 Ga0500566_0112346 3300053094 Bacteria 1480
999 Ga0500641_0000747 3300053096 Bacteria 11773
1000 Ga0500650_0089514 3300053098 Bacteria 1440
1001 Ga0500568_0052584 3300053139 Bacteria 1599
1002 Ga0500616_0004736 3300053153 Bacteria 9570
1003 Ga0500616_0036435 3300053153 Bacteria 2670
1004 Ga0500645_051596 3300053730 Bacteria 1200
1005 Ga0501084_0023539 3300054114 Bacteria 5138
1006 Ga0501084_0370131 3300054114 Bacteria 1211
1007 Ga0501084_0880187 3300054114 Bacteria 753
1008 Ga0501082_0026550 3300060353 Bacteria 4992
1009 Ga0501082_0349555 3300060353 Bacteria 1289
1010 Ga0501082_0568735 3300060353 Bacteria 992
1011 Ga0466962_0160303 3300061719 Bacteria 1093
1012 Ga0466962_0380322 3300061719 Bacteria 705

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10577925 Ga0111539_105779252 172
2 3300035119 Ga0373956_0339949 Ga0373956_0339949_43_564 173
3 3300048088 Ga0495602_0842122 Ga0495602_0842122_74_598 173
4 3300025916 Ga0207663_10080623 Ga0207663_100806234 185
5 3300046511 Ga0495608_0279154 Ga0495608_0279154_467_1027 185
6 3300026075 Ga0207708_10152108 Ga0207708_101521082 188
7 3300004803 Ga0058862_12191086 Ga0058862_121910861 189
8 3300037471 Ga0395905_0500874 Ga0395905_0500874_196_771 190
9 3300048903 Ga0496100_0704446 Ga0496100_0704446_21_596 190
10 3300048904 Ga0496101_0340027 Ga0496101_0340027_517_1092 190
11 3300048907 Ga0496104_0195705 Ga0496104_0195705_11_586 190
12 3300050490 nmdc:mga03n38_523875_c1 nmdc:mga03n38_523875_c1_23_595 190
13 3300053078 Ga0495612_0237305 Ga0495612_0237305_11_586 190
14 3300046473 Ga0495582_0212729 Ga0495582_0212729_37_615 191
15 3300046516 Ga0495628_0101785 Ga0495628_0101785_530_1105 191
16 3300046616 Ga0495668_0106349 Ga0495668_0106349_938_1513 191
17 3300046683 Ga0495658_0782518 Ga0495658_0782518_20_598 191
18 3300047319 Ga0495674_0452055 Ga0495674_0452055_128_703 191
19 3300047321 Ga0495676_0542368 Ga0495676_0542368_30_608 191
20 3300047322 Ga0495680_0326915 Ga0495680_0326915_478_1053 191
21 3300050492 nmdc:mga0yw44_155796_c1 nmdc:mga0yw44_155796_c1_31_606 191
22 3300039437 Ga0436365_0291537 Ga0436365_0291537_30_611 193
23 3300005434 Ga0070709_10935785 Ga0070709_109357851 196
24 3300044694 Ga0466963_0018448 Ga0466963_0018448_1700_2329 198
25 3300044842 Ga0466957_0125405 Ga0466957_0125405_703_1332 198
26 3300045049 Ga0466959_0034418 Ga0466959_0034418_763_1392 198
27 3300045836 Ga0466958_0067079 Ga0466958_0067079_1512_2141 198
28 3300061719 Ga0466962_0160303 Ga0466962_0160303_242_871 198
29 3300006914 Ga0075436_100129957 Ga0075436_1001299573 201
30 3300050512 nmdc:mga0n895_84596_c1 nmdc:mga0n895_84596_c1_49_672 201
31 3300050513 nmdc:mga0rr50_201279_c1 nmdc:mga0rr50_201279_c1_117_740 201
32 3300006175 Ga0070712_100052161 Ga0070712_1000521613 202
33 3300025915 Ga0207693_10185616 Ga0207693_101856162 202
34 3300048910 Ga0496107_0318195 Ga0496107_0318195_514_1137 202
35 3300050514 nmdc:mga08x19_483147_c1 nmdc:mga08x19_483147_c1_74_700 202
36 3300042876 Ga0451577_0277536 Ga0451577_0277536_801_1412 203
37 3300005327 Ga0070658_10210450 Ga0070658_102104501 205
38 3300005329 Ga0070683_100011408 Ga0070683_1000114084 205
39 3300005335 Ga0070666_10398149 Ga0070666_103981491 205
40 3300005336 Ga0070680_100001118 Ga0070680_10000111814 205
41 3300005339 Ga0070660_100522540 Ga0070660_1005225401 205
42 3300005341 Ga0070691_10005401 Ga0070691_100054014 205
43 3300005344 Ga0070661_100135873 Ga0070661_1001358732 205
44 3300005356 Ga0070674_100018571 Ga0070674_1000185713 205
45 3300005364 Ga0070673_100520815 Ga0070673_1005208152 205
46 3300005366 Ga0070659_100124649 Ga0070659_1001246492 205
47 3300005444 Ga0070694_100074074 Ga0070694_1000740743 205
48 3300005445 Ga0070708_100218484 Ga0070708_1002184841 205
49 3300005456 Ga0070678_100033430 Ga0070678_1000334302 205
50 3300005468 Ga0070707_100101717 Ga0070707_1001017172 205
51 3300005471 Ga0070698_100012347 Ga0070698_1000123476 205
52 3300005518 Ga0070699_100573922 Ga0070699_1005739222 205
53 3300005530 Ga0070679_100023849 Ga0070679_1000238492 205
54 3300005535 Ga0070684_100004629 Ga0070684_1000046296 205
55 3300005536 Ga0070697_100666805 Ga0070697_1006668051 205
56 3300005548 Ga0070665_100681923 Ga0070665_1006819232 205
57 3300005549 Ga0070704_100001250 Ga0070704_1000012504 205
58 3300005563 Ga0068855_100126004 Ga0068855_1001260043 205
59 3300005564 Ga0070664_100024037 Ga0070664_1000240372 205
60 3300005614 Ga0068856_100001606 Ga0068856_10000160614 205
61 3300005616 Ga0068852_100001045 Ga0068852_1000010457 205
62 3300005985 Ga0081539_10003208 Ga0081539_100032081 205
63 3300006042 Ga0075368_10086403 Ga0075368_100864032 205
64 3300006051 Ga0075364_10260995 Ga0075364_102609952 205
65 3300006177 Ga0075362_10003444 Ga0075362_100034441 205
66 3300006178 Ga0075367_10013529 Ga0075367_100135295 205
67 3300006178 Ga0075367_10039306 Ga0075367_100393063 205
68 3300006178 Ga0075367_10312623 Ga0075367_103126231 205
69 3300006844 Ga0075428_100194841 Ga0075428_1001948414 205
70 3300006847 Ga0075431_100171298 Ga0075431_1001712982 205
71 3300006847 Ga0075431_100883641 Ga0075431_1008836411 205
72 3300006871 Ga0075434_100103915 Ga0075434_1001039152 205
73 3300006880 Ga0075429_100000081 Ga0075429_10000008149 205
74 3300009093 Ga0105240_10215904 Ga0105240_102159044 205
75 3300009094 Ga0111539_10109039 Ga0111539_101090393 205
76 3300009094 Ga0111539_10229442 Ga0111539_102294423 205
77 3300009147 Ga0114129_10002113 Ga0114129_100021136 205
78 3300009147 Ga0114129_11987904 Ga0114129_119879041 205
79 3300009148 Ga0105243_11436345 Ga0105243_114363451 205
80 3300009545 Ga0105237_10141603 Ga0105237_101416032 205
81 3300009551 Ga0105238_10154909 Ga0105238_101549092 205
82 3300009551 Ga0105238_10160965 Ga0105238_101609652 205
83 3300009551 Ga0105238_10459267 Ga0105238_104592671 205
84 3300013104 Ga0157370_10980725 Ga0157370_109807251 205
85 3300013105 Ga0157369_10011724 Ga0157369_100117246 205
86 3300013296 Ga0157374_10298170 Ga0157374_102981702 205
87 3300013307 Ga0157372_10018682 Ga0157372_100186822 205
88 3300013307 Ga0157372_10245304 Ga0157372_102453043 205
89 3300014326 Ga0157380_11157619 Ga0157380_111576191 205
90 3300025302 Ga0207426_1013129 Ga0207426_10131293 205
91 3300025321 Ga0207656_10247897 Ga0207656_102478972 205
92 3300025909 Ga0207705_10213428 Ga0207705_102134282 205
93 3300025912 Ga0207707_10004277 Ga0207707_1000427712 205
94 3300025912 Ga0207707_10490182 Ga0207707_104901821 205
95 3300025913 Ga0207695_10026716 Ga0207695_100267162 205
96 3300025913 Ga0207695_11051143 Ga0207695_110511431 205
97 3300025917 Ga0207660_10008666 Ga0207660_100086662 205
98 3300025918 Ga0207662_10313530 Ga0207662_103135302 205
99 3300025920 Ga0207649_10007883 Ga0207649_100078833 205
100 3300025921 Ga0207652_10083726 Ga0207652_100837262 205
101 3300025924 Ga0207694_10290493 Ga0207694_102904932 205
102 3300025931 Ga0207644_10016623 Ga0207644_100166232 205
103 3300025937 Ga0207669_10471956 Ga0207669_104719561 205
104 3300025944 Ga0207661_10026523 Ga0207661_100265234 205
105 3300025949 Ga0207667_10055984 Ga0207667_100559844 205
106 3300025949 Ga0207667_10062848 Ga0207667_100628482 205
107 3300025981 Ga0207640_10529856 Ga0207640_105298561 205
108 3300026089 Ga0207648_10710169 Ga0207648_107101691 205
109 3300027907 Ga0207428_10049012 Ga0207428_100490123 205
110 3300028379 Ga0268266_10449037 Ga0268266_104490372 205
111 3300035113 Ga0373936_0104241 Ga0373936_0104241_506_1123 205
112 3300035114 Ga0373939_0069327 Ga0373939_0069327_267_929 205
113 3300035695 Ga0373927_0067847 Ga0373927_0067847_179_796 205
114 3300035725 Ga0373947_0125390 Ga0373947_0125390_370_987 205
115 3300037418 Ga0395900_0011461 Ga0395900_0011461_7335_7952 205
116 3300038443 Ga0395901_0564087 Ga0395901_0564087_497_1114 205
117 3300039450 Ga0436363_1455596 Ga0436363_1455596_86_703 205
118 3300041408 Ga0439453_0015398 Ga0439453_0015398_395_1015 205
119 3300042439 Ga0439464_0034921 Ga0439464_0034921_104_724 205
120 3300045976 Ga0466967_0091388 Ga0466967_0091388_2026_2643 205
121 3300047320 Ga0495672_0091047 Ga0495672_0091047_883_1503 205
122 3300049571 Ga0501034_0021303 Ga0501034_0021303_4825_5442 205
123 3300049584 Ga0501068_0012440 Ga0501068_0012440_3587_4204 205
124 3300049584 Ga0501068_0562319 Ga0501068_0562319_92_709 205
125 3300050492 nmdc:mga0yw44_14371_c1 nmdc:mga0yw44_14371_c1_812_1429 205
126 3300050493 nmdc:mga0k408_347576_c1 nmdc:mga0k408_347576_c1_17_634 205
127 3300050507 nmdc:mga05p37_51539_c1 nmdc:mga05p37_51539_c1_2756_3373 205
128 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_81955_82572 205
129 3300050511 nmdc:mga08y16_66523_c1 nmdc:mga08y16_66523_c1_2524_3144 205
130 3300050516 nmdc:mga0sz30_5978_c1 nmdc:mga0sz30_5978_c1_584_1201 205
131 3300053096 Ga0500641_0000747 Ga0500641_0000747_9174_9791 205
132 3300053153 Ga0500616_0004736 Ga0500616_0004736_743_1360 205
133 3300060353 Ga0501082_0568735 Ga0501082_0568735_248_865 205
134 3300005295 Ga0065707_10160974 Ga0065707_101609743 206
135 3300005327 Ga0070658_10120406 Ga0070658_101204062 206
136 3300005327 Ga0070658_10485900 Ga0070658_104859001 206
137 3300005329 Ga0070683_100311639 Ga0070683_1003116392 206
138 3300005330 Ga0070690_100556198 Ga0070690_1005561981 206
139 3300005336 Ga0070680_100109890 Ga0070680_1001098901 206
140 3300005339 Ga0070660_100478208 Ga0070660_1004782082 206
141 3300005343 Ga0070687_100211035 Ga0070687_1002110351 206
142 3300005353 Ga0070669_100140181 Ga0070669_1001401813 206
143 3300005364 Ga0070673_100954090 Ga0070673_1009540901 206
144 3300005365 Ga0070688_100051339 Ga0070688_1000513393 206
145 3300005434 Ga0070709_10159441 Ga0070709_101594412 206
146 3300005435 Ga0070714_100003288 Ga0070714_10000328811 206
147 3300005435 Ga0070714_100309305 Ga0070714_1003093052 206
148 3300005437 Ga0070710_10047384 Ga0070710_100473842 206
149 3300005440 Ga0070705_100054251 Ga0070705_1000542511 206
150 3300005441 Ga0070700_100712784 Ga0070700_1007127842 206
151 3300005456 Ga0070678_100025730 Ga0070678_1000257302 206
152 3300005458 Ga0070681_11030727 Ga0070681_110307271 206
153 3300005459 Ga0068867_100725869 Ga0068867_1007258691 206
154 3300005459 Ga0068867_100886910 Ga0068867_1008869101 206
155 3300005535 Ga0070684_100110848 Ga0070684_1001108484 206
156 3300005536 Ga0070697_100140324 Ga0070697_1001403241 206
157 3300005539 Ga0068853_100328104 Ga0068853_1003281042 206
158 3300005544 Ga0070686_100489299 Ga0070686_1004892992 206
159 3300005545 Ga0070695_100052568 Ga0070695_1000525682 206
160 3300005545 Ga0070695_100545741 Ga0070695_1005457411 206
161 3300005547 Ga0070693_100359509 Ga0070693_1003595092 206
162 3300005548 Ga0070665_100295067 Ga0070665_1002950672 206
163 3300005548 Ga0070665_100525754 Ga0070665_1005257542 206
164 3300005563 Ga0068855_100472019 Ga0068855_1004720191 206
165 3300005563 Ga0068855_100762977 Ga0068855_1007629772 206
166 3300005564 Ga0070664_100118550 Ga0070664_1001185503 206
167 3300005614 Ga0068856_100016444 Ga0068856_1000164447 206
168 3300005614 Ga0068856_100210294 Ga0068856_1002102942 206
169 3300005617 Ga0068859_100335208 Ga0068859_1003352082 206
170 3300005617 Ga0068859_100792025 Ga0068859_1007920251 206
171 3300005844 Ga0068862_100059517 Ga0068862_1000595173 206
172 3300005844 Ga0068862_100617918 Ga0068862_1006179182 206
173 3300006038 Ga0075365_10004171 Ga0075365_100041712 206
174 3300006038 Ga0075365_10011665 Ga0075365_100116653 206
175 3300006042 Ga0075368_10012897 Ga0075368_100128973 206
176 3300006042 Ga0075368_10018094 Ga0075368_100180944 206
177 3300006048 Ga0075363_100009278 Ga0075363_1000092785 206
178 3300006048 Ga0075363_100025914 Ga0075363_1000259142 206
179 3300006051 Ga0075364_10100398 Ga0075364_101003982 206
180 3300006173 Ga0070716_100016606 Ga0070716_1000166064 206
181 3300006178 Ga0075367_10002008 Ga0075367_100020087 206
182 3300006358 Ga0068871_100892732 Ga0068871_1008927321 206
183 3300006844 Ga0075428_100000617 Ga0075428_10000061716 206
184 3300006846 Ga0075430_100045690 Ga0075430_1000456902 206
185 3300006847 Ga0075431_100108855 Ga0075431_1001088552 206
186 3300006871 Ga0075434_100811838 Ga0075434_1008118382 206
187 3300006871 Ga0075434_100992981 Ga0075434_1009929812 206
188 3300006871 Ga0075434_101018597 Ga0075434_1010185972 206
189 3300006880 Ga0075429_100430352 Ga0075429_1004303522 206
190 3300006914 Ga0075436_100004004 Ga0075436_10000400412 206
191 3300006914 Ga0075436_100004115 Ga0075436_1000041157 206
192 3300006914 Ga0075436_100090088 Ga0075436_1000900882 206
193 3300006931 Ga0097620_100335219 Ga0097620_1003352192 206
194 3300006931 Ga0097620_100792112 Ga0097620_1007921121 206
195 3300007076 Ga0075435_100667463 Ga0075435_1006674631 206
196 3300007076 Ga0075435_100694013 Ga0075435_1006940132 206
197 3300007265 Ga0099794_10017902 Ga0099794_100179024 206
198 3300009093 Ga0105240_10012327 Ga0105240_100123278 206
199 3300009093 Ga0105240_10744984 Ga0105240_107449842 206
200 3300009094 Ga0111539_10565452 Ga0111539_105654522 206
201 3300009098 Ga0105245_10051077 Ga0105245_100510772 206
202 3300009147 Ga0114129_10221243 Ga0114129_102212433 206
203 3300009174 Ga0105241_10521919 Ga0105241_105219192 206
204 3300009176 Ga0105242_10349934 Ga0105242_103499341 206
205 3300009551 Ga0105238_10345146 Ga0105238_103451462 206
206 3300009551 Ga0105238_10563447 Ga0105238_105634472 206
207 3300009553 Ga0105249_10579958 Ga0105249_105799581 206
208 3300010159 Ga0099796_10023258 Ga0099796_100232583 206
209 3300010375 Ga0105239_10522002 Ga0105239_105220022 206
210 3300013100 Ga0157373_10093120 Ga0157373_100931202 206
211 3300013105 Ga0157369_10158993 Ga0157369_101589933 206
212 3300013296 Ga0157374_10369049 Ga0157374_103690492 206
213 3300013296 Ga0157374_10720035 Ga0157374_107200352 206
214 3300013307 Ga0157372_10088796 Ga0157372_100887961 206
215 3300013307 Ga0157372_10277978 Ga0157372_102779782 206
216 3300014326 Ga0157380_10405511 Ga0157380_104055112 206
217 3300014968 Ga0157379_10659050 Ga0157379_106590501 206
218 3300021361 Ga0213872_10021062 Ga0213872_100210624 206
219 3300021384 Ga0213876_10101010 Ga0213876_101010102 206
220 3300021388 Ga0213875_10000053 Ga0213875_1000005348 206
221 3300025302 Ga0207426_1056002 Ga0207426_10560022 206
222 3300025903 Ga0207680_10402985 Ga0207680_104029852 206
223 3300025905 Ga0207685_10031288 Ga0207685_100312882 206
224 3300025905 Ga0207685_10102199 Ga0207685_101021991 206
225 3300025906 Ga0207699_10316086 Ga0207699_103160861 206
226 3300025909 Ga0207705_10241045 Ga0207705_102410451 206
227 3300025914 Ga0207671_10077285 Ga0207671_100772851 206
228 3300025917 Ga0207660_10328117 Ga0207660_103281171 206
229 3300025918 Ga0207662_10290993 Ga0207662_102909932 206
230 3300025920 Ga0207649_10189617 Ga0207649_101896172 206
231 3300025921 Ga0207652_10648679 Ga0207652_106486791 206
232 3300025921 Ga0207652_10655105 Ga0207652_106551052 206
233 3300025923 Ga0207681_10118776 Ga0207681_101187762 206
234 3300025924 Ga0207694_10499360 Ga0207694_104993602 206
235 3300025927 Ga0207687_10067357 Ga0207687_100673572 206
236 3300025927 Ga0207687_10263202 Ga0207687_102632021 206
237 3300025928 Ga0207700_10013689 Ga0207700_100136892 206
238 3300025929 Ga0207664_10033479 Ga0207664_100334794 206
239 3300025929 Ga0207664_10456388 Ga0207664_104563882 206
240 3300025937 Ga0207669_10286357 Ga0207669_102863572 206
241 3300025937 Ga0207669_10740924 Ga0207669_107409241 206
242 3300025939 Ga0207665_10067219 Ga0207665_100672192 206
243 3300025939 Ga0207665_10097939 Ga0207665_100979392 206
244 3300025940 Ga0207691_10250595 Ga0207691_102505952 206
245 3300025941 Ga0207711_10227872 Ga0207711_102278722 206
246 3300025945 Ga0207679_10081985 Ga0207679_100819853 206
247 3300025949 Ga0207667_10118214 Ga0207667_101182143 206
248 3300025949 Ga0207667_10744060 Ga0207667_107440602 206
249 3300025961 Ga0207712_10234008 Ga0207712_102340081 206
250 3300025981 Ga0207640_10341830 Ga0207640_103418301 206
251 3300025986 Ga0207658_10802301 Ga0207658_108023011 206
252 3300026023 Ga0207677_10667069 Ga0207677_106670692 206
253 3300026075 Ga0207708_10896307 Ga0207708_108963071 206
254 3300026078 Ga0207702_10064733 Ga0207702_100647333 206
255 3300026089 Ga0207648_10278555 Ga0207648_102785552 206
256 3300026118 Ga0207675_100260100 Ga0207675_1002601002 206
257 3300026121 Ga0207683_10076816 Ga0207683_100768162 206
258 3300026142 Ga0207698_10127091 Ga0207698_101270913 206
259 3300026142 Ga0207698_10678084 Ga0207698_106780842 206
260 3300027512 Ga0209179_1011531 Ga0209179_10115312 206
261 3300027671 Ga0209588_1010903 Ga0209588_10109032 206
262 3300027866 Ga0209813_10003719 Ga0209813_100037194 206
263 3300028379 Ga0268266_10095158 Ga0268266_100951582 206
264 3300028573 Ga0265334_10012318 Ga0265334_100123183 206
265 3300030763 Ga0265763_1008412 Ga0265763_10084122 206
266 3300031728 Ga0316578_10268499 Ga0316578_102684991 206
267 3300035083 Ga0373926_0022219 Ga0373926_0022219_208_858 206
268 3300035111 Ga0373923_0002771 Ga0373923_0002771_1077_1700 206
269 3300035111 Ga0373923_0078977 Ga0373923_0078977_575_1195 206
270 3300035113 Ga0373936_0003979 Ga0373936_0003979_3206_3829 206
271 3300035116 Ga0373945_0001064 Ga0373945_0001064_4938_5561 206
272 3300035117 Ga0373953_0004294 Ga0373953_0004294_594_1217 206
273 3300035118 Ga0373954_0000906 Ga0373954_0000906_4620_5243 206
274 3300035118 Ga0373954_0002609 Ga0373954_0002609_6764_7384 206
275 3300035118 Ga0373954_0058587 Ga0373954_0058587_13_633 206
276 3300035119 Ga0373956_0000029 Ga0373956_0000029_31622_32242 206
277 3300035119 Ga0373956_0033037 Ga0373956_0033037_1414_2037 206
278 3300035120 Ga0373957_0010530 Ga0373957_0010530_253_873 206
279 3300035120 Ga0373957_0015261 Ga0373957_0015261_1519_2142 206
280 3300035121 Ga0373960_0014720 Ga0373960_0014720_698_1318 206
281 3300035170 Ga0373943_0003827 Ga0373943_0003827_3169_3792 206
282 3300035171 Ga0373946_0001814 Ga0373946_0001814_6625_7248 206
283 3300035172 Ga0373955_0000201 Ga0373955_0000201_6371_6994 206
284 3300035172 Ga0373955_0003420 Ga0373955_0003420_5818_6438 206
285 3300035241 Ga0373961_0108448 Ga0373961_0108448_46_666 206
286 3300035410 Ga0373924_0062256 Ga0373924_0062256_843_1466 206
287 3300035691 Ga0373931_0049908 Ga0373931_0049908_868_1494 206
288 3300035692 Ga0373935_0000068 Ga0373935_0000068_17683_18306 206
289 3300035692 Ga0373935_0048992 Ga0373935_0048992_1861_2484 206
290 3300035695 Ga0373927_0005387 Ga0373927_0005387_2903_3526 206
291 3300035695 Ga0373927_0331838 Ga0373927_0331838_274_897 206
292 3300035724 Ga0373933_0002902 Ga0373933_0002902_7663_8286 206
293 3300035724 Ga0373933_0003207 Ga0373933_0003207_4871_5491 206
294 3300035724 Ga0373933_0534282 Ga0373933_0534282_11_634 206
295 3300035724 Ga0373933_0647813 Ga0373933_0647813_64_684 206
296 3300035725 Ga0373947_0002537 Ga0373947_0002537_10172_10795 206
297 3300036401 Ga0373937_0000347 Ga0373937_0000347_5372_5995 206
298 3300036401 Ga0373937_0000441 Ga0373937_0000441_29866_30486 206
299 3300036401 Ga0373937_0045533 Ga0373937_0045533_218_838 206
300 3300036647 Ga0316582_0245053 Ga0316582_0245053_159_779 206
301 3300037068 Ga0373925_0000081 Ga0373925_0000081_44532_45155 206
302 3300037068 Ga0373925_0250494 Ga0373925_0250494_760_1383 206
303 3300037068 Ga0373925_0638458 Ga0373925_0638458_168_791 206
304 3300037312 Ga0395899_0014903 Ga0395899_0014903_483_1145 206
305 3300037312 Ga0395899_0096464 Ga0395899_0096464_1472_2098 206
306 3300037418 Ga0395900_0008428 Ga0395900_0008428_7990_8616 206
307 3300037418 Ga0395900_0143324 Ga0395900_0143324_1718_2380 206
308 3300037466 Ga0395898_0082166 Ga0395898_0082166_1030_1692 206
309 3300037466 Ga0395898_0138981 Ga0395898_0138981_1054_1680 206
310 3300037466 Ga0395898_0331558 Ga0395898_0331558_514_1191 206
311 3300037853 Ga0436364_0951864 Ga0436364_0951864_623_1246 206
312 3300038443 Ga0395901_0009788 Ga0395901_0009788_6732_7394 206
313 3300038443 Ga0395901_0018877 Ga0395901_0018877_3008_3634 206
314 3300038443 Ga0395901_0137101 Ga0395901_0137101_1189_1815 206
315 3300039437 Ga0436365_1099387 Ga0436365_1099387_1192_1815 206
316 3300039438 Ga0436360_0291491 Ga0436360_0291491_46_669 206
317 3300039438 Ga0436360_0775077 Ga0436360_0775077_157_780 206
318 3300039447 Ga0436361_0424457 Ga0436361_0424457_1047_1679 206
319 3300039447 Ga0436361_0914825 Ga0436361_0914825_90_713 206
320 3300039450 Ga0436363_0235431 Ga0436363_0235431_107_730 206
321 3300039450 Ga0436363_1012681 Ga0436363_1012681_788_1426 206
322 3300044694 Ga0466963_0025164 Ga0466963_0025164_581_1204 206
323 3300045051 Ga0451576_0295185 Ga0451576_0295185_123_743 206
324 3300045976 Ga0466967_0320079 Ga0466967_0320079_725_1348 206
325 3300046454 Ga0495592_0000196 Ga0495592_0000196_28725_29348 206
326 3300046454 Ga0495592_0022021 Ga0495592_0022021_3004_3624 206
327 3300046455 Ga0495603_0165172 Ga0495603_0165172_113_736 206
328 3300046459 Ga0495629_0003904 Ga0495629_0003904_3821_4444 206
329 3300046462 Ga0495651_0000356 Ga0495651_0000356_4597_5217 206
330 3300046462 Ga0495651_0000977 Ga0495651_0000977_8642_9265 206
331 3300046463 Ga0495653_0000193 Ga0495653_0000193_28780_29403 206
332 3300046463 Ga0495653_0367836 Ga0495653_0367836_21_641 206
333 3300046476 Ga0495662_0060059 Ga0495662_0060059_956_1579 206
334 3300046477 Ga0495664_0000016 Ga0495664_0000016_106235_106858 206
335 3300046511 Ga0495608_0000121 Ga0495608_0000121_17777_18400 206
336 3300046514 Ga0495618_0000124 Ga0495618_0000124_17796_18419 206
337 3300046516 Ga0495628_0000018 Ga0495628_0000018_63059_63682 206
338 3300046516 Ga0495628_0015254 Ga0495628_0015254_4001_4621 206
339 3300046517 Ga0495630_0002180 Ga0495630_0002180_9376_9999 206
340 3300046517 Ga0495630_0088692 Ga0495630_0088692_198_818 206
341 3300046529 Ga0495652_0000005 Ga0495652_0000005_376212_376835 206
342 3300046529 Ga0495652_0006146 Ga0495652_0006146_5861_6481 206
343 3300046533 Ga0495640_0000063 Ga0495640_0000063_21867_22490 206
344 3300046536 Ga0495587_0000134 Ga0495587_0000134_37768_38391 206
345 3300046543 Ga0495645_0000070 Ga0495645_0000070_39516_40139 206
346 3300046543 Ga0495645_0006688 Ga0495645_0006688_3478_4098 206
347 3300046559 Ga0495667_0000023 Ga0495667_0000023_129124_129747 206
348 3300046642 Ga0495634_0000241 Ga0495634_0000241_8649_9272 206
349 3300046642 Ga0495634_0131184 Ga0495634_0131184_832_1455 206
350 3300046663 Ga0495635_0000045 Ga0495635_0000045_43864_44487 206
351 3300046675 Ga0495657_0001202 Ga0495657_0001202_473_1096 206
352 3300046675 Ga0495657_0054030 Ga0495657_0054030_619_1239 206
353 3300046675 Ga0495657_0297955 Ga0495657_0297955_79_699 206
354 3300046678 Ga0495599_0000107 Ga0495599_0000107_37800_38423 206
355 3300046678 Ga0495599_0016176 Ga0495599_0016176_536_1156 206
356 3300046678 Ga0495599_0271096 Ga0495599_0271096_247_867 206
357 3300046679 Ga0495623_0000180 Ga0495623_0000180_29883_30506 206
358 3300046680 Ga0495646_0000027 Ga0495646_0000027_52328_52951 206
359 3300046683 Ga0495658_0020639 Ga0495658_0020639_2818_3441 206
360 3300046689 Ga0495613_0056616 Ga0495613_0056616_1278_1901 206
361 3300046690 Ga0495624_0093253 Ga0495624_0093253_116_739 206
362 3300046809 Ga0495600_0000062 Ga0495600_0000062_28831_29454 206
363 3300047317 Ga0495604_0000014 Ga0495604_0000014_57323_57946 206
364 3300047319 Ga0495674_0000014 Ga0495674_0000014_183294_183917 206
365 3300047322 Ga0495680_0000779 Ga0495680_0000779_7160_7783 206
366 3300047322 Ga0495680_0199616 Ga0495680_0199616_318_938 206
367 3300047444 Ga0495675_0000058 Ga0495675_0000058_37731_38354 206
368 3300047471 Ga0495684_0000059 Ga0495684_0000059_37772_38395 206
369 3300047673 Ga0495593_0005129 Ga0495593_0005129_3938_4561 206
370 3300048088 Ga0495602_0000017 Ga0495602_0000017_143900_144523 206
371 3300048904 Ga0496101_0018180 Ga0496101_0018180_2702_3325 206
372 3300048905 Ga0496102_0576835 Ga0496102_0576835_165_788 206
373 3300048907 Ga0496104_0001978 Ga0496104_0001978_13587_14210 206
374 3300048908 Ga0496105_0061405 Ga0496105_0061405_1359_1982 206
375 3300048911 Ga0496108_0005996 Ga0496108_0005996_548_1171 206
376 3300048911 Ga0496108_0077240 Ga0496108_0077240_2139_2762 206
377 3300048912 Ga0496109_0022511 Ga0496109_0022511_4601_5224 206
378 3300048912 Ga0496109_0586258 Ga0496109_0586258_245_868 206
379 3300048913 Ga0496110_0003146 Ga0496110_0003146_11285_11908 206
380 3300048915 Ga0496112_0003807 Ga0496112_0003807_10904_11527 206
381 3300048915 Ga0496112_0233439 Ga0496112_0233439_249_875 206
382 3300048916 Ga0496113_0075665 Ga0496113_0075665_452_1075 206
383 3300049568 Ga0501031_0023742 Ga0501031_0023742_1858_2478 206
384 3300049569 Ga0501032_0175050 Ga0501032_0175050_593_1213 206
385 3300049570 Ga0501033_0058028 Ga0501033_0058028_1311_1931 206
386 3300049571 Ga0501034_0000891 Ga0501034_0000891_4953_5576 206
387 3300049571 Ga0501034_0011745 Ga0501034_0011745_7203_7826 206
388 3300049571 Ga0501034_0234213 Ga0501034_0234213_386_1015 206
389 3300049572 Ga0501036_0171303 Ga0501036_0171303_116_736 206
390 3300049574 Ga0501038_0580131 Ga0501038_0580131_93_713 206
391 3300049575 Ga0501039_0008570 Ga0501039_0008570_1913_2533 206
392 3300049576 Ga0501040_0015963 Ga0501040_0015963_4297_4917 206
393 3300049577 Ga0501041_0033918 Ga0501041_0033918_10_630 206
394 3300049578 Ga0501042_0006103 Ga0501042_0006103_50_670 206
395 3300049578 Ga0501042_0291971 Ga0501042_0291971_285_908 206
396 3300049579 Ga0501043_0016253 Ga0501043_0016253_4578_5198 206
397 3300049579 Ga0501043_0059010 Ga0501043_0059010_2317_2946 206
398 3300049580 Ga0501046_0124912 Ga0501046_0124912_145_765 206
399 3300049580 Ga0501046_0266063 Ga0501046_0266063_330_953 206
400 3300049581 Ga0501047_0610694 Ga0501047_0610694_73_696 206
401 3300049582 Ga0501048_0011307 Ga0501048_0011307_4398_5018 206
402 3300049584 Ga0501068_0017211 Ga0501068_0017211_2683_3306 206
403 3300049585 Ga0501069_0041972 Ga0501069_0041972_1017_1637 206
404 3300049585 Ga0501069_0047991 Ga0501069_0047991_1396_2016 206
405 3300049586 Ga0501070_0003987 Ga0501070_0003987_11845_12465 206
406 3300049586 Ga0501070_0185817 Ga0501070_0185817_131_751 206
407 3300049586 Ga0501070_0787475 Ga0501070_0787475_38_661 206
408 3300049587 Ga0501071_0007220 Ga0501071_0007220_6411_7031 206
409 3300049587 Ga0501071_0671147 Ga0501071_0671147_141_764 206
410 3300049589 Ga0501073_0400560 Ga0501073_0400560_182_802 206
411 3300049590 Ga0501074_0001669 Ga0501074_0001669_3569_4189 206
412 3300049590 Ga0501074_0116108 Ga0501074_0116108_216_836 206
413 3300049591 Ga0501075_0038416 Ga0501075_0038416_1074_1694 206
414 3300049591 Ga0501075_0248755 Ga0501075_0248755_534_1154 206
415 3300049591 Ga0501075_0412224 Ga0501075_0412224_76_699 206
416 3300049591 Ga0501075_0451005 Ga0501075_0451005_311_934 206
417 3300049592 Ga0501076_0019950 Ga0501076_0019950_2614_3234 206
418 3300049592 Ga0501076_0166618 Ga0501076_0166618_224_847 206
419 3300049593 Ga0501077_0038035 Ga0501077_0038035_1891_2511 206
420 3300049741 Ga0501079_0142427 Ga0501079_0142427_1198_1818 206
421 3300049741 Ga0501079_0299090 Ga0501079_0299090_372_995 206
422 3300049742 Ga0501080_0049205 Ga0501080_0049205_1718_2338 206
423 3300049742 Ga0501080_0306962 Ga0501080_0306962_515_1135 206
424 3300049744 Ga0501083_0278715 Ga0501083_0278715_357_980 206
425 3300049822 Ga0501035_0102447 Ga0501035_0102447_50_670 206
426 3300049823 Ga0501044_0058411 Ga0501044_0058411_1733_2356 206
427 3300049823 Ga0501044_0435136 Ga0501044_0435136_125_754 206
428 3300049824 Ga0501045_0007001 Ga0501045_0007001_4966_5586 206
429 3300050490 nmdc:mga03n38_3932_c1 nmdc:mga03n38_3932_c1_2396_3019 206
430 3300050492 nmdc:mga0yw44_176483_c1 nmdc:mga0yw44_176483_c1_523_1146 206
431 3300050494 nmdc:mga06z11_39475_c1 nmdc:mga06z11_39475_c1_1163_1783 206
432 3300050494 nmdc:mga06z11_790_c1 nmdc:mga06z11_790_c1_10033_10656 206
433 3300050494 nmdc:mga06z11_9739_c1 nmdc:mga06z11_9739_c1_1379_1999 206
434 3300050507 nmdc:mga05p37_182270_c1 nmdc:mga05p37_182270_c1_232_855 206
435 3300050508 nmdc:mga09592_351191_c1 nmdc:mga09592_351191_c1_26_649 206
436 3300050508 nmdc:mga09592_452835_c1 nmdc:mga09592_452835_c1_315_938 206
437 3300050509 nmdc:mga0qj67_69955_c1 nmdc:mga0qj67_69955_c1_220_843 206
438 3300050509 nmdc:mga0qj67_72478_c1 nmdc:mga0qj67_72478_c1_1623_2246 206
439 3300050510 nmdc:mga06r32_118534_c1 nmdc:mga06r32_118534_c1_1372_1995 206
440 3300050510 nmdc:mga06r32_274046_c1 nmdc:mga06r32_274046_c1_65_688 206
441 3300050510 nmdc:mga06r32_5683_c1 nmdc:mga06r32_5683_c1_9236_9859 206
442 3300050512 nmdc:mga0n895_454272_c1 nmdc:mga0n895_454272_c1_61_684 206
443 3300050512 nmdc:mga0n895_809489_c1 nmdc:mga0n895_809489_c1_230_853 206
444 3300050512 nmdc:mga0n895_938110_c1 nmdc:mga0n895_938110_c1_182_802 206
445 3300050512 nmdc:mga0n895_98294_c1 nmdc:mga0n895_98294_c1_2043_2714 206
446 3300050513 nmdc:mga0rr50_137244_c1 nmdc:mga0rr50_137244_c1_33_656 206
447 3300050513 nmdc:mga0rr50_95527_c1 nmdc:mga0rr50_95527_c1_149_772 206
448 3300050514 nmdc:mga08x19_3673_c1 nmdc:mga08x19_3673_c1_2478_3098 206
449 3300050514 nmdc:mga08x19_40687_c1 nmdc:mga08x19_40687_c1_170_793 206
450 3300050515 nmdc:mga0a205_342822_c1 nmdc:mga0a205_342822_c1_676_1296 206
451 3300053077 Ga0495601_0000016 Ga0495601_0000016_143900_144523 206
452 3300053077 Ga0495601_0006967 Ga0495601_0006967_4505_5125 206
453 3300053077 Ga0495601_0011070 Ga0495601_0011070_4315_4938 206
454 3300053078 Ga0495612_0000041 Ga0495612_0000041_17740_18363 206
455 3300053084 Ga0495595_0000048 Ga0495595_0000048_11033_11656 206
456 3300053085 Ga0495619_0000050 Ga0495619_0000050_62960_63583 206
457 3300053085 Ga0495619_0041669 Ga0495619_0041669_1262_1885 206
458 3300053139 Ga0500568_0052584 Ga0500568_0052584_931_1554 206
459 3300053153 Ga0500616_0036435 Ga0500616_0036435_1924_2544 206
460 3300054114 Ga0501084_0023539 Ga0501084_0023539_1163_1783 206
461 3300060353 Ga0501082_0026550 Ga0501082_0026550_2249_2869 206
462 3300001990 JGI24737J22298_10023897 JGI24737J22298_100238974 207
463 3300001991 JGI24743J22301_10000589 JGI24743J22301_100005895 207
464 3300002075 JGI24738J21930_10011323 JGI24738J21930_100113231 207
465 3300002244 JGI24742J22300_10000606 JGI24742J22300_100006066 207
466 3300003659 JGI25404J52841_10004866 JGI25404J52841_100048664 207
467 3300005329 Ga0070683_100040594 Ga0070683_1000405943 207
468 3300005330 Ga0070690_100015826 Ga0070690_1000158264 207
469 3300005331 Ga0070670_100028487 Ga0070670_1000284875 207
470 3300005331 Ga0070670_100071135 Ga0070670_1000711352 207
471 3300005334 Ga0068869_100216323 Ga0068869_1002163234 207
472 3300005335 Ga0070666_10088544 Ga0070666_100885442 207
473 3300005337 Ga0070682_100022863 Ga0070682_1000228632 207
474 3300005337 Ga0070682_100605448 Ga0070682_1006054481 207
475 3300005338 Ga0068868_100009632 Ga0068868_1000096328 207
476 3300005338 Ga0068868_100353123 Ga0068868_1003531231 207
477 3300005339 Ga0070660_100195675 Ga0070660_1001956752 207
478 3300005340 Ga0070689_100001113 Ga0070689_1000011135 207
479 3300005340 Ga0070689_100194769 Ga0070689_1001947691 207
480 3300005343 Ga0070687_100199493 Ga0070687_1001994932 207
481 3300005344 Ga0070661_100881023 Ga0070661_1008810231 207
482 3300005345 Ga0070692_10022160 Ga0070692_100221604 207
483 3300005347 Ga0070668_100113320 Ga0070668_1001133204 207
484 3300005353 Ga0070669_100206839 Ga0070669_1002068391 207
485 3300005354 Ga0070675_100018009 Ga0070675_1000180095 207
486 3300005354 Ga0070675_100445561 Ga0070675_1004455612 207
487 3300005355 Ga0070671_100010831 Ga0070671_1000108314 207
488 3300005356 Ga0070674_100026532 Ga0070674_1000265324 207
489 3300005364 Ga0070673_100003804 Ga0070673_10000380411 207
490 3300005364 Ga0070673_100227319 Ga0070673_1002273192 207
491 3300005365 Ga0070688_100005939 Ga0070688_1000059394 207
492 3300005365 Ga0070688_100028550 Ga0070688_1000285504 207
493 3300005366 Ga0070659_100410292 Ga0070659_1004102922 207
494 3300005366 Ga0070659_100994151 Ga0070659_1009941511 207
495 3300005367 Ga0070667_100029214 Ga0070667_1000292145 207
496 3300005406 Ga0070703_10010838 Ga0070703_100108383 207
497 3300005434 Ga0070709_10011931 Ga0070709_100119315 207
498 3300005435 Ga0070714_100058344 Ga0070714_1000583442 207
499 3300005435 Ga0070714_100206856 Ga0070714_1002068562 207
500 3300005435 Ga0070714_100665610 Ga0070714_1006656101 207
501 3300005436 Ga0070713_100022225 Ga0070713_1000222255 207
502 3300005436 Ga0070713_100108922 Ga0070713_1001089224 207
503 3300005436 Ga0070713_100125140 Ga0070713_1001251402 207
504 3300005436 Ga0070713_100586417 Ga0070713_1005864172 207
505 3300005439 Ga0070711_100028231 Ga0070711_1000282314 207
506 3300005439 Ga0070711_100036765 Ga0070711_1000367651 207
507 3300005439 Ga0070711_100080849 Ga0070711_1000808492 207
508 3300005439 Ga0070711_100142841 Ga0070711_1001428413 207
509 3300005440 Ga0070705_100189603 Ga0070705_1001896032 207
510 3300005441 Ga0070700_100066485 Ga0070700_1000664854 207
511 3300005444 Ga0070694_100585525 Ga0070694_1005855251 207
512 3300005455 Ga0070663_100086303 Ga0070663_1000863031 207
513 3300005455 Ga0070663_100358866 Ga0070663_1003588661 207
514 3300005456 Ga0070678_100376024 Ga0070678_1003760243 207
515 3300005457 Ga0070662_100019278 Ga0070662_1000192786 207
516 3300005458 Ga0070681_10523966 Ga0070681_105239661 207
517 3300005459 Ga0068867_100019113 Ga0068867_1000191134 207
518 3300005466 Ga0070685_10008870 Ga0070685_100088704 207
519 3300005471 Ga0070698_100807164 Ga0070698_1008071641 207
520 3300005518 Ga0070699_100123881 Ga0070699_1001238811 207
521 3300005518 Ga0070699_101090168 Ga0070699_1010901681 207
522 3300005535 Ga0070684_100165021 Ga0070684_1001650212 207
523 3300005535 Ga0070684_100436286 Ga0070684_1004362863 207
524 3300005536 Ga0070697_100036459 Ga0070697_1000364595 207
525 3300005543 Ga0070672_100014289 Ga0070672_1000142893 207
526 3300005544 Ga0070686_100015033 Ga0070686_1000150336 207
527 3300005544 Ga0070686_100122087 Ga0070686_1001220872 207
528 3300005548 Ga0070665_100176983 Ga0070665_1001769832 207
529 3300005548 Ga0070665_100374217 Ga0070665_1003742171 207
530 3300005548 Ga0070665_100836225 Ga0070665_1008362252 207
531 3300005549 Ga0070704_100377119 Ga0070704_1003771191 207
532 3300005549 Ga0070704_100543519 Ga0070704_1005435191 207
533 3300005549 Ga0070704_100807306 Ga0070704_1008073061 207
534 3300005564 Ga0070664_100171265 Ga0070664_1001712651 207
535 3300005578 Ga0068854_100016650 Ga0068854_1000166505 207
536 3300005614 Ga0068856_100502094 Ga0068856_1005020942 207
537 3300005615 Ga0070702_100008194 Ga0070702_1000081945 207
538 3300005617 Ga0068859_100025009 Ga0068859_1000250094 207
539 3300005618 Ga0068864_100001978 Ga0068864_1000019782 207
540 3300005718 Ga0068866_10011518 Ga0068866_100115184 207
541 3300005834 Ga0068851_10025091 Ga0068851_100250912 207
542 3300005840 Ga0068870_10014577 Ga0068870_100145774 207
543 3300005841 Ga0068863_100019233 Ga0068863_1000192334 207
544 3300005842 Ga0068858_100022418 Ga0068858_1000224184 207
545 3300005842 Ga0068858_100116932 Ga0068858_1001169324 207
546 3300005842 Ga0068858_100184675 Ga0068858_1001846753 207
547 3300005843 Ga0068860_100054877 Ga0068860_1000548774 207
548 3300005843 Ga0068860_101087720 Ga0068860_1010877201 207
549 3300005844 Ga0068862_100024602 Ga0068862_1000246023 207
550 3300005844 Ga0068862_100283175 Ga0068862_1002831753 207
551 3300005937 Ga0081455_10001354 Ga0081455_1000135422 207
552 3300005937 Ga0081455_10300774 Ga0081455_103007741 207
553 3300005981 Ga0081538_10034525 Ga0081538_100345252 207
554 3300005981 Ga0081538_10150658 Ga0081538_101506582 207
555 3300005983 Ga0081540_1001046 Ga0081540_100104610 207
556 3300005983 Ga0081540_1002282 Ga0081540_100228210 207
557 3300005983 Ga0081540_1003104 Ga0081540_10031047 207
558 3300005983 Ga0081540_1100145 Ga0081540_11001452 207
559 3300006028 Ga0070717_10247489 Ga0070717_102474892 207
560 3300006028 Ga0070717_10349049 Ga0070717_103490493 207
561 3300006038 Ga0075365_10009965 Ga0075365_100099656 207
562 3300006038 Ga0075365_10208576 Ga0075365_102085763 207
563 3300006038 Ga0075365_10247488 Ga0075365_102474882 207
564 3300006038 Ga0075365_10352560 Ga0075365_103525602 207
565 3300006038 Ga0075365_10572926 Ga0075365_105729261 207
566 3300006051 Ga0075364_10124588 Ga0075364_101245882 207
567 3300006163 Ga0070715_10005759 Ga0070715_100057597 207
568 3300006175 Ga0070712_100076048 Ga0070712_1000760484 207
569 3300006175 Ga0070712_100579723 Ga0070712_1005797232 207
570 3300006237 Ga0097621_100020748 Ga0097621_1000207485 207
571 3300006353 Ga0075370_10038028 Ga0075370_100380282 207
572 3300006353 Ga0075370_10108901 Ga0075370_101089012 207
573 3300006358 Ga0068871_100016774 Ga0068871_1000167744 207
574 3300006844 Ga0075428_100062074 Ga0075428_1000620742 207
575 3300006844 Ga0075428_100082995 Ga0075428_1000829952 207
576 3300006844 Ga0075428_100378884 Ga0075428_1003788843 207
577 3300006844 Ga0075428_100532816 Ga0075428_1005328162 207
578 3300006844 Ga0075428_100578115 Ga0075428_1005781151 207
579 3300006847 Ga0075431_100073995 Ga0075431_1000739952 207
580 3300006847 Ga0075431_100820232 Ga0075431_1008202322 207
581 3300006852 Ga0075433_10043573 Ga0075433_100435732 207
582 3300006852 Ga0075433_10622550 Ga0075433_106225502 207
583 3300006871 Ga0075434_100070901 Ga0075434_1000709015 207
584 3300006871 Ga0075434_100131094 Ga0075434_1001310942 207
585 3300006871 Ga0075434_100540835 Ga0075434_1005408352 207
586 3300006871 Ga0075434_100622901 Ga0075434_1006229012 207
587 3300006880 Ga0075429_100271902 Ga0075429_1002719022 207
588 3300006881 Ga0068865_100174258 Ga0068865_1001742582 207
589 3300006931 Ga0097620_100025009 Ga0097620_1000250095 207
590 3300007076 Ga0075435_100275497 Ga0075435_1002754973 207
591 3300007076 Ga0075435_100316413 Ga0075435_1003164132 207
592 3300007265 Ga0099794_10011365 Ga0099794_100113655 207
593 3300007265 Ga0099794_10019828 Ga0099794_100198282 207
594 3300007788 Ga0099795_10059973 Ga0099795_100599732 207
595 3300009011 Ga0105251_10019995 Ga0105251_100199954 207
596 3300009092 Ga0105250_10036971 Ga0105250_100369713 207
597 3300009094 Ga0111539_10089724 Ga0111539_100897244 207
598 3300009094 Ga0111539_10150665 Ga0111539_101506652 207
599 3300009094 Ga0111539_10286824 Ga0111539_102868242 207
600 3300009094 Ga0111539_10578423 Ga0111539_105784232 207
601 3300009094 Ga0111539_11212562 Ga0111539_112125621 207
602 3300009098 Ga0105245_10231631 Ga0105245_102316311 207
603 3300009098 Ga0105245_11406078 Ga0105245_114060781 207
604 3300009147 Ga0114129_10011617 Ga0114129_100116177 207
605 3300009147 Ga0114129_10048513 Ga0114129_100485133 207
606 3300009147 Ga0114129_10349571 Ga0114129_103495714 207
607 3300009147 Ga0114129_11039546 Ga0114129_110395462 207
608 3300009147 Ga0114129_11487948 Ga0114129_114879481 207
609 3300009147 Ga0114129_11489605 Ga0114129_114896051 207
610 3300009148 Ga0105243_10440664 Ga0105243_104406642 207
611 3300009148 Ga0105243_10605780 Ga0105243_106057802 207
612 3300009176 Ga0105242_10028336 Ga0105242_100283362 207
613 3300009177 Ga0105248_10623085 Ga0105248_106230851 207
614 3300009545 Ga0105237_10028064 Ga0105237_100280645 207
615 3300009551 Ga0105238_10037417 Ga0105238_100374174 207
616 3300009553 Ga0105249_10015086 Ga0105249_100150866 207
617 3300009553 Ga0105249_10672243 Ga0105249_106722432 207
618 3300010159 Ga0099796_10010230 Ga0099796_100102302 207
619 3300010375 Ga0105239_10031952 Ga0105239_100319526 207
620 3300010375 Ga0105239_10188702 Ga0105239_101887021 207
621 3300010375 Ga0105239_10308693 Ga0105239_103086932 207
622 3300010375 Ga0105239_11216837 Ga0105239_112168371 207
623 3300013105 Ga0157369_10541407 Ga0157369_105414072 207
624 3300013296 Ga0157374_10083923 Ga0157374_100839232 207
625 3300013308 Ga0157375_10009835 Ga0157375_1000983510 207
626 3300013308 Ga0157375_10796818 Ga0157375_107968182 207
627 3300014325 Ga0163163_10303939 Ga0163163_103039394 207
628 3300014325 Ga0163163_10372967 Ga0163163_103729672 207
629 3300014325 Ga0163163_10390837 Ga0163163_103908372 207
630 3300014326 Ga0157380_10710931 Ga0157380_107109311 207
631 3300014745 Ga0157377_10004874 Ga0157377_100048746 207
632 3300014968 Ga0157379_10027886 Ga0157379_100278865 207
633 3300014969 Ga0157376_10135733 Ga0157376_101357334 207
634 3300017792 Ga0163161_10120185 Ga0163161_101201854 207
635 3300017792 Ga0163161_10780922 Ga0163161_107809221 207
636 3300021384 Ga0213876_10077341 Ga0213876_100773413 207
637 3300021384 Ga0213876_10099408 Ga0213876_100994083 207
638 3300021388 Ga0213875_10158083 Ga0213875_101580831 207
639 3300024225 Ga0224572_1004891 Ga0224572_10048912 207
640 3300024227 Ga0228598_1000876 Ga0228598_10008763 207
641 3300024227 Ga0228598_1020313 Ga0228598_10203131 207
642 3300025315 Ga0207697_10030261 Ga0207697_100302612 207
643 3300025315 Ga0207697_10032524 Ga0207697_100325242 207
644 3300025321 Ga0207656_10016209 Ga0207656_100162092 207
645 3300025898 Ga0207692_10226083 Ga0207692_102260832 207
646 3300025899 Ga0207642_10013018 Ga0207642_100130182 207
647 3300025901 Ga0207688_10003415 Ga0207688_100034152 207
648 3300025903 Ga0207680_10008657 Ga0207680_100086573 207
649 3300025904 Ga0207647_10064910 Ga0207647_100649102 207
650 3300025906 Ga0207699_10014408 Ga0207699_100144082 207
651 3300025907 Ga0207645_10048865 Ga0207645_100488652 207
652 3300025907 Ga0207645_10049992 Ga0207645_100499923 207
653 3300025907 Ga0207645_10398827 Ga0207645_103988271 207
654 3300025908 Ga0207643_10005672 Ga0207643_100056725 207
655 3300025910 Ga0207684_10096437 Ga0207684_100964372 207
656 3300025912 Ga0207707_10379776 Ga0207707_103797761 207
657 3300025914 Ga0207671_10214673 Ga0207671_102146732 207
658 3300025915 Ga0207693_10002485 Ga0207693_100024857 207
659 3300025915 Ga0207693_10041146 Ga0207693_100411466 207
660 3300025915 Ga0207693_10063092 Ga0207693_100630922 207
661 3300025915 Ga0207693_10226341 Ga0207693_102263413 207
662 3300025915 Ga0207693_10284764 Ga0207693_102847642 207
663 3300025915 Ga0207693_10458723 Ga0207693_104587231 207
664 3300025916 Ga0207663_10045292 Ga0207663_100452922 207
665 3300025916 Ga0207663_10118085 Ga0207663_101180852 207
666 3300025919 Ga0207657_10100027 Ga0207657_101000274 207
667 3300025919 Ga0207657_10554022 Ga0207657_105540221 207
668 3300025922 Ga0207646_10268358 Ga0207646_102683582 207
669 3300025924 Ga0207694_10129583 Ga0207694_101295832 207
670 3300025925 Ga0207650_10031312 Ga0207650_100313123 207
671 3300025925 Ga0207650_10071529 Ga0207650_100715292 207
672 3300025925 Ga0207650_10149991 Ga0207650_101499911 207
673 3300025926 Ga0207659_10298422 Ga0207659_102984222 207
674 3300025926 Ga0207659_10309531 Ga0207659_103095312 207
675 3300025926 Ga0207659_10552690 Ga0207659_105526901 207
676 3300025927 Ga0207687_10006331 Ga0207687_100063319 207
677 3300025928 Ga0207700_10078066 Ga0207700_100780663 207
678 3300025928 Ga0207700_10153148 Ga0207700_101531481 207
679 3300025928 Ga0207700_10178347 Ga0207700_101783472 207
680 3300025928 Ga0207700_10225900 Ga0207700_102259002 207
681 3300025928 Ga0207700_10308481 Ga0207700_103084812 207
682 3300025928 Ga0207700_10334744 Ga0207700_103347443 207
683 3300025929 Ga0207664_10333892 Ga0207664_103338921 207
684 3300025931 Ga0207644_10023230 Ga0207644_100232304 207
685 3300025931 Ga0207644_10038217 Ga0207644_100382174 207
686 3300025931 Ga0207644_10525956 Ga0207644_105259562 207
687 3300025932 Ga0207690_10018700 Ga0207690_100187004 207
688 3300025932 Ga0207690_10104102 Ga0207690_101041024 207
689 3300025933 Ga0207706_10038206 Ga0207706_100382064 207
690 3300025936 Ga0207670_10017680 Ga0207670_100176805 207
691 3300025936 Ga0207670_10020641 Ga0207670_100206411 207
692 3300025937 Ga0207669_10005520 Ga0207669_100055207 207
693 3300025939 Ga0207665_10004102 Ga0207665_100041025 207
694 3300025939 Ga0207665_10855171 Ga0207665_108551711 207
695 3300025940 Ga0207691_10001627 Ga0207691_1000162719 207
696 3300025941 Ga0207711_10101018 Ga0207711_101010182 207
697 3300025941 Ga0207711_10472488 Ga0207711_104724882 207
698 3300025942 Ga0207689_10007012 Ga0207689_100070129 207
699 3300025944 Ga0207661_10106947 Ga0207661_101069471 207
700 3300025945 Ga0207679_10015638 Ga0207679_100156385 207
701 3300025945 Ga0207679_10230954 Ga0207679_102309542 207
702 3300025960 Ga0207651_10135996 Ga0207651_101359964 207
703 3300025960 Ga0207651_10269391 Ga0207651_102693912 207
704 3300025972 Ga0207668_10007545 Ga0207668_100075454 207
705 3300025981 Ga0207640_10019201 Ga0207640_100192014 207
706 3300025986 Ga0207658_10096845 Ga0207658_100968454 207
707 3300026023 Ga0207677_10126300 Ga0207677_101263002 207
708 3300026023 Ga0207677_10391944 Ga0207677_103919442 207
709 3300026035 Ga0207703_10167640 Ga0207703_101676402 207
710 3300026035 Ga0207703_10525085 Ga0207703_105250851 207
711 3300026035 Ga0207703_10686420 Ga0207703_106864202 207
712 3300026041 Ga0207639_10158101 Ga0207639_101581014 207
713 3300026067 Ga0207678_10020051 Ga0207678_100200512 207
714 3300026067 Ga0207678_10334683 Ga0207678_103346832 207
715 3300026067 Ga0207678_10370403 Ga0207678_103704032 207
716 3300026075 Ga0207708_10001502 Ga0207708_100015029 207
717 3300026078 Ga0207702_11400396 Ga0207702_114003961 207
718 3300026089 Ga0207648_10006668 Ga0207648_100066687 207
719 3300026089 Ga0207648_10074077 Ga0207648_100740774 207
720 3300026095 Ga0207676_10018586 Ga0207676_100185865 207
721 3300026118 Ga0207675_100013475 Ga0207675_1000134759 207
722 3300026121 Ga0207683_10012333 Ga0207683_100123335 207
723 3300026121 Ga0207683_10547128 Ga0207683_105471281 207
724 3300027671 Ga0209588_1027516 Ga0209588_10275163 207
725 3300028379 Ga0268266_10286712 Ga0268266_102867121 207
726 3300028379 Ga0268266_10494120 Ga0268266_104941203 207
727 3300028379 Ga0268266_10760726 Ga0268266_107607261 207
728 3300028380 Ga0268265_10011597 Ga0268265_100115975 207
729 3300028380 Ga0268265_10597576 Ga0268265_105975761 207
730 3300028381 Ga0268264_10858049 Ga0268264_108580491 207
731 3300028800 Ga0265338_10151314 Ga0265338_101513142 207
732 3300030763 Ga0265763_1007016 Ga0265763_10070161 207
733 3300031018 Ga0265773_1006882 Ga0265773_10068821 207
734 3300031238 Ga0265332_10006574 Ga0265332_100065746 207
735 3300031241 Ga0265325_10002317 Ga0265325_100023173 207
736 3300031242 Ga0265329_10070499 Ga0265329_100704992 207
737 3300031247 Ga0265340_10015062 Ga0265340_100150622 207
738 3300031249 Ga0265339_10000078 Ga0265339_1000007869 207
739 3300031249 Ga0265339_10019601 Ga0265339_100196015 207
740 3300031250 Ga0265331_10154151 Ga0265331_101541512 207
741 3300031344 Ga0265316_10228627 Ga0265316_102286272 207
742 3300031595 Ga0265313_10003528 Ga0265313_100035284 207
743 3300031711 Ga0265314_10022239 Ga0265314_100222392 207
744 3300031712 Ga0265342_10002635 Ga0265342_100026356 207
745 3300035085 Ga0373929_0111511 Ga0373929_0111511_51_677 207
746 3300035089 Ga0373944_0024358 Ga0373944_0024358_72_698 207
747 3300035092 Ga0373952_0114059 Ga0373952_0114059_64_690 207
748 3300035113 Ga0373936_0010496 Ga0373936_0010496_2431_3054 207
749 3300035116 Ga0373945_0005949 Ga0373945_0005949_598_1221 207
750 3300035170 Ga0373943_0000208 Ga0373943_0000208_5568_6194 207
751 3300035170 Ga0373943_0032102 Ga0373943_0032102_1175_1798 207
752 3300035170 Ga0373943_0058368 Ga0373943_0058368_1048_1758 207
753 3300035171 Ga0373946_0006567 Ga0373946_0006567_598_1224 207
754 3300035171 Ga0373946_0020608 Ga0373946_0020608_1659_2282 207
755 3300035207 Ga0373942_0088537 Ga0373942_0088537_73_699 207
756 3300035207 Ga0373942_0185417 Ga0373942_0185417_14_640 207
757 3300035691 Ga0373931_0024776 Ga0373931_0024776_156_782 207
758 3300035691 Ga0373931_0177648 Ga0373931_0177648_239_862 207
759 3300035692 Ga0373935_0213117 Ga0373935_0213117_280_990 207
760 3300035692 Ga0373935_0431288 Ga0373935_0431288_98_724 207
761 3300035695 Ga0373927_0006191 Ga0373927_0006191_4874_5500 207
762 3300035695 Ga0373927_0026505 Ga0373927_0026505_2674_3300 207
763 3300035695 Ga0373927_0028489 Ga0373927_0028489_1209_1835 207
764 3300035695 Ga0373927_0039331 Ga0373927_0039331_463_1086 207
765 3300035695 Ga0373927_0179490 Ga0373927_0179490_83_706 207
766 3300035725 Ga0373947_0000178 Ga0373947_0000178_747_1373 207
767 3300035725 Ga0373947_0023662 Ga0373947_0023662_2146_2772 207
768 3300035725 Ga0373947_0064449 Ga0373947_0064449_375_1037 207
769 3300035725 Ga0373947_0102805 Ga0373947_0102805_461_1084 207
770 3300035725 Ga0373947_0180047 Ga0373947_0180047_433_1059 207
771 3300036401 Ga0373937_0179799 Ga0373937_0179799_395_1063 207
772 3300036401 Ga0373937_0194899 Ga0373937_0194899_878_1570 207
773 3300036401 Ga0373937_0250597 Ga0373937_0250597_142_852 207
774 3300037068 Ga0373925_0001482 Ga0373925_0001482_4330_4956 207
775 3300037068 Ga0373925_0044829 Ga0373925_0044829_2374_3000 207
776 3300037068 Ga0373925_0302993 Ga0373925_0302993_485_1108 207
777 3300037068 Ga0373925_0324306 Ga0373925_0324306_531_1154 207
778 3300037068 Ga0373925_0454820 Ga0373925_0454820_370_996 207
779 3300037418 Ga0395900_1067436 Ga0395900_1067436_62_685 207
780 3300037853 Ga0436364_0664195 Ga0436364_0664195_219_845 207
781 3300037853 Ga0436364_0716542 Ga0436364_0716542_1605_2231 207
782 3300038443 Ga0395901_0215568 Ga0395901_0215568_63_686 207
783 3300039437 Ga0436365_0042743 Ga0436365_0042743_367_996 207
784 3300039437 Ga0436365_1251077 Ga0436365_1251077_43_666 207
785 3300039437 Ga0436365_1336443 Ga0436365_1336443_1785_2411 207
786 3300039437 Ga0436365_1383206 Ga0436365_1383206_717_1346 207
787 3300039438 Ga0436360_1307075 Ga0436360_1307075_108_734 207
788 3300039447 Ga0436361_0687582 Ga0436361_0687582_341_967 207
789 3300039450 Ga0436363_0753578 Ga0436363_0753578_230_856 207
790 3300041512 Ga0451853_1512202 Ga0451853_1512202_588_1211 207
791 3300044684 Ga0466966_0306725 Ga0466966_0306725_237_863 207
792 3300044693 Ga0466961_0158392 Ga0466961_0158392_335_961 207
793 3300044694 Ga0466963_0034467 Ga0466963_0034467_1316_2086 207
794 3300045049 Ga0466959_0036016 Ga0466959_0036016_34_660 207
795 3300045051 Ga0451576_0599338 Ga0451576_0599338_53_676 207
796 3300045836 Ga0466958_0014631 Ga0466958_0014631_1702_2328 207
797 3300045976 Ga0466967_0611955 Ga0466967_0611955_83_709 207
798 3300046452 Ga0495617_118481 Ga0495617_118481_179_802 207
799 3300046454 Ga0495592_0287452 Ga0495592_0287452_209_952 207
800 3300046457 Ga0495590_0087493 Ga0495590_0087493_235_858 207
801 3300046458 Ga0495591_045515 Ga0495591_045515_137_760 207
802 3300046462 Ga0495651_0062022 Ga0495651_0062022_1716_2384 207
803 3300046462 Ga0495651_0088854 Ga0495651_0088854_793_1503 207
804 3300046463 Ga0495653_0125711 Ga0495653_0125711_188_814 207
805 3300046472 Ga0495580_0091021 Ga0495580_0091021_1289_1915 207
806 3300046473 Ga0495582_0022901 Ga0495582_0022901_917_1627 207
807 3300046473 Ga0495582_0034182 Ga0495582_0034182_289_912 207
808 3300046475 Ga0495639_0045107 Ga0495639_0045107_457_1080 207
809 3300046476 Ga0495662_0080447 Ga0495662_0080447_555_1181 207
810 3300046476 Ga0495662_0142170 Ga0495662_0142170_159_785 207
811 3300046476 Ga0495662_0242024 Ga0495662_0242024_56_679 207
812 3300046477 Ga0495664_0015488 Ga0495664_0015488_569_1195 207
813 3300046491 Ga0495584_0139415 Ga0495584_0139415_286_912 207
814 3300046499 Ga0495594_0266148 Ga0495594_0266148_62_685 207
815 3300046501 Ga0495607_0119698 Ga0495607_0119698_442_1065 207
816 3300046513 Ga0495616_0056321 Ga0495616_0056321_431_1054 207
817 3300046514 Ga0495618_0041757 Ga0495618_0041757_475_1101 207
818 3300046514 Ga0495618_0091385 Ga0495618_0091385_824_1447 207
819 3300046516 Ga0495628_0139904 Ga0495628_0139904_225_935 207
820 3300046517 Ga0495630_0269636 Ga0495630_0269636_378_1004 207
821 3300046517 Ga0495630_0432671 Ga0495630_0432671_100_723 207
822 3300046523 Ga0495644_0015905 Ga0495644_0015905_2248_2871 207
823 3300046526 Ga0495666_0057585 Ga0495666_0057585_155_778 207
824 3300046526 Ga0495666_0124149 Ga0495666_0124149_22_648 207
825 3300046529 Ga0495652_0044867 Ga0495652_0044867_493_1119 207
826 3300046529 Ga0495652_0173262 Ga0495652_0173262_46_756 207
827 3300046531 Ga0495665_0022710 Ga0495665_0022710_478_1104 207
828 3300046531 Ga0495665_0062082 Ga0495665_0062082_1192_1902 207
829 3300046531 Ga0495665_0111401 Ga0495665_0111401_131_757 207
830 3300046533 Ga0495640_0186408 Ga0495640_0186408_283_906 207
831 3300046533 Ga0495640_0192449 Ga0495640_0192449_615_1238 207
832 3300046533 Ga0495640_0261916 Ga0495640_0261916_383_1045 207
833 3300046535 Ga0495586_0027423 Ga0495586_0027423_1930_2556 207
834 3300046536 Ga0495587_0063866 Ga0495587_0063866_171_839 207
835 3300046536 Ga0495587_0289664 Ga0495587_0289664_243_869 207
836 3300046537 Ga0495598_0000513 Ga0495598_0000513_3933_4556 207
837 3300046537 Ga0495598_0085309 Ga0495598_0085309_213_836 207
838 3300046539 Ga0495621_0066992 Ga0495621_0066992_492_1115 207
839 3300046543 Ga0495645_0042265 Ga0495645_0042265_440_1066 207
840 3300046543 Ga0495645_0225337 Ga0495645_0225337_52_762 207
841 3300046558 Ga0495633_0126843 Ga0495633_0126843_73_696 207
842 3300046559 Ga0495667_0258536 Ga0495667_0258536_151_777 207
843 3300046559 Ga0495667_0321339 Ga0495667_0321339_62_772 207
844 3300046616 Ga0495668_0232391 Ga0495668_0232391_61_684 207
845 3300046642 Ga0495634_0006515 Ga0495634_0006515_6981_7607 207
846 3300046642 Ga0495634_0007380 Ga0495634_0007380_6173_6799 207
847 3300046642 Ga0495634_0023797 Ga0495634_0023797_3196_3858 207
848 3300046663 Ga0495635_0007866 Ga0495635_0007866_6302_6928 207
849 3300046663 Ga0495635_0474966 Ga0495635_0474966_108_776 207
850 3300046664 Ga0495659_0046419 Ga0495659_0046419_544_1167 207
851 3300046675 Ga0495657_0227561 Ga0495657_0227561_109_777 207
852 3300046679 Ga0495623_0290852 Ga0495623_0290852_172_882 207
853 3300046680 Ga0495646_0009489 Ga0495646_0009489_4406_5032 207
854 3300046680 Ga0495646_0086248 Ga0495646_0086248_869_1579 207
855 3300046681 Ga0495647_0017526 Ga0495647_0017526_817_1443 207
856 3300046681 Ga0495647_0133894 Ga0495647_0133894_335_961 207
857 3300046683 Ga0495658_0088488 Ga0495658_0088488_287_913 207
858 3300046689 Ga0495613_0028287 Ga0495613_0028287_786_1409 207
859 3300046689 Ga0495613_0055243 Ga0495613_0055243_2191_2853 207
860 3300046689 Ga0495613_0070264 Ga0495613_0070264_461_1087 207
861 3300046689 Ga0495613_0103178 Ga0495613_0103178_1074_1697 207
862 3300046690 Ga0495624_0052660 Ga0495624_0052660_1549_2175 207
863 3300046691 Ga0495670_0004845 Ga0495670_0004845_1409_2032 207
864 3300046692 Ga0495671_0025808 Ga0495671_0025808_2102_2725 207
865 3300046809 Ga0495600_0028026 Ga0495600_0028026_2438_3148 207
866 3300047315 Ga0495581_0050844 Ga0495581_0050844_962_1585 207
867 3300047315 Ga0495581_0164637 Ga0495581_0164637_99_809 207
868 3300047315 Ga0495581_0251664 Ga0495581_0251664_228_890 207
869 3300047319 Ga0495674_0146874 Ga0495674_0146874_688_1314 207
870 3300047321 Ga0495676_0021834 Ga0495676_0021834_3847_4470 207
871 3300047321 Ga0495676_0072883 Ga0495676_0072883_687_1313 207
872 3300047322 Ga0495680_0274377 Ga0495680_0274377_324_950 207
873 3300047444 Ga0495675_0074564 Ga0495675_0074564_275_985 207
874 3300047444 Ga0495675_0222744 Ga0495675_0222744_109_777 207
875 3300047471 Ga0495684_0023040 Ga0495684_0023040_1070_1693 207
876 3300047471 Ga0495684_0032711 Ga0495684_0032711_2672_3298 207
877 3300047673 Ga0495593_0006926 Ga0495593_0006926_411_1037 207
878 3300047673 Ga0495593_0092976 Ga0495593_0092976_368_991 207
879 3300047673 Ga0495593_0249251 Ga0495593_0249251_74_781 207
880 3300048088 Ga0495602_0281844 Ga0495602_0281844_34_702 207
881 3300048903 Ga0496100_0006029 Ga0496100_0006029_4716_5339 207
882 3300048903 Ga0496100_0007617 Ga0496100_0007617_2893_3516 207
883 3300048903 Ga0496100_0221282 Ga0496100_0221282_720_1346 207
884 3300048903 Ga0496100_0577318 Ga0496100_0577318_71_697 207
885 3300048904 Ga0496101_0000879 Ga0496101_0000879_7386_8009 207
886 3300048904 Ga0496101_0003104 Ga0496101_0003104_1073_1696 207
887 3300048904 Ga0496101_0011363 Ga0496101_0011363_1869_2492 207
888 3300048904 Ga0496101_0153974 Ga0496101_0153974_416_1042 207
889 3300048904 Ga0496101_0344962 Ga0496101_0344962_128_754 207
890 3300048904 Ga0496101_0608082 Ga0496101_0608082_218_844 207
891 3300048904 Ga0496101_0629180 Ga0496101_0629180_29_652 207
892 3300048905 Ga0496102_0008462 Ga0496102_0008462_6182_6805 207
893 3300048905 Ga0496102_0011826 Ga0496102_0011826_5073_5696 207
894 3300048905 Ga0496102_0024214 Ga0496102_0024214_1067_1690 207
895 3300048905 Ga0496102_0037021 Ga0496102_0037021_2952_3575 207
896 3300048905 Ga0496102_0069866 Ga0496102_0069866_2226_2852 207
897 3300048905 Ga0496102_0717283 Ga0496102_0717283_241_867 207
898 3300048905 Ga0496102_0902813 Ga0496102_0902813_127_750 207
899 3300048906 Ga0496103_0007237 Ga0496103_0007237_5897_6520 207
900 3300048906 Ga0496103_0048800 Ga0496103_0048800_1026_1649 207
901 3300048906 Ga0496103_0102030 Ga0496103_0102030_1015_1641 207
902 3300048906 Ga0496103_0243198 Ga0496103_0243198_242_865 207
903 3300048907 Ga0496104_0004384 Ga0496104_0004384_820_1443 207
904 3300048907 Ga0496104_0006107 Ga0496104_0006107_1193_1816 207
905 3300048907 Ga0496104_0017059 Ga0496104_0017059_1967_2590 207
906 3300048907 Ga0496104_0374083 Ga0496104_0374083_634_1260 207
907 3300048907 Ga0496104_0468513 Ga0496104_0468513_537_1160 207
908 3300048907 Ga0496104_0848001 Ga0496104_0848001_110_736 207
909 3300048907 Ga0496104_0990057 Ga0496104_0990057_11_637 207
910 3300048908 Ga0496105_0001999 Ga0496105_0001999_4150_4773 207
911 3300048908 Ga0496105_0005181 Ga0496105_0005181_7831_8454 207
912 3300048908 Ga0496105_0015753 Ga0496105_0015753_2482_3105 207
913 3300048908 Ga0496105_0061711 Ga0496105_0061711_880_1506 207
914 3300048908 Ga0496105_0098553 Ga0496105_0098553_485_1108 207
915 3300048908 Ga0496105_0454318 Ga0496105_0454318_175_801 207
916 3300048909 Ga0496106_0003496 Ga0496106_0003496_849_1472 207
917 3300048909 Ga0496106_0011510 Ga0496106_0011510_1572_2195 207
918 3300048909 Ga0496106_0016650 Ga0496106_0016650_1559_2182 207
919 3300048909 Ga0496106_0317869 Ga0496106_0317869_491_1117 207
920 3300048909 Ga0496106_0917103 Ga0496106_0917103_18_644 207
921 3300048910 Ga0496107_0008551 Ga0496107_0008551_3903_4526 207
922 3300048910 Ga0496107_0028396 Ga0496107_0028396_927_1550 207
923 3300048910 Ga0496107_0062820 Ga0496107_0062820_1667_2290 207
924 3300048910 Ga0496107_0181280 Ga0496107_0181280_803_1429 207
925 3300048911 Ga0496108_0000347 Ga0496108_0000347_3092_3715 207
926 3300048911 Ga0496108_0013218 Ga0496108_0013218_1759_2382 207
927 3300048911 Ga0496108_0018394 Ga0496108_0018394_2284_2907 207
928 3300048911 Ga0496108_0032557 Ga0496108_0032557_357_980 207
929 3300048912 Ga0496109_0005863 Ga0496109_0005863_1399_2022 207
930 3300048912 Ga0496109_0032495 Ga0496109_0032495_2037_2660 207
931 3300048912 Ga0496109_0045633 Ga0496109_0045633_2847_3470 207
932 3300048912 Ga0496109_0313055 Ga0496109_0313055_134_757 207
933 3300048912 Ga0496109_0498994 Ga0496109_0498994_184_810 207
934 3300048913 Ga0496110_0000339 Ga0496110_0000339_13064_13687 207
935 3300048913 Ga0496110_0012105 Ga0496110_0012105_2720_3343 207
936 3300048913 Ga0496110_0029719 Ga0496110_0029719_1399_2022 207
937 3300048913 Ga0496110_0074428 Ga0496110_0074428_961_1584 207
938 3300048913 Ga0496110_0170611 Ga0496110_0170611_817_1443 207
939 3300048913 Ga0496110_0264085 Ga0496110_0264085_698_1324 207
940 3300048913 Ga0496110_0323362 Ga0496110_0323362_616_1239 207
941 3300048913 Ga0496110_0625564 Ga0496110_0625564_223_849 207
942 3300048914 Ga0496111_0001676 Ga0496111_0001676_1827_2450 207
943 3300048914 Ga0496111_0009006 Ga0496111_0009006_1184_1807 207
944 3300048914 Ga0496111_0017366 Ga0496111_0017366_1793_2416 207
945 3300048914 Ga0496111_0021601 Ga0496111_0021601_323_946 207
946 3300048914 Ga0496111_0720866 Ga0496111_0720866_63_689 207
947 3300048915 Ga0496112_0002294 Ga0496112_0002294_1216_1839 207
948 3300048915 Ga0496112_0004698 Ga0496112_0004698_940_1563 207
949 3300048915 Ga0496112_0006289 Ga0496112_0006289_1218_1841 207
950 3300048915 Ga0496112_0129178 Ga0496112_0129178_819_1445 207
951 3300048915 Ga0496112_0618357 Ga0496112_0618357_166_789 207
952 3300048915 Ga0496112_0648060 Ga0496112_0648060_95_721 207
953 3300048915 Ga0496112_0917495 Ga0496112_0917495_111_737 207
954 3300048916 Ga0496113_0069726 Ga0496113_0069726_1681_2304 207
955 3300048916 Ga0496113_0114824 Ga0496113_0114824_1060_1683 207
956 3300048916 Ga0496113_0132092 Ga0496113_0132092_949_1575 207
957 3300048916 Ga0496113_0280044 Ga0496113_0280044_127_753 207
958 3300048917 Ga0496114_0110149 Ga0496114_0110149_1101_1724 207
959 3300048918 Ga0496115_0018524 Ga0496115_0018524_236_859 207
960 3300048918 Ga0496115_0055975 Ga0496115_0055975_1553_2179 207
961 3300048918 Ga0496115_0060795 Ga0496115_0060795_1102_1728 207
962 3300048918 Ga0496115_0257531 Ga0496115_0257531_465_1088 207
963 3300048918 Ga0496115_0316815 Ga0496115_0316815_560_1186 207
964 3300048918 Ga0496115_0826093 Ga0496115_0826093_46_669 207
965 3300049576 Ga0501040_0725460 Ga0501040_0725460_84_707 207
966 3300049582 Ga0501048_0331171 Ga0501048_0331171_66_698 207
967 3300049591 Ga0501075_0164115 Ga0501075_0164115_421_1044 207
968 3300049743 Ga0501081_0533014 Ga0501081_0533014_10_633 207
969 3300050492 nmdc:mga0yw44_70420_c1 nmdc:mga0yw44_70420_c1_907_1530 207
970 3300050495 nmdc:mga04h51_7974_c1 nmdc:mga04h51_7974_c1_146_769 207
971 3300050507 nmdc:mga05p37_13689_c1 nmdc:mga05p37_13689_c1_1658_2296 207
972 3300050507 nmdc:mga05p37_463312_c1 nmdc:mga05p37_463312_c1_180_806 207
973 3300050508 nmdc:mga09592_276302_c1 nmdc:mga09592_276302_c1_238_864 207
974 3300050508 nmdc:mga09592_551382_c1 nmdc:mga09592_551382_c1_241_864 207
975 3300050510 nmdc:mga06r32_134422_c1 nmdc:mga06r32_134422_c1_1242_1865 207
976 3300050510 nmdc:mga06r32_898206_c1 nmdc:mga06r32_898206_c1_180_806 207
977 3300050510 nmdc:mga06r32_899039_c1 nmdc:mga06r32_899039_c1_136_759 207
978 3300050511 nmdc:mga08y16_147315_c1 nmdc:mga08y16_147315_c1_1091_1714 207
979 3300050511 nmdc:mga08y16_496710_c1 nmdc:mga08y16_496710_c1_274_897 207
980 3300050511 nmdc:mga08y16_627756_c1 nmdc:mga08y16_627756_c1_381_1004 207
981 3300050512 nmdc:mga0n895_155498_c1 nmdc:mga0n895_155498_c1_1001_1624 207
982 3300050512 nmdc:mga0n895_459658_c1 nmdc:mga0n895_459658_c1_149_772 207
983 3300050512 nmdc:mga0n895_4873_c1 nmdc:mga0n895_4873_c1_3275_3901 207
984 3300050513 nmdc:mga0rr50_294262_c1 nmdc:mga0rr50_294262_c1_34_660 207
985 3300050513 nmdc:mga0rr50_929405_c1 nmdc:mga0rr50_929405_c1_11_634 207
986 3300050514 nmdc:mga08x19_127143_c1 nmdc:mga08x19_127143_c1_152_775 207
987 3300050515 nmdc:mga0a205_25016_c1 nmdc:mga0a205_25016_c1_4870_5496 207
988 3300050515 nmdc:mga0a205_394674_c1 nmdc:mga0a205_394674_c1_39_713 207
989 3300050515 nmdc:mga0a205_534460_c1 nmdc:mga0a205_534460_c1_333_956 207
990 3300053077 Ga0495601_0017716 Ga0495601_0017716_3005_3631 207
991 3300053077 Ga0495601_0043988 Ga0495601_0043988_1509_2171 207
992 3300053077 Ga0495601_0095332 Ga0495601_0095332_21_704 207
993 3300053077 Ga0495601_0259457 Ga0495601_0259457_87_797 207
994 3300053077 Ga0495601_0343242 Ga0495601_0343242_227_895 207
995 3300053078 Ga0495612_0008712 Ga0495612_0008712_2920_3546 207
996 3300053078 Ga0495612_0097294 Ga0495612_0097294_166_789 207
997 3300053078 Ga0495612_0222672 Ga0495612_0222672_167_793 207
998 3300053083 Ga0495655_0000981 Ga0495655_0000981_3166_3789 207
999 3300053084 Ga0495595_0001522 Ga0495595_0001522_2414_3082 207
1000 3300053084 Ga0495595_0143601 Ga0495595_0143601_368_994 207
1001 3300053085 Ga0495619_0002388 Ga0495619_0002388_8319_8945 207
1002 3300053085 Ga0495619_0088079 Ga0495619_0088079_541_1167 207
1003 3300053085 Ga0495619_0118435 Ga0495619_0118435_223_846 207
1004 3300053085 Ga0495619_0313965 Ga0495619_0313965_136_879 207
1005 3300053085 Ga0495619_0391363 Ga0495619_0391363_173_865 207
1006 3300053094 Ga0500566_0112346 Ga0500566_0112346_31_714 207
1007 3300053098 Ga0500650_0089514 Ga0500650_0089514_146_772 207
1008 3300053730 Ga0500645_051596 Ga0500645_051596_387_1013 207
1009 3300054114 Ga0501084_0370131 Ga0501084_0370131_510_1142 207
1010 3300054114 Ga0501084_0880187 Ga0501084_0880187_33_656 207
1011 3300060353 Ga0501082_0349555 Ga0501082_0349555_490_1113 207
1012 3300061719 Ga0466962_0380322 Ga0466962_0380322_43_669 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

48

124

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

57

125

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

53

134

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

154

244

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9703 1 207
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9657 1 207
4kh7-assembly2.cif.gz_A crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9648 1 207
6nv6-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9602 2 207
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9559 2 207
ID Description Score Start End Superfamily
af_P0ACA7_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9842 1 78 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.98 1 79 3.40.30.10
4ke3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9709 1 78 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9619 4 77 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9602 1 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537Q271-F1-model_v4 Glutathione S-transferase family protein 0.989 1 196 GO:0016740
AF-A0A382MT04-F1-model_v4 GST N-terminal domain-containing protein 0.9863 1 76
AF-A0A3D3VAC9-F1-model_v4 Glutathione S-transferase 0.9809 2 138 GO:0004364
GO:0006749
AF-A0A2H6AS68-F1-model_v4 Glutathione S-transferase GstB (EC 2.5.1.18) 0.9796 1 207 GO:0004364
AF-A0A520NSW7-F1-model_v4 Glutathione S-transferase family protein 0.9787 1 207 GO:0016740

Feature Viewer

pLDDT pTM Quality
97.33 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map