F488175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 400 | 1012 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0034467|Ga0466963_0034467_1316_2086 |
| Length | 256 |
| Sequence | LKIAIDGLSSSAPVDDPVFTGVAMYQRAIVYWMPACAGHEQSEEGGGAVIKIWGRNTSSNVQKVMWAVGEMGLPHQRIDIGGPFGKNREPAYLAMNPNGLVPTLEEADGFLLWESNSIVRYLAAKHKSAELEPPDPHARGRASQWMDWQLSVCGPAITPVFWGLIRTPPEKRDHAAIEAGKKNTTAAMLMVDEQLAKTAYLAGDAFSYGDIPVGIMAYRYRQLVPERPALKNFERWYAAISGRQAFKDQVGAVPLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 257 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 258 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 395 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.35 |
| Nodule | 0 |
| Rhizoplane | 9.88 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10023897 | 3300001990 | Bacteria | 1937 |
| 2 | JGI24743J22301_10000589 | 3300001991 | Bacteria | 4389 |
| 3 | JGI24738J21930_10011323 | 3300002075 | Bacteria | 1963 |
| 4 | JGI24742J22300_10000606 | 3300002244 | Bacteria | 5393 |
| 5 | JGI25404J52841_10004866 | 3300003659 | Bacteria | 2754 |
| 6 | Ga0058862_12191086 | 3300004803 | Bacteria | 762 |
| 7 | Ga0065707_10160974 | 3300005295 | Bacteria | 1563 |
| 8 | Ga0070658_10120406 | 3300005327 | Bacteria | 2181 |
| 9 | Ga0070658_10210450 | 3300005327 | Bacteria | 1642 |
| 10 | Ga0070658_10485900 | 3300005327 | Bacteria | 1066 |
| 11 | Ga0070683_100011408 | 3300005329 | Bacteria | 7681 |
| 12 | Ga0070683_100040594 | 3300005329 | Bacteria | 4280 |
| 13 | Ga0070683_100311639 | 3300005329 | Bacteria | 1497 |
| 14 | Ga0070690_100015826 | 3300005330 | Bacteria | 4506 |
| 15 | Ga0070690_100556198 | 3300005330 | Bacteria | 866 |
| 16 | Ga0070670_100028487 | 3300005331 | Bacteria | 4807 |
| 17 | Ga0070670_100071135 | 3300005331 | Bacteria | 2986 |
| 18 | Ga0068869_100216323 | 3300005334 | Bacteria | 1517 |
| 19 | Ga0070666_10088544 | 3300005335 | Bacteria | 2124 |
| 20 | Ga0070666_10398149 | 3300005335 | Bacteria | 990 |
| 21 | Ga0070680_100001118 | 3300005336 | Bacteria | 19276 |
| 22 | Ga0070680_100109890 | 3300005336 | Bacteria | 2294 |
| 23 | Ga0070682_100022863 | 3300005337 | Bacteria | 3708 |
| 24 | Ga0070682_100605448 | 3300005337 | Bacteria | 866 |
| 25 | Ga0068868_100009632 | 3300005338 | Bacteria | 6968 |
| 26 | Ga0068868_100353123 | 3300005338 | Bacteria | 1260 |
| 27 | Ga0070660_100195675 | 3300005339 | Bacteria | 1639 |
| 28 | Ga0070660_100478208 | 3300005339 | Bacteria | 1035 |
| 29 | Ga0070660_100522540 | 3300005339 | Bacteria | 989 |
| 30 | Ga0070689_100001113 | 3300005340 | Bacteria | 16894 |
| 31 | Ga0070689_100194769 | 3300005340 | Bacteria | 1652 |
| 32 | Ga0070691_10005401 | 3300005341 | Bacteria | 5812 |
| 33 | Ga0070687_100199493 | 3300005343 | Bacteria | 1211 |
| 34 | Ga0070687_100211035 | 3300005343 | Bacteria | 1183 |
| 35 | Ga0070661_100135873 | 3300005344 | Bacteria | 1850 |
| 36 | Ga0070661_100881023 | 3300005344 | Unclassified | 738 |
| 37 | Ga0070692_10022160 | 3300005345 | Bacteria | 3101 |
| 38 | Ga0070668_100113320 | 3300005347 | Bacteria | 2160 |
| 39 | Ga0070669_100140181 | 3300005353 | Unclassified | 1863 |
| 40 | Ga0070669_100206839 | 3300005353 | Bacteria | 1547 |
| 41 | Ga0070675_100018009 | 3300005354 | Bacteria | 5622 |
| 42 | Ga0070675_100445561 | 3300005354 | Bacteria | 1161 |
| 43 | Ga0070671_100010831 | 3300005355 | Bacteria | 7316 |
| 44 | Ga0070674_100018571 | 3300005356 | Bacteria | 4400 |
| 45 | Ga0070674_100026532 | 3300005356 | Bacteria | 3786 |
| 46 | Ga0070673_100003804 | 3300005364 | Bacteria | 9468 |
| 47 | Ga0070673_100227319 | 3300005364 | Bacteria | 1617 |
| 48 | Ga0070673_100520815 | 3300005364 | Bacteria | 1078 |
| 49 | Ga0070673_100954090 | 3300005364 | Bacteria | 797 |
| 50 | Ga0070688_100005939 | 3300005365 | Bacteria | 6468 |
| 51 | Ga0070688_100028550 | 3300005365 | Bacteria | 3332 |
| 52 | Ga0070688_100051339 | 3300005365 | Bacteria | 2572 |
| 53 | Ga0070659_100124649 | 3300005366 | Bacteria | 2090 |
| 54 | Ga0070659_100410292 | 3300005366 | Bacteria | 1144 |
| 55 | Ga0070659_100994151 | 3300005366 | Bacteria | 736 |
| 56 | Ga0070667_100029214 | 3300005367 | Bacteria | 4593 |
| 57 | Ga0070703_10010838 | 3300005406 | Bacteria | 2572 |
| 58 | Ga0070709_10011931 | 3300005434 | Bacteria | 4854 |
| 59 | Ga0070709_10159441 | 3300005434 | Bacteria | 1567 |
| 60 | Ga0070709_10935785 | 3300005434 | Bacteria | 687 |
| 61 | Ga0070714_100003288 | 3300005435 | Bacteria | 12043 |
| 62 | Ga0070714_100058344 | 3300005435 | Bacteria | 3306 |
| 63 | Ga0070714_100206856 | 3300005435 | Bacteria | 1797 |
| 64 | Ga0070714_100309305 | 3300005435 | Bacteria | 1475 |
| 65 | Ga0070714_100665610 | 3300005435 | Bacteria | 1003 |
| 66 | Ga0070713_100022225 | 3300005436 | Bacteria | 4898 |
| 67 | Ga0070713_100108922 | 3300005436 | Bacteria | 2412 |
| 68 | Ga0070713_100125140 | 3300005436 | Bacteria | 2260 |
| 69 | Ga0070713_100586417 | 3300005436 | Bacteria | 1058 |
| 70 | Ga0070710_10047384 | 3300005437 | Bacteria | 2397 |
| 71 | Ga0070711_100028231 | 3300005439 | Bacteria | 3691 |
| 72 | Ga0070711_100036765 | 3300005439 | Bacteria | 3282 |
| 73 | Ga0070711_100080849 | 3300005439 | Bacteria | 2315 |
| 74 | Ga0070711_100142841 | 3300005439 | Bacteria | 1796 |
| 75 | Ga0070705_100054251 | 3300005440 | Bacteria | 2350 |
| 76 | Ga0070705_100189603 | 3300005440 | Bacteria | 1400 |
| 77 | Ga0070700_100066485 | 3300005441 | Bacteria | 2288 |
| 78 | Ga0070700_100712784 | 3300005441 | Bacteria | 799 |
| 79 | Ga0070694_100074074 | 3300005444 | Bacteria | 2353 |
| 80 | Ga0070694_100585525 | 3300005444 | Bacteria | 897 |
| 81 | Ga0070708_100218484 | 3300005445 | Bacteria | 1787 |
| 82 | Ga0070663_100086303 | 3300005455 | Bacteria | 2317 |
| 83 | Ga0070663_100358866 | 3300005455 | Bacteria | 1182 |
| 84 | Ga0070678_100025730 | 3300005456 | Bacteria | 3966 |
| 85 | Ga0070678_100033430 | 3300005456 | Bacteria | 3571 |
| 86 | Ga0070678_100376024 | 3300005456 | Bacteria | 1228 |
| 87 | Ga0070662_100019278 | 3300005457 | Bacteria | 4630 |
| 88 | Ga0070681_10523966 | 3300005458 | Bacteria | 1098 |
| 89 | Ga0070681_11030727 | 3300005458 | Bacteria | 743 |
| 90 | Ga0068867_100019113 | 3300005459 | Bacteria | 4879 |
| 91 | Ga0068867_100725869 | 3300005459 | Bacteria | 879 |
| 92 | Ga0068867_100886910 | 3300005459 | Bacteria | 802 |
| 93 | Ga0070685_10008870 | 3300005466 | Bacteria | 5185 |
| 94 | Ga0070707_100101717 | 3300005468 | Bacteria | 2785 |
| 95 | Ga0070698_100012347 | 3300005471 | Bacteria | 9045 |
| 96 | Ga0070698_100807164 | 3300005471 | Bacteria | 882 |
| 97 | Ga0070699_100123881 | 3300005518 | Bacteria | 2274 |
| 98 | Ga0070699_100573922 | 3300005518 | Bacteria | 1027 |
| 99 | Ga0070699_101090168 | 3300005518 | Bacteria | 732 |
| 100 | Ga0070679_100023849 | 3300005530 | Bacteria | 5994 |
| 101 | Ga0070684_100004629 | 3300005535 | Bacteria | 10494 |
| 102 | Ga0070684_100110848 | 3300005535 | Bacteria | 2460 |
| 103 | Ga0070684_100165021 | 3300005535 | Bacteria | 2010 |
| 104 | Ga0070684_100436286 | 3300005535 | Bacteria | 1210 |
| 105 | Ga0070697_100036459 | 3300005536 | Bacteria | 3973 |
| 106 | Ga0070697_100140324 | 3300005536 | Unclassified | 2032 |
| 107 | Ga0070697_100666805 | 3300005536 | Bacteria | 916 |
| 108 | Ga0068853_100328104 | 3300005539 | Bacteria | 1420 |
| 109 | Ga0070672_100014289 | 3300005543 | Bacteria | 5624 |
| 110 | Ga0070686_100015033 | 3300005544 | Bacteria | 4474 |
| 111 | Ga0070686_100122087 | 3300005544 | Bacteria | 1790 |
| 112 | Ga0070686_100489299 | 3300005544 | Bacteria | 953 |
| 113 | Ga0070695_100052568 | 3300005545 | Bacteria | 2618 |
| 114 | Ga0070695_100545741 | 3300005545 | Bacteria | 903 |
| 115 | Ga0070693_100359509 | 3300005547 | Bacteria | 999 |
| 116 | Ga0070665_100176983 | 3300005548 | Bacteria | 2134 |
| 117 | Ga0070665_100295067 | 3300005548 | Bacteria | 1624 |
| 118 | Ga0070665_100374217 | 3300005548 | Bacteria | 1431 |
| 119 | Ga0070665_100525754 | 3300005548 | Bacteria | 1195 |
| 120 | Ga0070665_100681923 | 3300005548 | Bacteria | 1041 |
| 121 | Ga0070665_100836225 | 3300005548 | Bacteria | 934 |
| 122 | Ga0070704_100001250 | 3300005549 | Bacteria | 13398 |
| 123 | Ga0070704_100377119 | 3300005549 | Bacteria | 1204 |
| 124 | Ga0070704_100543519 | 3300005549 | Bacteria | 1014 |
| 125 | Ga0070704_100807306 | 3300005549 | Bacteria | 839 |
| 126 | Ga0068855_100126004 | 3300005563 | Bacteria | 2928 |
| 127 | Ga0068855_100472019 | 3300005563 | Bacteria | 1367 |
| 128 | Ga0068855_100762977 | 3300005563 | Bacteria | 1031 |
| 129 | Ga0070664_100024037 | 3300005564 | Bacteria | 5037 |
| 130 | Ga0070664_100118550 | 3300005564 | Bacteria | 2315 |
| 131 | Ga0070664_100171265 | 3300005564 | Bacteria | 1926 |
| 132 | Ga0068854_100016650 | 3300005578 | Bacteria | 4905 |
| 133 | Ga0068856_100001606 | 3300005614 | Bacteria | 23628 |
| 134 | Ga0068856_100016444 | 3300005614 | Bacteria | 7159 |
| 135 | Ga0068856_100210294 | 3300005614 | Bacteria | 1960 |
| 136 | Ga0068856_100502094 | 3300005614 | Bacteria | 1234 |
| 137 | Ga0070702_100008194 | 3300005615 | Bacteria | 5047 |
| 138 | Ga0068852_100001045 | 3300005616 | Bacteria | 18230 |
| 139 | Ga0068859_100025009 | 3300005617 | Bacteria | 5993 |
| 140 | Ga0068859_100335208 | 3300005617 | Bacteria | 1607 |
| 141 | Ga0068859_100792025 | 3300005617 | Bacteria | 1036 |
| 142 | Ga0068864_100001978 | 3300005618 | Bacteria | 16866 |
| 143 | Ga0068866_10011518 | 3300005718 | Bacteria | 3828 |
| 144 | Ga0068851_10025091 | 3300005834 | Bacteria | 2922 |
| 145 | Ga0068870_10014577 | 3300005840 | Bacteria | 3714 |
| 146 | Ga0068863_100019233 | 3300005841 | Bacteria | 6535 |
| 147 | Ga0068858_100022418 | 3300005842 | Bacteria | 5894 |
| 148 | Ga0068858_100116932 | 3300005842 | Bacteria | 2492 |
| 149 | Ga0068858_100184675 | 3300005842 | Bacteria | 1969 |
| 150 | Ga0068860_100054877 | 3300005843 | Bacteria | 3787 |
| 151 | Ga0068860_101087720 | 3300005843 | Bacteria | 819 |
| 152 | Ga0068862_100024602 | 3300005844 | Bacteria | 5054 |
| 153 | Ga0068862_100059517 | 3300005844 | Bacteria | 3280 |
| 154 | Ga0068862_100283175 | 3300005844 | Bacteria | 1520 |
| 155 | Ga0068862_100617918 | 3300005844 | Bacteria | 1042 |
| 156 | Ga0081455_10001354 | 3300005937 | Bacteria | 30285 |
| 157 | Ga0081455_10300774 | 3300005937 | Bacteria | 1151 |
| 158 | Ga0081538_10034525 | 3300005981 | Bacteria | 3342 |
| 159 | Ga0081538_10150658 | 3300005981 | Bacteria | 1054 |
| 160 | Ga0081540_1001046 | 3300005983 | Bacteria | 24692 |
| 161 | Ga0081540_1002282 | 3300005983 | Bacteria | 15746 |
| 162 | Ga0081540_1003104 | 3300005983 | Bacteria | 13307 |
| 163 | Ga0081540_1100145 | 3300005983 | Bacteria | 1250 |
| 164 | Ga0081539_10003208 | 3300005985 | Bacteria | 20654 |
| 165 | Ga0070717_10247489 | 3300006028 | Bacteria | 1574 |
| 166 | Ga0070717_10349049 | 3300006028 | Bacteria | 1323 |
| 167 | Ga0075365_10004171 | 3300006038 | Bacteria | 7608 |
| 168 | Ga0075365_10009965 | 3300006038 | Bacteria | 5502 |
| 169 | Ga0075365_10011665 | 3300006038 | Bacteria | 5178 |
| 170 | Ga0075365_10208576 | 3300006038 | Bacteria | 1370 |
| 171 | Ga0075365_10247488 | 3300006038 | Bacteria | 1252 |
| 172 | Ga0075365_10352560 | 3300006038 | Bacteria | 1037 |
| 173 | Ga0075365_10572926 | 3300006038 | Bacteria | 798 |
| 174 | Ga0075368_10012897 | 3300006042 | Bacteria | 3061 |
| 175 | Ga0075368_10018094 | 3300006042 | Bacteria | 2644 |
| 176 | Ga0075368_10086403 | 3300006042 | Bacteria | 1280 |
| 177 | Ga0075363_100009278 | 3300006048 | Bacteria | 4621 |
| 178 | Ga0075363_100025914 | 3300006048 | Bacteria | 2995 |
| 179 | Ga0075364_10100398 | 3300006051 | Bacteria | 1926 |
| 180 | Ga0075364_10124588 | 3300006051 | Bacteria | 1726 |
| 181 | Ga0075364_10260995 | 3300006051 | Bacteria | 1178 |
| 182 | Ga0070715_10005759 | 3300006163 | Bacteria | 4163 |
| 183 | Ga0070716_100016606 | 3300006173 | Bacteria | 3803 |
| 184 | Ga0070712_100052161 | 3300006175 | Bacteria | 2851 |
| 185 | Ga0070712_100076048 | 3300006175 | Bacteria | 2417 |
| 186 | Ga0070712_100579723 | 3300006175 | Bacteria | 948 |
| 187 | Ga0075362_10003444 | 3300006177 | Bacteria | 5528 |
| 188 | Ga0075367_10002008 | 3300006178 | Bacteria | 9074 |
| 189 | Ga0075367_10013529 | 3300006178 | Bacteria | 4390 |
| 190 | Ga0075367_10039306 | 3300006178 | Bacteria | 2758 |
| 191 | Ga0075367_10312623 | 3300006178 | Bacteria | 989 |
| 192 | Ga0097621_100020748 | 3300006237 | Bacteria | 5068 |
| 193 | Ga0075370_10038028 | 3300006353 | Bacteria | 2708 |
| 194 | Ga0075370_10108901 | 3300006353 | Bacteria | 1608 |
| 195 | Ga0068871_100016774 | 3300006358 | Bacteria | 5527 |
| 196 | Ga0068871_100892732 | 3300006358 | Bacteria | 823 |
| 197 | Ga0075428_100000617 | 3300006844 | Bacteria | 36390 |
| 198 | Ga0075428_100062074 | 3300006844 | Bacteria | 4092 |
| 199 | Ga0075428_100082995 | 3300006844 | Bacteria | 3496 |
| 200 | Ga0075428_100194841 | 3300006844 | Bacteria | 2191 |
| 201 | Ga0075428_100378884 | 3300006844 | Bacteria | 1517 |
| 202 | Ga0075428_100532816 | 3300006844 | Bacteria | 1256 |
| 203 | Ga0075428_100578115 | 3300006844 | Bacteria | 1201 |
| 204 | Ga0075430_100045690 | 3300006846 | Bacteria | 3699 |
| 205 | Ga0075431_100073995 | 3300006847 | Bacteria | 3515 |
| 206 | Ga0075431_100108855 | 3300006847 | Bacteria | 2860 |
| 207 | Ga0075431_100171298 | 3300006847 | Bacteria | 2230 |
| 208 | Ga0075431_100820232 | 3300006847 | Bacteria | 903 |
| 209 | Ga0075431_100883641 | 3300006847 | Bacteria | 864 |
| 210 | Ga0075433_10043573 | 3300006852 | Bacteria | 3896 |
| 211 | Ga0075433_10622550 | 3300006852 | Bacteria | 947 |
| 212 | Ga0075434_100070901 | 3300006871 | Bacteria | 3475 |
| 213 | Ga0075434_100103915 | 3300006871 | Bacteria | 2850 |
| 214 | Ga0075434_100131094 | 3300006871 | Bacteria | 2526 |
| 215 | Ga0075434_100540835 | 3300006871 | Bacteria | 1185 |
| 216 | Ga0075434_100622901 | 3300006871 | Bacteria | 1098 |
| 217 | Ga0075434_100811838 | 3300006871 | Bacteria | 951 |
| 218 | Ga0075434_100992981 | 3300006871 | Bacteria | 853 |
| 219 | Ga0075434_101018597 | 3300006871 | Bacteria | 842 |
| 220 | Ga0075429_100000081 | 3300006880 | Bacteria | 49207 |
| 221 | Ga0075429_100271902 | 3300006880 | Bacteria | 1484 |
| 222 | Ga0075429_100430352 | 3300006880 | Bacteria | 1156 |
| 223 | Ga0068865_100174258 | 3300006881 | Bacteria | 1652 |
| 224 | Ga0075436_100004004 | 3300006914 | Bacteria | 10108 |
| 225 | Ga0075436_100004115 | 3300006914 | Bacteria | 9977 |
| 226 | Ga0075436_100090088 | 3300006914 | Bacteria | 2132 |
| 227 | Ga0075436_100129957 | 3300006914 | Bacteria | 1766 |
| 228 | Ga0097620_100025009 | 3300006931 | Bacteria | 5993 |
| 229 | Ga0097620_100335219 | 3300006931 | Bacteria | 1607 |
| 230 | Ga0097620_100792112 | 3300006931 | Bacteria | 1036 |
| 231 | Ga0075435_100275497 | 3300007076 | Bacteria | 1436 |
| 232 | Ga0075435_100316413 | 3300007076 | Bacteria | 1336 |
| 233 | Ga0075435_100667463 | 3300007076 | Bacteria | 903 |
| 234 | Ga0075435_100694013 | 3300007076 | Bacteria | 885 |
| 235 | Ga0099794_10011365 | 3300007265 | Bacteria | 3809 |
| 236 | Ga0099794_10017902 | 3300007265 | Bacteria | 3167 |
| 237 | Ga0099794_10019828 | 3300007265 | Bacteria | 3036 |
| 238 | Ga0099795_10059973 | 3300007788 | Bacteria | 1409 |
| 239 | Ga0105251_10019995 | 3300009011 | Bacteria | 3524 |
| 240 | Ga0105250_10036971 | 3300009092 | Bacteria | 1959 |
| 241 | Ga0105240_10012327 | 3300009093 | Bacteria | 11807 |
| 242 | Ga0105240_10215904 | 3300009093 | Bacteria | 2238 |
| 243 | Ga0105240_10744984 | 3300009093 | Bacteria | 1066 |
| 244 | Ga0111539_10089724 | 3300009094 | Bacteria | 3612 |
| 245 | Ga0111539_10109039 | 3300009094 | Bacteria | 3249 |
| 246 | Ga0111539_10150665 | 3300009094 | Bacteria | 2722 |
| 247 | Ga0111539_10229442 | 3300009094 | Bacteria | 2162 |
| 248 | Ga0111539_10286824 | 3300009094 | Bacteria | 1916 |
| 249 | Ga0111539_10565452 | 3300009094 | Bacteria | 1324 |
| 250 | Ga0111539_10577925 | 3300009094 | Bacteria | 1309 |
| 251 | Ga0111539_10578423 | 3300009094 | Bacteria | 1308 |
| 252 | Ga0111539_11212562 | 3300009094 | Bacteria | 876 |
| 253 | Ga0105245_10051077 | 3300009098 | Bacteria | 3707 |
| 254 | Ga0105245_10231631 | 3300009098 | Bacteria | 1787 |
| 255 | Ga0105245_11406078 | 3300009098 | Bacteria | 748 |
| 256 | Ga0114129_10002113 | 3300009147 | Bacteria | 27369 |
| 257 | Ga0114129_10011617 | 3300009147 | Bacteria | 12537 |
| 258 | Ga0114129_10048513 | 3300009147 | Bacteria | 5966 |
| 259 | Ga0114129_10221243 | 3300009147 | Bacteria | 2554 |
| 260 | Ga0114129_10349571 | 3300009147 | Bacteria | 1959 |
| 261 | Ga0114129_11039546 | 3300009147 | Bacteria | 1029 |
| 262 | Ga0114129_11487948 | 3300009147 | Bacteria | 832 |
| 263 | Ga0114129_11489605 | 3300009147 | Bacteria | 832 |
| 264 | Ga0114129_11987904 | 3300009147 | Bacteria | 703 |
| 265 | Ga0105243_10440664 | 3300009148 | Bacteria | 1220 |
| 266 | Ga0105243_10605780 | 3300009148 | Bacteria | 1055 |
| 267 | Ga0105243_11436345 | 3300009148 | Bacteria | 711 |
| 268 | Ga0105241_10521919 | 3300009174 | Bacteria | 1062 |
| 269 | Ga0105242_10028336 | 3300009176 | Bacteria | 4458 |
| 270 | Ga0105242_10349934 | 3300009176 | Bacteria | 1364 |
| 271 | Ga0105248_10623085 | 3300009177 | Bacteria | 1217 |
| 272 | Ga0105237_10028064 | 3300009545 | Bacteria | 5734 |
| 273 | Ga0105237_10141603 | 3300009545 | Bacteria | 2399 |
| 274 | Ga0105238_10037417 | 3300009551 | Bacteria | 4933 |
| 275 | Ga0105238_10154909 | 3300009551 | Bacteria | 2267 |
| 276 | Ga0105238_10160965 | 3300009551 | Bacteria | 2220 |
| 277 | Ga0105238_10345146 | 3300009551 | Bacteria | 1477 |
| 278 | Ga0105238_10459267 | 3300009551 | Bacteria | 1271 |
| 279 | Ga0105238_10563447 | 3300009551 | Unclassified | 1144 |
| 280 | Ga0105249_10015086 | 3300009553 | Bacteria | 6835 |
| 281 | Ga0105249_10579958 | 3300009553 | Bacteria | 1175 |
| 282 | Ga0105249_10672243 | 3300009553 | Bacteria | 1094 |
| 283 | Ga0099796_10010230 | 3300010159 | Bacteria | 2572 |
| 284 | Ga0099796_10023258 | 3300010159 | Bacteria | 1933 |
| 285 | Ga0105239_10031952 | 3300010375 | Bacteria | 5784 |
| 286 | Ga0105239_10188702 | 3300010375 | Bacteria | 2307 |
| 287 | Ga0105239_10308693 | 3300010375 | Bacteria | 1783 |
| 288 | Ga0105239_10522002 | 3300010375 | Bacteria | 1351 |
| 289 | Ga0105239_11216837 | 3300010375 | Bacteria | 868 |
| 290 | Ga0157373_10093120 | 3300013100 | Bacteria | 2122 |
| 291 | Ga0157370_10980725 | 3300013104 | Bacteria | 765 |
| 292 | Ga0157369_10011724 | 3300013105 | Bacteria | 9953 |
| 293 | Ga0157369_10158993 | 3300013105 | Bacteria | 2386 |
| 294 | Ga0157369_10541407 | 3300013105 | Bacteria | 1204 |
| 295 | Ga0157374_10083923 | 3300013296 | Bacteria | 3027 |
| 296 | Ga0157374_10298170 | 3300013296 | Bacteria | 1594 |
| 297 | Ga0157374_10369049 | 3300013296 | Bacteria | 1428 |
| 298 | Ga0157374_10720035 | 3300013296 | Bacteria | 1012 |
| 299 | Ga0157372_10018682 | 3300013307 | Bacteria | 7458 |
| 300 | Ga0157372_10088796 | 3300013307 | Bacteria | 3510 |
| 301 | Ga0157372_10245304 | 3300013307 | Bacteria | 2079 |
| 302 | Ga0157372_10277978 | 3300013307 | Bacteria | 1947 |
| 303 | Ga0157375_10009835 | 3300013308 | Bacteria | 8410 |
| 304 | Ga0157375_10796818 | 3300013308 | Bacteria | 1094 |
| 305 | Ga0163163_10303939 | 3300014325 | Bacteria | 1648 |
| 306 | Ga0163163_10372967 | 3300014325 | Bacteria | 1484 |
| 307 | Ga0163163_10390837 | 3300014325 | Bacteria | 1449 |
| 308 | Ga0157380_10405511 | 3300014326 | Bacteria | 1295 |
| 309 | Ga0157380_10710931 | 3300014326 | Bacteria | 1011 |
| 310 | Ga0157380_11157619 | 3300014326 | Bacteria | 815 |
| 311 | Ga0157377_10004874 | 3300014745 | Bacteria | 6241 |
| 312 | Ga0157379_10027886 | 3300014968 | Bacteria | 5026 |
| 313 | Ga0157379_10659050 | 3300014968 | Bacteria | 980 |
| 314 | Ga0157376_10135733 | 3300014969 | Bacteria | 2201 |
| 315 | Ga0163161_10120185 | 3300017792 | Bacteria | 1973 |
| 316 | Ga0163161_10780922 | 3300017792 | Bacteria | 801 |
| 317 | Ga0213872_10021062 | 3300021361 | Bacteria | 3002 |
| 318 | Ga0213876_10077341 | 3300021384 | Bacteria | 1758 |
| 319 | Ga0213876_10099408 | 3300021384 | Bacteria | 1542 |
| 320 | Ga0213876_10101010 | 3300021384 | Bacteria | 1529 |
| 321 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 322 | Ga0213875_10158083 | 3300021388 | Bacteria | 1063 |
| 323 | Ga0224572_1004891 | 3300024225 | Bacteria | 2363 |
| 324 | Ga0228598_1000876 | 3300024227 | Bacteria | 6507 |
| 325 | Ga0228598_1020313 | 3300024227 | Bacteria | 1308 |
| 326 | Ga0207426_1013129 | 3300025302 | Bacteria | 3084 |
| 327 | Ga0207426_1056002 | 3300025302 | Bacteria | 1152 |
| 328 | Ga0207697_10030261 | 3300025315 | Bacteria | 2215 |
| 329 | Ga0207697_10032524 | 3300025315 | Bacteria | 2135 |
| 330 | Ga0207656_10016209 | 3300025321 | Bacteria | 2899 |
| 331 | Ga0207656_10247897 | 3300025321 | Bacteria | 872 |
| 332 | Ga0207692_10226083 | 3300025898 | Bacteria | 1111 |
| 333 | Ga0207642_10013018 | 3300025899 | Bacteria | 3021 |
| 334 | Ga0207688_10003415 | 3300025901 | Bacteria | 8665 |
| 335 | Ga0207680_10008657 | 3300025903 | Bacteria | 5010 |
| 336 | Ga0207680_10402985 | 3300025903 | Bacteria | 967 |
| 337 | Ga0207647_10064910 | 3300025904 | Bacteria | 2217 |
| 338 | Ga0207685_10031288 | 3300025905 | Bacteria | 1904 |
| 339 | Ga0207685_10102199 | 3300025905 | Bacteria | 1227 |
| 340 | Ga0207699_10014408 | 3300025906 | Bacteria | 4075 |
| 341 | Ga0207699_10316086 | 3300025906 | Bacteria | 1094 |
| 342 | Ga0207645_10048865 | 3300025907 | Bacteria | 2702 |
| 343 | Ga0207645_10049992 | 3300025907 | Bacteria | 2670 |
| 344 | Ga0207645_10398827 | 3300025907 | Bacteria | 925 |
| 345 | Ga0207643_10005672 | 3300025908 | Bacteria | 6678 |
| 346 | Ga0207705_10213428 | 3300025909 | Bacteria | 1464 |
| 347 | Ga0207705_10241045 | 3300025909 | Unclassified | 1377 |
| 348 | Ga0207684_10096437 | 3300025910 | Bacteria | 2524 |
| 349 | Ga0207707_10004277 | 3300025912 | Bacteria | 12633 |
| 350 | Ga0207707_10379776 | 3300025912 | Bacteria | 1215 |
| 351 | Ga0207707_10490182 | 3300025912 | Bacteria | 1049 |
| 352 | Ga0207695_10026716 | 3300025913 | Bacteria | 6440 |
| 353 | Ga0207695_11051143 | 3300025913 | Bacteria | 694 |
| 354 | Ga0207671_10077285 | 3300025914 | Bacteria | 2492 |
| 355 | Ga0207671_10214673 | 3300025914 | Bacteria | 1506 |
| 356 | Ga0207693_10002485 | 3300025915 | Bacteria | 16030 |
| 357 | Ga0207693_10041146 | 3300025915 | Bacteria | 3639 |
| 358 | Ga0207693_10063092 | 3300025915 | Bacteria | 2903 |
| 359 | Ga0207693_10185616 | 3300025915 | Bacteria | 1637 |
| 360 | Ga0207693_10226341 | 3300025915 | Bacteria | 1469 |
| 361 | Ga0207693_10284764 | 3300025915 | Bacteria | 1295 |
| 362 | Ga0207693_10458723 | 3300025915 | Unclassified | 996 |
| 363 | Ga0207663_10045292 | 3300025916 | Bacteria | 2705 |
| 364 | Ga0207663_10080623 | 3300025916 | Bacteria | 2129 |
| 365 | Ga0207663_10118085 | 3300025916 | Bacteria | 1811 |
| 366 | Ga0207660_10008666 | 3300025917 | Bacteria | 6579 |
| 367 | Ga0207660_10328117 | 3300025917 | Bacteria | 1223 |
| 368 | Ga0207662_10290993 | 3300025918 | Bacteria | 1083 |
| 369 | Ga0207662_10313530 | 3300025918 | Bacteria | 1046 |
| 370 | Ga0207657_10100027 | 3300025919 | Bacteria | 2408 |
| 371 | Ga0207657_10554022 | 3300025919 | Bacteria | 899 |
| 372 | Ga0207649_10007883 | 3300025920 | Bacteria | 5794 |
| 373 | Ga0207649_10189617 | 3300025920 | Bacteria | 1445 |
| 374 | Ga0207652_10083726 | 3300025921 | Bacteria | 2793 |
| 375 | Ga0207652_10648679 | 3300025921 | Unclassified | 944 |
| 376 | Ga0207652_10655105 | 3300025921 | Bacteria | 939 |
| 377 | Ga0207646_10268358 | 3300025922 | Bacteria | 1542 |
| 378 | Ga0207681_10118776 | 3300025923 | Unclassified | 1936 |
| 379 | Ga0207694_10129583 | 3300025924 | Bacteria | 2021 |
| 380 | Ga0207694_10290493 | 3300025924 | Bacteria | 1344 |
| 381 | Ga0207694_10499360 | 3300025924 | Bacteria | 1019 |
| 382 | Ga0207650_10031312 | 3300025925 | Bacteria | 3840 |
| 383 | Ga0207650_10071529 | 3300025925 | Bacteria | 2609 |
| 384 | Ga0207650_10149991 | 3300025925 | Bacteria | 1839 |
| 385 | Ga0207659_10298422 | 3300025926 | Bacteria | 1322 |
| 386 | Ga0207659_10309531 | 3300025926 | Bacteria | 1300 |
| 387 | Ga0207659_10552690 | 3300025926 | Bacteria | 979 |
| 388 | Ga0207687_10006331 | 3300025927 | Bacteria | 7824 |
| 389 | Ga0207687_10067357 | 3300025927 | Bacteria | 2547 |
| 390 | Ga0207687_10263202 | 3300025927 | Bacteria | 1376 |
| 391 | Ga0207700_10013689 | 3300025928 | Bacteria | 5289 |
| 392 | Ga0207700_10078066 | 3300025928 | Bacteria | 2574 |
| 393 | Ga0207700_10153148 | 3300025928 | Bacteria | 1907 |
| 394 | Ga0207700_10178347 | 3300025928 | Bacteria | 1777 |
| 395 | Ga0207700_10225900 | 3300025928 | Bacteria | 1589 |
| 396 | Ga0207700_10308481 | 3300025928 | Bacteria | 1368 |
| 397 | Ga0207700_10334744 | 3300025928 | Bacteria | 1315 |
| 398 | Ga0207664_10033479 | 3300025929 | Bacteria | 3948 |
| 399 | Ga0207664_10333892 | 3300025929 | Bacteria | 1339 |
| 400 | Ga0207664_10456388 | 3300025929 | Bacteria | 1141 |
| 401 | Ga0207644_10016623 | 3300025931 | Bacteria | 4953 |
| 402 | Ga0207644_10023230 | 3300025931 | Bacteria | 4244 |
| 403 | Ga0207644_10038217 | 3300025931 | Bacteria | 3380 |
| 404 | Ga0207644_10525956 | 3300025931 | Bacteria | 977 |
| 405 | Ga0207690_10018700 | 3300025932 | Bacteria | 4251 |
| 406 | Ga0207690_10104102 | 3300025932 | Bacteria | 2033 |
| 407 | Ga0207706_10038206 | 3300025933 | Bacteria | 4258 |
| 408 | Ga0207670_10017680 | 3300025936 | Bacteria | 4313 |
| 409 | Ga0207670_10020641 | 3300025936 | Bacteria | 4052 |
| 410 | Ga0207669_10005520 | 3300025937 | Bacteria | 5683 |
| 411 | Ga0207669_10286357 | 3300025937 | Bacteria | 1245 |
| 412 | Ga0207669_10471956 | 3300025937 | Bacteria | 998 |
| 413 | Ga0207669_10740924 | 3300025937 | Bacteria | 811 |
| 414 | Ga0207665_10004102 | 3300025939 | Bacteria | 9717 |
| 415 | Ga0207665_10067219 | 3300025939 | Bacteria | 2440 |
| 416 | Ga0207665_10097939 | 3300025939 | Bacteria | 2042 |
| 417 | Ga0207665_10855171 | 3300025939 | Bacteria | 720 |
| 418 | Ga0207691_10001627 | 3300025940 | Bacteria | 22294 |
| 419 | Ga0207691_10250595 | 3300025940 | Bacteria | 1528 |
| 420 | Ga0207711_10101018 | 3300025941 | Bacteria | 2552 |
| 421 | Ga0207711_10227872 | 3300025941 | Bacteria | 1706 |
| 422 | Ga0207711_10472488 | 3300025941 | Bacteria | 1168 |
| 423 | Ga0207689_10007012 | 3300025942 | Bacteria | 9907 |
| 424 | Ga0207661_10026523 | 3300025944 | Bacteria | 4415 |
| 425 | Ga0207661_10106947 | 3300025944 | Bacteria | 2359 |
| 426 | Ga0207679_10015638 | 3300025945 | Bacteria | 5020 |
| 427 | Ga0207679_10081985 | 3300025945 | Bacteria | 2468 |
| 428 | Ga0207679_10230954 | 3300025945 | Bacteria | 1562 |
| 429 | Ga0207667_10055984 | 3300025949 | Bacteria | 4144 |
| 430 | Ga0207667_10062848 | 3300025949 | Bacteria | 3881 |
| 431 | Ga0207667_10118214 | 3300025949 | Bacteria | 2732 |
| 432 | Ga0207667_10744060 | 3300025949 | Bacteria | 980 |
| 433 | Ga0207651_10135996 | 3300025960 | Bacteria | 1890 |
| 434 | Ga0207651_10269391 | 3300025960 | Bacteria | 1402 |
| 435 | Ga0207712_10234008 | 3300025961 | Bacteria | 1476 |
| 436 | Ga0207668_10007545 | 3300025972 | Bacteria | 6475 |
| 437 | Ga0207640_10019201 | 3300025981 | Bacteria | 4034 |
| 438 | Ga0207640_10341830 | 3300025981 | Bacteria | 1199 |
| 439 | Ga0207640_10529856 | 3300025981 | Bacteria | 986 |
| 440 | Ga0207658_10096845 | 3300025986 | Bacteria | 2302 |
| 441 | Ga0207658_10802301 | 3300025986 | Bacteria | 855 |
| 442 | Ga0207677_10126300 | 3300026023 | Bacteria | 1934 |
| 443 | Ga0207677_10391944 | 3300026023 | Bacteria | 1175 |
| 444 | Ga0207677_10667069 | 3300026023 | Bacteria | 919 |
| 445 | Ga0207703_10167640 | 3300026035 | Bacteria | 1929 |
| 446 | Ga0207703_10525085 | 3300026035 | Bacteria | 1114 |
| 447 | Ga0207703_10686420 | 3300026035 | Bacteria | 973 |
| 448 | Ga0207639_10158101 | 3300026041 | Bacteria | 1906 |
| 449 | Ga0207678_10020051 | 3300026067 | Bacteria | 5874 |
| 450 | Ga0207678_10334683 | 3300026067 | Bacteria | 1304 |
| 451 | Ga0207678_10370403 | 3300026067 | Bacteria | 1237 |
| 452 | Ga0207708_10001502 | 3300026075 | Bacteria | 17383 |
| 453 | Ga0207708_10152108 | 3300026075 | Bacteria | 1823 |
| 454 | Ga0207708_10896307 | 3300026075 | Bacteria | 767 |
| 455 | Ga0207702_10064733 | 3300026078 | Bacteria | 3129 |
| 456 | Ga0207702_11400396 | 3300026078 | Bacteria | 693 |
| 457 | Ga0207648_10006668 | 3300026089 | Bacteria | 11454 |
| 458 | Ga0207648_10074077 | 3300026089 | Bacteria | 2967 |
| 459 | Ga0207648_10278555 | 3300026089 | Bacteria | 1495 |
| 460 | Ga0207648_10710169 | 3300026089 | Bacteria | 932 |
| 461 | Ga0207676_10018586 | 3300026095 | Bacteria | 5056 |
| 462 | Ga0207675_100013475 | 3300026118 | Bacteria | 7630 |
| 463 | Ga0207675_100260100 | 3300026118 | Bacteria | 1682 |
| 464 | Ga0207683_10012333 | 3300026121 | Bacteria | 7294 |
| 465 | Ga0207683_10076816 | 3300026121 | Bacteria | 2957 |
| 466 | Ga0207683_10547128 | 3300026121 | Bacteria | 1070 |
| 467 | Ga0207698_10127091 | 3300026142 | Bacteria | 2170 |
| 468 | Ga0207698_10678084 | 3300026142 | Bacteria | 1024 |
| 469 | Ga0209179_1011531 | 3300027512 | Bacteria | 1568 |
| 470 | Ga0209588_1010903 | 3300027671 | Bacteria | 2738 |
| 471 | Ga0209588_1027516 | 3300027671 | Bacteria | 1809 |
| 472 | Ga0209813_10003719 | 3300027866 | Bacteria | 3594 |
| 473 | Ga0207428_10049012 | 3300027907 | Bacteria | 3386 |
| 474 | Ga0268266_10095158 | 3300028379 | Bacteria | 2616 |
| 475 | Ga0268266_10286712 | 3300028379 | Bacteria | 1532 |
| 476 | Ga0268266_10449037 | 3300028379 | Bacteria | 1225 |
| 477 | Ga0268266_10494120 | 3300028379 | Bacteria | 1168 |
| 478 | Ga0268266_10760726 | 3300028379 | Bacteria | 935 |
| 479 | Ga0268265_10011597 | 3300028380 | Bacteria | 5959 |
| 480 | Ga0268265_10597576 | 3300028380 | Bacteria | 1054 |
| 481 | Ga0268264_10858049 | 3300028381 | Bacteria | 910 |
| 482 | Ga0265334_10012318 | 3300028573 | Bacteria | 3595 |
| 483 | Ga0265338_10151314 | 3300028800 | Bacteria | 1802 |
| 484 | Ga0265763_1007016 | 3300030763 | Bacteria | 980 |
| 485 | Ga0265763_1008412 | 3300030763 | Bacteria | 921 |
| 486 | Ga0265773_1006882 | 3300031018 | Bacteria | 872 |
| 487 | Ga0265332_10006574 | 3300031238 | Bacteria | 5271 |
| 488 | Ga0265325_10002317 | 3300031241 | Bacteria | 12919 |
| 489 | Ga0265329_10070499 | 3300031242 | Bacteria | 1106 |
| 490 | Ga0265340_10015062 | 3300031247 | Bacteria | 4025 |
| 491 | Ga0265339_10000078 | 3300031249 | Bacteria | 83767 |
| 492 | Ga0265339_10019601 | 3300031249 | Bacteria | 3968 |
| 493 | Ga0265331_10154151 | 3300031250 | Bacteria | 1043 |
| 494 | Ga0265316_10228627 | 3300031344 | Bacteria | 1370 |
| 495 | Ga0265313_10003528 | 3300031595 | Bacteria | 12614 |
| 496 | Ga0265314_10022239 | 3300031711 | Bacteria | 4859 |
| 497 | Ga0265342_10002635 | 3300031712 | Bacteria | 15340 |
| 498 | Ga0316578_10268499 | 3300031728 | Bacteria | 1022 |
| 499 | Ga0373926_0022219 | 3300035083 | Bacteria | 2201 |
| 500 | Ga0373929_0111511 | 3300035085 | Bacteria | 700 |
| 501 | Ga0373944_0024358 | 3300035089 | Bacteria | 1773 |
| 502 | Ga0373952_0114059 | 3300035092 | Bacteria | 726 |
| 503 | Ga0373923_0002771 | 3300035111 | Bacteria | 5477 |
| 504 | Ga0373923_0078977 | 3300035111 | Bacteria | 1425 |
| 505 | Ga0373936_0003979 | 3300035113 | Bacteria | 5569 |
| 506 | Ga0373936_0010496 | 3300035113 | Bacteria | 3495 |
| 507 | Ga0373936_0104241 | 3300035113 | Bacteria | 1199 |
| 508 | Ga0373939_0069327 | 3300035114 | Bacteria | 1144 |
| 509 | Ga0373945_0001064 | 3300035116 | Bacteria | 8252 |
| 510 | Ga0373945_0005949 | 3300035116 | Bacteria | 3917 |
| 511 | Ga0373953_0004294 | 3300035117 | Bacteria | 4530 |
| 512 | Ga0373954_0000906 | 3300035118 | Bacteria | 11525 |
| 513 | Ga0373954_0002609 | 3300035118 | Bacteria | 7586 |
| 514 | Ga0373954_0058587 | 3300035118 | Bacteria | 1814 |
| 515 | Ga0373956_0000029 | 3300035119 | Bacteria | 45843 |
| 516 | Ga0373956_0033037 | 3300035119 | Bacteria | 2273 |
| 517 | Ga0373956_0339949 | 3300035119 | Bacteria | 715 |
| 518 | Ga0373957_0010530 | 3300035120 | Bacteria | 3060 |
| 519 | Ga0373957_0015261 | 3300035120 | Bacteria | 2641 |
| 520 | Ga0373960_0014720 | 3300035121 | Bacteria | 1986 |
| 521 | Ga0373943_0000208 | 3300035170 | Bacteria | 24045 |
| 522 | Ga0373943_0003827 | 3300035170 | Bacteria | 6840 |
| 523 | Ga0373943_0032102 | 3300035170 | Bacteria | 2494 |
| 524 | Ga0373943_0058368 | 3300035170 | Bacteria | 1921 |
| 525 | Ga0373946_0001814 | 3300035171 | Bacteria | 7457 |
| 526 | Ga0373946_0006567 | 3300035171 | Bacteria | 4221 |
| 527 | Ga0373946_0020608 | 3300035171 | Bacteria | 2549 |
| 528 | Ga0373955_0000201 | 3300035172 | Bacteria | 24761 |
| 529 | Ga0373955_0003420 | 3300035172 | Bacteria | 6976 |
| 530 | Ga0373942_0088537 | 3300035207 | Bacteria | 930 |
| 531 | Ga0373942_0185417 | 3300035207 | Unclassified | 683 |
| 532 | Ga0373961_0108448 | 3300035241 | Bacteria | 907 |
| 533 | Ga0373924_0062256 | 3300035410 | Bacteria | 1562 |
| 534 | Ga0373931_0024776 | 3300035691 | Bacteria | 3043 |
| 535 | Ga0373931_0049908 | 3300035691 | Bacteria | 2225 |
| 536 | Ga0373931_0177648 | 3300035691 | Bacteria | 1259 |
| 537 | Ga0373935_0000068 | 3300035692 | Bacteria | 43997 |
| 538 | Ga0373935_0048992 | 3300035692 | Bacteria | 2677 |
| 539 | Ga0373935_0213117 | 3300035692 | Bacteria | 1339 |
| 540 | Ga0373935_0431288 | 3300035692 | Bacteria | 950 |
| 541 | Ga0373927_0005387 | 3300035695 | Bacteria | 8840 |
| 542 | Ga0373927_0006191 | 3300035695 | Bacteria | 8171 |
| 543 | Ga0373927_0026505 | 3300035695 | Bacteria | 3788 |
| 544 | Ga0373927_0028489 | 3300035695 | Bacteria | 3643 |
| 545 | Ga0373927_0039331 | 3300035695 | Bacteria | 3069 |
| 546 | Ga0373927_0067847 | 3300035695 | Bacteria | 2308 |
| 547 | Ga0373927_0179490 | 3300035695 | Bacteria | 1389 |
| 548 | Ga0373927_0331838 | 3300035695 | Bacteria | 1002 |
| 549 | Ga0373933_0002902 | 3300035724 | Bacteria | 9577 |
| 550 | Ga0373933_0003207 | 3300035724 | Bacteria | 9130 |
| 551 | Ga0373933_0534282 | 3300035724 | Bacteria | 769 |
| 552 | Ga0373933_0647813 | 3300035724 | Bacteria | 694 |
| 553 | Ga0373947_0000178 | 3300035725 | Bacteria | 34953 |
| 554 | Ga0373947_0002537 | 3300035725 | Bacteria | 10978 |
| 555 | Ga0373947_0023662 | 3300035725 | Bacteria | 3575 |
| 556 | Ga0373947_0064449 | 3300035725 | Bacteria | 2234 |
| 557 | Ga0373947_0102805 | 3300035725 | Bacteria | 1797 |
| 558 | Ga0373947_0125390 | 3300035725 | Bacteria | 1635 |
| 559 | Ga0373947_0180047 | 3300035725 | Bacteria | 1375 |
| 560 | Ga0373937_0000347 | 3300036401 | Bacteria | 43749 |
| 561 | Ga0373937_0000441 | 3300036401 | Bacteria | 38394 |
| 562 | Ga0373937_0045533 | 3300036401 | Bacteria | 4010 |
| 563 | Ga0373937_0179799 | 3300036401 | Bacteria | 1986 |
| 564 | Ga0373937_0194899 | 3300036401 | Bacteria | 1904 |
| 565 | Ga0373937_0250597 | 3300036401 | Bacteria | 1669 |
| 566 | Ga0316582_0245053 | 3300036647 | Bacteria | 1228 |
| 567 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 568 | Ga0373925_0001482 | 3300037068 | Bacteria | 20154 |
| 569 | Ga0373925_0044829 | 3300037068 | Bacteria | 3284 |
| 570 | Ga0373925_0250494 | 3300037068 | Bacteria | 1420 |
| 571 | Ga0373925_0302993 | 3300037068 | Bacteria | 1290 |
| 572 | Ga0373925_0324306 | 3300037068 | Bacteria | 1247 |
| 573 | Ga0373925_0454820 | 3300037068 | Bacteria | 1049 |
| 574 | Ga0373925_0638458 | 3300037068 | Bacteria | 877 |
| 575 | Ga0395899_0014903 | 3300037312 | Bacteria | 5930 |
| 576 | Ga0395899_0096464 | 3300037312 | Bacteria | 2138 |
| 577 | Ga0395900_0008428 | 3300037418 | Bacteria | 10605 |
| 578 | Ga0395900_0011461 | 3300037418 | Bacteria | 9075 |
| 579 | Ga0395900_0143324 | 3300037418 | Bacteria | 2445 |
| 580 | Ga0395900_1067436 | 3300037418 | Bacteria | 726 |
| 581 | Ga0395898_0082166 | 3300037466 | Bacteria | 3106 |
| 582 | Ga0395898_0138981 | 3300037466 | Bacteria | 2325 |
| 583 | Ga0395898_0331558 | 3300037466 | Bacteria | 1451 |
| 584 | Ga0395905_0500874 | 3300037471 | Bacteria | 1115 |
| 585 | Ga0436364_0664195 | 3300037853 | Bacteria | 2975 |
| 586 | Ga0436364_0716542 | 3300037853 | Bacteria | 2780 |
| 587 | Ga0436364_0951864 | 3300037853 | Bacteria | 9370 |
| 588 | Ga0395901_0009788 | 3300038443 | Bacteria | 9721 |
| 589 | Ga0395901_0018877 | 3300038443 | Bacteria | 7049 |
| 590 | Ga0395901_0137101 | 3300038443 | Bacteria | 2571 |
| 591 | Ga0395901_0215568 | 3300038443 | Bacteria | 2008 |
| 592 | Ga0395901_0564087 | 3300038443 | Bacteria | 1152 |
| 593 | Ga0436365_0042743 | 3300039437 | Bacteria | 2739 |
| 594 | Ga0436365_0291537 | 3300039437 | Bacteria | 629 |
| 595 | Ga0436365_1099387 | 3300039437 | Bacteria | 3202 |
| 596 | Ga0436365_1251077 | 3300039437 | Bacteria | 937 |
| 597 | Ga0436365_1336443 | 3300039437 | Bacteria | 3131 |
| 598 | Ga0436365_1383206 | 3300039437 | Bacteria | 1820 |
| 599 | Ga0436360_0291491 | 3300039438 | Bacteria | 2024 |
| 600 | Ga0436360_0775077 | 3300039438 | Bacteria | 2194 |
| 601 | Ga0436360_1307075 | 3300039438 | Bacteria | 1174 |
| 602 | Ga0436361_0424457 | 3300039447 | Bacteria | 3406 |
| 603 | Ga0436361_0687582 | 3300039447 | Bacteria | 1439 |
| 604 | Ga0436361_0914825 | 3300039447 | Bacteria | 917 |
| 605 | Ga0436363_0235431 | 3300039450 | Bacteria | 801 |
| 606 | Ga0436363_0753578 | 3300039450 | Bacteria | 884 |
| 607 | Ga0436363_1012681 | 3300039450 | Bacteria | 2233 |
| 608 | Ga0436363_1455596 | 3300039450 | Bacteria | 957 |
| 609 | Ga0439453_0015398 | 3300041408 | Bacteria | 1322 |
| 610 | Ga0451853_1512202 | 3300041512 | Bacteria | 1297 |
| 611 | Ga0439464_0034921 | 3300042439 | Bacteria | 1419 |
| 612 | Ga0451577_0277536 | 3300042876 | Bacteria | 1518 |
| 613 | Ga0466966_0306725 | 3300044684 | Bacteria | 954 |
| 614 | Ga0466961_0158392 | 3300044693 | Bacteria | 1412 |
| 615 | Ga0466963_0018448 | 3300044694 | Bacteria | 4363 |
| 616 | Ga0466963_0025164 | 3300044694 | Bacteria | 3794 |
| 617 | Ga0466963_0034467 | 3300044694 | Bacteria | 3293 |
| 618 | Ga0466957_0125405 | 3300044842 | Bacteria | 1640 |
| 619 | Ga0466959_0034418 | 3300045049 | Bacteria | 3747 |
| 620 | Ga0466959_0036016 | 3300045049 | Bacteria | 3657 |
| 621 | Ga0451576_0295185 | 3300045051 | Bacteria | 1695 |
| 622 | Ga0451576_0599338 | 3300045051 | Bacteria | 1158 |
| 623 | Ga0466958_0014631 | 3300045836 | Bacteria | 4480 |
| 624 | Ga0466958_0067079 | 3300045836 | Bacteria | 2191 |
| 625 | Ga0466967_0091388 | 3300045976 | Bacteria | 2766 |
| 626 | Ga0466967_0320079 | 3300045976 | Bacteria | 1495 |
| 627 | Ga0466967_0611955 | 3300045976 | Bacteria | 1076 |
| 628 | Ga0495617_118481 | 3300046452 | Bacteria | 854 |
| 629 | Ga0495592_0000196 | 3300046454 | Bacteria | 51625 |
| 630 | Ga0495592_0022021 | 3300046454 | Bacteria | 4848 |
| 631 | Ga0495592_0287452 | 3300046454 | Bacteria | 1073 |
| 632 | Ga0495603_0165172 | 3300046455 | Bacteria | 1283 |
| 633 | Ga0495590_0087493 | 3300046457 | Bacteria | 1101 |
| 634 | Ga0495591_045515 | 3300046458 | Bacteria | 1223 |
| 635 | Ga0495629_0003904 | 3300046459 | Bacteria | 11215 |
| 636 | Ga0495651_0000356 | 3300046462 | Bacteria | 35210 |
| 637 | Ga0495651_0000977 | 3300046462 | Bacteria | 22167 |
| 638 | Ga0495651_0062022 | 3300046462 | Bacteria | 2861 |
| 639 | Ga0495651_0088854 | 3300046462 | Bacteria | 2321 |
| 640 | Ga0495653_0000193 | 3300046463 | Bacteria | 49516 |
| 641 | Ga0495653_0125711 | 3300046463 | Bacteria | 1821 |
| 642 | Ga0495653_0367836 | 3300046463 | Bacteria | 921 |
| 643 | Ga0495580_0091021 | 3300046472 | Bacteria | 2123 |
| 644 | Ga0495582_0022901 | 3300046473 | Bacteria | 3417 |
| 645 | Ga0495582_0034182 | 3300046473 | Bacteria | 2795 |
| 646 | Ga0495582_0212729 | 3300046473 | Bacteria | 1105 |
| 647 | Ga0495639_0045107 | 3300046475 | Bacteria | 1994 |
| 648 | Ga0495662_0060059 | 3300046476 | Bacteria | 1836 |
| 649 | Ga0495662_0080447 | 3300046476 | Bacteria | 1584 |
| 650 | Ga0495662_0142170 | 3300046476 | Bacteria | 1181 |
| 651 | Ga0495662_0242024 | 3300046476 | Bacteria | 889 |
| 652 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 653 | Ga0495664_0015488 | 3300046477 | Bacteria | 4334 |
| 654 | Ga0495584_0139415 | 3300046491 | Bacteria | 1231 |
| 655 | Ga0495594_0266148 | 3300046499 | Bacteria | 976 |
| 656 | Ga0495607_0119698 | 3300046501 | Bacteria | 1384 |
| 657 | Ga0495608_0000121 | 3300046511 | Bacteria | 56189 |
| 658 | Ga0495608_0279154 | 3300046511 | Bacteria | 1037 |
| 659 | Ga0495616_0056321 | 3300046513 | Bacteria | 1942 |
| 660 | Ga0495618_0000124 | 3300046514 | Bacteria | 56215 |
| 661 | Ga0495618_0041757 | 3300046514 | Bacteria | 2889 |
| 662 | Ga0495618_0091385 | 3300046514 | Bacteria | 1946 |
| 663 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 664 | Ga0495628_0015254 | 3300046516 | Bacteria | 6417 |
| 665 | Ga0495628_0101785 | 3300046516 | Bacteria | 2216 |
| 666 | Ga0495628_0139904 | 3300046516 | Bacteria | 1847 |
| 667 | Ga0495630_0002180 | 3300046517 | Bacteria | 13643 |
| 668 | Ga0495630_0088692 | 3300046517 | Bacteria | 2336 |
| 669 | Ga0495630_0269636 | 3300046517 | Bacteria | 1300 |
| 670 | Ga0495630_0432671 | 3300046517 | Bacteria | 1008 |
| 671 | Ga0495644_0015905 | 3300046523 | Bacteria | 2883 |
| 672 | Ga0495666_0057585 | 3300046526 | Bacteria | 1860 |
| 673 | Ga0495666_0124149 | 3300046526 | Bacteria | 1208 |
| 674 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 675 | Ga0495652_0006146 | 3300046529 | Bacteria | 11223 |
| 676 | Ga0495652_0044867 | 3300046529 | Bacteria | 3805 |
| 677 | Ga0495652_0173262 | 3300046529 | Bacteria | 1663 |
| 678 | Ga0495665_0022710 | 3300046531 | Bacteria | 3370 |
| 679 | Ga0495665_0062082 | 3300046531 | Bacteria | 1973 |
| 680 | Ga0495665_0111401 | 3300046531 | Bacteria | 1435 |
| 681 | Ga0495640_0000063 | 3300046533 | Bacteria | 60255 |
| 682 | Ga0495640_0186408 | 3300046533 | Bacteria | 1320 |
| 683 | Ga0495640_0192449 | 3300046533 | Bacteria | 1296 |
| 684 | Ga0495640_0261916 | 3300046533 | Bacteria | 1080 |
| 685 | Ga0495586_0027423 | 3300046535 | Bacteria | 3048 |
| 686 | Ga0495587_0000134 | 3300046536 | Bacteria | 56076 |
| 687 | Ga0495587_0063866 | 3300046536 | Bacteria | 2152 |
| 688 | Ga0495587_0289664 | 3300046536 | Bacteria | 917 |
| 689 | Ga0495598_0000513 | 3300046537 | Bacteria | 7181 |
| 690 | Ga0495598_0085309 | 3300046537 | Bacteria | 1020 |
| 691 | Ga0495621_0066992 | 3300046539 | Bacteria | 1315 |
| 692 | Ga0495645_0000070 | 3300046543 | Bacteria | 71823 |
| 693 | Ga0495645_0006688 | 3300046543 | Bacteria | 8009 |
| 694 | Ga0495645_0042265 | 3300046543 | Bacteria | 3323 |
| 695 | Ga0495645_0225337 | 3300046543 | Bacteria | 1258 |
| 696 | Ga0495633_0126843 | 3300046558 | Bacteria | 1181 |
| 697 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 698 | Ga0495667_0258536 | 3300046559 | Bacteria | 1108 |
| 699 | Ga0495667_0321339 | 3300046559 | Bacteria | 979 |
| 700 | Ga0495668_0106349 | 3300046616 | Bacteria | 1535 |
| 701 | Ga0495668_0232391 | 3300046616 | Bacteria | 1010 |
| 702 | Ga0495634_0000241 | 3300046642 | Bacteria | 51268 |
| 703 | Ga0495634_0006515 | 3300046642 | Bacteria | 8866 |
| 704 | Ga0495634_0007380 | 3300046642 | Bacteria | 8271 |
| 705 | Ga0495634_0023797 | 3300046642 | Bacteria | 4303 |
| 706 | Ga0495634_0131184 | 3300046642 | Bacteria | 1597 |
| 707 | Ga0495635_0000045 | 3300046663 | Bacteria | 82266 |
| 708 | Ga0495635_0007866 | 3300046663 | Bacteria | 7445 |
| 709 | Ga0495635_0474966 | 3300046663 | Unclassified | 825 |
| 710 | Ga0495659_0046419 | 3300046664 | Bacteria | 1568 |
| 711 | Ga0495657_0001202 | 3300046675 | Bacteria | 22674 |
| 712 | Ga0495657_0054030 | 3300046675 | Bacteria | 2685 |
| 713 | Ga0495657_0227561 | 3300046675 | Bacteria | 1129 |
| 714 | Ga0495657_0297955 | 3300046675 | Bacteria | 962 |
| 715 | Ga0495599_0000107 | 3300046678 | Bacteria | 56178 |
| 716 | Ga0495599_0016176 | 3300046678 | Bacteria | 4630 |
| 717 | Ga0495599_0271096 | 3300046678 | Bacteria | 1030 |
| 718 | Ga0495623_0000180 | 3300046679 | Bacteria | 39869 |
| 719 | Ga0495623_0290852 | 3300046679 | Bacteria | 906 |
| 720 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 721 | Ga0495646_0009489 | 3300046680 | Bacteria | 6177 |
| 722 | Ga0495646_0086248 | 3300046680 | Bacteria | 1821 |
| 723 | Ga0495647_0017526 | 3300046681 | Bacteria | 2536 |
| 724 | Ga0495647_0133894 | 3300046681 | Bacteria | 1052 |
| 725 | Ga0495658_0020639 | 3300046683 | Bacteria | 3461 |
| 726 | Ga0495658_0088488 | 3300046683 | Bacteria | 1830 |
| 727 | Ga0495658_0782518 | 3300046683 | Bacteria | 611 |
| 728 | Ga0495613_0028287 | 3300046689 | Bacteria | 4169 |
| 729 | Ga0495613_0055243 | 3300046689 | Bacteria | 2918 |
| 730 | Ga0495613_0056616 | 3300046689 | Bacteria | 2879 |
| 731 | Ga0495613_0070264 | 3300046689 | Bacteria | 2553 |
| 732 | Ga0495613_0103178 | 3300046689 | Bacteria | 2059 |
| 733 | Ga0495624_0052660 | 3300046690 | Bacteria | 2571 |
| 734 | Ga0495624_0093253 | 3300046690 | Bacteria | 1857 |
| 735 | Ga0495670_0004845 | 3300046691 | Bacteria | 6606 |
| 736 | Ga0495671_0025808 | 3300046692 | Bacteria | 3051 |
| 737 | Ga0495600_0000062 | 3300046809 | Bacteria | 61420 |
| 738 | Ga0495600_0028026 | 3300046809 | Bacteria | 3643 |
| 739 | Ga0495581_0050844 | 3300047315 | Bacteria | 2394 |
| 740 | Ga0495581_0164637 | 3300047315 | Bacteria | 1297 |
| 741 | Ga0495581_0251664 | 3300047315 | Bacteria | 1033 |
| 742 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 743 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 744 | Ga0495674_0146874 | 3300047319 | Bacteria | 1979 |
| 745 | Ga0495674_0452055 | 3300047319 | Bacteria | 1032 |
| 746 | Ga0495672_0091047 | 3300047320 | Bacteria | 1675 |
| 747 | Ga0495676_0021834 | 3300047321 | Bacteria | 5581 |
| 748 | Ga0495676_0072883 | 3300047321 | Bacteria | 2635 |
| 749 | Ga0495676_0542368 | 3300047321 | Bacteria | 761 |
| 750 | Ga0495680_0000779 | 3300047322 | Bacteria | 35728 |
| 751 | Ga0495680_0199616 | 3300047322 | Bacteria | 1435 |
| 752 | Ga0495680_0274377 | 3300047322 | Bacteria | 1190 |
| 753 | Ga0495680_0326915 | 3300047322 | Bacteria | 1072 |
| 754 | Ga0495675_0000058 | 3300047444 | Bacteria | 77587 |
| 755 | Ga0495675_0074564 | 3300047444 | Bacteria | 2138 |
| 756 | Ga0495675_0222744 | 3300047444 | Bacteria | 1141 |
| 757 | Ga0495684_0000059 | 3300047471 | Bacteria | 77947 |
| 758 | Ga0495684_0023040 | 3300047471 | Bacteria | 4790 |
| 759 | Ga0495684_0032711 | 3300047471 | Bacteria | 3994 |
| 760 | Ga0495593_0005129 | 3300047673 | Bacteria | 7741 |
| 761 | Ga0495593_0006926 | 3300047673 | Bacteria | 6638 |
| 762 | Ga0495593_0092976 | 3300047673 | Bacteria | 1552 |
| 763 | Ga0495593_0249251 | 3300047673 | Bacteria | 889 |
| 764 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 765 | Ga0495602_0281844 | 3300048088 | Bacteria | 1224 |
| 766 | Ga0495602_0842122 | 3300048088 | Bacteria | 613 |
| 767 | Ga0496100_0006029 | 3300048903 | Bacteria | 6579 |
| 768 | Ga0496100_0007617 | 3300048903 | Bacteria | 5988 |
| 769 | Ga0496100_0221282 | 3300048903 | Bacteria | 1389 |
| 770 | Ga0496100_0577318 | 3300048903 | Bacteria | 871 |
| 771 | Ga0496100_0704446 | 3300048903 | Bacteria | 788 |
| 772 | Ga0496101_0000879 | 3300048904 | Bacteria | 17685 |
| 773 | Ga0496101_0003104 | 3300048904 | Bacteria | 10272 |
| 774 | Ga0496101_0011363 | 3300048904 | Bacteria | 5905 |
| 775 | Ga0496101_0018180 | 3300048904 | Bacteria | 4776 |
| 776 | Ga0496101_0153974 | 3300048904 | Bacteria | 1760 |
| 777 | Ga0496101_0340027 | 3300048904 | Bacteria | 1179 |
| 778 | Ga0496101_0344962 | 3300048904 | Bacteria | 1170 |
| 779 | Ga0496101_0608082 | 3300048904 | Bacteria | 864 |
| 780 | Ga0496101_0629180 | 3300048904 | Bacteria | 848 |
| 781 | Ga0496102_0008462 | 3300048905 | Bacteria | 8821 |
| 782 | Ga0496102_0011826 | 3300048905 | Bacteria | 7533 |
| 783 | Ga0496102_0024214 | 3300048905 | Bacteria | 5396 |
| 784 | Ga0496102_0037021 | 3300048905 | Bacteria | 4400 |
| 785 | Ga0496102_0069866 | 3300048905 | Bacteria | 3224 |
| 786 | Ga0496102_0576835 | 3300048905 | Bacteria | 1048 |
| 787 | Ga0496102_0717283 | 3300048905 | Bacteria | 923 |
| 788 | Ga0496102_0902813 | 3300048905 | Bacteria | 805 |
| 789 | Ga0496103_0007237 | 3300048906 | Bacteria | 6615 |
| 790 | Ga0496103_0048800 | 3300048906 | Bacteria | 2617 |
| 791 | Ga0496103_0102030 | 3300048906 | Bacteria | 1817 |
| 792 | Ga0496103_0243198 | 3300048906 | Bacteria | 1158 |
| 793 | Ga0496104_0001978 | 3300048907 | Bacteria | 17751 |
| 794 | Ga0496104_0004384 | 3300048907 | Bacteria | 12293 |
| 795 | Ga0496104_0006107 | 3300048907 | Bacteria | 10574 |
| 796 | Ga0496104_0017059 | 3300048907 | Bacteria | 6607 |
| 797 | Ga0496104_0195705 | 3300048907 | Bacteria | 1934 |
| 798 | Ga0496104_0374083 | 3300048907 | Bacteria | 1337 |
| 799 | Ga0496104_0468513 | 3300048907 | Bacteria | 1171 |
| 800 | Ga0496104_0848001 | 3300048907 | Bacteria | 819 |
| 801 | Ga0496104_0990057 | 3300048907 | Bacteria | 745 |
| 802 | Ga0496105_0001999 | 3300048908 | Bacteria | 14708 |
| 803 | Ga0496105_0005181 | 3300048908 | Bacteria | 9880 |
| 804 | Ga0496105_0015753 | 3300048908 | Bacteria | 6033 |
| 805 | Ga0496105_0061405 | 3300048908 | Bacteria | 3101 |
| 806 | Ga0496105_0061711 | 3300048908 | Bacteria | 3094 |
| 807 | Ga0496105_0098553 | 3300048908 | Bacteria | 2413 |
| 808 | Ga0496105_0454318 | 3300048908 | Bacteria | 1011 |
| 809 | Ga0496106_0003496 | 3300048909 | Bacteria | 11703 |
| 810 | Ga0496106_0011510 | 3300048909 | Bacteria | 6542 |
| 811 | Ga0496106_0016650 | 3300048909 | Bacteria | 5438 |
| 812 | Ga0496106_0317869 | 3300048909 | Bacteria | 1250 |
| 813 | Ga0496106_0917103 | 3300048909 | Unclassified | 691 |
| 814 | Ga0496107_0008551 | 3300048910 | Bacteria | 7083 |
| 815 | Ga0496107_0028396 | 3300048910 | Bacteria | 3975 |
| 816 | Ga0496107_0062820 | 3300048910 | Bacteria | 2690 |
| 817 | Ga0496107_0181280 | 3300048910 | Bacteria | 1564 |
| 818 | Ga0496107_0318195 | 3300048910 | Bacteria | 1158 |
| 819 | Ga0496108_0000347 | 3300048911 | Bacteria | 39108 |
| 820 | Ga0496108_0005996 | 3300048911 | Bacteria | 9840 |
| 821 | Ga0496108_0013218 | 3300048911 | Bacteria | 6727 |
| 822 | Ga0496108_0018394 | 3300048911 | Bacteria | 5720 |
| 823 | Ga0496108_0032557 | 3300048911 | Bacteria | 4330 |
| 824 | Ga0496108_0077240 | 3300048911 | Bacteria | 2816 |
| 825 | Ga0496109_0005863 | 3300048912 | Bacteria | 10300 |
| 826 | Ga0496109_0022511 | 3300048912 | Bacteria | 5583 |
| 827 | Ga0496109_0032495 | 3300048912 | Bacteria | 4691 |
| 828 | Ga0496109_0045633 | 3300048912 | Bacteria | 3977 |
| 829 | Ga0496109_0313055 | 3300048912 | Bacteria | 1481 |
| 830 | Ga0496109_0498994 | 3300048912 | Bacteria | 1149 |
| 831 | Ga0496109_0586258 | 3300048912 | Bacteria | 1051 |
| 832 | Ga0496110_0000339 | 3300048913 | Bacteria | 31235 |
| 833 | Ga0496110_0003146 | 3300048913 | Bacteria | 12548 |
| 834 | Ga0496110_0012105 | 3300048913 | Bacteria | 7086 |
| 835 | Ga0496110_0029719 | 3300048913 | Bacteria | 4706 |
| 836 | Ga0496110_0074428 | 3300048913 | Bacteria | 3016 |
| 837 | Ga0496110_0170611 | 3300048913 | Bacteria | 1974 |
| 838 | Ga0496110_0264085 | 3300048913 | Bacteria | 1567 |
| 839 | Ga0496110_0323362 | 3300048913 | Bacteria | 1405 |
| 840 | Ga0496110_0625564 | 3300048913 | Bacteria | 975 |
| 841 | Ga0496111_0001676 | 3300048914 | Bacteria | 12899 |
| 842 | Ga0496111_0009006 | 3300048914 | Bacteria | 6640 |
| 843 | Ga0496111_0017366 | 3300048914 | Bacteria | 4975 |
| 844 | Ga0496111_0021601 | 3300048914 | Bacteria | 4497 |
| 845 | Ga0496111_0720866 | 3300048914 | Bacteria | 725 |
| 846 | Ga0496112_0002294 | 3300048915 | Bacteria | 15311 |
| 847 | Ga0496112_0003807 | 3300048915 | Bacteria | 12611 |
| 848 | Ga0496112_0004698 | 3300048915 | Bacteria | 11628 |
| 849 | Ga0496112_0006289 | 3300048915 | Bacteria | 10415 |
| 850 | Ga0496112_0129178 | 3300048915 | Bacteria | 2498 |
| 851 | Ga0496112_0233439 | 3300048915 | Bacteria | 1794 |
| 852 | Ga0496112_0618357 | 3300048915 | Bacteria | 1014 |
| 853 | Ga0496112_0648060 | 3300048915 | Bacteria | 986 |
| 854 | Ga0496112_0917495 | 3300048915 | Bacteria | 797 |
| 855 | Ga0496113_0069726 | 3300048916 | Bacteria | 2671 |
| 856 | Ga0496113_0075665 | 3300048916 | Bacteria | 2570 |
| 857 | Ga0496113_0114824 | 3300048916 | Bacteria | 2100 |
| 858 | Ga0496113_0132092 | 3300048916 | Bacteria | 1960 |
| 859 | Ga0496113_0280044 | 3300048916 | Bacteria | 1333 |
| 860 | Ga0496114_0110149 | 3300048917 | Bacteria | 2358 |
| 861 | Ga0496115_0018524 | 3300048918 | Bacteria | 5348 |
| 862 | Ga0496115_0055975 | 3300048918 | Bacteria | 3169 |
| 863 | Ga0496115_0060795 | 3300048918 | Bacteria | 3045 |
| 864 | Ga0496115_0257531 | 3300048918 | Bacteria | 1435 |
| 865 | Ga0496115_0316815 | 3300048918 | Bacteria | 1276 |
| 866 | Ga0496115_0826093 | 3300048918 | Bacteria | 719 |
| 867 | Ga0501031_0023742 | 3300049568 | Bacteria | 3997 |
| 868 | Ga0501032_0175050 | 3300049569 | Bacteria | 1406 |
| 869 | Ga0501033_0058028 | 3300049570 | Bacteria | 2860 |
| 870 | Ga0501034_0000891 | 3300049571 | Bacteria | 43738 |
| 871 | Ga0501034_0011745 | 3300049571 | Bacteria | 9060 |
| 872 | Ga0501034_0021303 | 3300049571 | Bacteria | 6609 |
| 873 | Ga0501034_0234213 | 3300049571 | Bacteria | 1784 |
| 874 | Ga0501036_0171303 | 3300049572 | Unclassified | 1829 |
| 875 | Ga0501038_0580131 | 3300049574 | Bacteria | 850 |
| 876 | Ga0501039_0008570 | 3300049575 | Bacteria | 7798 |
| 877 | Ga0501040_0015963 | 3300049576 | Bacteria | 4966 |
| 878 | Ga0501040_0725460 | 3300049576 | Bacteria | 719 |
| 879 | Ga0501041_0033918 | 3300049577 | Bacteria | 3089 |
| 880 | Ga0501042_0006103 | 3300049578 | Bacteria | 7807 |
| 881 | Ga0501042_0291971 | 3300049578 | Bacteria | 1178 |
| 882 | Ga0501043_0016253 | 3300049579 | Bacteria | 5837 |
| 883 | Ga0501043_0059010 | 3300049579 | Bacteria | 3011 |
| 884 | Ga0501046_0124912 | 3300049580 | Unclassified | 1955 |
| 885 | Ga0501046_0266063 | 3300049580 | Bacteria | 1258 |
| 886 | Ga0501047_0610694 | 3300049581 | Bacteria | 912 |
| 887 | Ga0501048_0011307 | 3300049582 | Bacteria | 6655 |
| 888 | Ga0501048_0331171 | 3300049582 | Bacteria | 1085 |
| 889 | Ga0501068_0012440 | 3300049584 | Bacteria | 4826 |
| 890 | Ga0501068_0017211 | 3300049584 | Bacteria | 4177 |
| 891 | Ga0501068_0562319 | 3300049584 | Unclassified | 742 |
| 892 | Ga0501069_0041972 | 3300049585 | Bacteria | 2529 |
| 893 | Ga0501069_0047991 | 3300049585 | Bacteria | 2371 |
| 894 | Ga0501070_0003987 | 3300049586 | Bacteria | 12699 |
| 895 | Ga0501070_0185817 | 3300049586 | Bacteria | 1709 |
| 896 | Ga0501070_0787475 | 3300049586 | Bacteria | 747 |
| 897 | Ga0501071_0007220 | 3300049587 | Bacteria | 7269 |
| 898 | Ga0501071_0671147 | 3300049587 | Bacteria | 798 |
| 899 | Ga0501073_0400560 | 3300049589 | Bacteria | 948 |
| 900 | Ga0501074_0001669 | 3300049590 | Bacteria | 15112 |
| 901 | Ga0501074_0116108 | 3300049590 | Bacteria | 1915 |
| 902 | Ga0501075_0038416 | 3300049591 | Bacteria | 3579 |
| 903 | Ga0501075_0164115 | 3300049591 | Bacteria | 1695 |
| 904 | Ga0501075_0248755 | 3300049591 | Bacteria | 1355 |
| 905 | Ga0501075_0412224 | 3300049591 | Bacteria | 1030 |
| 906 | Ga0501075_0451005 | 3300049591 | Bacteria | 981 |
| 907 | Ga0501076_0019950 | 3300049592 | Bacteria | 5128 |
| 908 | Ga0501076_0166618 | 3300049592 | Bacteria | 1796 |
| 909 | Ga0501077_0038035 | 3300049593 | Bacteria | 3063 |
| 910 | Ga0501079_0142427 | 3300049741 | Bacteria | 1867 |
| 911 | Ga0501079_0299090 | 3300049741 | Bacteria | 1259 |
| 912 | Ga0501080_0049205 | 3300049742 | Bacteria | 3924 |
| 913 | Ga0501080_0306962 | 3300049742 | Bacteria | 1438 |
| 914 | Ga0501081_0533014 | 3300049743 | Bacteria | 876 |
| 915 | Ga0501083_0278715 | 3300049744 | Bacteria | 1088 |
| 916 | Ga0501035_0102447 | 3300049822 | Bacteria | 2511 |
| 917 | Ga0501044_0058411 | 3300049823 | Bacteria | 3956 |
| 918 | Ga0501044_0435136 | 3300049823 | Bacteria | 1220 |
| 919 | Ga0501045_0007001 | 3300049824 | Bacteria | 7821 |
| 920 | nmdc:mga03n38_3932_c1 | 3300050490 | Bacteria | 4844 |
| 921 | nmdc:mga03n38_523875_c1 | 3300050490 | Unclassified | 668 |
| 922 | nmdc:mga0yw44_14371_c1 | 3300050492 | Bacteria | 4203 |
| 923 | nmdc:mga0yw44_155796_c1 | 3300050492 | Bacteria | 1493 |
| 924 | nmdc:mga0yw44_176483_c1 | 3300050492 | Bacteria | 1405 |
| 925 | nmdc:mga0yw44_70420_c1 | 3300050492 | Bacteria | 2168 |
| 926 | nmdc:mga0k408_347576_c1 | 3300050493 | Bacteria | 884 |
| 927 | nmdc:mga06z11_39475_c1 | 3300050494 | Bacteria | 2349 |
| 928 | nmdc:mga06z11_790_c1 | 3300050494 | Bacteria | 11561 |
| 929 | nmdc:mga06z11_9739_c1 | 3300050494 | Bacteria | 4060 |
| 930 | nmdc:mga04h51_7974_c1 | 3300050495 | Bacteria | 2818 |
| 931 | nmdc:mga05p37_13689_c1 | 3300050507 | Bacteria | 9722 |
| 932 | nmdc:mga05p37_182270_c1 | 3300050507 | Bacteria | 2554 |
| 933 | nmdc:mga05p37_463312_c1 | 3300050507 | Bacteria | 1464 |
| 934 | nmdc:mga05p37_51539_c1 | 3300050507 | Bacteria | 5061 |
| 935 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 936 | nmdc:mga09592_276302_c1 | 3300050508 | Bacteria | 1457 |
| 937 | nmdc:mga09592_351191_c1 | 3300050508 | Bacteria | 1276 |
| 938 | nmdc:mga09592_452835_c1 | 3300050508 | Bacteria | 1107 |
| 939 | nmdc:mga09592_551382_c1 | 3300050508 | Bacteria | 990 |
| 940 | nmdc:mga0qj67_69955_c1 | 3300050509 | Bacteria | 2799 |
| 941 | nmdc:mga0qj67_72478_c1 | 3300050509 | Bacteria | 2750 |
| 942 | nmdc:mga06r32_118534_c1 | 3300050510 | Bacteria | 2609 |
| 943 | nmdc:mga06r32_134422_c1 | 3300050510 | Bacteria | 2447 |
| 944 | nmdc:mga06r32_274046_c1 | 3300050510 | Bacteria | 1675 |
| 945 | nmdc:mga06r32_5683_c1 | 3300050510 | Bacteria | 11226 |
| 946 | nmdc:mga06r32_898206_c1 | 3300050510 | Bacteria | 842 |
| 947 | nmdc:mga06r32_899039_c1 | 3300050510 | Bacteria | 842 |
| 948 | nmdc:mga08y16_147315_c1 | 3300050511 | Bacteria | 2447 |
| 949 | nmdc:mga08y16_496710_c1 | 3300050511 | Bacteria | 1240 |
| 950 | nmdc:mga08y16_627756_c1 | 3300050511 | Bacteria | 1081 |
| 951 | nmdc:mga08y16_66523_c1 | 3300050511 | Bacteria | 3761 |
| 952 | nmdc:mga0n895_155498_c1 | 3300050512 | Bacteria | 2317 |
| 953 | nmdc:mga0n895_454272_c1 | 3300050512 | Bacteria | 1293 |
| 954 | nmdc:mga0n895_459658_c1 | 3300050512 | Bacteria | 1285 |
| 955 | nmdc:mga0n895_4873_c1 | 3300050512 | Bacteria | 11115 |
| 956 | nmdc:mga0n895_809489_c1 | 3300050512 | Bacteria | 927 |
| 957 | nmdc:mga0n895_84596_c1 | 3300050512 | Bacteria | 3165 |
| 958 | nmdc:mga0n895_938110_c1 | 3300050512 | Bacteria | 849 |
| 959 | nmdc:mga0n895_98294_c1 | 3300050512 | Bacteria | 2934 |
| 960 | nmdc:mga0rr50_137244_c1 | 3300050513 | Bacteria | 1964 |
| 961 | nmdc:mga0rr50_201279_c1 | 3300050513 | Bacteria | 1636 |
| 962 | nmdc:mga0rr50_294262_c1 | 3300050513 | Bacteria | 1357 |
| 963 | nmdc:mga0rr50_929405_c1 | 3300050513 | Bacteria | 741 |
| 964 | nmdc:mga0rr50_95527_c1 | 3300050513 | Bacteria | 2323 |
| 965 | nmdc:mga08x19_127143_c1 | 3300050514 | Bacteria | 1712 |
| 966 | nmdc:mga08x19_3673_c1 | 3300050514 | Bacteria | 9135 |
| 967 | nmdc:mga08x19_40687_c1 | 3300050514 | Bacteria | 2959 |
| 968 | nmdc:mga08x19_483147_c1 | 3300050514 | Bacteria | 873 |
| 969 | nmdc:mga0a205_25016_c1 | 3300050515 | Bacteria | 5684 |
| 970 | nmdc:mga0a205_342822_c1 | 3300050515 | Bacteria | 1362 |
| 971 | nmdc:mga0a205_394674_c1 | 3300050515 | Bacteria | 1247 |
| 972 | nmdc:mga0a205_534460_c1 | 3300050515 | Bacteria | 1028 |
| 973 | nmdc:mga0sz30_5978_c1 | 3300050516 | Bacteria | 3448 |
| 974 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 975 | Ga0495601_0006967 | 3300053077 | Bacteria | 6619 |
| 976 | Ga0495601_0011070 | 3300053077 | Bacteria | 5390 |
| 977 | Ga0495601_0017716 | 3300053077 | Bacteria | 4327 |
| 978 | Ga0495601_0043988 | 3300053077 | Bacteria | 2806 |
| 979 | Ga0495601_0095332 | 3300053077 | Bacteria | 1918 |
| 980 | Ga0495601_0259457 | 3300053077 | Bacteria | 1134 |
| 981 | Ga0495601_0343242 | 3300053077 | Bacteria | 971 |
| 982 | Ga0495612_0000041 | 3300053078 | Bacteria | 62752 |
| 983 | Ga0495612_0008712 | 3300053078 | Bacteria | 4114 |
| 984 | Ga0495612_0097294 | 3300053078 | Bacteria | 1251 |
| 985 | Ga0495612_0222672 | 3300053078 | Bacteria | 835 |
| 986 | Ga0495612_0237305 | 3300053078 | Bacteria | 809 |
| 987 | Ga0495655_0000981 | 3300053083 | Bacteria | 4424 |
| 988 | Ga0495595_0000048 | 3300053084 | Bacteria | 60581 |
| 989 | Ga0495595_0001522 | 3300053084 | Bacteria | 9051 |
| 990 | Ga0495595_0143601 | 3300053084 | Bacteria | 1172 |
| 991 | Ga0495619_0000050 | 3300053085 | Bacteria | 101361 |
| 992 | Ga0495619_0002388 | 3300053085 | Bacteria | 12328 |
| 993 | Ga0495619_0041669 | 3300053085 | Bacteria | 3004 |
| 994 | Ga0495619_0088079 | 3300053085 | Bacteria | 2100 |
| 995 | Ga0495619_0118435 | 3300053085 | Bacteria | 1814 |
| 996 | Ga0495619_0313965 | 3300053085 | Bacteria | 1085 |
| 997 | Ga0495619_0391363 | 3300053085 | Bacteria | 960 |
| 998 | Ga0500566_0112346 | 3300053094 | Bacteria | 1480 |
| 999 | Ga0500641_0000747 | 3300053096 | Bacteria | 11773 |
| 1000 | Ga0500650_0089514 | 3300053098 | Bacteria | 1440 |
| 1001 | Ga0500568_0052584 | 3300053139 | Bacteria | 1599 |
| 1002 | Ga0500616_0004736 | 3300053153 | Bacteria | 9570 |
| 1003 | Ga0500616_0036435 | 3300053153 | Bacteria | 2670 |
| 1004 | Ga0500645_051596 | 3300053730 | Bacteria | 1200 |
| 1005 | Ga0501084_0023539 | 3300054114 | Bacteria | 5138 |
| 1006 | Ga0501084_0370131 | 3300054114 | Bacteria | 1211 |
| 1007 | Ga0501084_0880187 | 3300054114 | Bacteria | 753 |
| 1008 | Ga0501082_0026550 | 3300060353 | Bacteria | 4992 |
| 1009 | Ga0501082_0349555 | 3300060353 | Bacteria | 1289 |
| 1010 | Ga0501082_0568735 | 3300060353 | Bacteria | 992 |
| 1011 | Ga0466962_0160303 | 3300061719 | Bacteria | 1093 |
| 1012 | Ga0466962_0380322 | 3300061719 | Bacteria | 705 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10577925 | Ga0111539_105779252 | 172 |
| 2 | 3300035119 | Ga0373956_0339949 | Ga0373956_0339949_43_564 | 173 |
| 3 | 3300048088 | Ga0495602_0842122 | Ga0495602_0842122_74_598 | 173 |
| 4 | 3300025916 | Ga0207663_10080623 | Ga0207663_100806234 | 185 |
| 5 | 3300046511 | Ga0495608_0279154 | Ga0495608_0279154_467_1027 | 185 |
| 6 | 3300026075 | Ga0207708_10152108 | Ga0207708_101521082 | 188 |
| 7 | 3300004803 | Ga0058862_12191086 | Ga0058862_121910861 | 189 |
| 8 | 3300037471 | Ga0395905_0500874 | Ga0395905_0500874_196_771 | 190 |
| 9 | 3300048903 | Ga0496100_0704446 | Ga0496100_0704446_21_596 | 190 |
| 10 | 3300048904 | Ga0496101_0340027 | Ga0496101_0340027_517_1092 | 190 |
| 11 | 3300048907 | Ga0496104_0195705 | Ga0496104_0195705_11_586 | 190 |
| 12 | 3300050490 | nmdc:mga03n38_523875_c1 | nmdc:mga03n38_523875_c1_23_595 | 190 |
| 13 | 3300053078 | Ga0495612_0237305 | Ga0495612_0237305_11_586 | 190 |
| 14 | 3300046473 | Ga0495582_0212729 | Ga0495582_0212729_37_615 | 191 |
| 15 | 3300046516 | Ga0495628_0101785 | Ga0495628_0101785_530_1105 | 191 |
| 16 | 3300046616 | Ga0495668_0106349 | Ga0495668_0106349_938_1513 | 191 |
| 17 | 3300046683 | Ga0495658_0782518 | Ga0495658_0782518_20_598 | 191 |
| 18 | 3300047319 | Ga0495674_0452055 | Ga0495674_0452055_128_703 | 191 |
| 19 | 3300047321 | Ga0495676_0542368 | Ga0495676_0542368_30_608 | 191 |
| 20 | 3300047322 | Ga0495680_0326915 | Ga0495680_0326915_478_1053 | 191 |
| 21 | 3300050492 | nmdc:mga0yw44_155796_c1 | nmdc:mga0yw44_155796_c1_31_606 | 191 |
| 22 | 3300039437 | Ga0436365_0291537 | Ga0436365_0291537_30_611 | 193 |
| 23 | 3300005434 | Ga0070709_10935785 | Ga0070709_109357851 | 196 |
| 24 | 3300044694 | Ga0466963_0018448 | Ga0466963_0018448_1700_2329 | 198 |
| 25 | 3300044842 | Ga0466957_0125405 | Ga0466957_0125405_703_1332 | 198 |
| 26 | 3300045049 | Ga0466959_0034418 | Ga0466959_0034418_763_1392 | 198 |
| 27 | 3300045836 | Ga0466958_0067079 | Ga0466958_0067079_1512_2141 | 198 |
| 28 | 3300061719 | Ga0466962_0160303 | Ga0466962_0160303_242_871 | 198 |
| 29 | 3300006914 | Ga0075436_100129957 | Ga0075436_1001299573 | 201 |
| 30 | 3300050512 | nmdc:mga0n895_84596_c1 | nmdc:mga0n895_84596_c1_49_672 | 201 |
| 31 | 3300050513 | nmdc:mga0rr50_201279_c1 | nmdc:mga0rr50_201279_c1_117_740 | 201 |
| 32 | 3300006175 | Ga0070712_100052161 | Ga0070712_1000521613 | 202 |
| 33 | 3300025915 | Ga0207693_10185616 | Ga0207693_101856162 | 202 |
| 34 | 3300048910 | Ga0496107_0318195 | Ga0496107_0318195_514_1137 | 202 |
| 35 | 3300050514 | nmdc:mga08x19_483147_c1 | nmdc:mga08x19_483147_c1_74_700 | 202 |
| 36 | 3300042876 | Ga0451577_0277536 | Ga0451577_0277536_801_1412 | 203 |
| 37 | 3300005327 | Ga0070658_10210450 | Ga0070658_102104501 | 205 |
| 38 | 3300005329 | Ga0070683_100011408 | Ga0070683_1000114084 | 205 |
| 39 | 3300005335 | Ga0070666_10398149 | Ga0070666_103981491 | 205 |
| 40 | 3300005336 | Ga0070680_100001118 | Ga0070680_10000111814 | 205 |
| 41 | 3300005339 | Ga0070660_100522540 | Ga0070660_1005225401 | 205 |
| 42 | 3300005341 | Ga0070691_10005401 | Ga0070691_100054014 | 205 |
| 43 | 3300005344 | Ga0070661_100135873 | Ga0070661_1001358732 | 205 |
| 44 | 3300005356 | Ga0070674_100018571 | Ga0070674_1000185713 | 205 |
| 45 | 3300005364 | Ga0070673_100520815 | Ga0070673_1005208152 | 205 |
| 46 | 3300005366 | Ga0070659_100124649 | Ga0070659_1001246492 | 205 |
| 47 | 3300005444 | Ga0070694_100074074 | Ga0070694_1000740743 | 205 |
| 48 | 3300005445 | Ga0070708_100218484 | Ga0070708_1002184841 | 205 |
| 49 | 3300005456 | Ga0070678_100033430 | Ga0070678_1000334302 | 205 |
| 50 | 3300005468 | Ga0070707_100101717 | Ga0070707_1001017172 | 205 |
| 51 | 3300005471 | Ga0070698_100012347 | Ga0070698_1000123476 | 205 |
| 52 | 3300005518 | Ga0070699_100573922 | Ga0070699_1005739222 | 205 |
| 53 | 3300005530 | Ga0070679_100023849 | Ga0070679_1000238492 | 205 |
| 54 | 3300005535 | Ga0070684_100004629 | Ga0070684_1000046296 | 205 |
| 55 | 3300005536 | Ga0070697_100666805 | Ga0070697_1006668051 | 205 |
| 56 | 3300005548 | Ga0070665_100681923 | Ga0070665_1006819232 | 205 |
| 57 | 3300005549 | Ga0070704_100001250 | Ga0070704_1000012504 | 205 |
| 58 | 3300005563 | Ga0068855_100126004 | Ga0068855_1001260043 | 205 |
| 59 | 3300005564 | Ga0070664_100024037 | Ga0070664_1000240372 | 205 |
| 60 | 3300005614 | Ga0068856_100001606 | Ga0068856_10000160614 | 205 |
| 61 | 3300005616 | Ga0068852_100001045 | Ga0068852_1000010457 | 205 |
| 62 | 3300005985 | Ga0081539_10003208 | Ga0081539_100032081 | 205 |
| 63 | 3300006042 | Ga0075368_10086403 | Ga0075368_100864032 | 205 |
| 64 | 3300006051 | Ga0075364_10260995 | Ga0075364_102609952 | 205 |
| 65 | 3300006177 | Ga0075362_10003444 | Ga0075362_100034441 | 205 |
| 66 | 3300006178 | Ga0075367_10013529 | Ga0075367_100135295 | 205 |
| 67 | 3300006178 | Ga0075367_10039306 | Ga0075367_100393063 | 205 |
| 68 | 3300006178 | Ga0075367_10312623 | Ga0075367_103126231 | 205 |
| 69 | 3300006844 | Ga0075428_100194841 | Ga0075428_1001948414 | 205 |
| 70 | 3300006847 | Ga0075431_100171298 | Ga0075431_1001712982 | 205 |
| 71 | 3300006847 | Ga0075431_100883641 | Ga0075431_1008836411 | 205 |
| 72 | 3300006871 | Ga0075434_100103915 | Ga0075434_1001039152 | 205 |
| 73 | 3300006880 | Ga0075429_100000081 | Ga0075429_10000008149 | 205 |
| 74 | 3300009093 | Ga0105240_10215904 | Ga0105240_102159044 | 205 |
| 75 | 3300009094 | Ga0111539_10109039 | Ga0111539_101090393 | 205 |
| 76 | 3300009094 | Ga0111539_10229442 | Ga0111539_102294423 | 205 |
| 77 | 3300009147 | Ga0114129_10002113 | Ga0114129_100021136 | 205 |
| 78 | 3300009147 | Ga0114129_11987904 | Ga0114129_119879041 | 205 |
| 79 | 3300009148 | Ga0105243_11436345 | Ga0105243_114363451 | 205 |
| 80 | 3300009545 | Ga0105237_10141603 | Ga0105237_101416032 | 205 |
| 81 | 3300009551 | Ga0105238_10154909 | Ga0105238_101549092 | 205 |
| 82 | 3300009551 | Ga0105238_10160965 | Ga0105238_101609652 | 205 |
| 83 | 3300009551 | Ga0105238_10459267 | Ga0105238_104592671 | 205 |
| 84 | 3300013104 | Ga0157370_10980725 | Ga0157370_109807251 | 205 |
| 85 | 3300013105 | Ga0157369_10011724 | Ga0157369_100117246 | 205 |
| 86 | 3300013296 | Ga0157374_10298170 | Ga0157374_102981702 | 205 |
| 87 | 3300013307 | Ga0157372_10018682 | Ga0157372_100186822 | 205 |
| 88 | 3300013307 | Ga0157372_10245304 | Ga0157372_102453043 | 205 |
| 89 | 3300014326 | Ga0157380_11157619 | Ga0157380_111576191 | 205 |
| 90 | 3300025302 | Ga0207426_1013129 | Ga0207426_10131293 | 205 |
| 91 | 3300025321 | Ga0207656_10247897 | Ga0207656_102478972 | 205 |
| 92 | 3300025909 | Ga0207705_10213428 | Ga0207705_102134282 | 205 |
| 93 | 3300025912 | Ga0207707_10004277 | Ga0207707_1000427712 | 205 |
| 94 | 3300025912 | Ga0207707_10490182 | Ga0207707_104901821 | 205 |
| 95 | 3300025913 | Ga0207695_10026716 | Ga0207695_100267162 | 205 |
| 96 | 3300025913 | Ga0207695_11051143 | Ga0207695_110511431 | 205 |
| 97 | 3300025917 | Ga0207660_10008666 | Ga0207660_100086662 | 205 |
| 98 | 3300025918 | Ga0207662_10313530 | Ga0207662_103135302 | 205 |
| 99 | 3300025920 | Ga0207649_10007883 | Ga0207649_100078833 | 205 |
| 100 | 3300025921 | Ga0207652_10083726 | Ga0207652_100837262 | 205 |
| 101 | 3300025924 | Ga0207694_10290493 | Ga0207694_102904932 | 205 |
| 102 | 3300025931 | Ga0207644_10016623 | Ga0207644_100166232 | 205 |
| 103 | 3300025937 | Ga0207669_10471956 | Ga0207669_104719561 | 205 |
| 104 | 3300025944 | Ga0207661_10026523 | Ga0207661_100265234 | 205 |
| 105 | 3300025949 | Ga0207667_10055984 | Ga0207667_100559844 | 205 |
| 106 | 3300025949 | Ga0207667_10062848 | Ga0207667_100628482 | 205 |
| 107 | 3300025981 | Ga0207640_10529856 | Ga0207640_105298561 | 205 |
| 108 | 3300026089 | Ga0207648_10710169 | Ga0207648_107101691 | 205 |
| 109 | 3300027907 | Ga0207428_10049012 | Ga0207428_100490123 | 205 |
| 110 | 3300028379 | Ga0268266_10449037 | Ga0268266_104490372 | 205 |
| 111 | 3300035113 | Ga0373936_0104241 | Ga0373936_0104241_506_1123 | 205 |
| 112 | 3300035114 | Ga0373939_0069327 | Ga0373939_0069327_267_929 | 205 |
| 113 | 3300035695 | Ga0373927_0067847 | Ga0373927_0067847_179_796 | 205 |
| 114 | 3300035725 | Ga0373947_0125390 | Ga0373947_0125390_370_987 | 205 |
| 115 | 3300037418 | Ga0395900_0011461 | Ga0395900_0011461_7335_7952 | 205 |
| 116 | 3300038443 | Ga0395901_0564087 | Ga0395901_0564087_497_1114 | 205 |
| 117 | 3300039450 | Ga0436363_1455596 | Ga0436363_1455596_86_703 | 205 |
| 118 | 3300041408 | Ga0439453_0015398 | Ga0439453_0015398_395_1015 | 205 |
| 119 | 3300042439 | Ga0439464_0034921 | Ga0439464_0034921_104_724 | 205 |
| 120 | 3300045976 | Ga0466967_0091388 | Ga0466967_0091388_2026_2643 | 205 |
| 121 | 3300047320 | Ga0495672_0091047 | Ga0495672_0091047_883_1503 | 205 |
| 122 | 3300049571 | Ga0501034_0021303 | Ga0501034_0021303_4825_5442 | 205 |
| 123 | 3300049584 | Ga0501068_0012440 | Ga0501068_0012440_3587_4204 | 205 |
| 124 | 3300049584 | Ga0501068_0562319 | Ga0501068_0562319_92_709 | 205 |
| 125 | 3300050492 | nmdc:mga0yw44_14371_c1 | nmdc:mga0yw44_14371_c1_812_1429 | 205 |
| 126 | 3300050493 | nmdc:mga0k408_347576_c1 | nmdc:mga0k408_347576_c1_17_634 | 205 |
| 127 | 3300050507 | nmdc:mga05p37_51539_c1 | nmdc:mga05p37_51539_c1_2756_3373 | 205 |
| 128 | 3300050508 | nmdc:mga09592_26_c1 | nmdc:mga09592_26_c1_81955_82572 | 205 |
| 129 | 3300050511 | nmdc:mga08y16_66523_c1 | nmdc:mga08y16_66523_c1_2524_3144 | 205 |
| 130 | 3300050516 | nmdc:mga0sz30_5978_c1 | nmdc:mga0sz30_5978_c1_584_1201 | 205 |
| 131 | 3300053096 | Ga0500641_0000747 | Ga0500641_0000747_9174_9791 | 205 |
| 132 | 3300053153 | Ga0500616_0004736 | Ga0500616_0004736_743_1360 | 205 |
| 133 | 3300060353 | Ga0501082_0568735 | Ga0501082_0568735_248_865 | 205 |
| 134 | 3300005295 | Ga0065707_10160974 | Ga0065707_101609743 | 206 |
| 135 | 3300005327 | Ga0070658_10120406 | Ga0070658_101204062 | 206 |
| 136 | 3300005327 | Ga0070658_10485900 | Ga0070658_104859001 | 206 |
| 137 | 3300005329 | Ga0070683_100311639 | Ga0070683_1003116392 | 206 |
| 138 | 3300005330 | Ga0070690_100556198 | Ga0070690_1005561981 | 206 |
| 139 | 3300005336 | Ga0070680_100109890 | Ga0070680_1001098901 | 206 |
| 140 | 3300005339 | Ga0070660_100478208 | Ga0070660_1004782082 | 206 |
| 141 | 3300005343 | Ga0070687_100211035 | Ga0070687_1002110351 | 206 |
| 142 | 3300005353 | Ga0070669_100140181 | Ga0070669_1001401813 | 206 |
| 143 | 3300005364 | Ga0070673_100954090 | Ga0070673_1009540901 | 206 |
| 144 | 3300005365 | Ga0070688_100051339 | Ga0070688_1000513393 | 206 |
| 145 | 3300005434 | Ga0070709_10159441 | Ga0070709_101594412 | 206 |
| 146 | 3300005435 | Ga0070714_100003288 | Ga0070714_10000328811 | 206 |
| 147 | 3300005435 | Ga0070714_100309305 | Ga0070714_1003093052 | 206 |
| 148 | 3300005437 | Ga0070710_10047384 | Ga0070710_100473842 | 206 |
| 149 | 3300005440 | Ga0070705_100054251 | Ga0070705_1000542511 | 206 |
| 150 | 3300005441 | Ga0070700_100712784 | Ga0070700_1007127842 | 206 |
| 151 | 3300005456 | Ga0070678_100025730 | Ga0070678_1000257302 | 206 |
| 152 | 3300005458 | Ga0070681_11030727 | Ga0070681_110307271 | 206 |
| 153 | 3300005459 | Ga0068867_100725869 | Ga0068867_1007258691 | 206 |
| 154 | 3300005459 | Ga0068867_100886910 | Ga0068867_1008869101 | 206 |
| 155 | 3300005535 | Ga0070684_100110848 | Ga0070684_1001108484 | 206 |
| 156 | 3300005536 | Ga0070697_100140324 | Ga0070697_1001403241 | 206 |
| 157 | 3300005539 | Ga0068853_100328104 | Ga0068853_1003281042 | 206 |
| 158 | 3300005544 | Ga0070686_100489299 | Ga0070686_1004892992 | 206 |
| 159 | 3300005545 | Ga0070695_100052568 | Ga0070695_1000525682 | 206 |
| 160 | 3300005545 | Ga0070695_100545741 | Ga0070695_1005457411 | 206 |
| 161 | 3300005547 | Ga0070693_100359509 | Ga0070693_1003595092 | 206 |
| 162 | 3300005548 | Ga0070665_100295067 | Ga0070665_1002950672 | 206 |
| 163 | 3300005548 | Ga0070665_100525754 | Ga0070665_1005257542 | 206 |
| 164 | 3300005563 | Ga0068855_100472019 | Ga0068855_1004720191 | 206 |
| 165 | 3300005563 | Ga0068855_100762977 | Ga0068855_1007629772 | 206 |
| 166 | 3300005564 | Ga0070664_100118550 | Ga0070664_1001185503 | 206 |
| 167 | 3300005614 | Ga0068856_100016444 | Ga0068856_1000164447 | 206 |
| 168 | 3300005614 | Ga0068856_100210294 | Ga0068856_1002102942 | 206 |
| 169 | 3300005617 | Ga0068859_100335208 | Ga0068859_1003352082 | 206 |
| 170 | 3300005617 | Ga0068859_100792025 | Ga0068859_1007920251 | 206 |
| 171 | 3300005844 | Ga0068862_100059517 | Ga0068862_1000595173 | 206 |
| 172 | 3300005844 | Ga0068862_100617918 | Ga0068862_1006179182 | 206 |
| 173 | 3300006038 | Ga0075365_10004171 | Ga0075365_100041712 | 206 |
| 174 | 3300006038 | Ga0075365_10011665 | Ga0075365_100116653 | 206 |
| 175 | 3300006042 | Ga0075368_10012897 | Ga0075368_100128973 | 206 |
| 176 | 3300006042 | Ga0075368_10018094 | Ga0075368_100180944 | 206 |
| 177 | 3300006048 | Ga0075363_100009278 | Ga0075363_1000092785 | 206 |
| 178 | 3300006048 | Ga0075363_100025914 | Ga0075363_1000259142 | 206 |
| 179 | 3300006051 | Ga0075364_10100398 | Ga0075364_101003982 | 206 |
| 180 | 3300006173 | Ga0070716_100016606 | Ga0070716_1000166064 | 206 |
| 181 | 3300006178 | Ga0075367_10002008 | Ga0075367_100020087 | 206 |
| 182 | 3300006358 | Ga0068871_100892732 | Ga0068871_1008927321 | 206 |
| 183 | 3300006844 | Ga0075428_100000617 | Ga0075428_10000061716 | 206 |
| 184 | 3300006846 | Ga0075430_100045690 | Ga0075430_1000456902 | 206 |
| 185 | 3300006847 | Ga0075431_100108855 | Ga0075431_1001088552 | 206 |
| 186 | 3300006871 | Ga0075434_100811838 | Ga0075434_1008118382 | 206 |
| 187 | 3300006871 | Ga0075434_100992981 | Ga0075434_1009929812 | 206 |
| 188 | 3300006871 | Ga0075434_101018597 | Ga0075434_1010185972 | 206 |
| 189 | 3300006880 | Ga0075429_100430352 | Ga0075429_1004303522 | 206 |
| 190 | 3300006914 | Ga0075436_100004004 | Ga0075436_10000400412 | 206 |
| 191 | 3300006914 | Ga0075436_100004115 | Ga0075436_1000041157 | 206 |
| 192 | 3300006914 | Ga0075436_100090088 | Ga0075436_1000900882 | 206 |
| 193 | 3300006931 | Ga0097620_100335219 | Ga0097620_1003352192 | 206 |
| 194 | 3300006931 | Ga0097620_100792112 | Ga0097620_1007921121 | 206 |
| 195 | 3300007076 | Ga0075435_100667463 | Ga0075435_1006674631 | 206 |
| 196 | 3300007076 | Ga0075435_100694013 | Ga0075435_1006940132 | 206 |
| 197 | 3300007265 | Ga0099794_10017902 | Ga0099794_100179024 | 206 |
| 198 | 3300009093 | Ga0105240_10012327 | Ga0105240_100123278 | 206 |
| 199 | 3300009093 | Ga0105240_10744984 | Ga0105240_107449842 | 206 |
| 200 | 3300009094 | Ga0111539_10565452 | Ga0111539_105654522 | 206 |
| 201 | 3300009098 | Ga0105245_10051077 | Ga0105245_100510772 | 206 |
| 202 | 3300009147 | Ga0114129_10221243 | Ga0114129_102212433 | 206 |
| 203 | 3300009174 | Ga0105241_10521919 | Ga0105241_105219192 | 206 |
| 204 | 3300009176 | Ga0105242_10349934 | Ga0105242_103499341 | 206 |
| 205 | 3300009551 | Ga0105238_10345146 | Ga0105238_103451462 | 206 |
| 206 | 3300009551 | Ga0105238_10563447 | Ga0105238_105634472 | 206 |
| 207 | 3300009553 | Ga0105249_10579958 | Ga0105249_105799581 | 206 |
| 208 | 3300010159 | Ga0099796_10023258 | Ga0099796_100232583 | 206 |
| 209 | 3300010375 | Ga0105239_10522002 | Ga0105239_105220022 | 206 |
| 210 | 3300013100 | Ga0157373_10093120 | Ga0157373_100931202 | 206 |
| 211 | 3300013105 | Ga0157369_10158993 | Ga0157369_101589933 | 206 |
| 212 | 3300013296 | Ga0157374_10369049 | Ga0157374_103690492 | 206 |
| 213 | 3300013296 | Ga0157374_10720035 | Ga0157374_107200352 | 206 |
| 214 | 3300013307 | Ga0157372_10088796 | Ga0157372_100887961 | 206 |
| 215 | 3300013307 | Ga0157372_10277978 | Ga0157372_102779782 | 206 |
| 216 | 3300014326 | Ga0157380_10405511 | Ga0157380_104055112 | 206 |
| 217 | 3300014968 | Ga0157379_10659050 | Ga0157379_106590501 | 206 |
| 218 | 3300021361 | Ga0213872_10021062 | Ga0213872_100210624 | 206 |
| 219 | 3300021384 | Ga0213876_10101010 | Ga0213876_101010102 | 206 |
| 220 | 3300021388 | Ga0213875_10000053 | Ga0213875_1000005348 | 206 |
| 221 | 3300025302 | Ga0207426_1056002 | Ga0207426_10560022 | 206 |
| 222 | 3300025903 | Ga0207680_10402985 | Ga0207680_104029852 | 206 |
| 223 | 3300025905 | Ga0207685_10031288 | Ga0207685_100312882 | 206 |
| 224 | 3300025905 | Ga0207685_10102199 | Ga0207685_101021991 | 206 |
| 225 | 3300025906 | Ga0207699_10316086 | Ga0207699_103160861 | 206 |
| 226 | 3300025909 | Ga0207705_10241045 | Ga0207705_102410451 | 206 |
| 227 | 3300025914 | Ga0207671_10077285 | Ga0207671_100772851 | 206 |
| 228 | 3300025917 | Ga0207660_10328117 | Ga0207660_103281171 | 206 |
| 229 | 3300025918 | Ga0207662_10290993 | Ga0207662_102909932 | 206 |
| 230 | 3300025920 | Ga0207649_10189617 | Ga0207649_101896172 | 206 |
| 231 | 3300025921 | Ga0207652_10648679 | Ga0207652_106486791 | 206 |
| 232 | 3300025921 | Ga0207652_10655105 | Ga0207652_106551052 | 206 |
| 233 | 3300025923 | Ga0207681_10118776 | Ga0207681_101187762 | 206 |
| 234 | 3300025924 | Ga0207694_10499360 | Ga0207694_104993602 | 206 |
| 235 | 3300025927 | Ga0207687_10067357 | Ga0207687_100673572 | 206 |
| 236 | 3300025927 | Ga0207687_10263202 | Ga0207687_102632021 | 206 |
| 237 | 3300025928 | Ga0207700_10013689 | Ga0207700_100136892 | 206 |
| 238 | 3300025929 | Ga0207664_10033479 | Ga0207664_100334794 | 206 |
| 239 | 3300025929 | Ga0207664_10456388 | Ga0207664_104563882 | 206 |
| 240 | 3300025937 | Ga0207669_10286357 | Ga0207669_102863572 | 206 |
| 241 | 3300025937 | Ga0207669_10740924 | Ga0207669_107409241 | 206 |
| 242 | 3300025939 | Ga0207665_10067219 | Ga0207665_100672192 | 206 |
| 243 | 3300025939 | Ga0207665_10097939 | Ga0207665_100979392 | 206 |
| 244 | 3300025940 | Ga0207691_10250595 | Ga0207691_102505952 | 206 |
| 245 | 3300025941 | Ga0207711_10227872 | Ga0207711_102278722 | 206 |
| 246 | 3300025945 | Ga0207679_10081985 | Ga0207679_100819853 | 206 |
| 247 | 3300025949 | Ga0207667_10118214 | Ga0207667_101182143 | 206 |
| 248 | 3300025949 | Ga0207667_10744060 | Ga0207667_107440602 | 206 |
| 249 | 3300025961 | Ga0207712_10234008 | Ga0207712_102340081 | 206 |
| 250 | 3300025981 | Ga0207640_10341830 | Ga0207640_103418301 | 206 |
| 251 | 3300025986 | Ga0207658_10802301 | Ga0207658_108023011 | 206 |
| 252 | 3300026023 | Ga0207677_10667069 | Ga0207677_106670692 | 206 |
| 253 | 3300026075 | Ga0207708_10896307 | Ga0207708_108963071 | 206 |
| 254 | 3300026078 | Ga0207702_10064733 | Ga0207702_100647333 | 206 |
| 255 | 3300026089 | Ga0207648_10278555 | Ga0207648_102785552 | 206 |
| 256 | 3300026118 | Ga0207675_100260100 | Ga0207675_1002601002 | 206 |
| 257 | 3300026121 | Ga0207683_10076816 | Ga0207683_100768162 | 206 |
| 258 | 3300026142 | Ga0207698_10127091 | Ga0207698_101270913 | 206 |
| 259 | 3300026142 | Ga0207698_10678084 | Ga0207698_106780842 | 206 |
| 260 | 3300027512 | Ga0209179_1011531 | Ga0209179_10115312 | 206 |
| 261 | 3300027671 | Ga0209588_1010903 | Ga0209588_10109032 | 206 |
| 262 | 3300027866 | Ga0209813_10003719 | Ga0209813_100037194 | 206 |
| 263 | 3300028379 | Ga0268266_10095158 | Ga0268266_100951582 | 206 |
| 264 | 3300028573 | Ga0265334_10012318 | Ga0265334_100123183 | 206 |
| 265 | 3300030763 | Ga0265763_1008412 | Ga0265763_10084122 | 206 |
| 266 | 3300031728 | Ga0316578_10268499 | Ga0316578_102684991 | 206 |
| 267 | 3300035083 | Ga0373926_0022219 | Ga0373926_0022219_208_858 | 206 |
| 268 | 3300035111 | Ga0373923_0002771 | Ga0373923_0002771_1077_1700 | 206 |
| 269 | 3300035111 | Ga0373923_0078977 | Ga0373923_0078977_575_1195 | 206 |
| 270 | 3300035113 | Ga0373936_0003979 | Ga0373936_0003979_3206_3829 | 206 |
| 271 | 3300035116 | Ga0373945_0001064 | Ga0373945_0001064_4938_5561 | 206 |
| 272 | 3300035117 | Ga0373953_0004294 | Ga0373953_0004294_594_1217 | 206 |
| 273 | 3300035118 | Ga0373954_0000906 | Ga0373954_0000906_4620_5243 | 206 |
| 274 | 3300035118 | Ga0373954_0002609 | Ga0373954_0002609_6764_7384 | 206 |
| 275 | 3300035118 | Ga0373954_0058587 | Ga0373954_0058587_13_633 | 206 |
| 276 | 3300035119 | Ga0373956_0000029 | Ga0373956_0000029_31622_32242 | 206 |
| 277 | 3300035119 | Ga0373956_0033037 | Ga0373956_0033037_1414_2037 | 206 |
| 278 | 3300035120 | Ga0373957_0010530 | Ga0373957_0010530_253_873 | 206 |
| 279 | 3300035120 | Ga0373957_0015261 | Ga0373957_0015261_1519_2142 | 206 |
| 280 | 3300035121 | Ga0373960_0014720 | Ga0373960_0014720_698_1318 | 206 |
| 281 | 3300035170 | Ga0373943_0003827 | Ga0373943_0003827_3169_3792 | 206 |
| 282 | 3300035171 | Ga0373946_0001814 | Ga0373946_0001814_6625_7248 | 206 |
| 283 | 3300035172 | Ga0373955_0000201 | Ga0373955_0000201_6371_6994 | 206 |
| 284 | 3300035172 | Ga0373955_0003420 | Ga0373955_0003420_5818_6438 | 206 |
| 285 | 3300035241 | Ga0373961_0108448 | Ga0373961_0108448_46_666 | 206 |
| 286 | 3300035410 | Ga0373924_0062256 | Ga0373924_0062256_843_1466 | 206 |
| 287 | 3300035691 | Ga0373931_0049908 | Ga0373931_0049908_868_1494 | 206 |
| 288 | 3300035692 | Ga0373935_0000068 | Ga0373935_0000068_17683_18306 | 206 |
| 289 | 3300035692 | Ga0373935_0048992 | Ga0373935_0048992_1861_2484 | 206 |
| 290 | 3300035695 | Ga0373927_0005387 | Ga0373927_0005387_2903_3526 | 206 |
| 291 | 3300035695 | Ga0373927_0331838 | Ga0373927_0331838_274_897 | 206 |
| 292 | 3300035724 | Ga0373933_0002902 | Ga0373933_0002902_7663_8286 | 206 |
| 293 | 3300035724 | Ga0373933_0003207 | Ga0373933_0003207_4871_5491 | 206 |
| 294 | 3300035724 | Ga0373933_0534282 | Ga0373933_0534282_11_634 | 206 |
| 295 | 3300035724 | Ga0373933_0647813 | Ga0373933_0647813_64_684 | 206 |
| 296 | 3300035725 | Ga0373947_0002537 | Ga0373947_0002537_10172_10795 | 206 |
| 297 | 3300036401 | Ga0373937_0000347 | Ga0373937_0000347_5372_5995 | 206 |
| 298 | 3300036401 | Ga0373937_0000441 | Ga0373937_0000441_29866_30486 | 206 |
| 299 | 3300036401 | Ga0373937_0045533 | Ga0373937_0045533_218_838 | 206 |
| 300 | 3300036647 | Ga0316582_0245053 | Ga0316582_0245053_159_779 | 206 |
| 301 | 3300037068 | Ga0373925_0000081 | Ga0373925_0000081_44532_45155 | 206 |
| 302 | 3300037068 | Ga0373925_0250494 | Ga0373925_0250494_760_1383 | 206 |
| 303 | 3300037068 | Ga0373925_0638458 | Ga0373925_0638458_168_791 | 206 |
| 304 | 3300037312 | Ga0395899_0014903 | Ga0395899_0014903_483_1145 | 206 |
| 305 | 3300037312 | Ga0395899_0096464 | Ga0395899_0096464_1472_2098 | 206 |
| 306 | 3300037418 | Ga0395900_0008428 | Ga0395900_0008428_7990_8616 | 206 |
| 307 | 3300037418 | Ga0395900_0143324 | Ga0395900_0143324_1718_2380 | 206 |
| 308 | 3300037466 | Ga0395898_0082166 | Ga0395898_0082166_1030_1692 | 206 |
| 309 | 3300037466 | Ga0395898_0138981 | Ga0395898_0138981_1054_1680 | 206 |
| 310 | 3300037466 | Ga0395898_0331558 | Ga0395898_0331558_514_1191 | 206 |
| 311 | 3300037853 | Ga0436364_0951864 | Ga0436364_0951864_623_1246 | 206 |
| 312 | 3300038443 | Ga0395901_0009788 | Ga0395901_0009788_6732_7394 | 206 |
| 313 | 3300038443 | Ga0395901_0018877 | Ga0395901_0018877_3008_3634 | 206 |
| 314 | 3300038443 | Ga0395901_0137101 | Ga0395901_0137101_1189_1815 | 206 |
| 315 | 3300039437 | Ga0436365_1099387 | Ga0436365_1099387_1192_1815 | 206 |
| 316 | 3300039438 | Ga0436360_0291491 | Ga0436360_0291491_46_669 | 206 |
| 317 | 3300039438 | Ga0436360_0775077 | Ga0436360_0775077_157_780 | 206 |
| 318 | 3300039447 | Ga0436361_0424457 | Ga0436361_0424457_1047_1679 | 206 |
| 319 | 3300039447 | Ga0436361_0914825 | Ga0436361_0914825_90_713 | 206 |
| 320 | 3300039450 | Ga0436363_0235431 | Ga0436363_0235431_107_730 | 206 |
| 321 | 3300039450 | Ga0436363_1012681 | Ga0436363_1012681_788_1426 | 206 |
| 322 | 3300044694 | Ga0466963_0025164 | Ga0466963_0025164_581_1204 | 206 |
| 323 | 3300045051 | Ga0451576_0295185 | Ga0451576_0295185_123_743 | 206 |
| 324 | 3300045976 | Ga0466967_0320079 | Ga0466967_0320079_725_1348 | 206 |
| 325 | 3300046454 | Ga0495592_0000196 | Ga0495592_0000196_28725_29348 | 206 |
| 326 | 3300046454 | Ga0495592_0022021 | Ga0495592_0022021_3004_3624 | 206 |
| 327 | 3300046455 | Ga0495603_0165172 | Ga0495603_0165172_113_736 | 206 |
| 328 | 3300046459 | Ga0495629_0003904 | Ga0495629_0003904_3821_4444 | 206 |
| 329 | 3300046462 | Ga0495651_0000356 | Ga0495651_0000356_4597_5217 | 206 |
| 330 | 3300046462 | Ga0495651_0000977 | Ga0495651_0000977_8642_9265 | 206 |
| 331 | 3300046463 | Ga0495653_0000193 | Ga0495653_0000193_28780_29403 | 206 |
| 332 | 3300046463 | Ga0495653_0367836 | Ga0495653_0367836_21_641 | 206 |
| 333 | 3300046476 | Ga0495662_0060059 | Ga0495662_0060059_956_1579 | 206 |
| 334 | 3300046477 | Ga0495664_0000016 | Ga0495664_0000016_106235_106858 | 206 |
| 335 | 3300046511 | Ga0495608_0000121 | Ga0495608_0000121_17777_18400 | 206 |
| 336 | 3300046514 | Ga0495618_0000124 | Ga0495618_0000124_17796_18419 | 206 |
| 337 | 3300046516 | Ga0495628_0000018 | Ga0495628_0000018_63059_63682 | 206 |
| 338 | 3300046516 | Ga0495628_0015254 | Ga0495628_0015254_4001_4621 | 206 |
| 339 | 3300046517 | Ga0495630_0002180 | Ga0495630_0002180_9376_9999 | 206 |
| 340 | 3300046517 | Ga0495630_0088692 | Ga0495630_0088692_198_818 | 206 |
| 341 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_376212_376835 | 206 |
| 342 | 3300046529 | Ga0495652_0006146 | Ga0495652_0006146_5861_6481 | 206 |
| 343 | 3300046533 | Ga0495640_0000063 | Ga0495640_0000063_21867_22490 | 206 |
| 344 | 3300046536 | Ga0495587_0000134 | Ga0495587_0000134_37768_38391 | 206 |
| 345 | 3300046543 | Ga0495645_0000070 | Ga0495645_0000070_39516_40139 | 206 |
| 346 | 3300046543 | Ga0495645_0006688 | Ga0495645_0006688_3478_4098 | 206 |
| 347 | 3300046559 | Ga0495667_0000023 | Ga0495667_0000023_129124_129747 | 206 |
| 348 | 3300046642 | Ga0495634_0000241 | Ga0495634_0000241_8649_9272 | 206 |
| 349 | 3300046642 | Ga0495634_0131184 | Ga0495634_0131184_832_1455 | 206 |
| 350 | 3300046663 | Ga0495635_0000045 | Ga0495635_0000045_43864_44487 | 206 |
| 351 | 3300046675 | Ga0495657_0001202 | Ga0495657_0001202_473_1096 | 206 |
| 352 | 3300046675 | Ga0495657_0054030 | Ga0495657_0054030_619_1239 | 206 |
| 353 | 3300046675 | Ga0495657_0297955 | Ga0495657_0297955_79_699 | 206 |
| 354 | 3300046678 | Ga0495599_0000107 | Ga0495599_0000107_37800_38423 | 206 |
| 355 | 3300046678 | Ga0495599_0016176 | Ga0495599_0016176_536_1156 | 206 |
| 356 | 3300046678 | Ga0495599_0271096 | Ga0495599_0271096_247_867 | 206 |
| 357 | 3300046679 | Ga0495623_0000180 | Ga0495623_0000180_29883_30506 | 206 |
| 358 | 3300046680 | Ga0495646_0000027 | Ga0495646_0000027_52328_52951 | 206 |
| 359 | 3300046683 | Ga0495658_0020639 | Ga0495658_0020639_2818_3441 | 206 |
| 360 | 3300046689 | Ga0495613_0056616 | Ga0495613_0056616_1278_1901 | 206 |
| 361 | 3300046690 | Ga0495624_0093253 | Ga0495624_0093253_116_739 | 206 |
| 362 | 3300046809 | Ga0495600_0000062 | Ga0495600_0000062_28831_29454 | 206 |
| 363 | 3300047317 | Ga0495604_0000014 | Ga0495604_0000014_57323_57946 | 206 |
| 364 | 3300047319 | Ga0495674_0000014 | Ga0495674_0000014_183294_183917 | 206 |
| 365 | 3300047322 | Ga0495680_0000779 | Ga0495680_0000779_7160_7783 | 206 |
| 366 | 3300047322 | Ga0495680_0199616 | Ga0495680_0199616_318_938 | 206 |
| 367 | 3300047444 | Ga0495675_0000058 | Ga0495675_0000058_37731_38354 | 206 |
| 368 | 3300047471 | Ga0495684_0000059 | Ga0495684_0000059_37772_38395 | 206 |
| 369 | 3300047673 | Ga0495593_0005129 | Ga0495593_0005129_3938_4561 | 206 |
| 370 | 3300048088 | Ga0495602_0000017 | Ga0495602_0000017_143900_144523 | 206 |
| 371 | 3300048904 | Ga0496101_0018180 | Ga0496101_0018180_2702_3325 | 206 |
| 372 | 3300048905 | Ga0496102_0576835 | Ga0496102_0576835_165_788 | 206 |
| 373 | 3300048907 | Ga0496104_0001978 | Ga0496104_0001978_13587_14210 | 206 |
| 374 | 3300048908 | Ga0496105_0061405 | Ga0496105_0061405_1359_1982 | 206 |
| 375 | 3300048911 | Ga0496108_0005996 | Ga0496108_0005996_548_1171 | 206 |
| 376 | 3300048911 | Ga0496108_0077240 | Ga0496108_0077240_2139_2762 | 206 |
| 377 | 3300048912 | Ga0496109_0022511 | Ga0496109_0022511_4601_5224 | 206 |
| 378 | 3300048912 | Ga0496109_0586258 | Ga0496109_0586258_245_868 | 206 |
| 379 | 3300048913 | Ga0496110_0003146 | Ga0496110_0003146_11285_11908 | 206 |
| 380 | 3300048915 | Ga0496112_0003807 | Ga0496112_0003807_10904_11527 | 206 |
| 381 | 3300048915 | Ga0496112_0233439 | Ga0496112_0233439_249_875 | 206 |
| 382 | 3300048916 | Ga0496113_0075665 | Ga0496113_0075665_452_1075 | 206 |
| 383 | 3300049568 | Ga0501031_0023742 | Ga0501031_0023742_1858_2478 | 206 |
| 384 | 3300049569 | Ga0501032_0175050 | Ga0501032_0175050_593_1213 | 206 |
| 385 | 3300049570 | Ga0501033_0058028 | Ga0501033_0058028_1311_1931 | 206 |
| 386 | 3300049571 | Ga0501034_0000891 | Ga0501034_0000891_4953_5576 | 206 |
| 387 | 3300049571 | Ga0501034_0011745 | Ga0501034_0011745_7203_7826 | 206 |
| 388 | 3300049571 | Ga0501034_0234213 | Ga0501034_0234213_386_1015 | 206 |
| 389 | 3300049572 | Ga0501036_0171303 | Ga0501036_0171303_116_736 | 206 |
| 390 | 3300049574 | Ga0501038_0580131 | Ga0501038_0580131_93_713 | 206 |
| 391 | 3300049575 | Ga0501039_0008570 | Ga0501039_0008570_1913_2533 | 206 |
| 392 | 3300049576 | Ga0501040_0015963 | Ga0501040_0015963_4297_4917 | 206 |
| 393 | 3300049577 | Ga0501041_0033918 | Ga0501041_0033918_10_630 | 206 |
| 394 | 3300049578 | Ga0501042_0006103 | Ga0501042_0006103_50_670 | 206 |
| 395 | 3300049578 | Ga0501042_0291971 | Ga0501042_0291971_285_908 | 206 |
| 396 | 3300049579 | Ga0501043_0016253 | Ga0501043_0016253_4578_5198 | 206 |
| 397 | 3300049579 | Ga0501043_0059010 | Ga0501043_0059010_2317_2946 | 206 |
| 398 | 3300049580 | Ga0501046_0124912 | Ga0501046_0124912_145_765 | 206 |
| 399 | 3300049580 | Ga0501046_0266063 | Ga0501046_0266063_330_953 | 206 |
| 400 | 3300049581 | Ga0501047_0610694 | Ga0501047_0610694_73_696 | 206 |
| 401 | 3300049582 | Ga0501048_0011307 | Ga0501048_0011307_4398_5018 | 206 |
| 402 | 3300049584 | Ga0501068_0017211 | Ga0501068_0017211_2683_3306 | 206 |
| 403 | 3300049585 | Ga0501069_0041972 | Ga0501069_0041972_1017_1637 | 206 |
| 404 | 3300049585 | Ga0501069_0047991 | Ga0501069_0047991_1396_2016 | 206 |
| 405 | 3300049586 | Ga0501070_0003987 | Ga0501070_0003987_11845_12465 | 206 |
| 406 | 3300049586 | Ga0501070_0185817 | Ga0501070_0185817_131_751 | 206 |
| 407 | 3300049586 | Ga0501070_0787475 | Ga0501070_0787475_38_661 | 206 |
| 408 | 3300049587 | Ga0501071_0007220 | Ga0501071_0007220_6411_7031 | 206 |
| 409 | 3300049587 | Ga0501071_0671147 | Ga0501071_0671147_141_764 | 206 |
| 410 | 3300049589 | Ga0501073_0400560 | Ga0501073_0400560_182_802 | 206 |
| 411 | 3300049590 | Ga0501074_0001669 | Ga0501074_0001669_3569_4189 | 206 |
| 412 | 3300049590 | Ga0501074_0116108 | Ga0501074_0116108_216_836 | 206 |
| 413 | 3300049591 | Ga0501075_0038416 | Ga0501075_0038416_1074_1694 | 206 |
| 414 | 3300049591 | Ga0501075_0248755 | Ga0501075_0248755_534_1154 | 206 |
| 415 | 3300049591 | Ga0501075_0412224 | Ga0501075_0412224_76_699 | 206 |
| 416 | 3300049591 | Ga0501075_0451005 | Ga0501075_0451005_311_934 | 206 |
| 417 | 3300049592 | Ga0501076_0019950 | Ga0501076_0019950_2614_3234 | 206 |
| 418 | 3300049592 | Ga0501076_0166618 | Ga0501076_0166618_224_847 | 206 |
| 419 | 3300049593 | Ga0501077_0038035 | Ga0501077_0038035_1891_2511 | 206 |
| 420 | 3300049741 | Ga0501079_0142427 | Ga0501079_0142427_1198_1818 | 206 |
| 421 | 3300049741 | Ga0501079_0299090 | Ga0501079_0299090_372_995 | 206 |
| 422 | 3300049742 | Ga0501080_0049205 | Ga0501080_0049205_1718_2338 | 206 |
| 423 | 3300049742 | Ga0501080_0306962 | Ga0501080_0306962_515_1135 | 206 |
| 424 | 3300049744 | Ga0501083_0278715 | Ga0501083_0278715_357_980 | 206 |
| 425 | 3300049822 | Ga0501035_0102447 | Ga0501035_0102447_50_670 | 206 |
| 426 | 3300049823 | Ga0501044_0058411 | Ga0501044_0058411_1733_2356 | 206 |
| 427 | 3300049823 | Ga0501044_0435136 | Ga0501044_0435136_125_754 | 206 |
| 428 | 3300049824 | Ga0501045_0007001 | Ga0501045_0007001_4966_5586 | 206 |
| 429 | 3300050490 | nmdc:mga03n38_3932_c1 | nmdc:mga03n38_3932_c1_2396_3019 | 206 |
| 430 | 3300050492 | nmdc:mga0yw44_176483_c1 | nmdc:mga0yw44_176483_c1_523_1146 | 206 |
| 431 | 3300050494 | nmdc:mga06z11_39475_c1 | nmdc:mga06z11_39475_c1_1163_1783 | 206 |
| 432 | 3300050494 | nmdc:mga06z11_790_c1 | nmdc:mga06z11_790_c1_10033_10656 | 206 |
| 433 | 3300050494 | nmdc:mga06z11_9739_c1 | nmdc:mga06z11_9739_c1_1379_1999 | 206 |
| 434 | 3300050507 | nmdc:mga05p37_182270_c1 | nmdc:mga05p37_182270_c1_232_855 | 206 |
| 435 | 3300050508 | nmdc:mga09592_351191_c1 | nmdc:mga09592_351191_c1_26_649 | 206 |
| 436 | 3300050508 | nmdc:mga09592_452835_c1 | nmdc:mga09592_452835_c1_315_938 | 206 |
| 437 | 3300050509 | nmdc:mga0qj67_69955_c1 | nmdc:mga0qj67_69955_c1_220_843 | 206 |
| 438 | 3300050509 | nmdc:mga0qj67_72478_c1 | nmdc:mga0qj67_72478_c1_1623_2246 | 206 |
| 439 | 3300050510 | nmdc:mga06r32_118534_c1 | nmdc:mga06r32_118534_c1_1372_1995 | 206 |
| 440 | 3300050510 | nmdc:mga06r32_274046_c1 | nmdc:mga06r32_274046_c1_65_688 | 206 |
| 441 | 3300050510 | nmdc:mga06r32_5683_c1 | nmdc:mga06r32_5683_c1_9236_9859 | 206 |
| 442 | 3300050512 | nmdc:mga0n895_454272_c1 | nmdc:mga0n895_454272_c1_61_684 | 206 |
| 443 | 3300050512 | nmdc:mga0n895_809489_c1 | nmdc:mga0n895_809489_c1_230_853 | 206 |
| 444 | 3300050512 | nmdc:mga0n895_938110_c1 | nmdc:mga0n895_938110_c1_182_802 | 206 |
| 445 | 3300050512 | nmdc:mga0n895_98294_c1 | nmdc:mga0n895_98294_c1_2043_2714 | 206 |
| 446 | 3300050513 | nmdc:mga0rr50_137244_c1 | nmdc:mga0rr50_137244_c1_33_656 | 206 |
| 447 | 3300050513 | nmdc:mga0rr50_95527_c1 | nmdc:mga0rr50_95527_c1_149_772 | 206 |
| 448 | 3300050514 | nmdc:mga08x19_3673_c1 | nmdc:mga08x19_3673_c1_2478_3098 | 206 |
| 449 | 3300050514 | nmdc:mga08x19_40687_c1 | nmdc:mga08x19_40687_c1_170_793 | 206 |
| 450 | 3300050515 | nmdc:mga0a205_342822_c1 | nmdc:mga0a205_342822_c1_676_1296 | 206 |
| 451 | 3300053077 | Ga0495601_0000016 | Ga0495601_0000016_143900_144523 | 206 |
| 452 | 3300053077 | Ga0495601_0006967 | Ga0495601_0006967_4505_5125 | 206 |
| 453 | 3300053077 | Ga0495601_0011070 | Ga0495601_0011070_4315_4938 | 206 |
| 454 | 3300053078 | Ga0495612_0000041 | Ga0495612_0000041_17740_18363 | 206 |
| 455 | 3300053084 | Ga0495595_0000048 | Ga0495595_0000048_11033_11656 | 206 |
| 456 | 3300053085 | Ga0495619_0000050 | Ga0495619_0000050_62960_63583 | 206 |
| 457 | 3300053085 | Ga0495619_0041669 | Ga0495619_0041669_1262_1885 | 206 |
| 458 | 3300053139 | Ga0500568_0052584 | Ga0500568_0052584_931_1554 | 206 |
| 459 | 3300053153 | Ga0500616_0036435 | Ga0500616_0036435_1924_2544 | 206 |
| 460 | 3300054114 | Ga0501084_0023539 | Ga0501084_0023539_1163_1783 | 206 |
| 461 | 3300060353 | Ga0501082_0026550 | Ga0501082_0026550_2249_2869 | 206 |
| 462 | 3300001990 | JGI24737J22298_10023897 | JGI24737J22298_100238974 | 207 |
| 463 | 3300001991 | JGI24743J22301_10000589 | JGI24743J22301_100005895 | 207 |
| 464 | 3300002075 | JGI24738J21930_10011323 | JGI24738J21930_100113231 | 207 |
| 465 | 3300002244 | JGI24742J22300_10000606 | JGI24742J22300_100006066 | 207 |
| 466 | 3300003659 | JGI25404J52841_10004866 | JGI25404J52841_100048664 | 207 |
| 467 | 3300005329 | Ga0070683_100040594 | Ga0070683_1000405943 | 207 |
| 468 | 3300005330 | Ga0070690_100015826 | Ga0070690_1000158264 | 207 |
| 469 | 3300005331 | Ga0070670_100028487 | Ga0070670_1000284875 | 207 |
| 470 | 3300005331 | Ga0070670_100071135 | Ga0070670_1000711352 | 207 |
| 471 | 3300005334 | Ga0068869_100216323 | Ga0068869_1002163234 | 207 |
| 472 | 3300005335 | Ga0070666_10088544 | Ga0070666_100885442 | 207 |
| 473 | 3300005337 | Ga0070682_100022863 | Ga0070682_1000228632 | 207 |
| 474 | 3300005337 | Ga0070682_100605448 | Ga0070682_1006054481 | 207 |
| 475 | 3300005338 | Ga0068868_100009632 | Ga0068868_1000096328 | 207 |
| 476 | 3300005338 | Ga0068868_100353123 | Ga0068868_1003531231 | 207 |
| 477 | 3300005339 | Ga0070660_100195675 | Ga0070660_1001956752 | 207 |
| 478 | 3300005340 | Ga0070689_100001113 | Ga0070689_1000011135 | 207 |
| 479 | 3300005340 | Ga0070689_100194769 | Ga0070689_1001947691 | 207 |
| 480 | 3300005343 | Ga0070687_100199493 | Ga0070687_1001994932 | 207 |
| 481 | 3300005344 | Ga0070661_100881023 | Ga0070661_1008810231 | 207 |
| 482 | 3300005345 | Ga0070692_10022160 | Ga0070692_100221604 | 207 |
| 483 | 3300005347 | Ga0070668_100113320 | Ga0070668_1001133204 | 207 |
| 484 | 3300005353 | Ga0070669_100206839 | Ga0070669_1002068391 | 207 |
| 485 | 3300005354 | Ga0070675_100018009 | Ga0070675_1000180095 | 207 |
| 486 | 3300005354 | Ga0070675_100445561 | Ga0070675_1004455612 | 207 |
| 487 | 3300005355 | Ga0070671_100010831 | Ga0070671_1000108314 | 207 |
| 488 | 3300005356 | Ga0070674_100026532 | Ga0070674_1000265324 | 207 |
| 489 | 3300005364 | Ga0070673_100003804 | Ga0070673_10000380411 | 207 |
| 490 | 3300005364 | Ga0070673_100227319 | Ga0070673_1002273192 | 207 |
| 491 | 3300005365 | Ga0070688_100005939 | Ga0070688_1000059394 | 207 |
| 492 | 3300005365 | Ga0070688_100028550 | Ga0070688_1000285504 | 207 |
| 493 | 3300005366 | Ga0070659_100410292 | Ga0070659_1004102922 | 207 |
| 494 | 3300005366 | Ga0070659_100994151 | Ga0070659_1009941511 | 207 |
| 495 | 3300005367 | Ga0070667_100029214 | Ga0070667_1000292145 | 207 |
| 496 | 3300005406 | Ga0070703_10010838 | Ga0070703_100108383 | 207 |
| 497 | 3300005434 | Ga0070709_10011931 | Ga0070709_100119315 | 207 |
| 498 | 3300005435 | Ga0070714_100058344 | Ga0070714_1000583442 | 207 |
| 499 | 3300005435 | Ga0070714_100206856 | Ga0070714_1002068562 | 207 |
| 500 | 3300005435 | Ga0070714_100665610 | Ga0070714_1006656101 | 207 |
| 501 | 3300005436 | Ga0070713_100022225 | Ga0070713_1000222255 | 207 |
| 502 | 3300005436 | Ga0070713_100108922 | Ga0070713_1001089224 | 207 |
| 503 | 3300005436 | Ga0070713_100125140 | Ga0070713_1001251402 | 207 |
| 504 | 3300005436 | Ga0070713_100586417 | Ga0070713_1005864172 | 207 |
| 505 | 3300005439 | Ga0070711_100028231 | Ga0070711_1000282314 | 207 |
| 506 | 3300005439 | Ga0070711_100036765 | Ga0070711_1000367651 | 207 |
| 507 | 3300005439 | Ga0070711_100080849 | Ga0070711_1000808492 | 207 |
| 508 | 3300005439 | Ga0070711_100142841 | Ga0070711_1001428413 | 207 |
| 509 | 3300005440 | Ga0070705_100189603 | Ga0070705_1001896032 | 207 |
| 510 | 3300005441 | Ga0070700_100066485 | Ga0070700_1000664854 | 207 |
| 511 | 3300005444 | Ga0070694_100585525 | Ga0070694_1005855251 | 207 |
| 512 | 3300005455 | Ga0070663_100086303 | Ga0070663_1000863031 | 207 |
| 513 | 3300005455 | Ga0070663_100358866 | Ga0070663_1003588661 | 207 |
| 514 | 3300005456 | Ga0070678_100376024 | Ga0070678_1003760243 | 207 |
| 515 | 3300005457 | Ga0070662_100019278 | Ga0070662_1000192786 | 207 |
| 516 | 3300005458 | Ga0070681_10523966 | Ga0070681_105239661 | 207 |
| 517 | 3300005459 | Ga0068867_100019113 | Ga0068867_1000191134 | 207 |
| 518 | 3300005466 | Ga0070685_10008870 | Ga0070685_100088704 | 207 |
| 519 | 3300005471 | Ga0070698_100807164 | Ga0070698_1008071641 | 207 |
| 520 | 3300005518 | Ga0070699_100123881 | Ga0070699_1001238811 | 207 |
| 521 | 3300005518 | Ga0070699_101090168 | Ga0070699_1010901681 | 207 |
| 522 | 3300005535 | Ga0070684_100165021 | Ga0070684_1001650212 | 207 |
| 523 | 3300005535 | Ga0070684_100436286 | Ga0070684_1004362863 | 207 |
| 524 | 3300005536 | Ga0070697_100036459 | Ga0070697_1000364595 | 207 |
| 525 | 3300005543 | Ga0070672_100014289 | Ga0070672_1000142893 | 207 |
| 526 | 3300005544 | Ga0070686_100015033 | Ga0070686_1000150336 | 207 |
| 527 | 3300005544 | Ga0070686_100122087 | Ga0070686_1001220872 | 207 |
| 528 | 3300005548 | Ga0070665_100176983 | Ga0070665_1001769832 | 207 |
| 529 | 3300005548 | Ga0070665_100374217 | Ga0070665_1003742171 | 207 |
| 530 | 3300005548 | Ga0070665_100836225 | Ga0070665_1008362252 | 207 |
| 531 | 3300005549 | Ga0070704_100377119 | Ga0070704_1003771191 | 207 |
| 532 | 3300005549 | Ga0070704_100543519 | Ga0070704_1005435191 | 207 |
| 533 | 3300005549 | Ga0070704_100807306 | Ga0070704_1008073061 | 207 |
| 534 | 3300005564 | Ga0070664_100171265 | Ga0070664_1001712651 | 207 |
| 535 | 3300005578 | Ga0068854_100016650 | Ga0068854_1000166505 | 207 |
| 536 | 3300005614 | Ga0068856_100502094 | Ga0068856_1005020942 | 207 |
| 537 | 3300005615 | Ga0070702_100008194 | Ga0070702_1000081945 | 207 |
| 538 | 3300005617 | Ga0068859_100025009 | Ga0068859_1000250094 | 207 |
| 539 | 3300005618 | Ga0068864_100001978 | Ga0068864_1000019782 | 207 |
| 540 | 3300005718 | Ga0068866_10011518 | Ga0068866_100115184 | 207 |
| 541 | 3300005834 | Ga0068851_10025091 | Ga0068851_100250912 | 207 |
| 542 | 3300005840 | Ga0068870_10014577 | Ga0068870_100145774 | 207 |
| 543 | 3300005841 | Ga0068863_100019233 | Ga0068863_1000192334 | 207 |
| 544 | 3300005842 | Ga0068858_100022418 | Ga0068858_1000224184 | 207 |
| 545 | 3300005842 | Ga0068858_100116932 | Ga0068858_1001169324 | 207 |
| 546 | 3300005842 | Ga0068858_100184675 | Ga0068858_1001846753 | 207 |
| 547 | 3300005843 | Ga0068860_100054877 | Ga0068860_1000548774 | 207 |
| 548 | 3300005843 | Ga0068860_101087720 | Ga0068860_1010877201 | 207 |
| 549 | 3300005844 | Ga0068862_100024602 | Ga0068862_1000246023 | 207 |
| 550 | 3300005844 | Ga0068862_100283175 | Ga0068862_1002831753 | 207 |
| 551 | 3300005937 | Ga0081455_10001354 | Ga0081455_1000135422 | 207 |
| 552 | 3300005937 | Ga0081455_10300774 | Ga0081455_103007741 | 207 |
| 553 | 3300005981 | Ga0081538_10034525 | Ga0081538_100345252 | 207 |
| 554 | 3300005981 | Ga0081538_10150658 | Ga0081538_101506582 | 207 |
| 555 | 3300005983 | Ga0081540_1001046 | Ga0081540_100104610 | 207 |
| 556 | 3300005983 | Ga0081540_1002282 | Ga0081540_100228210 | 207 |
| 557 | 3300005983 | Ga0081540_1003104 | Ga0081540_10031047 | 207 |
| 558 | 3300005983 | Ga0081540_1100145 | Ga0081540_11001452 | 207 |
| 559 | 3300006028 | Ga0070717_10247489 | Ga0070717_102474892 | 207 |
| 560 | 3300006028 | Ga0070717_10349049 | Ga0070717_103490493 | 207 |
| 561 | 3300006038 | Ga0075365_10009965 | Ga0075365_100099656 | 207 |
| 562 | 3300006038 | Ga0075365_10208576 | Ga0075365_102085763 | 207 |
| 563 | 3300006038 | Ga0075365_10247488 | Ga0075365_102474882 | 207 |
| 564 | 3300006038 | Ga0075365_10352560 | Ga0075365_103525602 | 207 |
| 565 | 3300006038 | Ga0075365_10572926 | Ga0075365_105729261 | 207 |
| 566 | 3300006051 | Ga0075364_10124588 | Ga0075364_101245882 | 207 |
| 567 | 3300006163 | Ga0070715_10005759 | Ga0070715_100057597 | 207 |
| 568 | 3300006175 | Ga0070712_100076048 | Ga0070712_1000760484 | 207 |
| 569 | 3300006175 | Ga0070712_100579723 | Ga0070712_1005797232 | 207 |
| 570 | 3300006237 | Ga0097621_100020748 | Ga0097621_1000207485 | 207 |
| 571 | 3300006353 | Ga0075370_10038028 | Ga0075370_100380282 | 207 |
| 572 | 3300006353 | Ga0075370_10108901 | Ga0075370_101089012 | 207 |
| 573 | 3300006358 | Ga0068871_100016774 | Ga0068871_1000167744 | 207 |
| 574 | 3300006844 | Ga0075428_100062074 | Ga0075428_1000620742 | 207 |
| 575 | 3300006844 | Ga0075428_100082995 | Ga0075428_1000829952 | 207 |
| 576 | 3300006844 | Ga0075428_100378884 | Ga0075428_1003788843 | 207 |
| 577 | 3300006844 | Ga0075428_100532816 | Ga0075428_1005328162 | 207 |
| 578 | 3300006844 | Ga0075428_100578115 | Ga0075428_1005781151 | 207 |
| 579 | 3300006847 | Ga0075431_100073995 | Ga0075431_1000739952 | 207 |
| 580 | 3300006847 | Ga0075431_100820232 | Ga0075431_1008202322 | 207 |
| 581 | 3300006852 | Ga0075433_10043573 | Ga0075433_100435732 | 207 |
| 582 | 3300006852 | Ga0075433_10622550 | Ga0075433_106225502 | 207 |
| 583 | 3300006871 | Ga0075434_100070901 | Ga0075434_1000709015 | 207 |
| 584 | 3300006871 | Ga0075434_100131094 | Ga0075434_1001310942 | 207 |
| 585 | 3300006871 | Ga0075434_100540835 | Ga0075434_1005408352 | 207 |
| 586 | 3300006871 | Ga0075434_100622901 | Ga0075434_1006229012 | 207 |
| 587 | 3300006880 | Ga0075429_100271902 | Ga0075429_1002719022 | 207 |
| 588 | 3300006881 | Ga0068865_100174258 | Ga0068865_1001742582 | 207 |
| 589 | 3300006931 | Ga0097620_100025009 | Ga0097620_1000250095 | 207 |
| 590 | 3300007076 | Ga0075435_100275497 | Ga0075435_1002754973 | 207 |
| 591 | 3300007076 | Ga0075435_100316413 | Ga0075435_1003164132 | 207 |
| 592 | 3300007265 | Ga0099794_10011365 | Ga0099794_100113655 | 207 |
| 593 | 3300007265 | Ga0099794_10019828 | Ga0099794_100198282 | 207 |
| 594 | 3300007788 | Ga0099795_10059973 | Ga0099795_100599732 | 207 |
| 595 | 3300009011 | Ga0105251_10019995 | Ga0105251_100199954 | 207 |
| 596 | 3300009092 | Ga0105250_10036971 | Ga0105250_100369713 | 207 |
| 597 | 3300009094 | Ga0111539_10089724 | Ga0111539_100897244 | 207 |
| 598 | 3300009094 | Ga0111539_10150665 | Ga0111539_101506652 | 207 |
| 599 | 3300009094 | Ga0111539_10286824 | Ga0111539_102868242 | 207 |
| 600 | 3300009094 | Ga0111539_10578423 | Ga0111539_105784232 | 207 |
| 601 | 3300009094 | Ga0111539_11212562 | Ga0111539_112125621 | 207 |
| 602 | 3300009098 | Ga0105245_10231631 | Ga0105245_102316311 | 207 |
| 603 | 3300009098 | Ga0105245_11406078 | Ga0105245_114060781 | 207 |
| 604 | 3300009147 | Ga0114129_10011617 | Ga0114129_100116177 | 207 |
| 605 | 3300009147 | Ga0114129_10048513 | Ga0114129_100485133 | 207 |
| 606 | 3300009147 | Ga0114129_10349571 | Ga0114129_103495714 | 207 |
| 607 | 3300009147 | Ga0114129_11039546 | Ga0114129_110395462 | 207 |
| 608 | 3300009147 | Ga0114129_11487948 | Ga0114129_114879481 | 207 |
| 609 | 3300009147 | Ga0114129_11489605 | Ga0114129_114896051 | 207 |
| 610 | 3300009148 | Ga0105243_10440664 | Ga0105243_104406642 | 207 |
| 611 | 3300009148 | Ga0105243_10605780 | Ga0105243_106057802 | 207 |
| 612 | 3300009176 | Ga0105242_10028336 | Ga0105242_100283362 | 207 |
| 613 | 3300009177 | Ga0105248_10623085 | Ga0105248_106230851 | 207 |
| 614 | 3300009545 | Ga0105237_10028064 | Ga0105237_100280645 | 207 |
| 615 | 3300009551 | Ga0105238_10037417 | Ga0105238_100374174 | 207 |
| 616 | 3300009553 | Ga0105249_10015086 | Ga0105249_100150866 | 207 |
| 617 | 3300009553 | Ga0105249_10672243 | Ga0105249_106722432 | 207 |
| 618 | 3300010159 | Ga0099796_10010230 | Ga0099796_100102302 | 207 |
| 619 | 3300010375 | Ga0105239_10031952 | Ga0105239_100319526 | 207 |
| 620 | 3300010375 | Ga0105239_10188702 | Ga0105239_101887021 | 207 |
| 621 | 3300010375 | Ga0105239_10308693 | Ga0105239_103086932 | 207 |
| 622 | 3300010375 | Ga0105239_11216837 | Ga0105239_112168371 | 207 |
| 623 | 3300013105 | Ga0157369_10541407 | Ga0157369_105414072 | 207 |
| 624 | 3300013296 | Ga0157374_10083923 | Ga0157374_100839232 | 207 |
| 625 | 3300013308 | Ga0157375_10009835 | Ga0157375_1000983510 | 207 |
| 626 | 3300013308 | Ga0157375_10796818 | Ga0157375_107968182 | 207 |
| 627 | 3300014325 | Ga0163163_10303939 | Ga0163163_103039394 | 207 |
| 628 | 3300014325 | Ga0163163_10372967 | Ga0163163_103729672 | 207 |
| 629 | 3300014325 | Ga0163163_10390837 | Ga0163163_103908372 | 207 |
| 630 | 3300014326 | Ga0157380_10710931 | Ga0157380_107109311 | 207 |
| 631 | 3300014745 | Ga0157377_10004874 | Ga0157377_100048746 | 207 |
| 632 | 3300014968 | Ga0157379_10027886 | Ga0157379_100278865 | 207 |
| 633 | 3300014969 | Ga0157376_10135733 | Ga0157376_101357334 | 207 |
| 634 | 3300017792 | Ga0163161_10120185 | Ga0163161_101201854 | 207 |
| 635 | 3300017792 | Ga0163161_10780922 | Ga0163161_107809221 | 207 |
| 636 | 3300021384 | Ga0213876_10077341 | Ga0213876_100773413 | 207 |
| 637 | 3300021384 | Ga0213876_10099408 | Ga0213876_100994083 | 207 |
| 638 | 3300021388 | Ga0213875_10158083 | Ga0213875_101580831 | 207 |
| 639 | 3300024225 | Ga0224572_1004891 | Ga0224572_10048912 | 207 |
| 640 | 3300024227 | Ga0228598_1000876 | Ga0228598_10008763 | 207 |
| 641 | 3300024227 | Ga0228598_1020313 | Ga0228598_10203131 | 207 |
| 642 | 3300025315 | Ga0207697_10030261 | Ga0207697_100302612 | 207 |
| 643 | 3300025315 | Ga0207697_10032524 | Ga0207697_100325242 | 207 |
| 644 | 3300025321 | Ga0207656_10016209 | Ga0207656_100162092 | 207 |
| 645 | 3300025898 | Ga0207692_10226083 | Ga0207692_102260832 | 207 |
| 646 | 3300025899 | Ga0207642_10013018 | Ga0207642_100130182 | 207 |
| 647 | 3300025901 | Ga0207688_10003415 | Ga0207688_100034152 | 207 |
| 648 | 3300025903 | Ga0207680_10008657 | Ga0207680_100086573 | 207 |
| 649 | 3300025904 | Ga0207647_10064910 | Ga0207647_100649102 | 207 |
| 650 | 3300025906 | Ga0207699_10014408 | Ga0207699_100144082 | 207 |
| 651 | 3300025907 | Ga0207645_10048865 | Ga0207645_100488652 | 207 |
| 652 | 3300025907 | Ga0207645_10049992 | Ga0207645_100499923 | 207 |
| 653 | 3300025907 | Ga0207645_10398827 | Ga0207645_103988271 | 207 |
| 654 | 3300025908 | Ga0207643_10005672 | Ga0207643_100056725 | 207 |
| 655 | 3300025910 | Ga0207684_10096437 | Ga0207684_100964372 | 207 |
| 656 | 3300025912 | Ga0207707_10379776 | Ga0207707_103797761 | 207 |
| 657 | 3300025914 | Ga0207671_10214673 | Ga0207671_102146732 | 207 |
| 658 | 3300025915 | Ga0207693_10002485 | Ga0207693_100024857 | 207 |
| 659 | 3300025915 | Ga0207693_10041146 | Ga0207693_100411466 | 207 |
| 660 | 3300025915 | Ga0207693_10063092 | Ga0207693_100630922 | 207 |
| 661 | 3300025915 | Ga0207693_10226341 | Ga0207693_102263413 | 207 |
| 662 | 3300025915 | Ga0207693_10284764 | Ga0207693_102847642 | 207 |
| 663 | 3300025915 | Ga0207693_10458723 | Ga0207693_104587231 | 207 |
| 664 | 3300025916 | Ga0207663_10045292 | Ga0207663_100452922 | 207 |
| 665 | 3300025916 | Ga0207663_10118085 | Ga0207663_101180852 | 207 |
| 666 | 3300025919 | Ga0207657_10100027 | Ga0207657_101000274 | 207 |
| 667 | 3300025919 | Ga0207657_10554022 | Ga0207657_105540221 | 207 |
| 668 | 3300025922 | Ga0207646_10268358 | Ga0207646_102683582 | 207 |
| 669 | 3300025924 | Ga0207694_10129583 | Ga0207694_101295832 | 207 |
| 670 | 3300025925 | Ga0207650_10031312 | Ga0207650_100313123 | 207 |
| 671 | 3300025925 | Ga0207650_10071529 | Ga0207650_100715292 | 207 |
| 672 | 3300025925 | Ga0207650_10149991 | Ga0207650_101499911 | 207 |
| 673 | 3300025926 | Ga0207659_10298422 | Ga0207659_102984222 | 207 |
| 674 | 3300025926 | Ga0207659_10309531 | Ga0207659_103095312 | 207 |
| 675 | 3300025926 | Ga0207659_10552690 | Ga0207659_105526901 | 207 |
| 676 | 3300025927 | Ga0207687_10006331 | Ga0207687_100063319 | 207 |
| 677 | 3300025928 | Ga0207700_10078066 | Ga0207700_100780663 | 207 |
| 678 | 3300025928 | Ga0207700_10153148 | Ga0207700_101531481 | 207 |
| 679 | 3300025928 | Ga0207700_10178347 | Ga0207700_101783472 | 207 |
| 680 | 3300025928 | Ga0207700_10225900 | Ga0207700_102259002 | 207 |
| 681 | 3300025928 | Ga0207700_10308481 | Ga0207700_103084812 | 207 |
| 682 | 3300025928 | Ga0207700_10334744 | Ga0207700_103347443 | 207 |
| 683 | 3300025929 | Ga0207664_10333892 | Ga0207664_103338921 | 207 |
| 684 | 3300025931 | Ga0207644_10023230 | Ga0207644_100232304 | 207 |
| 685 | 3300025931 | Ga0207644_10038217 | Ga0207644_100382174 | 207 |
| 686 | 3300025931 | Ga0207644_10525956 | Ga0207644_105259562 | 207 |
| 687 | 3300025932 | Ga0207690_10018700 | Ga0207690_100187004 | 207 |
| 688 | 3300025932 | Ga0207690_10104102 | Ga0207690_101041024 | 207 |
| 689 | 3300025933 | Ga0207706_10038206 | Ga0207706_100382064 | 207 |
| 690 | 3300025936 | Ga0207670_10017680 | Ga0207670_100176805 | 207 |
| 691 | 3300025936 | Ga0207670_10020641 | Ga0207670_100206411 | 207 |
| 692 | 3300025937 | Ga0207669_10005520 | Ga0207669_100055207 | 207 |
| 693 | 3300025939 | Ga0207665_10004102 | Ga0207665_100041025 | 207 |
| 694 | 3300025939 | Ga0207665_10855171 | Ga0207665_108551711 | 207 |
| 695 | 3300025940 | Ga0207691_10001627 | Ga0207691_1000162719 | 207 |
| 696 | 3300025941 | Ga0207711_10101018 | Ga0207711_101010182 | 207 |
| 697 | 3300025941 | Ga0207711_10472488 | Ga0207711_104724882 | 207 |
| 698 | 3300025942 | Ga0207689_10007012 | Ga0207689_100070129 | 207 |
| 699 | 3300025944 | Ga0207661_10106947 | Ga0207661_101069471 | 207 |
| 700 | 3300025945 | Ga0207679_10015638 | Ga0207679_100156385 | 207 |
| 701 | 3300025945 | Ga0207679_10230954 | Ga0207679_102309542 | 207 |
| 702 | 3300025960 | Ga0207651_10135996 | Ga0207651_101359964 | 207 |
| 703 | 3300025960 | Ga0207651_10269391 | Ga0207651_102693912 | 207 |
| 704 | 3300025972 | Ga0207668_10007545 | Ga0207668_100075454 | 207 |
| 705 | 3300025981 | Ga0207640_10019201 | Ga0207640_100192014 | 207 |
| 706 | 3300025986 | Ga0207658_10096845 | Ga0207658_100968454 | 207 |
| 707 | 3300026023 | Ga0207677_10126300 | Ga0207677_101263002 | 207 |
| 708 | 3300026023 | Ga0207677_10391944 | Ga0207677_103919442 | 207 |
| 709 | 3300026035 | Ga0207703_10167640 | Ga0207703_101676402 | 207 |
| 710 | 3300026035 | Ga0207703_10525085 | Ga0207703_105250851 | 207 |
| 711 | 3300026035 | Ga0207703_10686420 | Ga0207703_106864202 | 207 |
| 712 | 3300026041 | Ga0207639_10158101 | Ga0207639_101581014 | 207 |
| 713 | 3300026067 | Ga0207678_10020051 | Ga0207678_100200512 | 207 |
| 714 | 3300026067 | Ga0207678_10334683 | Ga0207678_103346832 | 207 |
| 715 | 3300026067 | Ga0207678_10370403 | Ga0207678_103704032 | 207 |
| 716 | 3300026075 | Ga0207708_10001502 | Ga0207708_100015029 | 207 |
| 717 | 3300026078 | Ga0207702_11400396 | Ga0207702_114003961 | 207 |
| 718 | 3300026089 | Ga0207648_10006668 | Ga0207648_100066687 | 207 |
| 719 | 3300026089 | Ga0207648_10074077 | Ga0207648_100740774 | 207 |
| 720 | 3300026095 | Ga0207676_10018586 | Ga0207676_100185865 | 207 |
| 721 | 3300026118 | Ga0207675_100013475 | Ga0207675_1000134759 | 207 |
| 722 | 3300026121 | Ga0207683_10012333 | Ga0207683_100123335 | 207 |
| 723 | 3300026121 | Ga0207683_10547128 | Ga0207683_105471281 | 207 |
| 724 | 3300027671 | Ga0209588_1027516 | Ga0209588_10275163 | 207 |
| 725 | 3300028379 | Ga0268266_10286712 | Ga0268266_102867121 | 207 |
| 726 | 3300028379 | Ga0268266_10494120 | Ga0268266_104941203 | 207 |
| 727 | 3300028379 | Ga0268266_10760726 | Ga0268266_107607261 | 207 |
| 728 | 3300028380 | Ga0268265_10011597 | Ga0268265_100115975 | 207 |
| 729 | 3300028380 | Ga0268265_10597576 | Ga0268265_105975761 | 207 |
| 730 | 3300028381 | Ga0268264_10858049 | Ga0268264_108580491 | 207 |
| 731 | 3300028800 | Ga0265338_10151314 | Ga0265338_101513142 | 207 |
| 732 | 3300030763 | Ga0265763_1007016 | Ga0265763_10070161 | 207 |
| 733 | 3300031018 | Ga0265773_1006882 | Ga0265773_10068821 | 207 |
| 734 | 3300031238 | Ga0265332_10006574 | Ga0265332_100065746 | 207 |
| 735 | 3300031241 | Ga0265325_10002317 | Ga0265325_100023173 | 207 |
| 736 | 3300031242 | Ga0265329_10070499 | Ga0265329_100704992 | 207 |
| 737 | 3300031247 | Ga0265340_10015062 | Ga0265340_100150622 | 207 |
| 738 | 3300031249 | Ga0265339_10000078 | Ga0265339_1000007869 | 207 |
| 739 | 3300031249 | Ga0265339_10019601 | Ga0265339_100196015 | 207 |
| 740 | 3300031250 | Ga0265331_10154151 | Ga0265331_101541512 | 207 |
| 741 | 3300031344 | Ga0265316_10228627 | Ga0265316_102286272 | 207 |
| 742 | 3300031595 | Ga0265313_10003528 | Ga0265313_100035284 | 207 |
| 743 | 3300031711 | Ga0265314_10022239 | Ga0265314_100222392 | 207 |
| 744 | 3300031712 | Ga0265342_10002635 | Ga0265342_100026356 | 207 |
| 745 | 3300035085 | Ga0373929_0111511 | Ga0373929_0111511_51_677 | 207 |
| 746 | 3300035089 | Ga0373944_0024358 | Ga0373944_0024358_72_698 | 207 |
| 747 | 3300035092 | Ga0373952_0114059 | Ga0373952_0114059_64_690 | 207 |
| 748 | 3300035113 | Ga0373936_0010496 | Ga0373936_0010496_2431_3054 | 207 |
| 749 | 3300035116 | Ga0373945_0005949 | Ga0373945_0005949_598_1221 | 207 |
| 750 | 3300035170 | Ga0373943_0000208 | Ga0373943_0000208_5568_6194 | 207 |
| 751 | 3300035170 | Ga0373943_0032102 | Ga0373943_0032102_1175_1798 | 207 |
| 752 | 3300035170 | Ga0373943_0058368 | Ga0373943_0058368_1048_1758 | 207 |
| 753 | 3300035171 | Ga0373946_0006567 | Ga0373946_0006567_598_1224 | 207 |
| 754 | 3300035171 | Ga0373946_0020608 | Ga0373946_0020608_1659_2282 | 207 |
| 755 | 3300035207 | Ga0373942_0088537 | Ga0373942_0088537_73_699 | 207 |
| 756 | 3300035207 | Ga0373942_0185417 | Ga0373942_0185417_14_640 | 207 |
| 757 | 3300035691 | Ga0373931_0024776 | Ga0373931_0024776_156_782 | 207 |
| 758 | 3300035691 | Ga0373931_0177648 | Ga0373931_0177648_239_862 | 207 |
| 759 | 3300035692 | Ga0373935_0213117 | Ga0373935_0213117_280_990 | 207 |
| 760 | 3300035692 | Ga0373935_0431288 | Ga0373935_0431288_98_724 | 207 |
| 761 | 3300035695 | Ga0373927_0006191 | Ga0373927_0006191_4874_5500 | 207 |
| 762 | 3300035695 | Ga0373927_0026505 | Ga0373927_0026505_2674_3300 | 207 |
| 763 | 3300035695 | Ga0373927_0028489 | Ga0373927_0028489_1209_1835 | 207 |
| 764 | 3300035695 | Ga0373927_0039331 | Ga0373927_0039331_463_1086 | 207 |
| 765 | 3300035695 | Ga0373927_0179490 | Ga0373927_0179490_83_706 | 207 |
| 766 | 3300035725 | Ga0373947_0000178 | Ga0373947_0000178_747_1373 | 207 |
| 767 | 3300035725 | Ga0373947_0023662 | Ga0373947_0023662_2146_2772 | 207 |
| 768 | 3300035725 | Ga0373947_0064449 | Ga0373947_0064449_375_1037 | 207 |
| 769 | 3300035725 | Ga0373947_0102805 | Ga0373947_0102805_461_1084 | 207 |
| 770 | 3300035725 | Ga0373947_0180047 | Ga0373947_0180047_433_1059 | 207 |
| 771 | 3300036401 | Ga0373937_0179799 | Ga0373937_0179799_395_1063 | 207 |
| 772 | 3300036401 | Ga0373937_0194899 | Ga0373937_0194899_878_1570 | 207 |
| 773 | 3300036401 | Ga0373937_0250597 | Ga0373937_0250597_142_852 | 207 |
| 774 | 3300037068 | Ga0373925_0001482 | Ga0373925_0001482_4330_4956 | 207 |
| 775 | 3300037068 | Ga0373925_0044829 | Ga0373925_0044829_2374_3000 | 207 |
| 776 | 3300037068 | Ga0373925_0302993 | Ga0373925_0302993_485_1108 | 207 |
| 777 | 3300037068 | Ga0373925_0324306 | Ga0373925_0324306_531_1154 | 207 |
| 778 | 3300037068 | Ga0373925_0454820 | Ga0373925_0454820_370_996 | 207 |
| 779 | 3300037418 | Ga0395900_1067436 | Ga0395900_1067436_62_685 | 207 |
| 780 | 3300037853 | Ga0436364_0664195 | Ga0436364_0664195_219_845 | 207 |
| 781 | 3300037853 | Ga0436364_0716542 | Ga0436364_0716542_1605_2231 | 207 |
| 782 | 3300038443 | Ga0395901_0215568 | Ga0395901_0215568_63_686 | 207 |
| 783 | 3300039437 | Ga0436365_0042743 | Ga0436365_0042743_367_996 | 207 |
| 784 | 3300039437 | Ga0436365_1251077 | Ga0436365_1251077_43_666 | 207 |
| 785 | 3300039437 | Ga0436365_1336443 | Ga0436365_1336443_1785_2411 | 207 |
| 786 | 3300039437 | Ga0436365_1383206 | Ga0436365_1383206_717_1346 | 207 |
| 787 | 3300039438 | Ga0436360_1307075 | Ga0436360_1307075_108_734 | 207 |
| 788 | 3300039447 | Ga0436361_0687582 | Ga0436361_0687582_341_967 | 207 |
| 789 | 3300039450 | Ga0436363_0753578 | Ga0436363_0753578_230_856 | 207 |
| 790 | 3300041512 | Ga0451853_1512202 | Ga0451853_1512202_588_1211 | 207 |
| 791 | 3300044684 | Ga0466966_0306725 | Ga0466966_0306725_237_863 | 207 |
| 792 | 3300044693 | Ga0466961_0158392 | Ga0466961_0158392_335_961 | 207 |
| 793 | 3300044694 | Ga0466963_0034467 | Ga0466963_0034467_1316_2086 | 207 |
| 794 | 3300045049 | Ga0466959_0036016 | Ga0466959_0036016_34_660 | 207 |
| 795 | 3300045051 | Ga0451576_0599338 | Ga0451576_0599338_53_676 | 207 |
| 796 | 3300045836 | Ga0466958_0014631 | Ga0466958_0014631_1702_2328 | 207 |
| 797 | 3300045976 | Ga0466967_0611955 | Ga0466967_0611955_83_709 | 207 |
| 798 | 3300046452 | Ga0495617_118481 | Ga0495617_118481_179_802 | 207 |
| 799 | 3300046454 | Ga0495592_0287452 | Ga0495592_0287452_209_952 | 207 |
| 800 | 3300046457 | Ga0495590_0087493 | Ga0495590_0087493_235_858 | 207 |
| 801 | 3300046458 | Ga0495591_045515 | Ga0495591_045515_137_760 | 207 |
| 802 | 3300046462 | Ga0495651_0062022 | Ga0495651_0062022_1716_2384 | 207 |
| 803 | 3300046462 | Ga0495651_0088854 | Ga0495651_0088854_793_1503 | 207 |
| 804 | 3300046463 | Ga0495653_0125711 | Ga0495653_0125711_188_814 | 207 |
| 805 | 3300046472 | Ga0495580_0091021 | Ga0495580_0091021_1289_1915 | 207 |
| 806 | 3300046473 | Ga0495582_0022901 | Ga0495582_0022901_917_1627 | 207 |
| 807 | 3300046473 | Ga0495582_0034182 | Ga0495582_0034182_289_912 | 207 |
| 808 | 3300046475 | Ga0495639_0045107 | Ga0495639_0045107_457_1080 | 207 |
| 809 | 3300046476 | Ga0495662_0080447 | Ga0495662_0080447_555_1181 | 207 |
| 810 | 3300046476 | Ga0495662_0142170 | Ga0495662_0142170_159_785 | 207 |
| 811 | 3300046476 | Ga0495662_0242024 | Ga0495662_0242024_56_679 | 207 |
| 812 | 3300046477 | Ga0495664_0015488 | Ga0495664_0015488_569_1195 | 207 |
| 813 | 3300046491 | Ga0495584_0139415 | Ga0495584_0139415_286_912 | 207 |
| 814 | 3300046499 | Ga0495594_0266148 | Ga0495594_0266148_62_685 | 207 |
| 815 | 3300046501 | Ga0495607_0119698 | Ga0495607_0119698_442_1065 | 207 |
| 816 | 3300046513 | Ga0495616_0056321 | Ga0495616_0056321_431_1054 | 207 |
| 817 | 3300046514 | Ga0495618_0041757 | Ga0495618_0041757_475_1101 | 207 |
| 818 | 3300046514 | Ga0495618_0091385 | Ga0495618_0091385_824_1447 | 207 |
| 819 | 3300046516 | Ga0495628_0139904 | Ga0495628_0139904_225_935 | 207 |
| 820 | 3300046517 | Ga0495630_0269636 | Ga0495630_0269636_378_1004 | 207 |
| 821 | 3300046517 | Ga0495630_0432671 | Ga0495630_0432671_100_723 | 207 |
| 822 | 3300046523 | Ga0495644_0015905 | Ga0495644_0015905_2248_2871 | 207 |
| 823 | 3300046526 | Ga0495666_0057585 | Ga0495666_0057585_155_778 | 207 |
| 824 | 3300046526 | Ga0495666_0124149 | Ga0495666_0124149_22_648 | 207 |
| 825 | 3300046529 | Ga0495652_0044867 | Ga0495652_0044867_493_1119 | 207 |
| 826 | 3300046529 | Ga0495652_0173262 | Ga0495652_0173262_46_756 | 207 |
| 827 | 3300046531 | Ga0495665_0022710 | Ga0495665_0022710_478_1104 | 207 |
| 828 | 3300046531 | Ga0495665_0062082 | Ga0495665_0062082_1192_1902 | 207 |
| 829 | 3300046531 | Ga0495665_0111401 | Ga0495665_0111401_131_757 | 207 |
| 830 | 3300046533 | Ga0495640_0186408 | Ga0495640_0186408_283_906 | 207 |
| 831 | 3300046533 | Ga0495640_0192449 | Ga0495640_0192449_615_1238 | 207 |
| 832 | 3300046533 | Ga0495640_0261916 | Ga0495640_0261916_383_1045 | 207 |
| 833 | 3300046535 | Ga0495586_0027423 | Ga0495586_0027423_1930_2556 | 207 |
| 834 | 3300046536 | Ga0495587_0063866 | Ga0495587_0063866_171_839 | 207 |
| 835 | 3300046536 | Ga0495587_0289664 | Ga0495587_0289664_243_869 | 207 |
| 836 | 3300046537 | Ga0495598_0000513 | Ga0495598_0000513_3933_4556 | 207 |
| 837 | 3300046537 | Ga0495598_0085309 | Ga0495598_0085309_213_836 | 207 |
| 838 | 3300046539 | Ga0495621_0066992 | Ga0495621_0066992_492_1115 | 207 |
| 839 | 3300046543 | Ga0495645_0042265 | Ga0495645_0042265_440_1066 | 207 |
| 840 | 3300046543 | Ga0495645_0225337 | Ga0495645_0225337_52_762 | 207 |
| 841 | 3300046558 | Ga0495633_0126843 | Ga0495633_0126843_73_696 | 207 |
| 842 | 3300046559 | Ga0495667_0258536 | Ga0495667_0258536_151_777 | 207 |
| 843 | 3300046559 | Ga0495667_0321339 | Ga0495667_0321339_62_772 | 207 |
| 844 | 3300046616 | Ga0495668_0232391 | Ga0495668_0232391_61_684 | 207 |
| 845 | 3300046642 | Ga0495634_0006515 | Ga0495634_0006515_6981_7607 | 207 |
| 846 | 3300046642 | Ga0495634_0007380 | Ga0495634_0007380_6173_6799 | 207 |
| 847 | 3300046642 | Ga0495634_0023797 | Ga0495634_0023797_3196_3858 | 207 |
| 848 | 3300046663 | Ga0495635_0007866 | Ga0495635_0007866_6302_6928 | 207 |
| 849 | 3300046663 | Ga0495635_0474966 | Ga0495635_0474966_108_776 | 207 |
| 850 | 3300046664 | Ga0495659_0046419 | Ga0495659_0046419_544_1167 | 207 |
| 851 | 3300046675 | Ga0495657_0227561 | Ga0495657_0227561_109_777 | 207 |
| 852 | 3300046679 | Ga0495623_0290852 | Ga0495623_0290852_172_882 | 207 |
| 853 | 3300046680 | Ga0495646_0009489 | Ga0495646_0009489_4406_5032 | 207 |
| 854 | 3300046680 | Ga0495646_0086248 | Ga0495646_0086248_869_1579 | 207 |
| 855 | 3300046681 | Ga0495647_0017526 | Ga0495647_0017526_817_1443 | 207 |
| 856 | 3300046681 | Ga0495647_0133894 | Ga0495647_0133894_335_961 | 207 |
| 857 | 3300046683 | Ga0495658_0088488 | Ga0495658_0088488_287_913 | 207 |
| 858 | 3300046689 | Ga0495613_0028287 | Ga0495613_0028287_786_1409 | 207 |
| 859 | 3300046689 | Ga0495613_0055243 | Ga0495613_0055243_2191_2853 | 207 |
| 860 | 3300046689 | Ga0495613_0070264 | Ga0495613_0070264_461_1087 | 207 |
| 861 | 3300046689 | Ga0495613_0103178 | Ga0495613_0103178_1074_1697 | 207 |
| 862 | 3300046690 | Ga0495624_0052660 | Ga0495624_0052660_1549_2175 | 207 |
| 863 | 3300046691 | Ga0495670_0004845 | Ga0495670_0004845_1409_2032 | 207 |
| 864 | 3300046692 | Ga0495671_0025808 | Ga0495671_0025808_2102_2725 | 207 |
| 865 | 3300046809 | Ga0495600_0028026 | Ga0495600_0028026_2438_3148 | 207 |
| 866 | 3300047315 | Ga0495581_0050844 | Ga0495581_0050844_962_1585 | 207 |
| 867 | 3300047315 | Ga0495581_0164637 | Ga0495581_0164637_99_809 | 207 |
| 868 | 3300047315 | Ga0495581_0251664 | Ga0495581_0251664_228_890 | 207 |
| 869 | 3300047319 | Ga0495674_0146874 | Ga0495674_0146874_688_1314 | 207 |
| 870 | 3300047321 | Ga0495676_0021834 | Ga0495676_0021834_3847_4470 | 207 |
| 871 | 3300047321 | Ga0495676_0072883 | Ga0495676_0072883_687_1313 | 207 |
| 872 | 3300047322 | Ga0495680_0274377 | Ga0495680_0274377_324_950 | 207 |
| 873 | 3300047444 | Ga0495675_0074564 | Ga0495675_0074564_275_985 | 207 |
| 874 | 3300047444 | Ga0495675_0222744 | Ga0495675_0222744_109_777 | 207 |
| 875 | 3300047471 | Ga0495684_0023040 | Ga0495684_0023040_1070_1693 | 207 |
| 876 | 3300047471 | Ga0495684_0032711 | Ga0495684_0032711_2672_3298 | 207 |
| 877 | 3300047673 | Ga0495593_0006926 | Ga0495593_0006926_411_1037 | 207 |
| 878 | 3300047673 | Ga0495593_0092976 | Ga0495593_0092976_368_991 | 207 |
| 879 | 3300047673 | Ga0495593_0249251 | Ga0495593_0249251_74_781 | 207 |
| 880 | 3300048088 | Ga0495602_0281844 | Ga0495602_0281844_34_702 | 207 |
| 881 | 3300048903 | Ga0496100_0006029 | Ga0496100_0006029_4716_5339 | 207 |
| 882 | 3300048903 | Ga0496100_0007617 | Ga0496100_0007617_2893_3516 | 207 |
| 883 | 3300048903 | Ga0496100_0221282 | Ga0496100_0221282_720_1346 | 207 |
| 884 | 3300048903 | Ga0496100_0577318 | Ga0496100_0577318_71_697 | 207 |
| 885 | 3300048904 | Ga0496101_0000879 | Ga0496101_0000879_7386_8009 | 207 |
| 886 | 3300048904 | Ga0496101_0003104 | Ga0496101_0003104_1073_1696 | 207 |
| 887 | 3300048904 | Ga0496101_0011363 | Ga0496101_0011363_1869_2492 | 207 |
| 888 | 3300048904 | Ga0496101_0153974 | Ga0496101_0153974_416_1042 | 207 |
| 889 | 3300048904 | Ga0496101_0344962 | Ga0496101_0344962_128_754 | 207 |
| 890 | 3300048904 | Ga0496101_0608082 | Ga0496101_0608082_218_844 | 207 |
| 891 | 3300048904 | Ga0496101_0629180 | Ga0496101_0629180_29_652 | 207 |
| 892 | 3300048905 | Ga0496102_0008462 | Ga0496102_0008462_6182_6805 | 207 |
| 893 | 3300048905 | Ga0496102_0011826 | Ga0496102_0011826_5073_5696 | 207 |
| 894 | 3300048905 | Ga0496102_0024214 | Ga0496102_0024214_1067_1690 | 207 |
| 895 | 3300048905 | Ga0496102_0037021 | Ga0496102_0037021_2952_3575 | 207 |
| 896 | 3300048905 | Ga0496102_0069866 | Ga0496102_0069866_2226_2852 | 207 |
| 897 | 3300048905 | Ga0496102_0717283 | Ga0496102_0717283_241_867 | 207 |
| 898 | 3300048905 | Ga0496102_0902813 | Ga0496102_0902813_127_750 | 207 |
| 899 | 3300048906 | Ga0496103_0007237 | Ga0496103_0007237_5897_6520 | 207 |
| 900 | 3300048906 | Ga0496103_0048800 | Ga0496103_0048800_1026_1649 | 207 |
| 901 | 3300048906 | Ga0496103_0102030 | Ga0496103_0102030_1015_1641 | 207 |
| 902 | 3300048906 | Ga0496103_0243198 | Ga0496103_0243198_242_865 | 207 |
| 903 | 3300048907 | Ga0496104_0004384 | Ga0496104_0004384_820_1443 | 207 |
| 904 | 3300048907 | Ga0496104_0006107 | Ga0496104_0006107_1193_1816 | 207 |
| 905 | 3300048907 | Ga0496104_0017059 | Ga0496104_0017059_1967_2590 | 207 |
| 906 | 3300048907 | Ga0496104_0374083 | Ga0496104_0374083_634_1260 | 207 |
| 907 | 3300048907 | Ga0496104_0468513 | Ga0496104_0468513_537_1160 | 207 |
| 908 | 3300048907 | Ga0496104_0848001 | Ga0496104_0848001_110_736 | 207 |
| 909 | 3300048907 | Ga0496104_0990057 | Ga0496104_0990057_11_637 | 207 |
| 910 | 3300048908 | Ga0496105_0001999 | Ga0496105_0001999_4150_4773 | 207 |
| 911 | 3300048908 | Ga0496105_0005181 | Ga0496105_0005181_7831_8454 | 207 |
| 912 | 3300048908 | Ga0496105_0015753 | Ga0496105_0015753_2482_3105 | 207 |
| 913 | 3300048908 | Ga0496105_0061711 | Ga0496105_0061711_880_1506 | 207 |
| 914 | 3300048908 | Ga0496105_0098553 | Ga0496105_0098553_485_1108 | 207 |
| 915 | 3300048908 | Ga0496105_0454318 | Ga0496105_0454318_175_801 | 207 |
| 916 | 3300048909 | Ga0496106_0003496 | Ga0496106_0003496_849_1472 | 207 |
| 917 | 3300048909 | Ga0496106_0011510 | Ga0496106_0011510_1572_2195 | 207 |
| 918 | 3300048909 | Ga0496106_0016650 | Ga0496106_0016650_1559_2182 | 207 |
| 919 | 3300048909 | Ga0496106_0317869 | Ga0496106_0317869_491_1117 | 207 |
| 920 | 3300048909 | Ga0496106_0917103 | Ga0496106_0917103_18_644 | 207 |
| 921 | 3300048910 | Ga0496107_0008551 | Ga0496107_0008551_3903_4526 | 207 |
| 922 | 3300048910 | Ga0496107_0028396 | Ga0496107_0028396_927_1550 | 207 |
| 923 | 3300048910 | Ga0496107_0062820 | Ga0496107_0062820_1667_2290 | 207 |
| 924 | 3300048910 | Ga0496107_0181280 | Ga0496107_0181280_803_1429 | 207 |
| 925 | 3300048911 | Ga0496108_0000347 | Ga0496108_0000347_3092_3715 | 207 |
| 926 | 3300048911 | Ga0496108_0013218 | Ga0496108_0013218_1759_2382 | 207 |
| 927 | 3300048911 | Ga0496108_0018394 | Ga0496108_0018394_2284_2907 | 207 |
| 928 | 3300048911 | Ga0496108_0032557 | Ga0496108_0032557_357_980 | 207 |
| 929 | 3300048912 | Ga0496109_0005863 | Ga0496109_0005863_1399_2022 | 207 |
| 930 | 3300048912 | Ga0496109_0032495 | Ga0496109_0032495_2037_2660 | 207 |
| 931 | 3300048912 | Ga0496109_0045633 | Ga0496109_0045633_2847_3470 | 207 |
| 932 | 3300048912 | Ga0496109_0313055 | Ga0496109_0313055_134_757 | 207 |
| 933 | 3300048912 | Ga0496109_0498994 | Ga0496109_0498994_184_810 | 207 |
| 934 | 3300048913 | Ga0496110_0000339 | Ga0496110_0000339_13064_13687 | 207 |
| 935 | 3300048913 | Ga0496110_0012105 | Ga0496110_0012105_2720_3343 | 207 |
| 936 | 3300048913 | Ga0496110_0029719 | Ga0496110_0029719_1399_2022 | 207 |
| 937 | 3300048913 | Ga0496110_0074428 | Ga0496110_0074428_961_1584 | 207 |
| 938 | 3300048913 | Ga0496110_0170611 | Ga0496110_0170611_817_1443 | 207 |
| 939 | 3300048913 | Ga0496110_0264085 | Ga0496110_0264085_698_1324 | 207 |
| 940 | 3300048913 | Ga0496110_0323362 | Ga0496110_0323362_616_1239 | 207 |
| 941 | 3300048913 | Ga0496110_0625564 | Ga0496110_0625564_223_849 | 207 |
| 942 | 3300048914 | Ga0496111_0001676 | Ga0496111_0001676_1827_2450 | 207 |
| 943 | 3300048914 | Ga0496111_0009006 | Ga0496111_0009006_1184_1807 | 207 |
| 944 | 3300048914 | Ga0496111_0017366 | Ga0496111_0017366_1793_2416 | 207 |
| 945 | 3300048914 | Ga0496111_0021601 | Ga0496111_0021601_323_946 | 207 |
| 946 | 3300048914 | Ga0496111_0720866 | Ga0496111_0720866_63_689 | 207 |
| 947 | 3300048915 | Ga0496112_0002294 | Ga0496112_0002294_1216_1839 | 207 |
| 948 | 3300048915 | Ga0496112_0004698 | Ga0496112_0004698_940_1563 | 207 |
| 949 | 3300048915 | Ga0496112_0006289 | Ga0496112_0006289_1218_1841 | 207 |
| 950 | 3300048915 | Ga0496112_0129178 | Ga0496112_0129178_819_1445 | 207 |
| 951 | 3300048915 | Ga0496112_0618357 | Ga0496112_0618357_166_789 | 207 |
| 952 | 3300048915 | Ga0496112_0648060 | Ga0496112_0648060_95_721 | 207 |
| 953 | 3300048915 | Ga0496112_0917495 | Ga0496112_0917495_111_737 | 207 |
| 954 | 3300048916 | Ga0496113_0069726 | Ga0496113_0069726_1681_2304 | 207 |
| 955 | 3300048916 | Ga0496113_0114824 | Ga0496113_0114824_1060_1683 | 207 |
| 956 | 3300048916 | Ga0496113_0132092 | Ga0496113_0132092_949_1575 | 207 |
| 957 | 3300048916 | Ga0496113_0280044 | Ga0496113_0280044_127_753 | 207 |
| 958 | 3300048917 | Ga0496114_0110149 | Ga0496114_0110149_1101_1724 | 207 |
| 959 | 3300048918 | Ga0496115_0018524 | Ga0496115_0018524_236_859 | 207 |
| 960 | 3300048918 | Ga0496115_0055975 | Ga0496115_0055975_1553_2179 | 207 |
| 961 | 3300048918 | Ga0496115_0060795 | Ga0496115_0060795_1102_1728 | 207 |
| 962 | 3300048918 | Ga0496115_0257531 | Ga0496115_0257531_465_1088 | 207 |
| 963 | 3300048918 | Ga0496115_0316815 | Ga0496115_0316815_560_1186 | 207 |
| 964 | 3300048918 | Ga0496115_0826093 | Ga0496115_0826093_46_669 | 207 |
| 965 | 3300049576 | Ga0501040_0725460 | Ga0501040_0725460_84_707 | 207 |
| 966 | 3300049582 | Ga0501048_0331171 | Ga0501048_0331171_66_698 | 207 |
| 967 | 3300049591 | Ga0501075_0164115 | Ga0501075_0164115_421_1044 | 207 |
| 968 | 3300049743 | Ga0501081_0533014 | Ga0501081_0533014_10_633 | 207 |
| 969 | 3300050492 | nmdc:mga0yw44_70420_c1 | nmdc:mga0yw44_70420_c1_907_1530 | 207 |
| 970 | 3300050495 | nmdc:mga04h51_7974_c1 | nmdc:mga04h51_7974_c1_146_769 | 207 |
| 971 | 3300050507 | nmdc:mga05p37_13689_c1 | nmdc:mga05p37_13689_c1_1658_2296 | 207 |
| 972 | 3300050507 | nmdc:mga05p37_463312_c1 | nmdc:mga05p37_463312_c1_180_806 | 207 |
| 973 | 3300050508 | nmdc:mga09592_276302_c1 | nmdc:mga09592_276302_c1_238_864 | 207 |
| 974 | 3300050508 | nmdc:mga09592_551382_c1 | nmdc:mga09592_551382_c1_241_864 | 207 |
| 975 | 3300050510 | nmdc:mga06r32_134422_c1 | nmdc:mga06r32_134422_c1_1242_1865 | 207 |
| 976 | 3300050510 | nmdc:mga06r32_898206_c1 | nmdc:mga06r32_898206_c1_180_806 | 207 |
| 977 | 3300050510 | nmdc:mga06r32_899039_c1 | nmdc:mga06r32_899039_c1_136_759 | 207 |
| 978 | 3300050511 | nmdc:mga08y16_147315_c1 | nmdc:mga08y16_147315_c1_1091_1714 | 207 |
| 979 | 3300050511 | nmdc:mga08y16_496710_c1 | nmdc:mga08y16_496710_c1_274_897 | 207 |
| 980 | 3300050511 | nmdc:mga08y16_627756_c1 | nmdc:mga08y16_627756_c1_381_1004 | 207 |
| 981 | 3300050512 | nmdc:mga0n895_155498_c1 | nmdc:mga0n895_155498_c1_1001_1624 | 207 |
| 982 | 3300050512 | nmdc:mga0n895_459658_c1 | nmdc:mga0n895_459658_c1_149_772 | 207 |
| 983 | 3300050512 | nmdc:mga0n895_4873_c1 | nmdc:mga0n895_4873_c1_3275_3901 | 207 |
| 984 | 3300050513 | nmdc:mga0rr50_294262_c1 | nmdc:mga0rr50_294262_c1_34_660 | 207 |
| 985 | 3300050513 | nmdc:mga0rr50_929405_c1 | nmdc:mga0rr50_929405_c1_11_634 | 207 |
| 986 | 3300050514 | nmdc:mga08x19_127143_c1 | nmdc:mga08x19_127143_c1_152_775 | 207 |
| 987 | 3300050515 | nmdc:mga0a205_25016_c1 | nmdc:mga0a205_25016_c1_4870_5496 | 207 |
| 988 | 3300050515 | nmdc:mga0a205_394674_c1 | nmdc:mga0a205_394674_c1_39_713 | 207 |
| 989 | 3300050515 | nmdc:mga0a205_534460_c1 | nmdc:mga0a205_534460_c1_333_956 | 207 |
| 990 | 3300053077 | Ga0495601_0017716 | Ga0495601_0017716_3005_3631 | 207 |
| 991 | 3300053077 | Ga0495601_0043988 | Ga0495601_0043988_1509_2171 | 207 |
| 992 | 3300053077 | Ga0495601_0095332 | Ga0495601_0095332_21_704 | 207 |
| 993 | 3300053077 | Ga0495601_0259457 | Ga0495601_0259457_87_797 | 207 |
| 994 | 3300053077 | Ga0495601_0343242 | Ga0495601_0343242_227_895 | 207 |
| 995 | 3300053078 | Ga0495612_0008712 | Ga0495612_0008712_2920_3546 | 207 |
| 996 | 3300053078 | Ga0495612_0097294 | Ga0495612_0097294_166_789 | 207 |
| 997 | 3300053078 | Ga0495612_0222672 | Ga0495612_0222672_167_793 | 207 |
| 998 | 3300053083 | Ga0495655_0000981 | Ga0495655_0000981_3166_3789 | 207 |
| 999 | 3300053084 | Ga0495595_0001522 | Ga0495595_0001522_2414_3082 | 207 |
| 1000 | 3300053084 | Ga0495595_0143601 | Ga0495595_0143601_368_994 | 207 |
| 1001 | 3300053085 | Ga0495619_0002388 | Ga0495619_0002388_8319_8945 | 207 |
| 1002 | 3300053085 | Ga0495619_0088079 | Ga0495619_0088079_541_1167 | 207 |
| 1003 | 3300053085 | Ga0495619_0118435 | Ga0495619_0118435_223_846 | 207 |
| 1004 | 3300053085 | Ga0495619_0313965 | Ga0495619_0313965_136_879 | 207 |
| 1005 | 3300053085 | Ga0495619_0391363 | Ga0495619_0391363_173_865 | 207 |
| 1006 | 3300053094 | Ga0500566_0112346 | Ga0500566_0112346_31_714 | 207 |
| 1007 | 3300053098 | Ga0500650_0089514 | Ga0500650_0089514_146_772 | 207 |
| 1008 | 3300053730 | Ga0500645_051596 | Ga0500645_051596_387_1013 | 207 |
| 1009 | 3300054114 | Ga0501084_0370131 | Ga0501084_0370131_510_1142 | 207 |
| 1010 | 3300054114 | Ga0501084_0880187 | Ga0501084_0880187_33_656 | 207 |
| 1011 | 3300060353 | Ga0501082_0349555 | Ga0501082_0349555_490_1113 | 207 |
| 1012 | 3300061719 | Ga0466962_0380322 | Ga0466962_0380322_43_669 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kh7-assembly3.cif.gz_B | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9703 | 1 | 207 |
| 4kh7-assembly3.cif.gz_B | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9657 | 1 | 207 |
| 4kh7-assembly2.cif.gz_A | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9648 | 1 | 207 |
| 6nv6-assembly2.cif.gz_B | crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound | 0.9602 | 2 | 207 |
| 6nxv-assembly4.cif.gz_D | crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form | 0.9559 | 2 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACA7_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9842 | 1 | 78 | 3.40.30.10 |
| 4ielA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.98 | 1 | 79 | 3.40.30.10 |
| 4ke3A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9709 | 1 | 78 | 3.40.30.10 |
| af_Q7JVZ8_6_81_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9619 | 4 | 77 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9602 | 1 | 77 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537Q271-F1-model_v4 | Glutathione S-transferase family protein | 0.989 | 1 | 196 |
GO:0016740
|
| AF-A0A382MT04-F1-model_v4 | GST N-terminal domain-containing protein | 0.9863 | 1 | 76 |
|
| AF-A0A3D3VAC9-F1-model_v4 | Glutathione S-transferase | 0.9809 | 2 | 138 |
GO:0004364
GO:0006749 |
| AF-A0A2H6AS68-F1-model_v4 | Glutathione S-transferase GstB (EC 2.5.1.18) | 0.9796 | 1 | 207 |
GO:0004364
|
| AF-A0A520NSW7-F1-model_v4 | Glutathione S-transferase family protein | 0.9787 | 1 | 207 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar