F488122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1010 | 436 | 1003 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0527779|Ga0466969_0527779_16_486 |
| Length | 156 |
| Sequence | MPRHGPALVARRFFPLVDSACPQETNVIDHTGVTVSDFQASKRFYTNALAPIGYELLREFPASVTGHTDVAGFGADGVADFWLSKGTPNDPPIHIAFRAKDRGQVDAFYAAAIAAGGKDNGKPGLRPHYHANYYGAFVLDPDGHNVEAVCHDDPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 2 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 3 | 2904699407 | |||
| 4 | 2922425934 | |||
| 5 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 102 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 103 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 104 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 136 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 137 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 138 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 139 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 251 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 414 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 418 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 428 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 431 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 434 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 435 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 436 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.3 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.21 |
| Nodule | 1.78 |
| Rhizoplane | 7.13 |
| Rhizosphere | 76.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1011817 | 3300001904 | Bacteria | 1418 |
| 2 | JGI25165J46597_1025647 | 3300003214 | Bacteria | 764 |
| 3 | JGI25165J46597_1029114 | 3300003214 | Bacteria | 713 |
| 4 | JGI25160J50197_1004632 | 3300003354 | Bacteria | 5911 |
| 5 | JGI25404J52841_10005705 | 3300003659 | Bacteria | 2576 |
| 6 | JGI25404J52841_10025828 | 3300003659 | Bacteria | 1264 |
| 7 | JGI25404J52841_10033067 | 3300003659 | Bacteria | 1102 |
| 8 | JGI25404J52841_10084342 | 3300003659 | Bacteria | 664 |
| 9 | JGI25404J52841_10102911 | 3300003659 | Bacteria | 599 |
| 10 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 11 | Ga0055542_1013422 | 3300003762 | Bacteria | 1377 |
| 12 | Ga0055529_1008771 | 3300003763 | Bacteria | 1339 |
| 13 | Ga0065165_1090711 | 3300005262 | Bacteria | 778 |
| 14 | Ga0070658_10033059 | 3300005327 | Bacteria | 4160 |
| 15 | Ga0070658_10199322 | 3300005327 | Bacteria | 1688 |
| 16 | Ga0070676_10249349 | 3300005328 | Bacteria | 1184 |
| 17 | Ga0070683_100064888 | 3300005329 | Bacteria | 3399 |
| 18 | Ga0070690_100088359 | 3300005330 | Bacteria | 2037 |
| 19 | Ga0070690_100707735 | 3300005330 | Bacteria | 774 |
| 20 | Ga0070670_100000064 | 3300005331 | Bacteria | 110044 |
| 21 | Ga0070670_100114975 | 3300005331 | Bacteria | 2320 |
| 22 | Ga0070670_100813020 | 3300005331 | Bacteria | 844 |
| 23 | Ga0068869_100199707 | 3300005334 | Bacteria | 1576 |
| 24 | Ga0068869_100378826 | 3300005334 | Bacteria | 1159 |
| 25 | Ga0068869_100401758 | 3300005334 | Bacteria | 1127 |
| 26 | Ga0070666_10009187 | 3300005335 | Bacteria | 6162 |
| 27 | Ga0070666_10024946 | 3300005335 | Bacteria | 3897 |
| 28 | Ga0070666_10330618 | 3300005335 | Bacteria | 1088 |
| 29 | Ga0070666_10331253 | 3300005335 | Bacteria | 1087 |
| 30 | Ga0068868_100093315 | 3300005338 | Bacteria | 2427 |
| 31 | Ga0068868_100133802 | 3300005338 | Bacteria | 2031 |
| 32 | Ga0068868_100158320 | 3300005338 | Bacteria | 1869 |
| 33 | Ga0068868_101251026 | 3300005338 | Bacteria | 688 |
| 34 | Ga0068868_101828918 | 3300005338 | Bacteria | 574 |
| 35 | Ga0070660_100199989 | 3300005339 | Bacteria | 1621 |
| 36 | Ga0070660_100324698 | 3300005339 | Bacteria | 1265 |
| 37 | Ga0070660_100884065 | 3300005339 | Bacteria | 753 |
| 38 | Ga0070689_100000218 | 3300005340 | Bacteria | 34123 |
| 39 | Ga0070689_100241800 | 3300005340 | Bacteria | 1487 |
| 40 | Ga0070691_10093764 | 3300005341 | Bacteria | 1483 |
| 41 | Ga0070691_10162486 | 3300005341 | Bacteria | 1152 |
| 42 | Ga0070687_100042940 | 3300005343 | Bacteria | 2294 |
| 43 | Ga0070687_100553150 | 3300005343 | Bacteria | 783 |
| 44 | Ga0070661_100131921 | 3300005344 | Bacteria | 1877 |
| 45 | Ga0070661_100150817 | 3300005344 | Bacteria | 1757 |
| 46 | Ga0070668_100010504 | 3300005347 | Bacteria | 6882 |
| 47 | Ga0070668_100191400 | 3300005347 | Bacteria | 1676 |
| 48 | Ga0070668_100841909 | 3300005347 | Bacteria | 817 |
| 49 | Ga0070669_100008388 | 3300005353 | Bacteria | 7373 |
| 50 | Ga0070669_100273198 | 3300005353 | Bacteria | 1352 |
| 51 | Ga0070675_100313891 | 3300005354 | Bacteria | 1384 |
| 52 | Ga0070675_100745309 | 3300005354 | Bacteria | 893 |
| 53 | Ga0070675_100909457 | 3300005354 | Bacteria | 807 |
| 54 | Ga0070671_100000025 | 3300005355 | Bacteria | 121912 |
| 55 | Ga0070671_100076587 | 3300005355 | Bacteria | 2795 |
| 56 | Ga0070674_100017006 | 3300005356 | Bacteria | 4566 |
| 57 | Ga0070674_100308270 | 3300005356 | Bacteria | 1265 |
| 58 | Ga0070673_100140442 | 3300005364 | Bacteria | 2037 |
| 59 | Ga0070673_101156388 | 3300005364 | Bacteria | 724 |
| 60 | Ga0070688_100124152 | 3300005365 | Bacteria | 1733 |
| 61 | Ga0070659_100796319 | 3300005366 | Bacteria | 822 |
| 62 | Ga0070659_101972830 | 3300005366 | Bacteria | 524 |
| 63 | Ga0070667_100000095 | 3300005367 | Bacteria | 109595 |
| 64 | Ga0070667_100056278 | 3300005367 | Bacteria | 3322 |
| 65 | Ga0070667_100140477 | 3300005367 | Bacteria | 2114 |
| 66 | Ga0070667_100384601 | 3300005367 | Bacteria | 1275 |
| 67 | Ga0070667_101269099 | 3300005367 | Bacteria | 690 |
| 68 | Ga0070709_10719820 | 3300005434 | Bacteria | 778 |
| 69 | Ga0070709_10814407 | 3300005434 | Bacteria | 734 |
| 70 | Ga0070714_100457006 | 3300005435 | Bacteria | 1214 |
| 71 | Ga0070714_102044108 | 3300005435 | Bacteria | 559 |
| 72 | Ga0070701_10204175 | 3300005438 | Bacteria | 1170 |
| 73 | Ga0070701_10536984 | 3300005438 | Bacteria | 765 |
| 74 | Ga0070701_10698486 | 3300005438 | Bacteria | 682 |
| 75 | Ga0070705_100928012 | 3300005440 | Bacteria | 702 |
| 76 | Ga0070700_100307204 | 3300005441 | Bacteria | 1160 |
| 77 | Ga0070700_101038432 | 3300005441 | Bacteria | 676 |
| 78 | Ga0070694_100129946 | 3300005444 | Bacteria | 1818 |
| 79 | Ga0070694_100149770 | 3300005444 | Bacteria | 1703 |
| 80 | Ga0070708_100096040 | 3300005445 | Bacteria | 2707 |
| 81 | Ga0070663_100003997 | 3300005455 | Bacteria | 8599 |
| 82 | Ga0070663_100096127 | 3300005455 | Bacteria | 2203 |
| 83 | Ga0070663_100194344 | 3300005455 | Bacteria | 1581 |
| 84 | Ga0070663_100214406 | 3300005455 | Bacteria | 1509 |
| 85 | Ga0070663_100285031 | 3300005455 | Bacteria | 1317 |
| 86 | Ga0070663_100878201 | 3300005455 | Bacteria | 773 |
| 87 | Ga0070663_101172429 | 3300005455 | Bacteria | 674 |
| 88 | Ga0070663_101671141 | 3300005455 | Bacteria | 569 |
| 89 | Ga0070678_100045346 | 3300005456 | Bacteria | 3145 |
| 90 | Ga0070662_100143187 | 3300005457 | Bacteria | 1855 |
| 91 | Ga0070662_100190696 | 3300005457 | Bacteria | 1621 |
| 92 | Ga0070662_100614437 | 3300005457 | Bacteria | 915 |
| 93 | Ga0068867_100612459 | 3300005459 | Bacteria | 951 |
| 94 | Ga0070685_10000005 | 3300005466 | Bacteria | 190119 |
| 95 | Ga0070685_10001102 | 3300005466 | Bacteria | 14437 |
| 96 | Ga0070685_10067843 | 3300005466 | Bacteria | 2105 |
| 97 | Ga0070685_10213706 | 3300005466 | Bacteria | 1260 |
| 98 | Ga0070707_100887752 | 3300005468 | Bacteria | 856 |
| 99 | Ga0070699_100280999 | 3300005518 | Bacteria | 1491 |
| 100 | Ga0070699_100521664 | 3300005518 | Bacteria | 1080 |
| 101 | Ga0070684_100012771 | 3300005535 | Bacteria | 6745 |
| 102 | Ga0070684_100573414 | 3300005535 | Bacteria | 1048 |
| 103 | Ga0070697_100224933 | 3300005536 | Bacteria | 1600 |
| 104 | Ga0068853_100032986 | 3300005539 | Bacteria | 4390 |
| 105 | Ga0068853_100316025 | 3300005539 | Bacteria | 1447 |
| 106 | Ga0068853_100756326 | 3300005539 | Bacteria | 929 |
| 107 | Ga0070672_100641985 | 3300005543 | Bacteria | 927 |
| 108 | Ga0070695_100062134 | 3300005545 | Bacteria | 2425 |
| 109 | Ga0070695_100070751 | 3300005545 | Bacteria | 2283 |
| 110 | Ga0070696_100729516 | 3300005546 | Bacteria | 810 |
| 111 | Ga0070665_100003534 | 3300005548 | Bacteria | 16618 |
| 112 | Ga0070665_100037379 | 3300005548 | Bacteria | 4883 |
| 113 | Ga0070665_100130649 | 3300005548 | Bacteria | 2513 |
| 114 | Ga0070665_100167983 | 3300005548 | Bacteria | 2196 |
| 115 | Ga0070665_100212527 | 3300005548 | Bacteria | 1935 |
| 116 | Ga0070665_100574111 | 3300005548 | Bacteria | 1140 |
| 117 | Ga0070704_100030715 | 3300005549 | Bacteria | 3603 |
| 118 | Ga0068855_100271538 | 3300005563 | Bacteria | 1886 |
| 119 | Ga0068855_100549226 | 3300005563 | Bacteria | 1251 |
| 120 | Ga0068855_101543241 | 3300005563 | Bacteria | 681 |
| 121 | Ga0068855_101712331 | 3300005563 | Bacteria | 641 |
| 122 | Ga0070664_100062488 | 3300005564 | Bacteria | 3175 |
| 123 | Ga0070664_100245222 | 3300005564 | Bacteria | 1609 |
| 124 | Ga0070664_100378305 | 3300005564 | Bacteria | 1292 |
| 125 | Ga0070664_101062645 | 3300005564 | Bacteria | 762 |
| 126 | Ga0070664_101373258 | 3300005564 | Bacteria | 668 |
| 127 | Ga0068857_100884596 | 3300005577 | Bacteria | 856 |
| 128 | Ga0068857_100927161 | 3300005577 | Bacteria | 836 |
| 129 | Ga0068854_100033413 | 3300005578 | Bacteria | 3586 |
| 130 | Ga0068854_100747574 | 3300005578 | Bacteria | 848 |
| 131 | Ga0068856_100071936 | 3300005614 | Bacteria | 3424 |
| 132 | Ga0068856_100545639 | 3300005614 | Bacteria | 1180 |
| 133 | Ga0068856_100734886 | 3300005614 | Bacteria | 1007 |
| 134 | Ga0068856_100944819 | 3300005614 | Bacteria | 881 |
| 135 | Ga0068856_101207148 | 3300005614 | Bacteria | 773 |
| 136 | Ga0070702_101091014 | 3300005615 | Bacteria | 637 |
| 137 | Ga0068852_100018450 | 3300005616 | Bacteria | 5497 |
| 138 | Ga0068852_100099851 | 3300005616 | Bacteria | 2617 |
| 139 | Ga0068852_101093894 | 3300005616 | Bacteria | 817 |
| 140 | Ga0068852_101099323 | 3300005616 | Bacteria | 815 |
| 141 | Ga0068859_100121233 | 3300005617 | Bacteria | 2681 |
| 142 | Ga0068859_100593838 | 3300005617 | Bacteria | 1201 |
| 143 | Ga0068859_100757110 | 3300005617 | Bacteria | 1060 |
| 144 | Ga0068859_101236919 | 3300005617 | Bacteria | 822 |
| 145 | Ga0068864_100000073 | 3300005618 | Bacteria | 109681 |
| 146 | Ga0068864_100357216 | 3300005618 | Bacteria | 1380 |
| 147 | Ga0068866_10138942 | 3300005718 | Bacteria | 1392 |
| 148 | Ga0068866_10184305 | 3300005718 | Bacteria | 1235 |
| 149 | Ga0068866_10208917 | 3300005718 | Bacteria | 1171 |
| 150 | Ga0068866_10292221 | 3300005718 | Bacteria | 1014 |
| 151 | Ga0068861_100006933 | 3300005719 | Bacteria | 7738 |
| 152 | Ga0068861_100010562 | 3300005719 | Bacteria | 6411 |
| 153 | Ga0068861_100025418 | 3300005719 | Bacteria | 4295 |
| 154 | Ga0068861_101062731 | 3300005719 | Bacteria | 776 |
| 155 | Ga0068851_10006423 | 3300005834 | Bacteria | 5366 |
| 156 | Ga0068870_10616860 | 3300005840 | Bacteria | 739 |
| 157 | Ga0068863_100117351 | 3300005841 | Bacteria | 2536 |
| 158 | Ga0068863_100127838 | 3300005841 | Bacteria | 2425 |
| 159 | Ga0068858_100002044 | 3300005842 | Bacteria | 20565 |
| 160 | Ga0068858_100053469 | 3300005842 | Bacteria | 3735 |
| 161 | Ga0068858_100141230 | 3300005842 | Bacteria | 2261 |
| 162 | Ga0068858_100244294 | 3300005842 | Bacteria | 1704 |
| 163 | Ga0068858_100341605 | 3300005842 | Bacteria | 1433 |
| 164 | Ga0068858_100611462 | 3300005842 | Bacteria | 1058 |
| 165 | Ga0068858_100660045 | 3300005842 | Bacteria | 1016 |
| 166 | Ga0068858_101954832 | 3300005842 | Bacteria | 580 |
| 167 | Ga0068860_100002476 | 3300005843 | Bacteria | 19371 |
| 168 | Ga0068860_100354647 | 3300005843 | Bacteria | 1444 |
| 169 | Ga0068860_100400160 | 3300005843 | Bacteria | 1358 |
| 170 | Ga0068860_100466032 | 3300005843 | Bacteria | 1258 |
| 171 | Ga0068860_100585771 | 3300005843 | Bacteria | 1120 |
| 172 | Ga0068860_101569913 | 3300005843 | Bacteria | 680 |
| 173 | Ga0068862_100018007 | 3300005844 | Bacteria | 5885 |
| 174 | Ga0068862_100269758 | 3300005844 | Bacteria | 1556 |
| 175 | Ga0068862_100369457 | 3300005844 | Bacteria | 1335 |
| 176 | Ga0068862_100706392 | 3300005844 | Bacteria | 977 |
| 177 | Ga0081455_10066073 | 3300005937 | Bacteria | 3022 |
| 178 | Ga0081455_10427031 | 3300005937 | Bacteria | 912 |
| 179 | Ga0081538_10001222 | 3300005981 | Bacteria | 26967 |
| 180 | Ga0081540_1006755 | 3300005983 | Bacteria | 8296 |
| 181 | Ga0081540_1014175 | 3300005983 | Bacteria | 5128 |
| 182 | Ga0081540_1015865 | 3300005983 | Bacteria | 4748 |
| 183 | Ga0081540_1063026 | 3300005983 | Bacteria | 1757 |
| 184 | Ga0081540_1099549 | 3300005983 | Bacteria | 1256 |
| 185 | Ga0081540_1132526 | 3300005983 | Bacteria | 1015 |
| 186 | Ga0081540_1205164 | 3300005983 | Bacteria | 713 |
| 187 | Ga0081539_10138687 | 3300005985 | Bacteria | 1184 |
| 188 | Ga0070717_11989392 | 3300006028 | Bacteria | 524 |
| 189 | Ga0075365_10059701 | 3300006038 | Bacteria | 2543 |
| 190 | Ga0075365_10111571 | 3300006038 | Bacteria | 1879 |
| 191 | Ga0075365_10226698 | 3300006038 | Bacteria | 1311 |
| 192 | Ga0075365_10300975 | 3300006038 | Bacteria | 1129 |
| 193 | Ga0075365_10464055 | 3300006038 | Bacteria | 894 |
| 194 | Ga0075368_10006038 | 3300006042 | Bacteria | 4206 |
| 195 | Ga0075363_100226531 | 3300006048 | Bacteria | 1072 |
| 196 | Ga0075363_100277487 | 3300006048 | Bacteria | 969 |
| 197 | Ga0075364_10030335 | 3300006051 | Bacteria | 3470 |
| 198 | Ga0075364_10236613 | 3300006051 | Bacteria | 1240 |
| 199 | Ga0075364_10619061 | 3300006051 | Bacteria | 740 |
| 200 | Ga0070715_10306164 | 3300006163 | Bacteria | 852 |
| 201 | Ga0070716_100562523 | 3300006173 | Bacteria | 852 |
| 202 | Ga0075362_10022671 | 3300006177 | Bacteria | 2648 |
| 203 | Ga0075362_10110744 | 3300006177 | Bacteria | 1292 |
| 204 | Ga0075367_10563272 | 3300006178 | Bacteria | 724 |
| 205 | Ga0075369_10034622 | 3300006186 | Bacteria | 2144 |
| 206 | Ga0075369_10088562 | 3300006186 | Bacteria | 1379 |
| 207 | Ga0075366_10047140 | 3300006195 | Bacteria | 2554 |
| 208 | Ga0075366_10545116 | 3300006195 | Bacteria | 718 |
| 209 | Ga0075366_10937820 | 3300006195 | Bacteria | 539 |
| 210 | Ga0097621_100056117 | 3300006237 | Bacteria | 3217 |
| 211 | Ga0097621_100056680 | 3300006237 | Bacteria | 3202 |
| 212 | Ga0097621_102049946 | 3300006237 | Bacteria | 547 |
| 213 | Ga0075370_10229335 | 3300006353 | Bacteria | 1099 |
| 214 | Ga0075370_10668263 | 3300006353 | Bacteria | 631 |
| 215 | Ga0068871_100376434 | 3300006358 | Bacteria | 1260 |
| 216 | Ga0068871_100848913 | 3300006358 | Bacteria | 844 |
| 217 | Ga0068871_101017249 | 3300006358 | Unclassified | 772 |
| 218 | Ga0075428_100007957 | 3300006844 | Bacteria | 11759 |
| 219 | Ga0075428_100092034 | 3300006844 | Bacteria | 3306 |
| 220 | Ga0075428_100956125 | 3300006844 | Bacteria | 908 |
| 221 | Ga0075428_102026561 | 3300006844 | Bacteria | 596 |
| 222 | Ga0075430_100058369 | 3300006846 | Bacteria | 3244 |
| 223 | Ga0075430_100139627 | 3300006846 | Bacteria | 2018 |
| 224 | Ga0075430_100677977 | 3300006846 | Bacteria | 850 |
| 225 | Ga0075430_101640919 | 3300006846 | Bacteria | 528 |
| 226 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 227 | Ga0075431_100073780 | 3300006847 | Bacteria | 3521 |
| 228 | Ga0075431_100717136 | 3300006847 | Bacteria | 977 |
| 229 | Ga0075433_10446718 | 3300006852 | Bacteria | 1140 |
| 230 | Ga0075433_10458333 | 3300006852 | Unclassified | 1124 |
| 231 | Ga0075434_100252281 | 3300006871 | Bacteria | 1784 |
| 232 | Ga0075434_101285425 | 3300006871 | Bacteria | 743 |
| 233 | Ga0075429_100086645 | 3300006880 | Bacteria | 2729 |
| 234 | Ga0068865_100140089 | 3300006881 | Bacteria | 1823 |
| 235 | Ga0068865_100584611 | 3300006881 | Bacteria | 942 |
| 236 | Ga0068865_101821739 | 3300006881 | Bacteria | 550 |
| 237 | Ga0097620_100121240 | 3300006931 | Bacteria | 2681 |
| 238 | Ga0097620_100593852 | 3300006931 | Bacteria | 1201 |
| 239 | Ga0097620_100757015 | 3300006931 | Bacteria | 1060 |
| 240 | Ga0097620_101236923 | 3300006931 | Bacteria | 822 |
| 241 | Ga0099825_1034203 | 3300006941 | Bacteria | 1909 |
| 242 | Ga0099824_1008295 | 3300006942 | Bacteria | 13346 |
| 243 | Ga0099822_1047693 | 3300006943 | Bacteria | 1936 |
| 244 | Ga0099823_1082188 | 3300006944 | Bacteria | 1225 |
| 245 | Ga0099823_1128175 | 3300006944 | Bacteria | 622 |
| 246 | Ga0075435_100135066 | 3300007076 | Bacteria | 2066 |
| 247 | Ga0075435_100265617 | 3300007076 | Bacteria | 1463 |
| 248 | Ga0075435_100265959 | 3300007076 | Bacteria | 1462 |
| 249 | Ga0075435_100409109 | 3300007076 | Bacteria | 1167 |
| 250 | Ga0075435_100419858 | 3300007076 | Bacteria | 1152 |
| 251 | Ga0105250_10171171 | 3300009092 | Bacteria | 909 |
| 252 | Ga0105240_10000450 | 3300009093 | Bacteria | 75626 |
| 253 | Ga0105240_10005199 | 3300009093 | Bacteria | 19472 |
| 254 | Ga0105240_10117376 | 3300009093 | Bacteria | 3208 |
| 255 | Ga0105240_10208055 | 3300009093 | Bacteria | 2288 |
| 256 | Ga0105240_10330563 | 3300009093 | Bacteria | 1734 |
| 257 | Ga0105240_10727977 | 3300009093 | Bacteria | 1080 |
| 258 | Ga0105240_11099260 | 3300009093 | Bacteria | 846 |
| 259 | Ga0105240_12709916 | 3300009093 | Bacteria | 511 |
| 260 | Ga0111539_10000504 | 3300009094 | Bacteria | 49771 |
| 261 | Ga0111539_10042598 | 3300009094 | Bacteria | 5449 |
| 262 | Ga0111539_10082019 | 3300009094 | Bacteria | 3793 |
| 263 | Ga0111539_10182458 | 3300009094 | Bacteria | 2451 |
| 264 | Ga0111539_10188945 | 3300009094 | Bacteria | 2404 |
| 265 | Ga0111539_10389385 | 3300009094 | Bacteria | 1623 |
| 266 | Ga0111539_11317867 | 3300009094 | Bacteria | 838 |
| 267 | Ga0105247_10015814 | 3300009101 | Bacteria | 4516 |
| 268 | Ga0105247_10026444 | 3300009101 | Bacteria | 3504 |
| 269 | Ga0105247_10299937 | 3300009101 | Bacteria | 1114 |
| 270 | Ga0105247_11223096 | 3300009101 | Bacteria | 599 |
| 271 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 272 | Ga0114129_10126638 | 3300009147 | Bacteria | 3511 |
| 273 | Ga0114129_10443960 | 3300009147 | Bacteria | 1703 |
| 274 | Ga0105243_10044750 | 3300009148 | Bacteria | 3475 |
| 275 | Ga0105243_10092482 | 3300009148 | Bacteria | 2494 |
| 276 | Ga0105243_10145212 | 3300009148 | Bacteria | 2029 |
| 277 | Ga0105241_10067148 | 3300009174 | Bacteria | 2775 |
| 278 | Ga0105241_10092165 | 3300009174 | Bacteria | 2392 |
| 279 | Ga0105241_10134050 | 3300009174 | Bacteria | 2009 |
| 280 | Ga0105241_10367629 | 3300009174 | Bacteria | 1253 |
| 281 | Ga0105241_10559150 | 3300009174 | Bacteria | 1028 |
| 282 | Ga0105241_11772787 | 3300009174 | Bacteria | 602 |
| 283 | Ga0105242_10241965 | 3300009176 | Bacteria | 1623 |
| 284 | Ga0105242_10420308 | 3300009176 | Bacteria | 1252 |
| 285 | Ga0105248_10120204 | 3300009177 | Bacteria | 2963 |
| 286 | Ga0105248_10188067 | 3300009177 | Bacteria | 2327 |
| 287 | Ga0105248_10221684 | 3300009177 | Bacteria | 2129 |
| 288 | Ga0105248_10361332 | 3300009177 | Bacteria | 1635 |
| 289 | Ga0105237_10003771 | 3300009545 | Bacteria | 17843 |
| 290 | Ga0105237_10009728 | 3300009545 | Bacteria | 10286 |
| 291 | Ga0105237_10051692 | 3300009545 | Bacteria | 4127 |
| 292 | Ga0105237_10099929 | 3300009545 | Bacteria | 2892 |
| 293 | Ga0105237_10200368 | 3300009545 | Bacteria | 1996 |
| 294 | Ga0105237_11902621 | 3300009545 | Bacteria | 603 |
| 295 | Ga0105237_12028378 | 3300009545 | Bacteria | 584 |
| 296 | Ga0105238_10002042 | 3300009551 | Bacteria | 20365 |
| 297 | Ga0105238_10013642 | 3300009551 | Bacteria | 8205 |
| 298 | Ga0105238_10205129 | 3300009551 | Bacteria | 1947 |
| 299 | Ga0105238_10274416 | 3300009551 | Bacteria | 1667 |
| 300 | Ga0105238_11976296 | 3300009551 | Bacteria | 617 |
| 301 | Ga0105249_10046667 | 3300009553 | Bacteria | 3943 |
| 302 | Ga0105249_10129837 | 3300009553 | Bacteria | 2404 |
| 303 | Ga0105249_10152947 | 3300009553 | Bacteria | 2223 |
| 304 | Ga0105249_10177317 | 3300009553 | Bacteria | 2071 |
| 305 | Ga0105249_10249014 | 3300009553 | Bacteria | 1761 |
| 306 | Ga0105249_11086502 | 3300009553 | Bacteria | 870 |
| 307 | Ga0105249_11116190 | 3300009553 | Bacteria | 859 |
| 308 | Ga0105249_11878063 | 3300009553 | Bacteria | 672 |
| 309 | Ga0105239_10014317 | 3300010375 | Bacteria | 8800 |
| 310 | Ga0105239_10027503 | 3300010375 | Bacteria | 6259 |
| 311 | Ga0105239_10070819 | 3300010375 | Bacteria | 3830 |
| 312 | Ga0105239_10247145 | 3300010375 | Bacteria | 2003 |
| 313 | Ga0105239_10284074 | 3300010375 | Bacteria | 1863 |
| 314 | Ga0105239_10614361 | 3300010375 | Bacteria | 1240 |
| 315 | Ga0105239_10903292 | 3300010375 | Bacteria | 1014 |
| 316 | Ga0105239_10964878 | 3300010375 | Bacteria | 980 |
| 317 | Ga0105239_11400150 | 3300010375 | Bacteria | 807 |
| 318 | Ga0105246_10072093 | 3300011119 | Bacteria | 2434 |
| 319 | Ga0105246_10766471 | 3300011119 | Bacteria | 853 |
| 320 | Ga0105246_11212336 | 3300011119 | Bacteria | 695 |
| 321 | Ga0105246_11257500 | 3300011119 | Bacteria | 684 |
| 322 | Ga0157370_10064289 | 3300013104 | Bacteria | 3474 |
| 323 | Ga0157369_10000197 | 3300013105 | Bacteria | 84466 |
| 324 | Ga0157369_10059628 | 3300013105 | Bacteria | 4115 |
| 325 | Ga0157369_10389073 | 3300013105 | Bacteria | 1447 |
| 326 | Ga0157374_10027203 | 3300013296 | Bacteria | 5156 |
| 327 | Ga0157374_10061313 | 3300013296 | Bacteria | 3522 |
| 328 | Ga0157374_10135048 | 3300013296 | Bacteria | 2391 |
| 329 | Ga0157374_10514557 | 3300013296 | Bacteria | 1202 |
| 330 | Ga0157374_10724610 | 3300013296 | Unclassified | 1008 |
| 331 | Ga0157374_10793288 | 3300013296 | Bacteria | 963 |
| 332 | Ga0157378_10089921 | 3300013297 | Bacteria | 2790 |
| 333 | Ga0157378_10959786 | 3300013297 | Bacteria | 888 |
| 334 | Ga0157378_11713876 | 3300013297 | Bacteria | 676 |
| 335 | Ga0163162_10483629 | 3300013306 | Bacteria | 1369 |
| 336 | Ga0163162_11182607 | 3300013306 | Bacteria | 867 |
| 337 | Ga0163162_11572114 | 3300013306 | Bacteria | 750 |
| 338 | Ga0157372_10120789 | 3300013307 | Bacteria | 3009 |
| 339 | Ga0157372_10219224 | 3300013307 | Bacteria | 2205 |
| 340 | Ga0157372_10499714 | 3300013307 | Bacteria | 1418 |
| 341 | Ga0157372_13322672 | 3300013307 | Bacteria | 512 |
| 342 | Ga0157375_10122777 | 3300013308 | Bacteria | 2709 |
| 343 | Ga0157375_10554349 | 3300013308 | Bacteria | 1311 |
| 344 | Ga0157375_10641208 | 3300013308 | Bacteria | 1219 |
| 345 | Ga0157375_10689452 | 3300013308 | Bacteria | 1176 |
| 346 | Ga0157375_11185549 | 3300013308 | Bacteria | 895 |
| 347 | Ga0157375_12376244 | 3300013308 | Unclassified | 632 |
| 348 | Ga0157375_12552730 | 3300013308 | Bacteria | 610 |
| 349 | Ga0163163_10001573 | 3300014325 | Bacteria | 19239 |
| 350 | Ga0163163_10008737 | 3300014325 | Bacteria | 9015 |
| 351 | Ga0163163_10108419 | 3300014325 | Bacteria | 2804 |
| 352 | Ga0163163_10224424 | 3300014325 | Bacteria | 1928 |
| 353 | Ga0163163_10420667 | 3300014325 | Bacteria | 1395 |
| 354 | Ga0163163_10430406 | 3300014325 | Bacteria | 1379 |
| 355 | Ga0163163_10764936 | 3300014325 | Unclassified | 1029 |
| 356 | Ga0163163_13248336 | 3300014325 | Bacteria | 507 |
| 357 | Ga0157380_10234797 | 3300014326 | Bacteria | 1649 |
| 358 | Ga0157380_10279675 | 3300014326 | Bacteria | 1526 |
| 359 | Ga0157380_11164888 | 3300014326 | Bacteria | 813 |
| 360 | Ga0157379_10095777 | 3300014968 | Bacteria | 2663 |
| 361 | Ga0157379_10129296 | 3300014968 | Bacteria | 2272 |
| 362 | Ga0157379_10271735 | 3300014968 | Bacteria | 1541 |
| 363 | Ga0157379_10600355 | 3300014968 | Bacteria | 1028 |
| 364 | Ga0157379_12065285 | 3300014968 | Bacteria | 564 |
| 365 | Ga0157376_10191623 | 3300014969 | Bacteria | 1875 |
| 366 | Ga0157376_11071391 | 3300014969 | Bacteria | 831 |
| 367 | Ga0157376_11898049 | 3300014969 | Bacteria | 633 |
| 368 | Ga0157376_13126642 | 3300014969 | Bacteria | 501 |
| 369 | Ga0182007_10191258 | 3300015262 | Bacteria | 712 |
| 370 | Ga0163161_10030502 | 3300017792 | Bacteria | 3838 |
| 371 | Ga0163161_10921818 | 3300017792 | Bacteria | 741 |
| 372 | Ga0206356_10810643 | 3300020070 | Bacteria | 2024 |
| 373 | Ga0206353_10858696 | 3300020082 | Bacteria | 6278 |
| 374 | Ga0214542_1040082 | 3300021321 | Bacteria | 1217 |
| 375 | Ga0214545_1049363 | 3300021324 | Bacteria | 865 |
| 376 | Ga0214543_1040892 | 3300021327 | Bacteria | 1218 |
| 377 | Ga0213874_10138503 | 3300021377 | Bacteria | 841 |
| 378 | Ga0213871_10054984 | 3300021441 | Bacteria | 1099 |
| 379 | Ga0224712_10003411 | 3300022467 | Bacteria | 4125 |
| 380 | Ga0209674_107151 | 3300025226 | Bacteria | 1438 |
| 381 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 382 | Ga0209026_1013566 | 3300025250 | Bacteria | 1385 |
| 383 | Ga0209148_1001706 | 3300025254 | Bacteria | 9700 |
| 384 | Ga0209148_1001992 | 3300025254 | Bacteria | 8061 |
| 385 | Ga0209759_1003269 | 3300025256 | Bacteria | 6551 |
| 386 | Ga0209759_1003924 | 3300025256 | Bacteria | 5734 |
| 387 | Ga0209233_1001411 | 3300025261 | Bacteria | 9473 |
| 388 | Ga0209233_1008223 | 3300025261 | Bacteria | 3242 |
| 389 | Ga0209233_1014099 | 3300025261 | Bacteria | 2262 |
| 390 | Ga0209233_1017254 | 3300025261 | Bacteria | 1970 |
| 391 | Ga0209233_1019148 | 3300025261 | Bacteria | 1825 |
| 392 | Ga0209455_1002997 | 3300025272 | Bacteria | 6203 |
| 393 | Ga0209455_1059813 | 3300025272 | Bacteria | 502 |
| 394 | Ga0209130_1042214 | 3300025284 | Bacteria | 874 |
| 395 | Ga0209564_1004981 | 3300025295 | Bacteria | 7824 |
| 396 | Ga0209758_1000397 | 3300025297 | Bacteria | 75408 |
| 397 | Ga0209758_1032773 | 3300025297 | Bacteria | 2102 |
| 398 | Ga0209256_1016929 | 3300025299 | Bacteria | 2453 |
| 399 | Ga0209256_1019562 | 3300025299 | Bacteria | 2150 |
| 400 | Ga0209256_1069455 | 3300025299 | Bacteria | 797 |
| 401 | Ga0207426_1000886 | 3300025302 | Bacteria | 30736 |
| 402 | Ga0209257_1080457 | 3300025304 | Bacteria | 837 |
| 403 | Ga0209257_1124311 | 3300025304 | Bacteria | 599 |
| 404 | Ga0207656_10000840 | 3300025321 | Bacteria | 10031 |
| 405 | Ga0207696_1087903 | 3300025711 | Bacteria | 853 |
| 406 | Ga0207682_10043211 | 3300025893 | Bacteria | 1844 |
| 407 | Ga0207642_10111209 | 3300025899 | Bacteria | 1395 |
| 408 | Ga0207642_10535474 | 3300025899 | Bacteria | 721 |
| 409 | Ga0207710_10006552 | 3300025900 | Bacteria | 4962 |
| 410 | Ga0207710_10097910 | 3300025900 | Bacteria | 1380 |
| 411 | Ga0207710_10217379 | 3300025900 | Unclassified | 948 |
| 412 | Ga0207710_10314277 | 3300025900 | Bacteria | 793 |
| 413 | Ga0207688_10077703 | 3300025901 | Bacteria | 1892 |
| 414 | Ga0207680_10104749 | 3300025903 | Bacteria | 1824 |
| 415 | Ga0207680_10176043 | 3300025903 | Bacteria | 1444 |
| 416 | Ga0207680_10184360 | 3300025903 | Bacteria | 1413 |
| 417 | Ga0207680_10606776 | 3300025903 | Bacteria | 783 |
| 418 | Ga0207647_10000425 | 3300025904 | Bacteria | 34674 |
| 419 | Ga0207647_10007446 | 3300025904 | Bacteria | 7906 |
| 420 | Ga0207647_10211354 | 3300025904 | Bacteria | 1120 |
| 421 | Ga0207647_10400278 | 3300025904 | Bacteria | 773 |
| 422 | Ga0207699_10079206 | 3300025906 | Bacteria | 2032 |
| 423 | Ga0207699_10612949 | 3300025906 | Bacteria | 793 |
| 424 | Ga0207699_10711556 | 3300025906 | Bacteria | 735 |
| 425 | Ga0207705_10453777 | 3300025909 | Bacteria | 994 |
| 426 | Ga0207705_10754123 | 3300025909 | Bacteria | 756 |
| 427 | Ga0207654_10027666 | 3300025911 | Bacteria | 3084 |
| 428 | Ga0207654_10044616 | 3300025911 | Bacteria | 2519 |
| 429 | Ga0207654_10047882 | 3300025911 | Bacteria | 2444 |
| 430 | Ga0207654_10112180 | 3300025911 | Bacteria | 1698 |
| 431 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 432 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 433 | Ga0207695_10099021 | 3300025913 | Bacteria | 2914 |
| 434 | Ga0207695_10398335 | 3300025913 | Bacteria | 1261 |
| 435 | Ga0207695_10492398 | 3300025913 | Bacteria | 1108 |
| 436 | Ga0207695_10716574 | 3300025913 | Bacteria | 881 |
| 437 | Ga0207671_10002713 | 3300025914 | Bacteria | 18544 |
| 438 | Ga0207671_10030308 | 3300025914 | Bacteria | 4035 |
| 439 | Ga0207671_10151361 | 3300025914 | Bacteria | 1792 |
| 440 | Ga0207671_10213059 | 3300025914 | Bacteria | 1512 |
| 441 | Ga0207660_11213746 | 3300025917 | Bacteria | 613 |
| 442 | Ga0207657_10026602 | 3300025919 | Bacteria | 5312 |
| 443 | Ga0207657_10127631 | 3300025919 | Bacteria | 2087 |
| 444 | Ga0207657_10560766 | 3300025919 | Bacteria | 893 |
| 445 | Ga0207649_10286618 | 3300025920 | Bacteria | 1199 |
| 446 | Ga0207649_10771306 | 3300025920 | Bacteria | 749 |
| 447 | Ga0207649_11068713 | 3300025920 | Bacteria | 636 |
| 448 | Ga0207646_10780842 | 3300025922 | Bacteria | 851 |
| 449 | Ga0207681_10059988 | 3300025923 | Bacteria | 2609 |
| 450 | Ga0207694_10001186 | 3300025924 | Bacteria | 22567 |
| 451 | Ga0207694_10166327 | 3300025924 | Bacteria | 1784 |
| 452 | Ga0207650_10000106 | 3300025925 | Bacteria | 110058 |
| 453 | Ga0207650_10085997 | 3300025925 | Bacteria | 2393 |
| 454 | Ga0207659_10217534 | 3300025926 | Bacteria | 1534 |
| 455 | Ga0207659_10987038 | 3300025926 | Bacteria | 724 |
| 456 | Ga0207659_10987391 | 3300025926 | Bacteria | 724 |
| 457 | Ga0207659_11271871 | 3300025926 | Bacteria | 632 |
| 458 | Ga0207687_10147173 | 3300025927 | Bacteria | 1793 |
| 459 | Ga0207687_10192006 | 3300025927 | Bacteria | 1590 |
| 460 | Ga0207700_11939193 | 3300025928 | Bacteria | 515 |
| 461 | Ga0207644_10000049 | 3300025931 | Bacteria | 95260 |
| 462 | Ga0207644_10152295 | 3300025931 | Bacteria | 1790 |
| 463 | Ga0207644_10764961 | 3300025931 | Bacteria | 807 |
| 464 | Ga0207690_10044661 | 3300025932 | Bacteria | 2922 |
| 465 | Ga0207690_10374053 | 3300025932 | Bacteria | 1131 |
| 466 | Ga0207706_10011818 | 3300025933 | Bacteria | 7951 |
| 467 | Ga0207706_10168661 | 3300025933 | Bacteria | 1924 |
| 468 | Ga0207706_10347683 | 3300025933 | Bacteria | 1289 |
| 469 | Ga0207706_10503785 | 3300025933 | Bacteria | 1045 |
| 470 | Ga0207706_11389754 | 3300025933 | Bacteria | 577 |
| 471 | Ga0207686_10153635 | 3300025934 | Bacteria | 1605 |
| 472 | Ga0207709_10118512 | 3300025935 | Bacteria | 1783 |
| 473 | Ga0207670_10001216 | 3300025936 | Bacteria | 13599 |
| 474 | Ga0207670_11090472 | 3300025936 | Bacteria | 674 |
| 475 | Ga0207669_10025543 | 3300025937 | Bacteria | 3195 |
| 476 | Ga0207669_10488710 | 3300025937 | Bacteria | 983 |
| 477 | Ga0207704_10112245 | 3300025938 | Bacteria | 1846 |
| 478 | Ga0207704_10497220 | 3300025938 | Bacteria | 982 |
| 479 | Ga0207665_10595739 | 3300025939 | Bacteria | 863 |
| 480 | Ga0207691_10107400 | 3300025940 | Bacteria | 2485 |
| 481 | Ga0207691_10174281 | 3300025940 | Bacteria | 1882 |
| 482 | Ga0207711_10000393 | 3300025941 | Bacteria | 46458 |
| 483 | Ga0207711_10181683 | 3300025941 | Bacteria | 1913 |
| 484 | Ga0207689_10139944 | 3300025942 | Bacteria | 1994 |
| 485 | Ga0207689_10238012 | 3300025942 | Bacteria | 1505 |
| 486 | Ga0207689_10384788 | 3300025942 | Bacteria | 1168 |
| 487 | Ga0207689_10485110 | 3300025942 | Bacteria | 1035 |
| 488 | Ga0207689_10617156 | 3300025942 | Bacteria | 913 |
| 489 | Ga0207689_11155791 | 3300025942 | Bacteria | 652 |
| 490 | Ga0207689_11796817 | 3300025942 | Bacteria | 506 |
| 491 | Ga0207661_10049749 | 3300025944 | Bacteria | 3337 |
| 492 | Ga0207679_10156798 | 3300025945 | Bacteria | 1860 |
| 493 | Ga0207679_10207922 | 3300025945 | Bacteria | 1639 |
| 494 | Ga0207679_10348578 | 3300025945 | Bacteria | 1290 |
| 495 | Ga0207679_10404310 | 3300025945 | Bacteria | 1202 |
| 496 | Ga0207679_11125844 | 3300025945 | Bacteria | 720 |
| 497 | Ga0207667_10454558 | 3300025949 | Bacteria | 1301 |
| 498 | Ga0207667_11057383 | 3300025949 | Bacteria | 796 |
| 499 | Ga0207667_11373608 | 3300025949 | Bacteria | 681 |
| 500 | Ga0207651_10989985 | 3300025960 | Bacteria | 751 |
| 501 | Ga0207712_10000291 | 3300025961 | Bacteria | 47334 |
| 502 | Ga0207712_10044794 | 3300025961 | Bacteria | 3060 |
| 503 | Ga0207712_10333673 | 3300025961 | Bacteria | 1255 |
| 504 | Ga0207712_11272880 | 3300025961 | Bacteria | 657 |
| 505 | Ga0207668_10085104 | 3300025972 | Bacteria | 2306 |
| 506 | Ga0207640_10001052 | 3300025981 | Bacteria | 15248 |
| 507 | Ga0207640_10395606 | 3300025981 | Bacteria | 1124 |
| 508 | Ga0207640_10478931 | 3300025981 | Bacteria | 1032 |
| 509 | Ga0207658_10000073 | 3300025986 | Bacteria | 111738 |
| 510 | Ga0207658_10155946 | 3300025986 | Bacteria | 1866 |
| 511 | Ga0207677_10076028 | 3300026023 | Bacteria | 2389 |
| 512 | Ga0207677_10198109 | 3300026023 | Bacteria | 1594 |
| 513 | Ga0207677_10239593 | 3300026023 | Bacteria | 1466 |
| 514 | Ga0207677_10317934 | 3300026023 | Bacteria | 1293 |
| 515 | Ga0207703_10002746 | 3300026035 | Bacteria | 15077 |
| 516 | Ga0207703_10096638 | 3300026035 | Bacteria | 2494 |
| 517 | Ga0207703_10204174 | 3300026035 | Bacteria | 1758 |
| 518 | Ga0207703_10253438 | 3300026035 | Bacteria | 1587 |
| 519 | Ga0207639_10000161 | 3300026041 | Bacteria | 51519 |
| 520 | Ga0207639_10089594 | 3300026041 | Bacteria | 2459 |
| 521 | Ga0207639_10518047 | 3300026041 | Bacteria | 1092 |
| 522 | Ga0207639_10615315 | 3300026041 | Bacteria | 1002 |
| 523 | Ga0207639_11381071 | 3300026041 | Bacteria | 661 |
| 524 | Ga0207678_10005017 | 3300026067 | Bacteria | 11877 |
| 525 | Ga0207678_10142462 | 3300026067 | Bacteria | 2046 |
| 526 | Ga0207678_10217505 | 3300026067 | Bacteria | 1635 |
| 527 | Ga0207678_10240553 | 3300026067 | Bacteria | 1550 |
| 528 | Ga0207678_10328064 | 3300026067 | Bacteria | 1317 |
| 529 | Ga0207678_11484875 | 3300026067 | Bacteria | 598 |
| 530 | Ga0207678_11520632 | 3300026067 | Bacteria | 591 |
| 531 | Ga0207708_10191222 | 3300026075 | Bacteria | 1629 |
| 532 | Ga0207708_10325342 | 3300026075 | Bacteria | 1255 |
| 533 | Ga0207708_11138764 | 3300026075 | Bacteria | 681 |
| 534 | Ga0207702_10107794 | 3300026078 | Bacteria | 2471 |
| 535 | Ga0207702_10112744 | 3300026078 | Bacteria | 2420 |
| 536 | Ga0207702_10201709 | 3300026078 | Bacteria | 1844 |
| 537 | Ga0207702_10216754 | 3300026078 | Bacteria | 1782 |
| 538 | Ga0207702_10224358 | 3300026078 | Bacteria | 1752 |
| 539 | Ga0207702_11003725 | 3300026078 | Bacteria | 828 |
| 540 | Ga0207702_11330873 | 3300026078 | Bacteria | 712 |
| 541 | Ga0207641_10129481 | 3300026088 | Bacteria | 2264 |
| 542 | Ga0207641_10157856 | 3300026088 | Bacteria | 2059 |
| 543 | Ga0207641_10195283 | 3300026088 | Bacteria | 1862 |
| 544 | Ga0207641_10293638 | 3300026088 | Bacteria | 1533 |
| 545 | Ga0207641_10407342 | 3300026088 | Bacteria | 1307 |
| 546 | Ga0207648_10229096 | 3300026089 | Bacteria | 1653 |
| 547 | Ga0207648_10325604 | 3300026089 | Bacteria | 1382 |
| 548 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 549 | Ga0207676_10107939 | 3300026095 | Bacteria | 2323 |
| 550 | Ga0207676_10549397 | 3300026095 | Unclassified | 1103 |
| 551 | Ga0207676_12101890 | 3300026095 | Bacteria | 563 |
| 552 | Ga0207674_10125947 | 3300026116 | Bacteria | 2527 |
| 553 | Ga0207674_10238330 | 3300026116 | Bacteria | 1766 |
| 554 | Ga0207675_100003423 | 3300026118 | Bacteria | 15497 |
| 555 | Ga0207675_100021239 | 3300026118 | Bacteria | 6046 |
| 556 | Ga0207675_100025297 | 3300026118 | Bacteria | 5525 |
| 557 | Ga0207675_100665908 | 3300026118 | Bacteria | 1048 |
| 558 | Ga0207683_10150269 | 3300026121 | Bacteria | 2102 |
| 559 | Ga0207683_10162150 | 3300026121 | Bacteria | 2022 |
| 560 | Ga0207698_10914008 | 3300026142 | Bacteria | 885 |
| 561 | Ga0207698_11040750 | 3300026142 | Bacteria | 830 |
| 562 | Ga0207698_11082097 | 3300026142 | Bacteria | 814 |
| 563 | Ga0209389_1000157 | 3300027296 | Bacteria | 56696 |
| 564 | Ga0209389_1002855 | 3300027296 | Bacteria | 13519 |
| 565 | Ga0209589_1006917 | 3300027357 | Bacteria | 18508 |
| 566 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 567 | Ga0209489_101111 | 3300027361 | Bacteria | 54702 |
| 568 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 569 | Ga0209813_10023191 | 3300027866 | Bacteria | 1763 |
| 570 | Ga0207428_10003737 | 3300027907 | Bacteria | 14610 |
| 571 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 572 | Ga0268266_10189744 | 3300028379 | Bacteria | 1876 |
| 573 | Ga0268266_10371353 | 3300028379 | Bacteria | 1347 |
| 574 | Ga0268266_10751197 | 3300028379 | Unclassified | 941 |
| 575 | Ga0268265_10001308 | 3300028380 | Bacteria | 21377 |
| 576 | Ga0268265_10149880 | 3300028380 | Bacteria | 1966 |
| 577 | Ga0268265_10253139 | 3300028380 | Bacteria | 1561 |
| 578 | Ga0268265_10269682 | 3300028380 | Bacteria | 1518 |
| 579 | Ga0268265_10717852 | 3300028380 | Bacteria | 967 |
| 580 | Ga0268265_10823759 | 3300028380 | Bacteria | 906 |
| 581 | Ga0268265_12143009 | 3300028380 | Bacteria | 566 |
| 582 | Ga0268264_10000123 | 3300028381 | Bacteria | 189361 |
| 583 | Ga0268264_10034371 | 3300028381 | Bacteria | 4170 |
| 584 | Ga0268264_10388154 | 3300028381 | Bacteria | 1339 |
| 585 | Ga0307511_10000923 | 3300030521 | Bacteria | 31061 |
| 586 | Ga0307513_10040464 | 3300031456 | Bacteria | 5153 |
| 587 | Ga0307513_10257961 | 3300031456 | Bacteria | 1535 |
| 588 | Ga0307509_10310000 | 3300031507 | Bacteria | 1321 |
| 589 | Ga0307408_100091188 | 3300031548 | Bacteria | 2301 |
| 590 | Ga0307516_10621194 | 3300031730 | Bacteria | 735 |
| 591 | Ga0307405_11331000 | 3300031731 | Bacteria | 626 |
| 592 | Ga0307409_102150306 | 3300031995 | Bacteria | 588 |
| 593 | Ga0307411_12297872 | 3300032005 | Bacteria | 507 |
| 594 | Ga0307510_10030650 | 3300033180 | Bacteria | 6094 |
| 595 | Ga0307510_10397357 | 3300033180 | Bacteria | 822 |
| 596 | Ga0373928_0095946 | 3300035084 | Bacteria | 767 |
| 597 | Ga0373941_0096459 | 3300035115 | Bacteria | 1023 |
| 598 | Ga0373953_0393845 | 3300035117 | Bacteria | 609 |
| 599 | Ga0373957_0281580 | 3300035120 | Bacteria | 703 |
| 600 | Ga0373960_0318691 | 3300035121 | Bacteria | 582 |
| 601 | Ga0373935_0355102 | 3300035692 | Bacteria | 1046 |
| 602 | Ga0373927_0074339 | 3300035695 | Bacteria | 2200 |
| 603 | Ga0373933_0000068 | 3300035724 | Bacteria | 63195 |
| 604 | Ga0373933_0246808 | 3300035724 | Bacteria | 1149 |
| 605 | Ga0373933_1161355 | 3300035724 | Bacteria | 509 |
| 606 | Ga0373947_0017798 | 3300035725 | Bacteria | 4088 |
| 607 | Ga0373947_0325052 | 3300035725 | Bacteria | 1029 |
| 608 | Ga0373937_0125120 | 3300036401 | Bacteria | 2398 |
| 609 | Ga0373937_1254905 | 3300036401 | Bacteria | 689 |
| 610 | Ga0316584_0860031 | 3300036712 | Bacteria | 613 |
| 611 | Ga0373925_0017902 | 3300037068 | Bacteria | 5143 |
| 612 | Ga0373925_0598776 | 3300037068 | Bacteria | 908 |
| 613 | Ga0395899_0021619 | 3300037312 | Bacteria | 4879 |
| 614 | Ga0395900_0050015 | 3300037418 | Bacteria | 4306 |
| 615 | Ga0395900_0381849 | 3300037418 | Bacteria | 1376 |
| 616 | Ga0395898_1479339 | 3300037466 | Bacteria | 605 |
| 617 | Ga0436364_1404047 | 3300037853 | Bacteria | 889 |
| 618 | Ga0395901_0000173 | 3300038443 | Bacteria | 83610 |
| 619 | Ga0395901_2118230 | 3300038443 | Bacteria | 507 |
| 620 | Ga0436365_0217255 | 3300039437 | Bacteria | 937 |
| 621 | Ga0436365_0362878 | 3300039437 | Bacteria | 535 |
| 622 | Ga0436365_0368099 | 3300039437 | Bacteria | 526 |
| 623 | Ga0436360_0177325 | 3300039438 | Bacteria | 1079 |
| 624 | Ga0436360_0431968 | 3300039438 | Bacteria | 1007 |
| 625 | Ga0436361_1011853 | 3300039447 | Bacteria | 3867 |
| 626 | Ga0436363_1313418 | 3300039450 | Bacteria | 712 |
| 627 | Ga0436363_1540722 | 3300039450 | Bacteria | 908 |
| 628 | Ga0436362_0855659 | 3300039453 | Bacteria | 563 |
| 629 | Ga0436362_1102929 | 3300039453 | Bacteria | 1039 |
| 630 | Ga0439436_0024136 | 3300041404 | Bacteria | 1796 |
| 631 | Ga0439465_0000040 | 3300041413 | Bacteria | 26319 |
| 632 | Ga0451853_1113938 | 3300041512 | Bacteria | 1131 |
| 633 | Ga0451853_2256764 | 3300041512 | Bacteria | 627 |
| 634 | Ga0439431_0212070 | 3300041997 | Bacteria | 567 |
| 635 | Ga0439449_0000398 | 3300042007 | Bacteria | 16106 |
| 636 | Ga0439458_0150967 | 3300042157 | Bacteria | 622 |
| 637 | Ga0439464_0294212 | 3300042439 | Bacteria | 529 |
| 638 | Ga0466969_0007141 | 3300044656 | Bacteria | 5947 |
| 639 | Ga0466969_0527779 | 3300044656 | Bacteria | 539 |
| 640 | Ga0466972_0003163 | 3300044658 | Bacteria | 8175 |
| 641 | Ga0466972_0260021 | 3300044658 | Bacteria | 811 |
| 642 | Ga0466980_0047200 | 3300044668 | Bacteria | 3013 |
| 643 | Ga0466966_0010768 | 3300044684 | Bacteria | 6079 |
| 644 | Ga0466966_0013758 | 3300044684 | Bacteria | 5353 |
| 645 | Ga0466966_0017642 | 3300044684 | Bacteria | 4714 |
| 646 | Ga0466966_0030637 | 3300044684 | Bacteria | 3490 |
| 647 | Ga0466966_0163607 | 3300044684 | Bacteria | 1354 |
| 648 | Ga0466961_0000849 | 3300044693 | Bacteria | 19114 |
| 649 | Ga0466961_0014864 | 3300044693 | Bacteria | 5001 |
| 650 | Ga0466961_0055337 | 3300044693 | Bacteria | 2530 |
| 651 | Ga0466961_0110028 | 3300044693 | Bacteria | 1734 |
| 652 | Ga0466963_0004353 | 3300044694 | Bacteria | 8220 |
| 653 | Ga0466963_0321397 | 3300044694 | Bacteria | 1089 |
| 654 | Ga0466964_0065636 | 3300044706 | Bacteria | 1521 |
| 655 | Ga0466971_0436487 | 3300044719 | Bacteria | 641 |
| 656 | Ga0466968_0080763 | 3300044735 | Bacteria | 1428 |
| 657 | Ga0466968_0311148 | 3300044735 | Bacteria | 759 |
| 658 | Ga0466970_0168601 | 3300044765 | Bacteria | 1213 |
| 659 | Ga0466970_0412746 | 3300044765 | Bacteria | 771 |
| 660 | Ga0466970_0433193 | 3300044765 | Bacteria | 752 |
| 661 | Ga0466959_0009297 | 3300045049 | Bacteria | 6983 |
| 662 | Ga0466959_0017369 | 3300045049 | Bacteria | 5274 |
| 663 | Ga0466959_0017621 | 3300045049 | Bacteria | 5237 |
| 664 | Ga0466959_0025900 | 3300045049 | Bacteria | 4350 |
| 665 | Ga0451576_1071464 | 3300045051 | Bacteria | 844 |
| 666 | Ga0451576_2350413 | 3300045051 | Bacteria | 546 |
| 667 | Ga0466958_0000419 | 3300045836 | Bacteria | 17478 |
| 668 | Ga0466958_0308602 | 3300045836 | Bacteria | 1016 |
| 669 | Ga0466958_0590491 | 3300045836 | Bacteria | 722 |
| 670 | Ga0466958_0624209 | 3300045836 | Bacteria | 701 |
| 671 | Ga0466967_0015071 | 3300045976 | Bacteria | 6048 |
| 672 | Ga0495617_096917 | 3300046452 | Bacteria | 960 |
| 673 | Ga0495592_0380101 | 3300046454 | Bacteria | 899 |
| 674 | Ga0495603_0180118 | 3300046455 | Bacteria | 1223 |
| 675 | Ga0495590_0092190 | 3300046457 | Bacteria | 1072 |
| 676 | Ga0495629_0083216 | 3300046459 | Bacteria | 2233 |
| 677 | Ga0495629_0342721 | 3300046459 | Bacteria | 1020 |
| 678 | Ga0495638_0032658 | 3300046460 | Bacteria | 3334 |
| 679 | Ga0495641_0026237 | 3300046461 | Bacteria | 2845 |
| 680 | Ga0495641_0265799 | 3300046461 | Bacteria | 772 |
| 681 | Ga0495651_0091567 | 3300046462 | Bacteria | 2279 |
| 682 | Ga0495653_0265840 | 3300046463 | Bacteria | 1132 |
| 683 | Ga0495580_0003171 | 3300046472 | Bacteria | 14098 |
| 684 | Ga0495582_0046043 | 3300046473 | Bacteria | 2402 |
| 685 | Ga0495605_0138396 | 3300046474 | Bacteria | 1094 |
| 686 | Ga0495605_0145849 | 3300046474 | Bacteria | 1059 |
| 687 | Ga0495605_0325839 | 3300046474 | Bacteria | 647 |
| 688 | Ga0495639_0008643 | 3300046475 | Bacteria | 4367 |
| 689 | Ga0495639_0317123 | 3300046475 | Bacteria | 779 |
| 690 | Ga0495662_0120272 | 3300046476 | Bacteria | 1289 |
| 691 | Ga0495585_0511405 | 3300046492 | Bacteria | 570 |
| 692 | Ga0495594_0493616 | 3300046499 | Bacteria | 695 |
| 693 | Ga0495596_0096004 | 3300046500 | Bacteria | 1151 |
| 694 | Ga0495596_0254165 | 3300046500 | Bacteria | 682 |
| 695 | Ga0495583_0058267 | 3300046506 | Bacteria | 1734 |
| 696 | Ga0495583_0124159 | 3300046506 | Bacteria | 1084 |
| 697 | Ga0495606_0031017 | 3300046507 | Bacteria | 3722 |
| 698 | Ga0495606_0043113 | 3300046507 | Bacteria | 3012 |
| 699 | Ga0495606_0244358 | 3300046507 | Bacteria | 999 |
| 700 | Ga0495608_0027780 | 3300046511 | Bacteria | 3848 |
| 701 | Ga0495608_0434747 | 3300046511 | Bacteria | 800 |
| 702 | Ga0495610_0076110 | 3300046512 | Bacteria | 1553 |
| 703 | Ga0495616_0030402 | 3300046513 | Bacteria | 2839 |
| 704 | Ga0495616_0150921 | 3300046513 | Bacteria | 1051 |
| 705 | Ga0495616_0201807 | 3300046513 | Bacteria | 874 |
| 706 | Ga0495620_0188813 | 3300046515 | Bacteria | 795 |
| 707 | Ga0495628_0301397 | 3300046516 | Bacteria | 1186 |
| 708 | Ga0495628_0708442 | 3300046516 | Bacteria | 710 |
| 709 | Ga0495632_0300364 | 3300046519 | Bacteria | 712 |
| 710 | Ga0495632_0353539 | 3300046519 | Bacteria | 646 |
| 711 | Ga0495643_0019724 | 3300046522 | Bacteria | 3897 |
| 712 | Ga0495643_0144262 | 3300046522 | Bacteria | 1184 |
| 713 | Ga0495643_0263163 | 3300046522 | Bacteria | 800 |
| 714 | Ga0495644_0138258 | 3300046523 | Bacteria | 930 |
| 715 | Ga0495648_0272860 | 3300046524 | Bacteria | 805 |
| 716 | Ga0495648_0294076 | 3300046524 | Bacteria | 764 |
| 717 | Ga0495648_0461180 | 3300046524 | Bacteria | 553 |
| 718 | Ga0495666_0067795 | 3300046526 | Bacteria | 1700 |
| 719 | Ga0495642_0394757 | 3300046528 | Bacteria | 610 |
| 720 | Ga0495652_0144078 | 3300046529 | Bacteria | 1870 |
| 721 | Ga0495654_0169746 | 3300046530 | Bacteria | 952 |
| 722 | Ga0495665_0023819 | 3300046531 | Bacteria | 3289 |
| 723 | Ga0495640_0065792 | 3300046533 | Bacteria | 2447 |
| 724 | Ga0495587_0104524 | 3300046536 | Bacteria | 1630 |
| 725 | Ga0495609_0209427 | 3300046538 | Bacteria | 813 |
| 726 | Ga0495609_0283019 | 3300046538 | Bacteria | 678 |
| 727 | Ga0495597_0016294 | 3300046542 | Bacteria | 3510 |
| 728 | Ga0495622_0008550 | 3300046557 | Bacteria | 4743 |
| 729 | Ga0495622_0047423 | 3300046557 | Bacteria | 1996 |
| 730 | Ga0495622_0059200 | 3300046557 | Bacteria | 1773 |
| 731 | Ga0495656_0116262 | 3300046615 | Bacteria | 1257 |
| 732 | Ga0495656_0122773 | 3300046615 | Bacteria | 1228 |
| 733 | Ga0495668_0025947 | 3300046616 | Bacteria | 3327 |
| 734 | Ga0495668_0109260 | 3300046616 | Bacteria | 1513 |
| 735 | Ga0495668_0294907 | 3300046616 | Bacteria | 889 |
| 736 | Ga0495634_0295030 | 3300046642 | Bacteria | 981 |
| 737 | Ga0495634_0328065 | 3300046642 | Bacteria | 920 |
| 738 | Ga0495625_0185183 | 3300046660 | Bacteria | 1382 |
| 739 | Ga0495625_0265945 | 3300046660 | Bacteria | 1108 |
| 740 | Ga0495625_0736094 | 3300046660 | Bacteria | 579 |
| 741 | Ga0495635_0007080 | 3300046663 | Bacteria | 7840 |
| 742 | Ga0495635_0167448 | 3300046663 | Bacteria | 1495 |
| 743 | Ga0495635_0249521 | 3300046663 | Bacteria | 1197 |
| 744 | Ga0495661_0019318 | 3300046665 | Bacteria | 4468 |
| 745 | Ga0495588_0010784 | 3300046674 | Bacteria | 4265 |
| 746 | Ga0495588_0120418 | 3300046674 | Bacteria | 1383 |
| 747 | Ga0495588_0134094 | 3300046674 | Bacteria | 1307 |
| 748 | Ga0495657_0082505 | 3300046675 | Bacteria | 2077 |
| 749 | Ga0495646_0062776 | 3300046680 | Bacteria | 2208 |
| 750 | Ga0495647_0312603 | 3300046681 | Bacteria | 710 |
| 751 | Ga0495658_0152049 | 3300046683 | Bacteria | 1422 |
| 752 | Ga0495658_0160461 | 3300046683 | Bacteria | 1386 |
| 753 | Ga0495658_1031471 | 3300046683 | Bacteria | 525 |
| 754 | Ga0495613_0001403 | 3300046689 | Bacteria | 18361 |
| 755 | Ga0495613_0115015 | 3300046689 | Bacteria | 1936 |
| 756 | Ga0495624_0069272 | 3300046690 | Bacteria | 2197 |
| 757 | Ga0495670_0089042 | 3300046691 | Bacteria | 1578 |
| 758 | Ga0495671_0626322 | 3300046692 | Bacteria | 511 |
| 759 | Ga0495649_0007561 | 3300046694 | Bacteria | 6612 |
| 760 | Ga0495649_0118585 | 3300046694 | Bacteria | 1400 |
| 761 | Ga0495649_0132640 | 3300046694 | Bacteria | 1314 |
| 762 | Ga0495649_0635620 | 3300046694 | Bacteria | 525 |
| 763 | Ga0495589_0101403 | 3300046794 | Bacteria | 1393 |
| 764 | Ga0495589_0114758 | 3300046794 | Bacteria | 1299 |
| 765 | Ga0495600_0058329 | 3300046809 | Bacteria | 2522 |
| 766 | Ga0495581_0013206 | 3300047315 | Bacteria | 4790 |
| 767 | Ga0495581_0525418 | 3300047315 | Bacteria | 687 |
| 768 | Ga0495604_0002649 | 3300047317 | Bacteria | 14363 |
| 769 | Ga0495636_0005476 | 3300047318 | Bacteria | 4988 |
| 770 | Ga0495674_0108061 | 3300047319 | Bacteria | 2361 |
| 771 | Ga0495674_0767913 | 3300047319 | Bacteria | 752 |
| 772 | Ga0495674_1117257 | 3300047319 | Bacteria | 599 |
| 773 | Ga0495676_0043408 | 3300047321 | Bacteria | 3680 |
| 774 | Ga0495676_0106528 | 3300047321 | Bacteria | 2065 |
| 775 | Ga0495676_0276381 | 3300047321 | Bacteria | 1138 |
| 776 | Ga0495680_0030632 | 3300047322 | Bacteria | 4391 |
| 777 | Ga0495680_0230504 | 3300047322 | Bacteria | 1319 |
| 778 | Ga0495683_0171618 | 3300047323 | Bacteria | 996 |
| 779 | Ga0495683_0281631 | 3300047323 | Bacteria | 719 |
| 780 | Ga0495687_015370 | 3300047443 | Bacteria | 3896 |
| 781 | Ga0495687_020237 | 3300047443 | Bacteria | 3246 |
| 782 | Ga0495675_0464355 | 3300047444 | Bacteria | 731 |
| 783 | Ga0495677_0422379 | 3300047445 | Bacteria | 528 |
| 784 | Ga0495673_0068596 | 3300047469 | Bacteria | 1498 |
| 785 | Ga0495673_0094867 | 3300047469 | Bacteria | 1214 |
| 786 | Ga0495686_0009742 | 3300047472 | Bacteria | 6894 |
| 787 | Ga0495593_0004337 | 3300047673 | Bacteria | 8441 |
| 788 | Ga0495593_0285275 | 3300047673 | Bacteria | 825 |
| 789 | Ga0495602_0148575 | 3300048088 | Bacteria | 1845 |
| 790 | Ga0495614_0015295 | 3300048089 | Bacteria | 3344 |
| 791 | Ga0496100_0051591 | 3300048903 | Bacteria | 2671 |
| 792 | Ga0496100_0257014 | 3300048903 | Unclassified | 1294 |
| 793 | Ga0496101_0031533 | 3300048904 | Bacteria | 3727 |
| 794 | Ga0496101_0111450 | 3300048904 | Bacteria | 2060 |
| 795 | Ga0496101_0148906 | 3300048904 | Bacteria | 1789 |
| 796 | Ga0496101_0167719 | 3300048904 | Bacteria | 1686 |
| 797 | Ga0496101_0508112 | 3300048904 | Unclassified | 952 |
| 798 | Ga0496101_0816273 | 3300048904 | Bacteria | 735 |
| 799 | Ga0496102_0007791 | 3300048905 | Bacteria | 9155 |
| 800 | Ga0496102_0033503 | 3300048905 | Bacteria | 4617 |
| 801 | Ga0496102_0145385 | 3300048905 | Unclassified | 2225 |
| 802 | Ga0496102_0269762 | 3300048905 | Bacteria | 1604 |
| 803 | Ga0496102_0301397 | 3300048905 | Bacteria | 1510 |
| 804 | Ga0496102_0852831 | 3300048905 | Bacteria | 833 |
| 805 | Ga0496102_1121387 | 3300048905 | Bacteria | 706 |
| 806 | Ga0496103_0003944 | 3300048906 | Bacteria | 9015 |
| 807 | Ga0496103_0080964 | 3300048906 | Bacteria | 2042 |
| 808 | Ga0496103_0324648 | 3300048906 | Bacteria | 990 |
| 809 | Ga0496104_0000896 | 3300048907 | Bacteria | 25644 |
| 810 | Ga0496104_0010154 | 3300048907 | Bacteria | 8403 |
| 811 | Ga0496104_0061346 | 3300048907 | Bacteria | 3565 |
| 812 | Ga0496104_0148887 | 3300048907 | Bacteria | 2247 |
| 813 | Ga0496104_0172657 | 3300048907 | Bacteria | 2072 |
| 814 | Ga0496105_0009605 | 3300048908 | Bacteria | 7572 |
| 815 | Ga0496105_0022007 | 3300048908 | Bacteria | 5162 |
| 816 | Ga0496105_0034201 | 3300048908 | Bacteria | 4179 |
| 817 | Ga0496105_0048155 | 3300048908 | Bacteria | 3518 |
| 818 | Ga0496105_0128979 | 3300048908 | Bacteria | 2086 |
| 819 | Ga0496105_0196347 | 3300048908 | Bacteria | 1648 |
| 820 | Ga0496106_0018282 | 3300048909 | Bacteria | 5181 |
| 821 | Ga0496106_0133527 | 3300048909 | Bacteria | 1948 |
| 822 | Ga0496106_0176907 | 3300048909 | Bacteria | 1693 |
| 823 | Ga0496106_0193306 | 3300048909 | Bacteria | 1618 |
| 824 | Ga0496106_0225514 | 3300048909 | Bacteria | 1495 |
| 825 | Ga0496106_0233591 | 3300048909 | Bacteria | 1468 |
| 826 | Ga0496107_0131081 | 3300048910 | Bacteria | 1851 |
| 827 | Ga0496107_0244165 | 3300048910 | Bacteria | 1336 |
| 828 | Ga0496107_0810164 | 3300048910 | Bacteria | 685 |
| 829 | Ga0496107_0924951 | 3300048910 | Bacteria | 635 |
| 830 | Ga0496107_1013894 | 3300048910 | Bacteria | 602 |
| 831 | Ga0496108_0022480 | 3300048911 | Bacteria | 5185 |
| 832 | Ga0496108_0093896 | 3300048911 | Bacteria | 2553 |
| 833 | Ga0496108_0181189 | 3300048911 | Bacteria | 1824 |
| 834 | Ga0496109_0032965 | 3300048912 | Bacteria | 4660 |
| 835 | Ga0496109_0152816 | 3300048912 | Bacteria | 2161 |
| 836 | Ga0496109_0694419 | 3300048912 | Bacteria | 955 |
| 837 | Ga0496110_0040959 | 3300048913 | Bacteria | 4039 |
| 838 | Ga0496110_0185077 | 3300048913 | Bacteria | 1891 |
| 839 | Ga0496110_0218656 | 3300048913 | Bacteria | 1732 |
| 840 | Ga0496110_0350871 | 3300048913 | Bacteria | 1344 |
| 841 | Ga0496110_0515594 | 3300048913 | Bacteria | 1088 |
| 842 | Ga0496112_0002053 | 3300048915 | Bacteria | 15963 |
| 843 | Ga0496112_0108548 | 3300048915 | Bacteria | 2745 |
| 844 | Ga0496112_0154635 | 3300048915 | Bacteria | 2261 |
| 845 | Ga0496112_0624199 | 3300048915 | Bacteria | 1009 |
| 846 | Ga0496112_0637107 | 3300048915 | Unclassified | 996 |
| 847 | Ga0496113_0008940 | 3300048916 | Bacteria | 6557 |
| 848 | Ga0496113_0019656 | 3300048916 | Bacteria | 4730 |
| 849 | Ga0496113_0055287 | 3300048916 | Bacteria | 2975 |
| 850 | Ga0496113_0133740 | 3300048916 | Bacteria | 1948 |
| 851 | Ga0496113_0399006 | 3300048916 | Unclassified | 1104 |
| 852 | Ga0496113_0919829 | 3300048916 | Bacteria | 691 |
| 853 | Ga0496114_0008142 | 3300048917 | Bacteria | 8306 |
| 854 | Ga0496114_0128797 | 3300048917 | Bacteria | 2184 |
| 855 | Ga0496114_0187411 | 3300048917 | Bacteria | 1809 |
| 856 | Ga0496114_0384536 | 3300048917 | Bacteria | 1242 |
| 857 | Ga0496115_0002618 | 3300048918 | Bacteria | 12914 |
| 858 | Ga0496115_0015633 | 3300048918 | Bacteria | 5762 |
| 859 | Ga0496115_0051770 | 3300048918 | Bacteria | 3292 |
| 860 | Ga0496115_0132308 | 3300048918 | Bacteria | 2056 |
| 861 | Ga0496115_0171231 | 3300048918 | Bacteria | 1796 |
| 862 | Ga0496115_0188586 | 3300048918 | Bacteria | 1704 |
| 863 | Ga0496116_0063313 | 3300048919 | Bacteria | 2383 |
| 864 | Ga0496117_0090930 | 3300048920 | Bacteria | 1965 |
| 865 | Ga0496117_0215132 | 3300048920 | Bacteria | 1074 |
| 866 | Ga0496118_0030959 | 3300048921 | Bacteria | 4450 |
| 867 | Ga0496118_0216629 | 3300048921 | Bacteria | 1118 |
| 868 | Ga0496118_0376014 | 3300048921 | Bacteria | 747 |
| 869 | Ga0496118_0406508 | 3300048921 | Bacteria | 705 |
| 870 | Ga0496119_0010947 | 3300048922 | Bacteria | 7574 |
| 871 | Ga0496119_0057211 | 3300048922 | Bacteria | 2358 |
| 872 | Ga0496119_0141287 | 3300048922 | Bacteria | 1300 |
| 873 | Ga0496119_0384077 | 3300048922 | Bacteria | 673 |
| 874 | Ga0496120_0041739 | 3300048923 | Bacteria | 2684 |
| 875 | Ga0496120_0083996 | 3300048923 | Bacteria | 1718 |
| 876 | Ga0496121_0037690 | 3300048924 | Bacteria | 4290 |
| 877 | Ga0496121_0045625 | 3300048924 | Bacteria | 3763 |
| 878 | Ga0496121_0099679 | 3300048924 | Bacteria | 2245 |
| 879 | Ga0496121_0288166 | 3300048924 | Bacteria | 1120 |
| 880 | Ga0496121_0419972 | 3300048924 | Bacteria | 870 |
| 881 | Ga0496122_0129629 | 3300048925 | Bacteria | 1606 |
| 882 | Ga0496123_0141291 | 3300048926 | Bacteria | 1316 |
| 883 | Ga0496124_0010692 | 3300048927 | Bacteria | 9258 |
| 884 | Ga0496124_0072508 | 3300048927 | Bacteria | 2852 |
| 885 | Ga0496124_0084480 | 3300048927 | Bacteria | 2603 |
| 886 | Ga0496125_0041692 | 3300048928 | Bacteria | 3921 |
| 887 | Ga0496125_0079792 | 3300048928 | Bacteria | 2508 |
| 888 | Ga0496125_0497035 | 3300048928 | Bacteria | 687 |
| 889 | Ga0496126_0068767 | 3300048929 | Bacteria | 3161 |
| 890 | Ga0496126_0082842 | 3300048929 | Bacteria | 2833 |
| 891 | Ga0496126_0112419 | 3300048929 | Bacteria | 2371 |
| 892 | Ga0496126_0163803 | 3300048929 | Bacteria | 1899 |
| 893 | Ga0496126_0373602 | 3300048929 | Bacteria | 1162 |
| 894 | Ga0496126_0566452 | 3300048929 | Bacteria | 899 |
| 895 | Ga0496126_0734975 | 3300048929 | Bacteria | 763 |
| 896 | Ga0496126_1053827 | 3300048929 | Bacteria | 607 |
| 897 | Ga0495682_0056409 | 3300049460 | Bacteria | 1424 |
| 898 | Ga0495682_0182165 | 3300049460 | Bacteria | 746 |
| 899 | Ga0495682_0362092 | 3300049460 | Bacteria | 511 |
| 900 | Ga0501031_0826809 | 3300049568 | Bacteria | 594 |
| 901 | Ga0501032_0141492 | 3300049569 | Bacteria | 1584 |
| 902 | Ga0501034_0177251 | 3300049571 | Bacteria | 2097 |
| 903 | Ga0501034_0650400 | 3300049571 | Bacteria | 956 |
| 904 | Ga0501036_1307695 | 3300049572 | Bacteria | 589 |
| 905 | Ga0501037_0043998 | 3300049573 | Bacteria | 3281 |
| 906 | Ga0501038_0068064 | 3300049574 | Bacteria | 3028 |
| 907 | Ga0501041_0703195 | 3300049577 | Bacteria | 647 |
| 908 | Ga0501043_0936715 | 3300049579 | Bacteria | 619 |
| 909 | Ga0501046_0474030 | 3300049580 | Bacteria | 899 |
| 910 | Ga0501047_0129506 | 3300049581 | Bacteria | 2404 |
| 911 | Ga0501070_0116928 | 3300049586 | Bacteria | 2202 |
| 912 | Ga0501072_0104772 | 3300049588 | Bacteria | 2249 |
| 913 | Ga0501072_0622822 | 3300049588 | Bacteria | 850 |
| 914 | Ga0501075_0165053 | 3300049591 | Bacteria | 1690 |
| 915 | Ga0501075_1326609 | 3300049591 | Bacteria | 545 |
| 916 | Ga0501076_0222417 | 3300049592 | Bacteria | 1543 |
| 917 | Ga0501077_0107165 | 3300049593 | Bacteria | 1771 |
| 918 | Ga0501225_0015607 | 3300049705 | Bacteria | 2114 |
| 919 | Ga0501081_0398107 | 3300049743 | Bacteria | 1019 |
| 920 | Ga0501241_003956 | 3300049758 | Bacteria | 2786 |
| 921 | Ga0501035_0015022 | 3300049822 | Bacteria | 7146 |
| 922 | Ga0501044_0059220 | 3300049823 | Bacteria | 3925 |
| 923 | nmdc:mga03683_60448_c1 | 3300050489 | Bacteria | 1600 |
| 924 | nmdc:mga03n38_439937_c1 | 3300050490 | Bacteria | 724 |
| 925 | nmdc:mga03n38_643743_c1 | 3300050490 | Bacteria | 607 |
| 926 | nmdc:mga00v17_109947_c1 | 3300050491 | Bacteria | 1748 |
| 927 | nmdc:mga00v17_464197_c1 | 3300050491 | Bacteria | 822 |
| 928 | nmdc:mga00v17_492634_c1 | 3300050491 | Bacteria | 795 |
| 929 | nmdc:mga0yw44_14029_c1 | 3300050492 | Bacteria | 4240 |
| 930 | nmdc:mga0yw44_273673_c1 | 3300050492 | Bacteria | 1127 |
| 931 | nmdc:mga0yw44_321852_c1 | 3300050492 | Bacteria | 1038 |
| 932 | nmdc:mga0yw44_53372_c1 | 3300050492 | Bacteria | 2455 |
| 933 | nmdc:mga0yw44_95236_c1 | 3300050492 | Bacteria | 1888 |
| 934 | nmdc:mga0k408_53816_c1 | 3300050493 | Bacteria | 2333 |
| 935 | nmdc:mga06z11_228691_c1 | 3300050494 | Bacteria | 1089 |
| 936 | nmdc:mga06z11_312415_c1 | 3300050494 | Bacteria | 936 |
| 937 | nmdc:mga06z11_68007_c1 | 3300050494 | Bacteria | 1877 |
| 938 | nmdc:mga04h51_30657_c1 | 3300050495 | Bacteria | 1694 |
| 939 | nmdc:mga07m45_180822_c1 | 3300050496 | Bacteria | 1226 |
| 940 | nmdc:mga05p37_1028560_c1 | 3300050507 | Bacteria | 872 |
| 941 | nmdc:mga05p37_311_c1 | 3300050507 | Bacteria | 51481 |
| 942 | nmdc:mga05p37_530232_c1 | 3300050507 | Bacteria | 1345 |
| 943 | nmdc:mga09592_74789_c1 | 3300050508 | Bacteria | 2879 |
| 944 | nmdc:mga0qj67_155511_c1 | 3300050509 | Bacteria | 1856 |
| 945 | nmdc:mga0qj67_164949_c1 | 3300050509 | Bacteria | 1798 |
| 946 | nmdc:mga0qj67_521501_c1 | 3300050509 | Bacteria | 954 |
| 947 | nmdc:mga06r32_1386853_c1 | 3300050510 | Bacteria | 645 |
| 948 | nmdc:mga06r32_54893_c1 | 3300050510 | Bacteria | 3821 |
| 949 | nmdc:mga08y16_1584774_c1 | 3300050511 | Bacteria | 613 |
| 950 | nmdc:mga08y16_165_c1 | 3300050511 | Bacteria | 57478 |
| 951 | nmdc:mga08y16_309090_c1 | 3300050511 | Bacteria | 1628 |
| 952 | nmdc:mga08y16_427382_c1 | 3300050511 | Unclassified | 1353 |
| 953 | nmdc:mga08y16_437247_c1 | 3300050511 | Bacteria | 1336 |
| 954 | nmdc:mga08y16_860179_c1 | 3300050511 | Bacteria | 895 |
| 955 | nmdc:mga0n895_251544_c1 | 3300050512 | Bacteria | 1793 |
| 956 | nmdc:mga0n895_59484_c1 | 3300050512 | Bacteria | 3769 |
| 957 | nmdc:mga0n895_755344_c1 | 3300050512 | Bacteria | 965 |
| 958 | nmdc:mga0rr50_65089_c1 | 3300050513 | Bacteria | 2760 |
| 959 | nmdc:mga0rr50_748081_c1 | 3300050513 | Bacteria | 834 |
| 960 | nmdc:mga0rr50_829547_c1 | 3300050513 | Bacteria | 789 |
| 961 | nmdc:mga0a205_194358_c1 | 3300050515 | Bacteria | 1920 |
| 962 | nmdc:mga0a205_441251_c1 | 3300050515 | Bacteria | 1162 |
| 963 | nmdc:mga0a205_619288_c1 | 3300050515 | Bacteria | 935 |
| 964 | nmdc:mga0sz30_566013_c1 | 3300050516 | Bacteria | 513 |
| 965 | nmdc:mga0sz30_56798_c1 | 3300050516 | Bacteria | 1668 |
| 966 | nmdc:mga0sz30_61894_c1 | 3300050516 | Bacteria | 1600 |
| 967 | nmdc:mga0sz30_97097_c1 | 3300050516 | Bacteria | 1285 |
| 968 | Ga0495601_0014670 | 3300053077 | Bacteria | 4725 |
| 969 | Ga0495601_0449289 | 3300053077 | Bacteria | 834 |
| 970 | Ga0495612_0009372 | 3300053078 | Bacteria | 3975 |
| 971 | Ga0500610_0076022 | 3300053079 | Bacteria | 1751 |
| 972 | Ga0495655_0011762 | 3300053083 | Bacteria | 1766 |
| 973 | Ga0495595_0010648 | 3300053084 | Bacteria | 3829 |
| 974 | Ga0495595_0093397 | 3300053084 | Bacteria | 1446 |
| 975 | Ga0495595_0102385 | 3300053084 | Bacteria | 1383 |
| 976 | Ga0495619_0018271 | 3300053085 | Bacteria | 4449 |
| 977 | Ga0495619_0481544 | 3300053085 | Bacteria | 854 |
| 978 | Ga0500578_0250110 | 3300053086 | Bacteria | 1068 |
| 979 | Ga0500569_008279 | 3300053109 | Bacteria | 2373 |
| 980 | Ga0500572_121149 | 3300053111 | Bacteria | 847 |
| 981 | Ga0500594_0275886 | 3300053118 | Bacteria | 562 |
| 982 | Ga0500595_014651 | 3300053119 | Bacteria | 2968 |
| 983 | Ga0500628_195353 | 3300053129 | Bacteria | 582 |
| 984 | Ga0500642_0027747 | 3300053130 | Bacteria | 2327 |
| 985 | Ga0500642_0289263 | 3300053130 | Bacteria | 743 |
| 986 | Ga0500559_0104698 | 3300053136 | Bacteria | 1306 |
| 987 | Ga0500564_001786 | 3300053138 | Bacteria | 7617 |
| 988 | Ga0500568_0150482 | 3300053139 | Bacteria | 861 |
| 989 | Ga0500577_0300758 | 3300053142 | Bacteria | 700 |
| 990 | Ga0500588_0025865 | 3300053146 | Bacteria | 1636 |
| 991 | Ga0500590_298728 | 3300053148 | Bacteria | 607 |
| 992 | Ga0500604_0005054 | 3300053151 | Bacteria | 3490 |
| 993 | Ga0500639_232147 | 3300053163 | Bacteria | 758 |
| 994 | Ga0500637_0077213 | 3300053178 | Bacteria | 1921 |
| 995 | Ga0500645_127298 | 3300053730 | Bacteria | 708 |
| 996 | Ga0500609_003004 | 3300053731 | Bacteria | 2396 |
| 997 | Ga0500552_046751 | 3300053733 | Bacteria | 721 |
| 998 | Ga0500661_028649 | 3300055283 | Bacteria | 982 |
| 999 | Ga0501082_0708921 | 3300060353 | Bacteria | 881 |
| 1000 | Ga0466962_0073131 | 3300061719 | Bacteria | 1638 |
| 1001 | Ga0530510_0071062 | 3300061734 | Bacteria | 2526 |
| 1002 | Ga0530510_0217832 | 3300061734 | Bacteria | 1419 |
| 1003 | Ga0530510_0370772 | 3300061734 | Bacteria | 1077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042439 | Ga0439464_0294212 | Ga0439464_0294212_52_375 | 100 |
| 2 | 3300005434 | Ga0070709_10814407 | Ga0070709_108144072 | 106 |
| 3 | 3300005435 | Ga0070714_100457006 | Ga0070714_1004570062 | 106 |
| 4 | 3300025906 | Ga0207699_10079206 | Ga0207699_100792062 | 106 |
| 5 | iso_pu_bacteria | 8019555841 | 8019561302 | 109 |
| 6 | iso_pu_bacteria | 8019565922 | 8019571386 | 109 |
| 7 | 3300006195 | Ga0075366_10937820 | Ga0075366_109378201 | 113 |
| 8 | 3300006038 | Ga0075365_10226698 | Ga0075365_102266982 | 114 |
| 9 | 3300025926 | Ga0207659_11271871 | Ga0207659_112718711 | 116 |
| 10 | 3300049581 | Ga0501047_0129506 | Ga0501047_0129506_2018_2377 | 116 |
| 11 | 3300005329 | Ga0070683_100064888 | Ga0070683_1000648884 | 117 |
| 12 | 3300005354 | Ga0070675_100909457 | Ga0070675_1009094571 | 117 |
| 13 | 3300005535 | Ga0070684_100012771 | Ga0070684_1000127719 | 117 |
| 14 | 3300005564 | Ga0070664_100062488 | Ga0070664_1000624885 | 117 |
| 15 | 3300025944 | Ga0207661_10049749 | Ga0207661_100497492 | 117 |
| 16 | 3300025945 | Ga0207679_10404310 | Ga0207679_104043103 | 117 |
| 17 | 3300031995 | Ga0307409_102150306 | Ga0307409_1021503061 | 117 |
| 18 | iso_pu_bacteria | 3005710791 | 3005711924 | 117 |
| 19 | 3300009094 | Ga0111539_10182458 | Ga0111539_101824582 | 118 |
| 20 | 3300050511 | nmdc:mga08y16_427382_c1 | nmdc:mga08y16_427382_c1_790_1206 | 118 |
| 21 | iso_pu_bacteria | 2524023228 | 2524533006 | 118 |
| 22 | iso_pu_bacteria | 2904699407 | 2904711282 | 118 |
| 23 | iso_pu_bacteria | 2922425934 | 2922433008 | 118 |
| 24 | 3300005340 | Ga0070689_100000218 | Ga0070689_10000021827 | 119 |
| 25 | 3300005365 | Ga0070688_100124152 | Ga0070688_1001241521 | 119 |
| 26 | 3300005615 | Ga0070702_101091014 | Ga0070702_1010910141 | 119 |
| 27 | 3300005844 | Ga0068862_100706392 | Ga0068862_1007063922 | 119 |
| 28 | 3300025936 | Ga0207670_10001216 | Ga0207670_100012168 | 119 |
| 29 | 3300028380 | Ga0268265_10823759 | Ga0268265_108237592 | 119 |
| 30 | 3300046683 | Ga0495658_1031471 | Ga0495658_1031471_10_426 | 119 |
| 31 | 3300046642 | Ga0495634_0328065 | Ga0495634_0328065_541_906 | 120 |
| 32 | 3300049588 | Ga0501072_0622822 | Ga0501072_0622822_261_671 | 120 |
| 33 | 3300049591 | Ga0501075_1326609 | Ga0501075_1326609_111_521 | 120 |
| 34 | 3300005334 | Ga0068869_100401758 | Ga0068869_1004017582 | 121 |
| 35 | 3300005340 | Ga0070689_100241800 | Ga0070689_1002418002 | 121 |
| 36 | 3300005438 | Ga0070701_10698486 | Ga0070701_106984862 | 121 |
| 37 | 3300005444 | Ga0070694_100149770 | Ga0070694_1001497702 | 121 |
| 38 | 3300005545 | Ga0070695_100062134 | Ga0070695_1000621342 | 121 |
| 39 | 3300005563 | Ga0068855_100549226 | Ga0068855_1005492262 | 121 |
| 40 | 3300005616 | Ga0068852_101099323 | Ga0068852_1010993232 | 121 |
| 41 | 3300005617 | Ga0068859_100593838 | Ga0068859_1005938382 | 121 |
| 42 | 3300005842 | Ga0068858_100141230 | Ga0068858_1001412304 | 121 |
| 43 | 3300006844 | Ga0075428_100092034 | Ga0075428_1000920345 | 121 |
| 44 | 3300006844 | Ga0075428_102026561 | Ga0075428_1020265612 | 121 |
| 45 | 3300006846 | Ga0075430_100139627 | Ga0075430_1001396273 | 121 |
| 46 | 3300006847 | Ga0075431_100717136 | Ga0075431_1007171362 | 121 |
| 47 | 3300006931 | Ga0097620_100593852 | Ga0097620_1005938522 | 121 |
| 48 | 3300009094 | Ga0111539_10082019 | Ga0111539_100820194 | 121 |
| 49 | 3300009101 | Ga0105247_11223096 | Ga0105247_112230961 | 121 |
| 50 | 3300009177 | Ga0105248_10361332 | Ga0105248_103613322 | 121 |
| 51 | 3300009551 | Ga0105238_11976296 | Ga0105238_119762962 | 121 |
| 52 | 3300009553 | Ga0105249_11878063 | Ga0105249_118780632 | 121 |
| 53 | 3300011119 | Ga0105246_10072093 | Ga0105246_100720932 | 121 |
| 54 | 3300013105 | Ga0157369_10389073 | Ga0157369_103890732 | 121 |
| 55 | 3300013296 | Ga0157374_10135048 | Ga0157374_101350482 | 121 |
| 56 | 3300014325 | Ga0163163_10008737 | Ga0163163_100087373 | 121 |
| 57 | 3300014968 | Ga0157379_10129296 | Ga0157379_101292962 | 121 |
| 58 | 3300014969 | Ga0157376_11898049 | Ga0157376_118980491 | 121 |
| 59 | 3300025904 | Ga0207647_10211354 | Ga0207647_102113541 | 121 |
| 60 | 3300026035 | Ga0207703_10253438 | Ga0207703_102534382 | 121 |
| 61 | 3300030521 | Ga0307511_10000923 | Ga0307511_1000092319 | 121 |
| 62 | 3300039438 | Ga0436360_0177325 | Ga0436360_0177325_361_750 | 121 |
| 63 | 3300039438 | Ga0436360_0431968 | Ga0436360_0431968_306_695 | 121 |
| 64 | 3300039453 | Ga0436362_1102929 | Ga0436362_1102929_442_831 | 121 |
| 65 | 3300048904 | Ga0496101_0148906 | Ga0496101_0148906_102_470 | 121 |
| 66 | 3300048905 | Ga0496102_0033503 | Ga0496102_0033503_869_1237 | 121 |
| 67 | 3300048907 | Ga0496104_0010154 | Ga0496104_0010154_3136_3504 | 121 |
| 68 | 3300048908 | Ga0496105_0022007 | Ga0496105_0022007_3381_3749 | 121 |
| 69 | 3300048909 | Ga0496106_0018282 | Ga0496106_0018282_1595_1963 | 121 |
| 70 | 3300048910 | Ga0496107_0131081 | Ga0496107_0131081_319_687 | 121 |
| 71 | 3300048911 | Ga0496108_0022480 | Ga0496108_0022480_1768_2136 | 121 |
| 72 | 3300048912 | Ga0496109_0152816 | Ga0496109_0152816_178_546 | 121 |
| 73 | 3300048913 | Ga0496110_0040959 | Ga0496110_0040959_2496_2864 | 121 |
| 74 | 3300048915 | Ga0496112_0002053 | Ga0496112_0002053_9970_10338 | 121 |
| 75 | 3300048918 | Ga0496115_0015633 | Ga0496115_0015633_2730_3098 | 121 |
| 76 | 3300049571 | Ga0501034_0177251 | Ga0501034_0177251_1642_2019 | 121 |
| 77 | 3300050509 | nmdc:mga0qj67_164949_c1 | nmdc:mga0qj67_164949_c1_1154_1546 | 121 |
| 78 | 3300050510 | nmdc:mga06r32_1386853_c1 | nmdc:mga06r32_1386853_c1_40_432 | 121 |
| 79 | 3300050511 | nmdc:mga08y16_437247_c1 | nmdc:mga08y16_437247_c1_135_527 | 121 |
| 80 | 3300003214 | JGI25165J46597_1029114 | JGI25165J46597_10291141 | 122 |
| 81 | 3300003659 | JGI25404J52841_10005705 | JGI25404J52841_100057053 | 122 |
| 82 | 3300003659 | JGI25404J52841_10025828 | JGI25404J52841_100258282 | 122 |
| 83 | 3300003659 | JGI25404J52841_10033067 | JGI25404J52841_100330672 | 122 |
| 84 | 3300003659 | JGI25404J52841_10084342 | JGI25404J52841_100843421 | 122 |
| 85 | 3300003659 | JGI25404J52841_10102911 | JGI25404J52841_101029111 | 122 |
| 86 | 3300003763 | Ga0055529_1008771 | Ga0055529_10087712 | 122 |
| 87 | 3300005339 | Ga0070660_100324698 | Ga0070660_1003246981 | 122 |
| 88 | 3300005366 | Ga0070659_101972830 | Ga0070659_1019728301 | 122 |
| 89 | 3300005434 | Ga0070709_10719820 | Ga0070709_107198202 | 122 |
| 90 | 3300005455 | Ga0070663_100214406 | Ga0070663_1002144062 | 122 |
| 91 | 3300005535 | Ga0070684_100573414 | Ga0070684_1005734142 | 122 |
| 92 | 3300005614 | Ga0068856_100734886 | Ga0068856_1007348862 | 122 |
| 93 | 3300005614 | Ga0068856_101207148 | Ga0068856_1012071482 | 122 |
| 94 | 3300005618 | Ga0068864_100357216 | Ga0068864_1003572162 | 122 |
| 95 | 3300005842 | Ga0068858_100341605 | Ga0068858_1003416052 | 122 |
| 96 | 3300005983 | Ga0081540_1006755 | Ga0081540_10067557 | 122 |
| 97 | 3300005983 | Ga0081540_1014175 | Ga0081540_10141755 | 122 |
| 98 | 3300005983 | Ga0081540_1015865 | Ga0081540_10158655 | 122 |
| 99 | 3300005983 | Ga0081540_1063026 | Ga0081540_10630261 | 122 |
| 100 | 3300005983 | Ga0081540_1099549 | Ga0081540_10995492 | 122 |
| 101 | 3300005983 | Ga0081540_1132526 | Ga0081540_11325262 | 122 |
| 102 | 3300006163 | Ga0070715_10306164 | Ga0070715_103061642 | 122 |
| 103 | 3300006173 | Ga0070716_100562523 | Ga0070716_1005625232 | 122 |
| 104 | 3300006871 | Ga0075434_100252281 | Ga0075434_1002522812 | 122 |
| 105 | 3300007076 | Ga0075435_100409109 | Ga0075435_1004091092 | 122 |
| 106 | 3300009545 | Ga0105237_11902621 | Ga0105237_119026211 | 122 |
| 107 | 3300010375 | Ga0105239_10014317 | Ga0105239_100143174 | 122 |
| 108 | 3300011119 | Ga0105246_11257500 | Ga0105246_112575002 | 122 |
| 109 | 3300013296 | Ga0157374_10514557 | Ga0157374_105145572 | 122 |
| 110 | 3300013297 | Ga0157378_11713876 | Ga0157378_117138762 | 122 |
| 111 | 3300013308 | Ga0157375_11185549 | Ga0157375_111855492 | 122 |
| 112 | 3300021441 | Ga0213871_10054984 | Ga0213871_100549841 | 122 |
| 113 | 3300025254 | Ga0209148_1001992 | Ga0209148_10019925 | 122 |
| 114 | 3300025261 | Ga0209233_1001411 | Ga0209233_10014112 | 122 |
| 115 | 3300025261 | Ga0209233_1014099 | Ga0209233_10140993 | 122 |
| 116 | 3300025272 | Ga0209455_1002997 | Ga0209455_10029972 | 122 |
| 117 | 3300025272 | Ga0209455_1059813 | Ga0209455_10598131 | 122 |
| 118 | 3300025906 | Ga0207699_10711556 | Ga0207699_107115562 | 122 |
| 119 | 3300025909 | Ga0207705_10754123 | Ga0207705_107541232 | 122 |
| 120 | 3300025917 | Ga0207660_11213746 | Ga0207660_112137462 | 122 |
| 121 | 3300025919 | Ga0207657_10560766 | Ga0207657_105607662 | 122 |
| 122 | 3300025960 | Ga0207651_10989985 | Ga0207651_109899852 | 122 |
| 123 | 3300025961 | Ga0207712_11272880 | Ga0207712_112728802 | 122 |
| 124 | 3300026067 | Ga0207678_10240553 | Ga0207678_102405532 | 122 |
| 125 | 3300026078 | Ga0207702_10107794 | Ga0207702_101077942 | 122 |
| 126 | 3300026078 | Ga0207702_11003725 | Ga0207702_110037252 | 122 |
| 127 | 3300026095 | Ga0207676_10107939 | Ga0207676_101079392 | 122 |
| 128 | 3300026121 | Ga0207683_10162150 | Ga0207683_101621502 | 122 |
| 129 | 3300031548 | Ga0307408_100091188 | Ga0307408_1000911882 | 122 |
| 130 | 3300031731 | Ga0307405_11331000 | Ga0307405_113310001 | 122 |
| 131 | 3300035084 | Ga0373928_0095946 | Ga0373928_0095946_261_641 | 122 |
| 132 | 3300035692 | Ga0373935_0355102 | Ga0373935_0355102_251_622 | 122 |
| 133 | 3300039437 | Ga0436365_0217255 | Ga0436365_0217255_147_566 | 122 |
| 134 | 3300039453 | Ga0436362_0855659 | Ga0436362_0855659_40_408 | 122 |
| 135 | 3300046500 | Ga0495596_0254165 | Ga0495596_0254165_199_570 | 122 |
| 136 | 3300046794 | Ga0495589_0114758 | Ga0495589_0114758_270_641 | 122 |
| 137 | 3300047445 | Ga0495677_0422379 | Ga0495677_0422379_122_493 | 122 |
| 138 | 3300048906 | Ga0496103_0324648 | Ga0496103_0324648_436_807 | 122 |
| 139 | 3300048908 | Ga0496105_0128979 | Ga0496105_0128979_593_964 | 122 |
| 140 | 3300048909 | Ga0496106_0225514 | Ga0496106_0225514_994_1365 | 122 |
| 141 | 3300048910 | Ga0496107_0244165 | Ga0496107_0244165_851_1222 | 122 |
| 142 | 3300048913 | Ga0496110_0515594 | Ga0496110_0515594_163_534 | 122 |
| 143 | 3300048915 | Ga0496112_0108548 | Ga0496112_0108548_1702_2073 | 122 |
| 144 | 3300048916 | Ga0496113_0055287 | Ga0496113_0055287_61_432 | 122 |
| 145 | 3300048918 | Ga0496115_0188586 | Ga0496115_0188586_1118_1489 | 122 |
| 146 | 3300048924 | Ga0496121_0288166 | Ga0496121_0288166_584_955 | 122 |
| 147 | 3300048929 | Ga0496126_0163803 | Ga0496126_0163803_1349_1720 | 122 |
| 148 | 3300048929 | Ga0496126_0373602 | Ga0496126_0373602_202_573 | 122 |
| 149 | 3300049569 | Ga0501032_0141492 | Ga0501032_0141492_1117_1500 | 122 |
| 150 | 3300049573 | Ga0501037_0043998 | Ga0501037_0043998_1137_1520 | 122 |
| 151 | 3300049574 | Ga0501038_0068064 | Ga0501038_0068064_2282_2665 | 122 |
| 152 | 3300049579 | Ga0501043_0936715 | Ga0501043_0936715_216_599 | 122 |
| 153 | 3300049580 | Ga0501046_0474030 | Ga0501046_0474030_438_821 | 122 |
| 154 | 3300049586 | Ga0501070_0116928 | Ga0501070_0116928_1465_1848 | 122 |
| 155 | 3300049822 | Ga0501035_0015022 | Ga0501035_0015022_4539_4922 | 122 |
| 156 | 3300049823 | Ga0501044_0059220 | Ga0501044_0059220_3268_3651 | 122 |
| 157 | 3300050513 | nmdc:mga0rr50_829547_c1 | nmdc:mga0rr50_829547_c1_203_574 | 122 |
| 158 | 3300053079 | Ga0500610_0076022 | Ga0500610_0076022_678_1049 | 122 |
| 159 | 3300053086 | Ga0500578_0250110 | Ga0500578_0250110_138_509 | 122 |
| 160 | 3300053109 | Ga0500569_008279 | Ga0500569_008279_1865_2236 | 122 |
| 161 | 3300053142 | Ga0500577_0300758 | Ga0500577_0300758_194_565 | 122 |
| 162 | 3300053146 | Ga0500588_0025865 | Ga0500588_0025865_1082_1453 | 122 |
| 163 | 3300053730 | Ga0500645_127298 | Ga0500645_127298_274_645 | 122 |
| 164 | 3300053731 | Ga0500609_003004 | Ga0500609_003004_1135_1506 | 122 |
| 165 | iso_pu_bacteria | 2515154123 | 2515690549 | 124 |
| 166 | 3300005445 | Ga0070708_100096040 | Ga0070708_1000960403 | 125 |
| 167 | 3300005937 | Ga0081455_10066073 | Ga0081455_100660732 | 125 |
| 168 | 3300006353 | Ga0075370_10668263 | Ga0075370_106682631 | 125 |
| 169 | 3300009147 | Ga0114129_10126638 | Ga0114129_101266385 | 125 |
| 170 | 3300031456 | Ga0307513_10040464 | Ga0307513_100404645 | 125 |
| 171 | 3300033180 | Ga0307510_10397357 | Ga0307510_103973572 | 125 |
| 172 | 3300037418 | Ga0395900_0381849 | Ga0395900_0381849_31_426 | 125 |
| 173 | 3300037466 | Ga0395898_1479339 | Ga0395898_1479339_54_449 | 125 |
| 174 | 3300042157 | Ga0439458_0150967 | Ga0439458_0150967_25_423 | 125 |
| 175 | 3300047472 | Ga0495686_0009742 | Ga0495686_0009742_4081_4476 | 125 |
| 176 | 3300006028 | Ga0070717_11989392 | Ga0070717_119893921 | 126 |
| 177 | 3300006038 | Ga0075365_10059701 | Ga0075365_100597013 | 126 |
| 178 | 3300006177 | Ga0075362_10110744 | Ga0075362_101107443 | 126 |
| 179 | 3300006237 | Ga0097621_100056117 | Ga0097621_1000561173 | 126 |
| 180 | 3300025250 | Ga0209026_1013566 | Ga0209026_10135662 | 126 |
| 181 | 3300036712 | Ga0316584_0860031 | Ga0316584_0860031_86_478 | 126 |
| 182 | 3300038443 | Ga0395901_2118230 | Ga0395901_2118230_61_459 | 126 |
| 183 | 3300045051 | Ga0451576_2350413 | Ga0451576_2350413_155_535 | 126 |
| 184 | 3300047443 | Ga0495687_020237 | Ga0495687_020237_423_803 | 126 |
| 185 | 3300050489 | nmdc:mga03683_60448_c1 | nmdc:mga03683_60448_c1_383_763 | 126 |
| 186 | 3300005330 | Ga0070690_100707735 | Ga0070690_1007077351 | 127 |
| 187 | 3300005331 | Ga0070670_100000064 | Ga0070670_10000006477 | 127 |
| 188 | 3300005334 | Ga0068869_100199707 | Ga0068869_1001997071 | 127 |
| 189 | 3300005335 | Ga0070666_10024946 | Ga0070666_100249463 | 127 |
| 190 | 3300005338 | Ga0068868_100093315 | Ga0068868_1000933152 | 127 |
| 191 | 3300005341 | Ga0070691_10093764 | Ga0070691_100937642 | 127 |
| 192 | 3300005341 | Ga0070691_10162486 | Ga0070691_101624862 | 127 |
| 193 | 3300005343 | Ga0070687_100042940 | Ga0070687_1000429401 | 127 |
| 194 | 3300005343 | Ga0070687_100553150 | Ga0070687_1005531502 | 127 |
| 195 | 3300005344 | Ga0070661_100150817 | Ga0070661_1001508172 | 127 |
| 196 | 3300005347 | Ga0070668_100841909 | Ga0070668_1008419092 | 127 |
| 197 | 3300005353 | Ga0070669_100008388 | Ga0070669_1000083884 | 127 |
| 198 | 3300005354 | Ga0070675_100313891 | Ga0070675_1003138912 | 127 |
| 199 | 3300005355 | Ga0070671_100000025 | Ga0070671_10000002591 | 127 |
| 200 | 3300005356 | Ga0070674_100308270 | Ga0070674_1003082701 | 127 |
| 201 | 3300005364 | Ga0070673_101156388 | Ga0070673_1011563881 | 127 |
| 202 | 3300005367 | Ga0070667_100000095 | Ga0070667_10000009525 | 127 |
| 203 | 3300005438 | Ga0070701_10204175 | Ga0070701_102041752 | 127 |
| 204 | 3300005440 | Ga0070705_100928012 | Ga0070705_1009280121 | 127 |
| 205 | 3300005441 | Ga0070700_100307204 | Ga0070700_1003072042 | 127 |
| 206 | 3300005444 | Ga0070694_100129946 | Ga0070694_1001299463 | 127 |
| 207 | 3300005455 | Ga0070663_100096127 | Ga0070663_1000961272 | 127 |
| 208 | 3300005455 | Ga0070663_100194344 | Ga0070663_1001943442 | 127 |
| 209 | 3300005455 | Ga0070663_100878201 | Ga0070663_1008782012 | 127 |
| 210 | 3300005466 | Ga0070685_10000005 | Ga0070685_1000000519 | 127 |
| 211 | 3300005466 | Ga0070685_10067843 | Ga0070685_100678433 | 127 |
| 212 | 3300005466 | Ga0070685_10213706 | Ga0070685_102137061 | 127 |
| 213 | 3300005543 | Ga0070672_100641985 | Ga0070672_1006419851 | 127 |
| 214 | 3300005545 | Ga0070695_100070751 | Ga0070695_1000707513 | 127 |
| 215 | 3300005546 | Ga0070696_100729516 | Ga0070696_1007295162 | 127 |
| 216 | 3300005548 | Ga0070665_100037379 | Ga0070665_1000373792 | 127 |
| 217 | 3300005548 | Ga0070665_100130649 | Ga0070665_1001306493 | 127 |
| 218 | 3300005564 | Ga0070664_100245222 | Ga0070664_1002452222 | 127 |
| 219 | 3300005564 | Ga0070664_100378305 | Ga0070664_1003783053 | 127 |
| 220 | 3300005564 | Ga0070664_101062645 | Ga0070664_1010626452 | 127 |
| 221 | 3300005564 | Ga0070664_101373258 | Ga0070664_1013732582 | 127 |
| 222 | 3300005614 | Ga0068856_100944819 | Ga0068856_1009448192 | 127 |
| 223 | 3300005616 | Ga0068852_101093894 | Ga0068852_1010938942 | 127 |
| 224 | 3300005617 | Ga0068859_100121233 | Ga0068859_1001212332 | 127 |
| 225 | 3300005618 | Ga0068864_100000073 | Ga0068864_10000007325 | 127 |
| 226 | 3300005718 | Ga0068866_10138942 | Ga0068866_101389422 | 127 |
| 227 | 3300005718 | Ga0068866_10292221 | Ga0068866_102922211 | 127 |
| 228 | 3300005719 | Ga0068861_100006933 | Ga0068861_1000069337 | 127 |
| 229 | 3300005719 | Ga0068861_100010562 | Ga0068861_1000105625 | 127 |
| 230 | 3300005719 | Ga0068861_101062731 | Ga0068861_1010627312 | 127 |
| 231 | 3300005840 | Ga0068870_10616860 | Ga0068870_106168601 | 127 |
| 232 | 3300005842 | Ga0068858_100053469 | Ga0068858_1000534692 | 127 |
| 233 | 3300005842 | Ga0068858_101954832 | Ga0068858_1019548321 | 127 |
| 234 | 3300005843 | Ga0068860_100002476 | Ga0068860_1000024764 | 127 |
| 235 | 3300005843 | Ga0068860_101569913 | Ga0068860_1015699131 | 127 |
| 236 | 3300005844 | Ga0068862_100018007 | Ga0068862_1000180075 | 127 |
| 237 | 3300005844 | Ga0068862_100369457 | Ga0068862_1003694572 | 127 |
| 238 | 3300006237 | Ga0097621_102049946 | Ga0097621_1020499461 | 127 |
| 239 | 3300006358 | Ga0068871_100376434 | Ga0068871_1003764341 | 127 |
| 240 | 3300006846 | Ga0075430_101640919 | Ga0075430_1016409191 | 127 |
| 241 | 3300006881 | Ga0068865_100584611 | Ga0068865_1005846112 | 127 |
| 242 | 3300006931 | Ga0097620_100121240 | Ga0097620_1001212402 | 127 |
| 243 | 3300009093 | Ga0105240_11099260 | Ga0105240_110992602 | 127 |
| 244 | 3300009094 | Ga0111539_10389385 | Ga0111539_103893852 | 127 |
| 245 | 3300009094 | Ga0111539_11317867 | Ga0111539_113178671 | 127 |
| 246 | 3300009174 | Ga0105241_11772787 | Ga0105241_117727872 | 127 |
| 247 | 3300009177 | Ga0105248_10120204 | Ga0105248_101202042 | 127 |
| 248 | 3300009553 | Ga0105249_10129837 | Ga0105249_101298374 | 127 |
| 249 | 3300011119 | Ga0105246_10766471 | Ga0105246_107664712 | 127 |
| 250 | 3300013104 | Ga0157370_10064289 | Ga0157370_100642893 | 127 |
| 251 | 3300013105 | Ga0157369_10000197 | Ga0157369_1000019760 | 127 |
| 252 | 3300013307 | Ga0157372_10120789 | Ga0157372_101207892 | 127 |
| 253 | 3300013308 | Ga0157375_10641208 | Ga0157375_106412081 | 127 |
| 254 | 3300013308 | Ga0157375_12552730 | Ga0157375_125527301 | 127 |
| 255 | 3300014325 | Ga0163163_10001573 | Ga0163163_100015735 | 127 |
| 256 | 3300014325 | Ga0163163_10430406 | Ga0163163_104304062 | 127 |
| 257 | 3300014325 | Ga0163163_13248336 | Ga0163163_132483361 | 127 |
| 258 | 3300014326 | Ga0157380_10279675 | Ga0157380_102796752 | 127 |
| 259 | 3300014968 | Ga0157379_10095777 | Ga0157379_100957773 | 127 |
| 260 | 3300014968 | Ga0157379_12065285 | Ga0157379_120652851 | 127 |
| 261 | 3300014969 | Ga0157376_11071391 | Ga0157376_110713911 | 127 |
| 262 | 3300017792 | Ga0163161_10921818 | Ga0163161_109218181 | 127 |
| 263 | 3300020070 | Ga0206356_10810643 | Ga0206356_108106432 | 127 |
| 264 | 3300020082 | Ga0206353_10858696 | Ga0206353_108586963 | 127 |
| 265 | 3300021377 | Ga0213874_10138503 | Ga0213874_101385032 | 127 |
| 266 | 3300022467 | Ga0224712_10003411 | Ga0224712_100034112 | 127 |
| 267 | 3300025893 | Ga0207682_10043211 | Ga0207682_100432112 | 127 |
| 268 | 3300025899 | Ga0207642_10111209 | Ga0207642_101112093 | 127 |
| 269 | 3300025899 | Ga0207642_10535474 | Ga0207642_105354742 | 127 |
| 270 | 3300025900 | Ga0207710_10006552 | Ga0207710_100065525 | 127 |
| 271 | 3300025903 | Ga0207680_10184360 | Ga0207680_101843602 | 127 |
| 272 | 3300025903 | Ga0207680_10606776 | Ga0207680_106067761 | 127 |
| 273 | 3300025913 | Ga0207695_10398335 | Ga0207695_103983352 | 127 |
| 274 | 3300025920 | Ga0207649_10286618 | Ga0207649_102866182 | 127 |
| 275 | 3300025920 | Ga0207649_11068713 | Ga0207649_110687132 | 127 |
| 276 | 3300025923 | Ga0207681_10059988 | Ga0207681_100599884 | 127 |
| 277 | 3300025925 | Ga0207650_10000106 | Ga0207650_1000010675 | 127 |
| 278 | 3300025926 | Ga0207659_10987038 | Ga0207659_109870381 | 127 |
| 279 | 3300025931 | Ga0207644_10000049 | Ga0207644_1000004964 | 127 |
| 280 | 3300025937 | Ga0207669_10488710 | Ga0207669_104887102 | 127 |
| 281 | 3300025938 | Ga0207704_10497220 | Ga0207704_104972201 | 127 |
| 282 | 3300025940 | Ga0207691_10107400 | Ga0207691_101074003 | 127 |
| 283 | 3300025940 | Ga0207691_10174281 | Ga0207691_101742812 | 127 |
| 284 | 3300025941 | Ga0207711_10000393 | Ga0207711_1000039332 | 127 |
| 285 | 3300025942 | Ga0207689_10139944 | Ga0207689_101399442 | 127 |
| 286 | 3300025942 | Ga0207689_10485110 | Ga0207689_104851103 | 127 |
| 287 | 3300025942 | Ga0207689_11155791 | Ga0207689_111557911 | 127 |
| 288 | 3300025945 | Ga0207679_10156798 | Ga0207679_101567982 | 127 |
| 289 | 3300025945 | Ga0207679_11125844 | Ga0207679_111258441 | 127 |
| 290 | 3300025986 | Ga0207658_10000073 | Ga0207658_1000007375 | 127 |
| 291 | 3300026023 | Ga0207677_10076028 | Ga0207677_100760282 | 127 |
| 292 | 3300026035 | Ga0207703_10096638 | Ga0207703_100966382 | 127 |
| 293 | 3300026041 | Ga0207639_10615315 | Ga0207639_106153152 | 127 |
| 294 | 3300026067 | Ga0207678_10142462 | Ga0207678_101424623 | 127 |
| 295 | 3300026075 | Ga0207708_10325342 | Ga0207708_103253422 | 127 |
| 296 | 3300026078 | Ga0207702_10216754 | Ga0207702_102167543 | 127 |
| 297 | 3300026078 | Ga0207702_11330873 | Ga0207702_113308732 | 127 |
| 298 | 3300026088 | Ga0207641_10157856 | Ga0207641_101578562 | 127 |
| 299 | 3300026088 | Ga0207641_10195283 | Ga0207641_101952832 | 127 |
| 300 | 3300026089 | Ga0207648_10229096 | Ga0207648_102290962 | 127 |
| 301 | 3300026095 | Ga0207676_10000010 | Ga0207676_1000001075 | 127 |
| 302 | 3300026118 | Ga0207675_100003423 | Ga0207675_10000342310 | 127 |
| 303 | 3300026118 | Ga0207675_100025297 | Ga0207675_1000252976 | 127 |
| 304 | 3300026142 | Ga0207698_11040750 | Ga0207698_110407501 | 127 |
| 305 | 3300028380 | Ga0268265_10001308 | Ga0268265_1000130811 | 127 |
| 306 | 3300028380 | Ga0268265_10717852 | Ga0268265_107178522 | 127 |
| 307 | 3300028381 | Ga0268264_10000123 | Ga0268264_10000123164 | 127 |
| 308 | 3300031456 | Ga0307513_10257961 | Ga0307513_102579613 | 127 |
| 309 | 3300031507 | Ga0307509_10310000 | Ga0307509_103100002 | 127 |
| 310 | 3300031730 | Ga0307516_10621194 | Ga0307516_106211942 | 127 |
| 311 | 3300032005 | Ga0307411_12297872 | Ga0307411_122978721 | 127 |
| 312 | 3300035115 | Ga0373941_0096459 | Ga0373941_0096459_351_746 | 127 |
| 313 | 3300035117 | Ga0373953_0393845 | Ga0373953_0393845_134_520 | 127 |
| 314 | 3300035121 | Ga0373960_0318691 | Ga0373960_0318691_92_487 | 127 |
| 315 | 3300036401 | Ga0373937_0125120 | Ga0373937_0125120_1151_1537 | 127 |
| 316 | 3300037068 | Ga0373925_0598776 | Ga0373925_0598776_343_729 | 127 |
| 317 | 3300037312 | Ga0395899_0021619 | Ga0395899_0021619_338_721 | 127 |
| 318 | 3300037418 | Ga0395900_0050015 | Ga0395900_0050015_2840_3223 | 127 |
| 319 | 3300038443 | Ga0395901_0000173 | Ga0395901_0000173_44711_45094 | 127 |
| 320 | 3300039437 | Ga0436365_0362878 | Ga0436365_0362878_105_488 | 127 |
| 321 | 3300039450 | Ga0436363_1540722 | Ga0436363_1540722_357_740 | 127 |
| 322 | 3300041512 | Ga0451853_1113938 | Ga0451853_1113938_520_906 | 127 |
| 323 | 3300041512 | Ga0451853_2256764 | Ga0451853_2256764_230_613 | 127 |
| 324 | 3300044684 | Ga0466966_0163607 | Ga0466966_0163607_162_545 | 127 |
| 325 | 3300045051 | Ga0451576_1071464 | Ga0451576_1071464_105_488 | 127 |
| 326 | 3300045836 | Ga0466958_0000419 | Ga0466958_0000419_6938_7321 | 127 |
| 327 | 3300046460 | Ga0495638_0032658 | Ga0495638_0032658_272_655 | 127 |
| 328 | 3300046461 | Ga0495641_0265799 | Ga0495641_0265799_175_561 | 127 |
| 329 | 3300046615 | Ga0495656_0116262 | Ga0495656_0116262_179_565 | 127 |
| 330 | 3300048927 | Ga0496124_0084480 | Ga0496124_0084480_1971_2354 | 127 |
| 331 | 3300048929 | Ga0496126_0566452 | Ga0496126_0566452_282_665 | 127 |
| 332 | 3300049705 | Ga0501225_0015607 | Ga0501225_0015607_300_686 | 127 |
| 333 | 3300050511 | nmdc:mga08y16_1584774_c1 | nmdc:mga08y16_1584774_c1_57_449 | 127 |
| 334 | 3300050511 | nmdc:mga08y16_860179_c1 | nmdc:mga08y16_860179_c1_232_636 | 127 |
| 335 | 3300050516 | nmdc:mga0sz30_566013_c1 | nmdc:mga0sz30_566013_c1_78_461 | 127 |
| 336 | 3300053118 | Ga0500594_0275886 | Ga0500594_0275886_30_413 | 127 |
| 337 | 3300053129 | Ga0500628_195353 | Ga0500628_195353_189_572 | 127 |
| 338 | 3300053130 | Ga0500642_0027747 | Ga0500642_0027747_441_824 | 127 |
| 339 | 3300053139 | Ga0500568_0150482 | Ga0500568_0150482_352_735 | 127 |
| 340 | 3300053151 | Ga0500604_0005054 | Ga0500604_0005054_2769_3152 | 127 |
| 341 | 3300061719 | Ga0466962_0073131 | Ga0466962_0073131_624_1007 | 127 |
| 342 | 3300003354 | JGI25160J50197_1004632 | JGI25160J50197_10046325 | 128 |
| 343 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013150 | 128 |
| 344 | 3300003762 | Ga0055542_1013422 | Ga0055542_10134222 | 128 |
| 345 | 3300005262 | Ga0065165_1090711 | Ga0065165_10907112 | 128 |
| 346 | 3300005327 | Ga0070658_10033059 | Ga0070658_100330592 | 128 |
| 347 | 3300005327 | Ga0070658_10199322 | Ga0070658_101993222 | 128 |
| 348 | 3300005331 | Ga0070670_100813020 | Ga0070670_1008130201 | 128 |
| 349 | 3300005335 | Ga0070666_10330618 | Ga0070666_103306181 | 128 |
| 350 | 3300005338 | Ga0068868_100158320 | Ga0068868_1001583203 | 128 |
| 351 | 3300005338 | Ga0068868_101251026 | Ga0068868_1012510262 | 128 |
| 352 | 3300005338 | Ga0068868_101828918 | Ga0068868_1018289181 | 128 |
| 353 | 3300005339 | Ga0070660_100199989 | Ga0070660_1001999892 | 128 |
| 354 | 3300005339 | Ga0070660_100884065 | Ga0070660_1008840652 | 128 |
| 355 | 3300005347 | Ga0070668_100010504 | Ga0070668_1000105046 | 128 |
| 356 | 3300005353 | Ga0070669_100273198 | Ga0070669_1002731981 | 128 |
| 357 | 3300005354 | Ga0070675_100745309 | Ga0070675_1007453092 | 128 |
| 358 | 3300005355 | Ga0070671_100076587 | Ga0070671_1000765873 | 128 |
| 359 | 3300005364 | Ga0070673_100140442 | Ga0070673_1001404422 | 128 |
| 360 | 3300005366 | Ga0070659_100796319 | Ga0070659_1007963191 | 128 |
| 361 | 3300005367 | Ga0070667_100056278 | Ga0070667_1000562783 | 128 |
| 362 | 3300005367 | Ga0070667_101269099 | Ga0070667_1012690991 | 128 |
| 363 | 3300005441 | Ga0070700_101038432 | Ga0070700_1010384321 | 128 |
| 364 | 3300005455 | Ga0070663_100285031 | Ga0070663_1002850312 | 128 |
| 365 | 3300005455 | Ga0070663_101671141 | Ga0070663_1016711411 | 128 |
| 366 | 3300005457 | Ga0070662_100143187 | Ga0070662_1001431872 | 128 |
| 367 | 3300005468 | Ga0070707_100887752 | Ga0070707_1008877521 | 128 |
| 368 | 3300005518 | Ga0070699_100280999 | Ga0070699_1002809992 | 128 |
| 369 | 3300005518 | Ga0070699_100521664 | Ga0070699_1005216642 | 128 |
| 370 | 3300005536 | Ga0070697_100224933 | Ga0070697_1002249333 | 128 |
| 371 | 3300005539 | Ga0068853_100316025 | Ga0068853_1003160252 | 128 |
| 372 | 3300005548 | Ga0070665_100167983 | Ga0070665_1001679832 | 128 |
| 373 | 3300005548 | Ga0070665_100212527 | Ga0070665_1002125272 | 128 |
| 374 | 3300005548 | Ga0070665_100574111 | Ga0070665_1005741112 | 128 |
| 375 | 3300005549 | Ga0070704_100030715 | Ga0070704_1000307154 | 128 |
| 376 | 3300005563 | Ga0068855_101712331 | Ga0068855_1017123312 | 128 |
| 377 | 3300005577 | Ga0068857_100884596 | Ga0068857_1008845962 | 128 |
| 378 | 3300005577 | Ga0068857_100927161 | Ga0068857_1009271612 | 128 |
| 379 | 3300005614 | Ga0068856_100071936 | Ga0068856_1000719364 | 128 |
| 380 | 3300005614 | Ga0068856_100545639 | Ga0068856_1005456393 | 128 |
| 381 | 3300005616 | Ga0068852_100099851 | Ga0068852_1000998512 | 128 |
| 382 | 3300005617 | Ga0068859_100757110 | Ga0068859_1007571102 | 128 |
| 383 | 3300005617 | Ga0068859_101236919 | Ga0068859_1012369192 | 128 |
| 384 | 3300005718 | Ga0068866_10184305 | Ga0068866_101843052 | 128 |
| 385 | 3300005718 | Ga0068866_10208917 | Ga0068866_102089172 | 128 |
| 386 | 3300005841 | Ga0068863_100117351 | Ga0068863_1001173511 | 128 |
| 387 | 3300005842 | Ga0068858_100244294 | Ga0068858_1002442942 | 128 |
| 388 | 3300005842 | Ga0068858_100611462 | Ga0068858_1006114622 | 128 |
| 389 | 3300005843 | Ga0068860_100354647 | Ga0068860_1003546473 | 128 |
| 390 | 3300005843 | Ga0068860_100400160 | Ga0068860_1004001602 | 128 |
| 391 | 3300005843 | Ga0068860_100585771 | Ga0068860_1005857711 | 128 |
| 392 | 3300005844 | Ga0068862_100269758 | Ga0068862_1002697582 | 128 |
| 393 | 3300005937 | Ga0081455_10427031 | Ga0081455_104270312 | 128 |
| 394 | 3300005981 | Ga0081538_10001222 | Ga0081538_1000122213 | 128 |
| 395 | 3300005983 | Ga0081540_1205164 | Ga0081540_12051641 | 128 |
| 396 | 3300005985 | Ga0081539_10138687 | Ga0081539_101386873 | 128 |
| 397 | 3300006038 | Ga0075365_10111571 | Ga0075365_101115713 | 128 |
| 398 | 3300006038 | Ga0075365_10300975 | Ga0075365_103009752 | 128 |
| 399 | 3300006038 | Ga0075365_10464055 | Ga0075365_104640551 | 128 |
| 400 | 3300006042 | Ga0075368_10006038 | Ga0075368_100060384 | 128 |
| 401 | 3300006048 | Ga0075363_100226531 | Ga0075363_1002265313 | 128 |
| 402 | 3300006048 | Ga0075363_100277487 | Ga0075363_1002774872 | 128 |
| 403 | 3300006051 | Ga0075364_10030335 | Ga0075364_100303353 | 128 |
| 404 | 3300006051 | Ga0075364_10619061 | Ga0075364_106190612 | 128 |
| 405 | 3300006177 | Ga0075362_10022671 | Ga0075362_100226711 | 128 |
| 406 | 3300006178 | Ga0075367_10563272 | Ga0075367_105632721 | 128 |
| 407 | 3300006186 | Ga0075369_10034622 | Ga0075369_100346222 | 128 |
| 408 | 3300006186 | Ga0075369_10088562 | Ga0075369_100885623 | 128 |
| 409 | 3300006195 | Ga0075366_10047140 | Ga0075366_100471403 | 128 |
| 410 | 3300006195 | Ga0075366_10545116 | Ga0075366_105451161 | 128 |
| 411 | 3300006353 | Ga0075370_10229335 | Ga0075370_102293351 | 128 |
| 412 | 3300006358 | Ga0068871_100848913 | Ga0068871_1008489131 | 128 |
| 413 | 3300006358 | Ga0068871_101017249 | Ga0068871_1010172492 | 128 |
| 414 | 3300006844 | Ga0075428_100007957 | Ga0075428_1000079573 | 128 |
| 415 | 3300006844 | Ga0075428_100956125 | Ga0075428_1009561252 | 128 |
| 416 | 3300006846 | Ga0075430_100058369 | Ga0075430_1000583692 | 128 |
| 417 | 3300006846 | Ga0075430_100677977 | Ga0075430_1006779772 | 128 |
| 418 | 3300006847 | Ga0075431_100000003 | Ga0075431_100000003111 | 128 |
| 419 | 3300006847 | Ga0075431_100073780 | Ga0075431_1000737804 | 128 |
| 420 | 3300006852 | Ga0075433_10446718 | Ga0075433_104467183 | 128 |
| 421 | 3300006852 | Ga0075433_10458333 | Ga0075433_104583332 | 128 |
| 422 | 3300006871 | Ga0075434_101285425 | Ga0075434_1012854252 | 128 |
| 423 | 3300006880 | Ga0075429_100086645 | Ga0075429_1000866454 | 128 |
| 424 | 3300006881 | Ga0068865_101821739 | Ga0068865_1018217392 | 128 |
| 425 | 3300006931 | Ga0097620_100757015 | Ga0097620_1007570152 | 128 |
| 426 | 3300006931 | Ga0097620_101236923 | Ga0097620_1012369232 | 128 |
| 427 | 3300006941 | Ga0099825_1034203 | Ga0099825_10342032 | 128 |
| 428 | 3300006942 | Ga0099824_1008295 | Ga0099824_10082953 | 128 |
| 429 | 3300006943 | Ga0099822_1047693 | Ga0099822_10476932 | 128 |
| 430 | 3300006944 | Ga0099823_1082188 | Ga0099823_10821882 | 128 |
| 431 | 3300006944 | Ga0099823_1128175 | Ga0099823_11281752 | 128 |
| 432 | 3300007076 | Ga0075435_100135066 | Ga0075435_1001350663 | 128 |
| 433 | 3300007076 | Ga0075435_100265617 | Ga0075435_1002656172 | 128 |
| 434 | 3300007076 | Ga0075435_100265959 | Ga0075435_1002659592 | 128 |
| 435 | 3300007076 | Ga0075435_100419858 | Ga0075435_1004198582 | 128 |
| 436 | 3300009092 | Ga0105250_10171171 | Ga0105250_101711712 | 128 |
| 437 | 3300009093 | Ga0105240_10005199 | Ga0105240_1000519915 | 128 |
| 438 | 3300009093 | Ga0105240_10208055 | Ga0105240_102080554 | 128 |
| 439 | 3300009093 | Ga0105240_10330563 | Ga0105240_103305632 | 128 |
| 440 | 3300009093 | Ga0105240_12709916 | Ga0105240_127099161 | 128 |
| 441 | 3300009094 | Ga0111539_10000504 | Ga0111539_1000050436 | 128 |
| 442 | 3300009094 | Ga0111539_10042598 | Ga0111539_100425982 | 128 |
| 443 | 3300009094 | Ga0111539_10188945 | Ga0111539_101889451 | 128 |
| 444 | 3300009101 | Ga0105247_10015814 | Ga0105247_100158146 | 128 |
| 445 | 3300009101 | Ga0105247_10299937 | Ga0105247_102999372 | 128 |
| 446 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006278 | 128 |
| 447 | 3300009147 | Ga0114129_10443960 | Ga0114129_104439603 | 128 |
| 448 | 3300009148 | Ga0105243_10092482 | Ga0105243_100924822 | 128 |
| 449 | 3300009148 | Ga0105243_10145212 | Ga0105243_101452123 | 128 |
| 450 | 3300009174 | Ga0105241_10067148 | Ga0105241_100671482 | 128 |
| 451 | 3300009174 | Ga0105241_10134050 | Ga0105241_101340502 | 128 |
| 452 | 3300009174 | Ga0105241_10367629 | Ga0105241_103676291 | 128 |
| 453 | 3300009174 | Ga0105241_10559150 | Ga0105241_105591502 | 128 |
| 454 | 3300009176 | Ga0105242_10420308 | Ga0105242_104203082 | 128 |
| 455 | 3300009177 | Ga0105248_10188067 | Ga0105248_101880673 | 128 |
| 456 | 3300009177 | Ga0105248_10221684 | Ga0105248_102216843 | 128 |
| 457 | 3300009545 | Ga0105237_10003771 | Ga0105237_1000377115 | 128 |
| 458 | 3300009545 | Ga0105237_10009728 | Ga0105237_100097284 | 128 |
| 459 | 3300009545 | Ga0105237_10200368 | Ga0105237_102003682 | 128 |
| 460 | 3300009545 | Ga0105237_12028378 | Ga0105237_120283781 | 128 |
| 461 | 3300009551 | Ga0105238_10205129 | Ga0105238_102051293 | 128 |
| 462 | 3300009551 | Ga0105238_10274416 | Ga0105238_102744162 | 128 |
| 463 | 3300009553 | Ga0105249_10046667 | Ga0105249_100466672 | 128 |
| 464 | 3300009553 | Ga0105249_10152947 | Ga0105249_101529472 | 128 |
| 465 | 3300009553 | Ga0105249_11086502 | Ga0105249_110865021 | 128 |
| 466 | 3300010375 | Ga0105239_10027503 | Ga0105239_100275033 | 128 |
| 467 | 3300010375 | Ga0105239_10070819 | Ga0105239_100708195 | 128 |
| 468 | 3300010375 | Ga0105239_10284074 | Ga0105239_102840742 | 128 |
| 469 | 3300010375 | Ga0105239_10903292 | Ga0105239_109032922 | 128 |
| 470 | 3300010375 | Ga0105239_10964878 | Ga0105239_109648782 | 128 |
| 471 | 3300010375 | Ga0105239_11400150 | Ga0105239_114001502 | 128 |
| 472 | 3300013296 | Ga0157374_10061313 | Ga0157374_100613133 | 128 |
| 473 | 3300013296 | Ga0157374_10724610 | Ga0157374_107246102 | 128 |
| 474 | 3300013296 | Ga0157374_10793288 | Ga0157374_107932882 | 128 |
| 475 | 3300013297 | Ga0157378_10089921 | Ga0157378_100899213 | 128 |
| 476 | 3300013306 | Ga0163162_10483629 | Ga0163162_104836293 | 128 |
| 477 | 3300013306 | Ga0163162_11182607 | Ga0163162_111826071 | 128 |
| 478 | 3300013307 | Ga0157372_13322672 | Ga0157372_133226721 | 128 |
| 479 | 3300013308 | Ga0157375_10554349 | Ga0157375_105543493 | 128 |
| 480 | 3300013308 | Ga0157375_10689452 | Ga0157375_106894522 | 128 |
| 481 | 3300013308 | Ga0157375_12376244 | Ga0157375_123762441 | 128 |
| 482 | 3300014325 | Ga0163163_10108419 | Ga0163163_101084193 | 128 |
| 483 | 3300014325 | Ga0163163_10420667 | Ga0163163_104206672 | 128 |
| 484 | 3300014325 | Ga0163163_10764936 | Ga0163163_107649362 | 128 |
| 485 | 3300014326 | Ga0157380_11164888 | Ga0157380_111648882 | 128 |
| 486 | 3300014968 | Ga0157379_10271735 | Ga0157379_102717352 | 128 |
| 487 | 3300014968 | Ga0157379_10600355 | Ga0157379_106003551 | 128 |
| 488 | 3300014969 | Ga0157376_13126642 | Ga0157376_131266421 | 128 |
| 489 | 3300015262 | Ga0182007_10191258 | Ga0182007_101912581 | 128 |
| 490 | 3300021321 | Ga0214542_1040082 | Ga0214542_10400822 | 128 |
| 491 | 3300021324 | Ga0214545_1049363 | Ga0214545_10493631 | 128 |
| 492 | 3300021327 | Ga0214543_1040892 | Ga0214543_10408922 | 128 |
| 493 | 3300025226 | Ga0209674_107151 | Ga0209674_1071513 | 128 |
| 494 | 3300025230 | Ga0209563_100025 | Ga0209563_100025436 | 128 |
| 495 | 3300025254 | Ga0209148_1001706 | Ga0209148_10017068 | 128 |
| 496 | 3300025256 | Ga0209759_1003269 | Ga0209759_10032692 | 128 |
| 497 | 3300025256 | Ga0209759_1003924 | Ga0209759_10039243 | 128 |
| 498 | 3300025261 | Ga0209233_1017254 | Ga0209233_10172542 | 128 |
| 499 | 3300025261 | Ga0209233_1019148 | Ga0209233_10191482 | 128 |
| 500 | 3300025284 | Ga0209130_1042214 | Ga0209130_10422142 | 128 |
| 501 | 3300025295 | Ga0209564_1004981 | Ga0209564_10049813 | 128 |
| 502 | 3300025297 | Ga0209758_1000397 | Ga0209758_100039738 | 128 |
| 503 | 3300025297 | Ga0209758_1032773 | Ga0209758_10327732 | 128 |
| 504 | 3300025299 | Ga0209256_1016929 | Ga0209256_10169292 | 128 |
| 505 | 3300025299 | Ga0209256_1019562 | Ga0209256_10195622 | 128 |
| 506 | 3300025299 | Ga0209256_1069455 | Ga0209256_10694552 | 128 |
| 507 | 3300025302 | Ga0207426_1000886 | Ga0207426_10008867 | 128 |
| 508 | 3300025304 | Ga0209257_1080457 | Ga0209257_10804572 | 128 |
| 509 | 3300025304 | Ga0209257_1124311 | Ga0209257_11243112 | 128 |
| 510 | 3300025711 | Ga0207696_1087903 | Ga0207696_10879032 | 128 |
| 511 | 3300025900 | Ga0207710_10097910 | Ga0207710_100979101 | 128 |
| 512 | 3300025900 | Ga0207710_10217379 | Ga0207710_102173792 | 128 |
| 513 | 3300025900 | Ga0207710_10314277 | Ga0207710_103142772 | 128 |
| 514 | 3300025901 | Ga0207688_10077703 | Ga0207688_100777033 | 128 |
| 515 | 3300025904 | Ga0207647_10007446 | Ga0207647_100074464 | 128 |
| 516 | 3300025904 | Ga0207647_10400278 | Ga0207647_104002781 | 128 |
| 517 | 3300025906 | Ga0207699_10612949 | Ga0207699_106129491 | 128 |
| 518 | 3300025909 | Ga0207705_10453777 | Ga0207705_104537772 | 128 |
| 519 | 3300025911 | Ga0207654_10044616 | Ga0207654_100446162 | 128 |
| 520 | 3300025911 | Ga0207654_10047882 | Ga0207654_100478823 | 128 |
| 521 | 3300025911 | Ga0207654_10112180 | Ga0207654_101121802 | 128 |
| 522 | 3300025913 | Ga0207695_10000148 | Ga0207695_10000148152 | 128 |
| 523 | 3300025913 | Ga0207695_10492398 | Ga0207695_104923982 | 128 |
| 524 | 3300025914 | Ga0207671_10002713 | Ga0207671_100027135 | 128 |
| 525 | 3300025914 | Ga0207671_10151361 | Ga0207671_101513613 | 128 |
| 526 | 3300025919 | Ga0207657_10026602 | Ga0207657_100266024 | 128 |
| 527 | 3300025919 | Ga0207657_10127631 | Ga0207657_101276312 | 128 |
| 528 | 3300025922 | Ga0207646_10780842 | Ga0207646_107808422 | 128 |
| 529 | 3300025924 | Ga0207694_10166327 | Ga0207694_101663272 | 128 |
| 530 | 3300025926 | Ga0207659_10987391 | Ga0207659_109873912 | 128 |
| 531 | 3300025927 | Ga0207687_10147173 | Ga0207687_101471732 | 128 |
| 532 | 3300025927 | Ga0207687_10192006 | Ga0207687_101920062 | 128 |
| 533 | 3300025928 | Ga0207700_11939193 | Ga0207700_119391931 | 128 |
| 534 | 3300025931 | Ga0207644_10152295 | Ga0207644_101522953 | 128 |
| 535 | 3300025932 | Ga0207690_10044661 | Ga0207690_100446614 | 128 |
| 536 | 3300025932 | Ga0207690_10374053 | Ga0207690_103740532 | 128 |
| 537 | 3300025933 | Ga0207706_10168661 | Ga0207706_101686612 | 128 |
| 538 | 3300025933 | Ga0207706_10347683 | Ga0207706_103476832 | 128 |
| 539 | 3300025933 | Ga0207706_11389754 | Ga0207706_113897542 | 128 |
| 540 | 3300025934 | Ga0207686_10153635 | Ga0207686_101536352 | 128 |
| 541 | 3300025935 | Ga0207709_10118512 | Ga0207709_101185122 | 128 |
| 542 | 3300025936 | Ga0207670_11090472 | Ga0207670_110904721 | 128 |
| 543 | 3300025939 | Ga0207665_10595739 | Ga0207665_105957393 | 128 |
| 544 | 3300025941 | Ga0207711_10181683 | Ga0207711_101816832 | 128 |
| 545 | 3300025942 | Ga0207689_10238012 | Ga0207689_102380122 | 128 |
| 546 | 3300025942 | Ga0207689_10384788 | Ga0207689_103847882 | 128 |
| 547 | 3300025942 | Ga0207689_11796817 | Ga0207689_117968171 | 128 |
| 548 | 3300025945 | Ga0207679_10348578 | Ga0207679_103485783 | 128 |
| 549 | 3300025949 | Ga0207667_10454558 | Ga0207667_104545582 | 128 |
| 550 | 3300025949 | Ga0207667_11057383 | Ga0207667_110573832 | 128 |
| 551 | 3300025961 | Ga0207712_10044794 | Ga0207712_100447943 | 128 |
| 552 | 3300025972 | Ga0207668_10085104 | Ga0207668_100851042 | 128 |
| 553 | 3300025981 | Ga0207640_10395606 | Ga0207640_103956061 | 128 |
| 554 | 3300025986 | Ga0207658_10155946 | Ga0207658_101559462 | 128 |
| 555 | 3300026023 | Ga0207677_10198109 | Ga0207677_101981092 | 128 |
| 556 | 3300026023 | Ga0207677_10317934 | Ga0207677_103179342 | 128 |
| 557 | 3300026035 | Ga0207703_10204174 | Ga0207703_102041743 | 128 |
| 558 | 3300026041 | Ga0207639_10089594 | Ga0207639_100895943 | 128 |
| 559 | 3300026041 | Ga0207639_11381071 | Ga0207639_113810711 | 128 |
| 560 | 3300026067 | Ga0207678_10328064 | Ga0207678_103280642 | 128 |
| 561 | 3300026067 | Ga0207678_11484875 | Ga0207678_114848751 | 128 |
| 562 | 3300026067 | Ga0207678_11520632 | Ga0207678_115206321 | 128 |
| 563 | 3300026075 | Ga0207708_10191222 | Ga0207708_101912223 | 128 |
| 564 | 3300026075 | Ga0207708_11138764 | Ga0207708_111387641 | 128 |
| 565 | 3300026078 | Ga0207702_10112744 | Ga0207702_101127443 | 128 |
| 566 | 3300026078 | Ga0207702_10224358 | Ga0207702_102243583 | 128 |
| 567 | 3300026088 | Ga0207641_10293638 | Ga0207641_102936383 | 128 |
| 568 | 3300026088 | Ga0207641_10407342 | Ga0207641_104073422 | 128 |
| 569 | 3300026095 | Ga0207676_10549397 | Ga0207676_105493972 | 128 |
| 570 | 3300026116 | Ga0207674_10238330 | Ga0207674_102383302 | 128 |
| 571 | 3300026118 | Ga0207675_100665908 | Ga0207675_1006659081 | 128 |
| 572 | 3300026142 | Ga0207698_10914008 | Ga0207698_109140081 | 128 |
| 573 | 3300026142 | Ga0207698_11082097 | Ga0207698_110820972 | 128 |
| 574 | 3300027296 | Ga0209389_1000157 | Ga0209389_100015710 | 128 |
| 575 | 3300027296 | Ga0209389_1002855 | Ga0209389_10028554 | 128 |
| 576 | 3300027357 | Ga0209589_1006917 | Ga0209589_100691710 | 128 |
| 577 | 3300027361 | Ga0209489_100045 | Ga0209489_100045146 | 128 |
| 578 | 3300027361 | Ga0209489_101111 | Ga0209489_10111150 | 128 |
| 579 | 3300027363 | Ga0209700_100011 | Ga0209700_100011308 | 128 |
| 580 | 3300027866 | Ga0209813_10023191 | Ga0209813_100231911 | 128 |
| 581 | 3300027907 | Ga0207428_10003737 | Ga0207428_1000373710 | 128 |
| 582 | 3300028379 | Ga0268266_10189744 | Ga0268266_101897442 | 128 |
| 583 | 3300028379 | Ga0268266_10371353 | Ga0268266_103713532 | 128 |
| 584 | 3300028379 | Ga0268266_10751197 | Ga0268266_107511972 | 128 |
| 585 | 3300028380 | Ga0268265_10149880 | Ga0268265_101498802 | 128 |
| 586 | 3300028380 | Ga0268265_10269682 | Ga0268265_102696823 | 128 |
| 587 | 3300028380 | Ga0268265_12143009 | Ga0268265_121430092 | 128 |
| 588 | 3300028381 | Ga0268264_10388154 | Ga0268264_103881543 | 128 |
| 589 | 3300033180 | Ga0307510_10030650 | Ga0307510_100306502 | 128 |
| 590 | 3300035724 | Ga0373933_0000068 | Ga0373933_0000068_19825_20214 | 128 |
| 591 | 3300035724 | Ga0373933_0246808 | Ga0373933_0246808_472_861 | 128 |
| 592 | 3300035725 | Ga0373947_0325052 | Ga0373947_0325052_229_615 | 128 |
| 593 | 3300036401 | Ga0373937_1254905 | Ga0373937_1254905_46_432 | 128 |
| 594 | 3300037853 | Ga0436364_1404047 | Ga0436364_1404047_219_605 | 128 |
| 595 | 3300039437 | Ga0436365_0368099 | Ga0436365_0368099_115_501 | 128 |
| 596 | 3300039447 | Ga0436361_1011853 | Ga0436361_1011853_2036_2422 | 128 |
| 597 | 3300039450 | Ga0436363_1313418 | Ga0436363_1313418_294_680 | 128 |
| 598 | 3300041404 | Ga0439436_0024136 | Ga0439436_0024136_400_789 | 128 |
| 599 | 3300041413 | Ga0439465_0000040 | Ga0439465_0000040_23902_24291 | 128 |
| 600 | 3300041997 | Ga0439431_0212070 | Ga0439431_0212070_61_450 | 128 |
| 601 | 3300042007 | Ga0439449_0000398 | Ga0439449_0000398_12620_13009 | 128 |
| 602 | 3300044656 | Ga0466969_0007141 | Ga0466969_0007141_2447_2833 | 128 |
| 603 | 3300044658 | Ga0466972_0003163 | Ga0466972_0003163_7046_7432 | 128 |
| 604 | 3300044658 | Ga0466972_0260021 | Ga0466972_0260021_228_614 | 128 |
| 605 | 3300044668 | Ga0466980_0047200 | Ga0466980_0047200_1559_1951 | 128 |
| 606 | 3300044684 | Ga0466966_0017642 | Ga0466966_0017642_1306_1692 | 128 |
| 607 | 3300044684 | Ga0466966_0030637 | Ga0466966_0030637_1487_1873 | 128 |
| 608 | 3300044693 | Ga0466961_0000849 | Ga0466961_0000849_8430_8816 | 128 |
| 609 | 3300044693 | Ga0466961_0014864 | Ga0466961_0014864_4539_4931 | 128 |
| 610 | 3300044693 | Ga0466961_0110028 | Ga0466961_0110028_315_701 | 128 |
| 611 | 3300044694 | Ga0466963_0004353 | Ga0466963_0004353_5781_6167 | 128 |
| 612 | 3300044706 | Ga0466964_0065636 | Ga0466964_0065636_184_570 | 128 |
| 613 | 3300044735 | Ga0466968_0080763 | Ga0466968_0080763_600_986 | 128 |
| 614 | 3300044735 | Ga0466968_0311148 | Ga0466968_0311148_78_464 | 128 |
| 615 | 3300044765 | Ga0466970_0168601 | Ga0466970_0168601_553_939 | 128 |
| 616 | 3300044765 | Ga0466970_0412746 | Ga0466970_0412746_64_450 | 128 |
| 617 | 3300045049 | Ga0466959_0017369 | Ga0466959_0017369_1297_1683 | 128 |
| 618 | 3300045049 | Ga0466959_0025900 | Ga0466959_0025900_1618_2004 | 128 |
| 619 | 3300045836 | Ga0466958_0308602 | Ga0466958_0308602_614_1000 | 128 |
| 620 | 3300045836 | Ga0466958_0590491 | Ga0466958_0590491_45_437 | 128 |
| 621 | 3300045976 | Ga0466967_0015071 | Ga0466967_0015071_2817_3203 | 128 |
| 622 | 3300046457 | Ga0495590_0092190 | Ga0495590_0092190_190_576 | 128 |
| 623 | 3300046459 | Ga0495629_0083216 | Ga0495629_0083216_798_1184 | 128 |
| 624 | 3300046459 | Ga0495629_0342721 | Ga0495629_0342721_617_1003 | 128 |
| 625 | 3300046462 | Ga0495651_0091567 | Ga0495651_0091567_918_1304 | 128 |
| 626 | 3300046463 | Ga0495653_0265840 | Ga0495653_0265840_469_855 | 128 |
| 627 | 3300046474 | Ga0495605_0138396 | Ga0495605_0138396_316_702 | 128 |
| 628 | 3300046474 | Ga0495605_0145849 | Ga0495605_0145849_282_668 | 128 |
| 629 | 3300046474 | Ga0495605_0325839 | Ga0495605_0325839_10_396 | 128 |
| 630 | 3300046475 | Ga0495639_0317123 | Ga0495639_0317123_271_657 | 128 |
| 631 | 3300046476 | Ga0495662_0120272 | Ga0495662_0120272_394_780 | 128 |
| 632 | 3300046500 | Ga0495596_0096004 | Ga0495596_0096004_128_514 | 128 |
| 633 | 3300046506 | Ga0495583_0058267 | Ga0495583_0058267_739_1137 | 128 |
| 634 | 3300046506 | Ga0495583_0124159 | Ga0495583_0124159_66_452 | 128 |
| 635 | 3300046507 | Ga0495606_0031017 | Ga0495606_0031017_3073_3459 | 128 |
| 636 | 3300046507 | Ga0495606_0043113 | Ga0495606_0043113_246_632 | 128 |
| 637 | 3300046507 | Ga0495606_0244358 | Ga0495606_0244358_434_820 | 128 |
| 638 | 3300046511 | Ga0495608_0027780 | Ga0495608_0027780_1759_2145 | 128 |
| 639 | 3300046512 | Ga0495610_0076110 | Ga0495610_0076110_113_499 | 128 |
| 640 | 3300046513 | Ga0495616_0030402 | Ga0495616_0030402_763_1149 | 128 |
| 641 | 3300046513 | Ga0495616_0150921 | Ga0495616_0150921_526_924 | 128 |
| 642 | 3300046515 | Ga0495620_0188813 | Ga0495620_0188813_31_417 | 128 |
| 643 | 3300046516 | Ga0495628_0301397 | Ga0495628_0301397_278_664 | 128 |
| 644 | 3300046516 | Ga0495628_0708442 | Ga0495628_0708442_252_638 | 128 |
| 645 | 3300046519 | Ga0495632_0300364 | Ga0495632_0300364_246_632 | 128 |
| 646 | 3300046522 | Ga0495643_0019724 | Ga0495643_0019724_1760_2146 | 128 |
| 647 | 3300046522 | Ga0495643_0144262 | Ga0495643_0144262_473_859 | 128 |
| 648 | 3300046522 | Ga0495643_0263163 | Ga0495643_0263163_270_656 | 128 |
| 649 | 3300046524 | Ga0495648_0272860 | Ga0495648_0272860_44_430 | 128 |
| 650 | 3300046524 | Ga0495648_0294076 | Ga0495648_0294076_146_532 | 128 |
| 651 | 3300046524 | Ga0495648_0461180 | Ga0495648_0461180_106_492 | 128 |
| 652 | 3300046529 | Ga0495652_0144078 | Ga0495652_0144078_455_841 | 128 |
| 653 | 3300046530 | Ga0495654_0169746 | Ga0495654_0169746_431_817 | 128 |
| 654 | 3300046533 | Ga0495640_0065792 | Ga0495640_0065792_1111_1497 | 128 |
| 655 | 3300046536 | Ga0495587_0104524 | Ga0495587_0104524_438_824 | 128 |
| 656 | 3300046538 | Ga0495609_0209427 | Ga0495609_0209427_171_557 | 128 |
| 657 | 3300046538 | Ga0495609_0283019 | Ga0495609_0283019_73_459 | 128 |
| 658 | 3300046542 | Ga0495597_0016294 | Ga0495597_0016294_1583_1969 | 128 |
| 659 | 3300046557 | Ga0495622_0047423 | Ga0495622_0047423_1129_1515 | 128 |
| 660 | 3300046557 | Ga0495622_0059200 | Ga0495622_0059200_1107_1493 | 128 |
| 661 | 3300046616 | Ga0495668_0025947 | Ga0495668_0025947_1949_2335 | 128 |
| 662 | 3300046616 | Ga0495668_0109260 | Ga0495668_0109260_236_634 | 128 |
| 663 | 3300046616 | Ga0495668_0294907 | Ga0495668_0294907_86_472 | 128 |
| 664 | 3300046642 | Ga0495634_0295030 | Ga0495634_0295030_527_913 | 128 |
| 665 | 3300046660 | Ga0495625_0185183 | Ga0495625_0185183_801_1187 | 128 |
| 666 | 3300046660 | Ga0495625_0265945 | Ga0495625_0265945_386_772 | 128 |
| 667 | 3300046660 | Ga0495625_0736094 | Ga0495625_0736094_159_545 | 128 |
| 668 | 3300046663 | Ga0495635_0007080 | Ga0495635_0007080_1506_1892 | 128 |
| 669 | 3300046663 | Ga0495635_0249521 | Ga0495635_0249521_564_953 | 128 |
| 670 | 3300046665 | Ga0495661_0019318 | Ga0495661_0019318_379_777 | 128 |
| 671 | 3300046674 | Ga0495588_0120418 | Ga0495588_0120418_295_693 | 128 |
| 672 | 3300046674 | Ga0495588_0134094 | Ga0495588_0134094_722_1108 | 128 |
| 673 | 3300046675 | Ga0495657_0082505 | Ga0495657_0082505_288_674 | 128 |
| 674 | 3300046680 | Ga0495646_0062776 | Ga0495646_0062776_287_673 | 128 |
| 675 | 3300046683 | Ga0495658_0152049 | Ga0495658_0152049_982_1371 | 128 |
| 676 | 3300046683 | Ga0495658_0160461 | Ga0495658_0160461_285_671 | 128 |
| 677 | 3300046689 | Ga0495613_0115015 | Ga0495613_0115015_672_1058 | 128 |
| 678 | 3300046690 | Ga0495624_0069272 | Ga0495624_0069272_834_1220 | 128 |
| 679 | 3300046691 | Ga0495670_0089042 | Ga0495670_0089042_458_856 | 128 |
| 680 | 3300046692 | Ga0495671_0626322 | Ga0495671_0626322_12_398 | 128 |
| 681 | 3300046694 | Ga0495649_0007561 | Ga0495649_0007561_5820_6206 | 128 |
| 682 | 3300046694 | Ga0495649_0118585 | Ga0495649_0118585_721_1107 | 128 |
| 683 | 3300046694 | Ga0495649_0132640 | Ga0495649_0132640_482_868 | 128 |
| 684 | 3300046809 | Ga0495600_0058329 | Ga0495600_0058329_678_1064 | 128 |
| 685 | 3300047315 | Ga0495581_0525418 | Ga0495581_0525418_76_462 | 128 |
| 686 | 3300047317 | Ga0495604_0002649 | Ga0495604_0002649_7791_8177 | 128 |
| 687 | 3300047318 | Ga0495636_0005476 | Ga0495636_0005476_2173_2571 | 128 |
| 688 | 3300047319 | Ga0495674_0108061 | Ga0495674_0108061_135_521 | 128 |
| 689 | 3300047319 | Ga0495674_1117257 | Ga0495674_1117257_129_515 | 128 |
| 690 | 3300047321 | Ga0495676_0106528 | Ga0495676_0106528_988_1374 | 128 |
| 691 | 3300047321 | Ga0495676_0276381 | Ga0495676_0276381_592_978 | 128 |
| 692 | 3300047322 | Ga0495680_0230504 | Ga0495680_0230504_881_1270 | 128 |
| 693 | 3300047323 | Ga0495683_0171618 | Ga0495683_0171618_10_396 | 128 |
| 694 | 3300047323 | Ga0495683_0281631 | Ga0495683_0281631_144_530 | 128 |
| 695 | 3300047443 | Ga0495687_015370 | Ga0495687_015370_1751_2137 | 128 |
| 696 | 3300047444 | Ga0495675_0464355 | Ga0495675_0464355_176_562 | 128 |
| 697 | 3300047469 | Ga0495673_0068596 | Ga0495673_0068596_299_685 | 128 |
| 698 | 3300047469 | Ga0495673_0094867 | Ga0495673_0094867_166_552 | 128 |
| 699 | 3300047673 | Ga0495593_0285275 | Ga0495593_0285275_222_608 | 128 |
| 700 | 3300048088 | Ga0495602_0148575 | Ga0495602_0148575_637_1023 | 128 |
| 701 | 3300048903 | Ga0496100_0051591 | Ga0496100_0051591_561_947 | 128 |
| 702 | 3300048903 | Ga0496100_0257014 | Ga0496100_0257014_353_739 | 128 |
| 703 | 3300048904 | Ga0496101_0111450 | Ga0496101_0111450_652_1038 | 128 |
| 704 | 3300048904 | Ga0496101_0167719 | Ga0496101_0167719_444_830 | 128 |
| 705 | 3300048904 | Ga0496101_0508112 | Ga0496101_0508112_36_422 | 128 |
| 706 | 3300048904 | Ga0496101_0816273 | Ga0496101_0816273_29_415 | 128 |
| 707 | 3300048905 | Ga0496102_0007791 | Ga0496102_0007791_2914_3300 | 128 |
| 708 | 3300048905 | Ga0496102_0145385 | Ga0496102_0145385_908_1294 | 128 |
| 709 | 3300048905 | Ga0496102_0269762 | Ga0496102_0269762_1007_1405 | 128 |
| 710 | 3300048905 | Ga0496102_0301397 | Ga0496102_0301397_97_483 | 128 |
| 711 | 3300048905 | Ga0496102_0852831 | Ga0496102_0852831_280_666 | 128 |
| 712 | 3300048905 | Ga0496102_1121387 | Ga0496102_1121387_272_658 | 128 |
| 713 | 3300048906 | Ga0496103_0003944 | Ga0496103_0003944_1624_2010 | 128 |
| 714 | 3300048906 | Ga0496103_0080964 | Ga0496103_0080964_181_579 | 128 |
| 715 | 3300048907 | Ga0496104_0000896 | Ga0496104_0000896_4884_5270 | 128 |
| 716 | 3300048907 | Ga0496104_0148887 | Ga0496104_0148887_926_1312 | 128 |
| 717 | 3300048907 | Ga0496104_0172657 | Ga0496104_0172657_692_1078 | 128 |
| 718 | 3300048908 | Ga0496105_0009605 | Ga0496105_0009605_1105_1491 | 128 |
| 719 | 3300048908 | Ga0496105_0034201 | Ga0496105_0034201_3372_3758 | 128 |
| 720 | 3300048908 | Ga0496105_0048155 | Ga0496105_0048155_969_1355 | 128 |
| 721 | 3300048908 | Ga0496105_0196347 | Ga0496105_0196347_18_404 | 128 |
| 722 | 3300048909 | Ga0496106_0133527 | Ga0496106_0133527_1542_1928 | 128 |
| 723 | 3300048909 | Ga0496106_0176907 | Ga0496106_0176907_926_1324 | 128 |
| 724 | 3300048909 | Ga0496106_0233591 | Ga0496106_0233591_955_1341 | 128 |
| 725 | 3300048910 | Ga0496107_0810164 | Ga0496107_0810164_263_649 | 128 |
| 726 | 3300048910 | Ga0496107_0924951 | Ga0496107_0924951_10_396 | 128 |
| 727 | 3300048910 | Ga0496107_1013894 | Ga0496107_1013894_91_477 | 128 |
| 728 | 3300048911 | Ga0496108_0093896 | Ga0496108_0093896_210_596 | 128 |
| 729 | 3300048911 | Ga0496108_0181189 | Ga0496108_0181189_689_1075 | 128 |
| 730 | 3300048912 | Ga0496109_0032965 | Ga0496109_0032965_3998_4384 | 128 |
| 731 | 3300048912 | Ga0496109_0694419 | Ga0496109_0694419_209_595 | 128 |
| 732 | 3300048913 | Ga0496110_0185077 | Ga0496110_0185077_1426_1812 | 128 |
| 733 | 3300048913 | Ga0496110_0218656 | Ga0496110_0218656_36_422 | 128 |
| 734 | 3300048913 | Ga0496110_0350871 | Ga0496110_0350871_252_638 | 128 |
| 735 | 3300048915 | Ga0496112_0154635 | Ga0496112_0154635_942_1328 | 128 |
| 736 | 3300048915 | Ga0496112_0624199 | Ga0496112_0624199_161_547 | 128 |
| 737 | 3300048915 | Ga0496112_0637107 | Ga0496112_0637107_129_515 | 128 |
| 738 | 3300048916 | Ga0496113_0008940 | Ga0496113_0008940_5187_5573 | 128 |
| 739 | 3300048916 | Ga0496113_0019656 | Ga0496113_0019656_695_1081 | 128 |
| 740 | 3300048916 | Ga0496113_0133740 | Ga0496113_0133740_684_1070 | 128 |
| 741 | 3300048916 | Ga0496113_0399006 | Ga0496113_0399006_291_677 | 128 |
| 742 | 3300048917 | Ga0496114_0128797 | Ga0496114_0128797_1371_1757 | 128 |
| 743 | 3300048917 | Ga0496114_0187411 | Ga0496114_0187411_61_447 | 128 |
| 744 | 3300048917 | Ga0496114_0384536 | Ga0496114_0384536_846_1232 | 128 |
| 745 | 3300048918 | Ga0496115_0002618 | Ga0496115_0002618_8782_9168 | 128 |
| 746 | 3300048918 | Ga0496115_0132308 | Ga0496115_0132308_61_447 | 128 |
| 747 | 3300048918 | Ga0496115_0171231 | Ga0496115_0171231_692_1078 | 128 |
| 748 | 3300048919 | Ga0496116_0063313 | Ga0496116_0063313_1500_1886 | 128 |
| 749 | 3300048920 | Ga0496117_0090930 | Ga0496117_0090930_1204_1590 | 128 |
| 750 | 3300048920 | Ga0496117_0215132 | Ga0496117_0215132_164_550 | 128 |
| 751 | 3300048921 | Ga0496118_0216629 | Ga0496118_0216629_267_653 | 128 |
| 752 | 3300048921 | Ga0496118_0376014 | Ga0496118_0376014_232_618 | 128 |
| 753 | 3300048921 | Ga0496118_0406508 | Ga0496118_0406508_108_494 | 128 |
| 754 | 3300048922 | Ga0496119_0010947 | Ga0496119_0010947_1111_1497 | 128 |
| 755 | 3300048922 | Ga0496119_0057211 | Ga0496119_0057211_1188_1574 | 128 |
| 756 | 3300048922 | Ga0496119_0141287 | Ga0496119_0141287_858_1244 | 128 |
| 757 | 3300048922 | Ga0496119_0384077 | Ga0496119_0384077_187_573 | 128 |
| 758 | 3300048923 | Ga0496120_0041739 | Ga0496120_0041739_1173_1559 | 128 |
| 759 | 3300048923 | Ga0496120_0083996 | Ga0496120_0083996_544_930 | 128 |
| 760 | 3300048924 | Ga0496121_0037690 | Ga0496121_0037690_149_535 | 128 |
| 761 | 3300048924 | Ga0496121_0045625 | Ga0496121_0045625_2511_2897 | 128 |
| 762 | 3300048924 | Ga0496121_0099679 | Ga0496121_0099679_1242_1628 | 128 |
| 763 | 3300048924 | Ga0496121_0419972 | Ga0496121_0419972_339_725 | 128 |
| 764 | 3300048925 | Ga0496122_0129629 | Ga0496122_0129629_935_1321 | 128 |
| 765 | 3300048926 | Ga0496123_0141291 | Ga0496123_0141291_339_725 | 128 |
| 766 | 3300048927 | Ga0496124_0010692 | Ga0496124_0010692_8390_8776 | 128 |
| 767 | 3300048927 | Ga0496124_0072508 | Ga0496124_0072508_2106_2492 | 128 |
| 768 | 3300048928 | Ga0496125_0041692 | Ga0496125_0041692_678_1064 | 128 |
| 769 | 3300048928 | Ga0496125_0079792 | Ga0496125_0079792_955_1341 | 128 |
| 770 | 3300048928 | Ga0496125_0497035 | Ga0496125_0497035_285_671 | 128 |
| 771 | 3300048929 | Ga0496126_0082842 | Ga0496126_0082842_1580_1966 | 128 |
| 772 | 3300048929 | Ga0496126_0112419 | Ga0496126_0112419_562_948 | 128 |
| 773 | 3300048929 | Ga0496126_0734975 | Ga0496126_0734975_274_660 | 128 |
| 774 | 3300048929 | Ga0496126_1053827 | Ga0496126_1053827_186_572 | 128 |
| 775 | 3300049460 | Ga0495682_0056409 | Ga0495682_0056409_645_1031 | 128 |
| 776 | 3300049460 | Ga0495682_0182165 | Ga0495682_0182165_290_676 | 128 |
| 777 | 3300049460 | Ga0495682_0362092 | Ga0495682_0362092_91_477 | 128 |
| 778 | 3300049568 | Ga0501031_0826809 | Ga0501031_0826809_154_543 | 128 |
| 779 | 3300049572 | Ga0501036_1307695 | Ga0501036_1307695_120_509 | 128 |
| 780 | 3300049577 | Ga0501041_0703195 | Ga0501041_0703195_52_438 | 128 |
| 781 | 3300049588 | Ga0501072_0104772 | Ga0501072_0104772_1118_1507 | 128 |
| 782 | 3300049591 | Ga0501075_0165053 | Ga0501075_0165053_460_849 | 128 |
| 783 | 3300049592 | Ga0501076_0222417 | Ga0501076_0222417_633_1022 | 128 |
| 784 | 3300049593 | Ga0501077_0107165 | Ga0501077_0107165_531_920 | 128 |
| 785 | 3300049743 | Ga0501081_0398107 | Ga0501081_0398107_231_620 | 128 |
| 786 | 3300050490 | nmdc:mga03n38_439937_c1 | nmdc:mga03n38_439937_c1_104_490 | 128 |
| 787 | 3300050490 | nmdc:mga03n38_643743_c1 | nmdc:mga03n38_643743_c1_142_528 | 128 |
| 788 | 3300050491 | nmdc:mga00v17_109947_c1 | nmdc:mga00v17_109947_c1_620_1006 | 128 |
| 789 | 3300050491 | nmdc:mga00v17_492634_c1 | nmdc:mga00v17_492634_c1_335_721 | 128 |
| 790 | 3300050492 | nmdc:mga0yw44_14029_c1 | nmdc:mga0yw44_14029_c1_2989_3375 | 128 |
| 791 | 3300050492 | nmdc:mga0yw44_273673_c1 | nmdc:mga0yw44_273673_c1_516_902 | 128 |
| 792 | 3300050492 | nmdc:mga0yw44_321852_c1 | nmdc:mga0yw44_321852_c1_261_647 | 128 |
| 793 | 3300050492 | nmdc:mga0yw44_53372_c1 | nmdc:mga0yw44_53372_c1_748_1134 | 128 |
| 794 | 3300050492 | nmdc:mga0yw44_95236_c1 | nmdc:mga0yw44_95236_c1_760_1146 | 128 |
| 795 | 3300050493 | nmdc:mga0k408_53816_c1 | nmdc:mga0k408_53816_c1_513_899 | 128 |
| 796 | 3300050494 | nmdc:mga06z11_228691_c1 | nmdc:mga06z11_228691_c1_666_1055 | 128 |
| 797 | 3300050494 | nmdc:mga06z11_312415_c1 | nmdc:mga06z11_312415_c1_500_886 | 128 |
| 798 | 3300050494 | nmdc:mga06z11_68007_c1 | nmdc:mga06z11_68007_c1_1424_1810 | 128 |
| 799 | 3300050495 | nmdc:mga04h51_30657_c1 | nmdc:mga04h51_30657_c1_946_1332 | 128 |
| 800 | 3300050496 | nmdc:mga07m45_180822_c1 | nmdc:mga07m45_180822_c1_484_870 | 128 |
| 801 | 3300050507 | nmdc:mga05p37_1028560_c1 | nmdc:mga05p37_1028560_c1_359_748 | 128 |
| 802 | 3300050507 | nmdc:mga05p37_311_c1 | nmdc:mga05p37_311_c1_25703_26092 | 128 |
| 803 | 3300050507 | nmdc:mga05p37_530232_c1 | nmdc:mga05p37_530232_c1_839_1228 | 128 |
| 804 | 3300050508 | nmdc:mga09592_74789_c1 | nmdc:mga09592_74789_c1_2222_2611 | 128 |
| 805 | 3300050509 | nmdc:mga0qj67_155511_c1 | nmdc:mga0qj67_155511_c1_955_1344 | 128 |
| 806 | 3300050509 | nmdc:mga0qj67_521501_c1 | nmdc:mga0qj67_521501_c1_196_585 | 128 |
| 807 | 3300050510 | nmdc:mga06r32_54893_c1 | nmdc:mga06r32_54893_c1_3216_3605 | 128 |
| 808 | 3300050511 | nmdc:mga08y16_165_c1 | nmdc:mga08y16_165_c1_27230_27619 | 128 |
| 809 | 3300050511 | nmdc:mga08y16_309090_c1 | nmdc:mga08y16_309090_c1_162_551 | 128 |
| 810 | 3300050512 | nmdc:mga0n895_251544_c1 | nmdc:mga0n895_251544_c1_738_1127 | 128 |
| 811 | 3300050512 | nmdc:mga0n895_59484_c1 | nmdc:mga0n895_59484_c1_196_582 | 128 |
| 812 | 3300050512 | nmdc:mga0n895_755344_c1 | nmdc:mga0n895_755344_c1_201_587 | 128 |
| 813 | 3300050513 | nmdc:mga0rr50_65089_c1 | nmdc:mga0rr50_65089_c1_1418_1804 | 128 |
| 814 | 3300050513 | nmdc:mga0rr50_748081_c1 | nmdc:mga0rr50_748081_c1_354_743 | 128 |
| 815 | 3300050515 | nmdc:mga0a205_194358_c1 | nmdc:mga0a205_194358_c1_319_708 | 128 |
| 816 | 3300050515 | nmdc:mga0a205_441251_c1 | nmdc:mga0a205_441251_c1_76_462 | 128 |
| 817 | 3300050515 | nmdc:mga0a205_619288_c1 | nmdc:mga0a205_619288_c1_124_513 | 128 |
| 818 | 3300050516 | nmdc:mga0sz30_56798_c1 | nmdc:mga0sz30_56798_c1_480_866 | 128 |
| 819 | 3300050516 | nmdc:mga0sz30_61894_c1 | nmdc:mga0sz30_61894_c1_779_1165 | 128 |
| 820 | 3300050516 | nmdc:mga0sz30_97097_c1 | nmdc:mga0sz30_97097_c1_154_540 | 128 |
| 821 | 3300053077 | Ga0495601_0014670 | Ga0495601_0014670_1031_1417 | 128 |
| 822 | 3300053078 | Ga0495612_0009372 | Ga0495612_0009372_3019_3405 | 128 |
| 823 | 3300053083 | Ga0495655_0011762 | Ga0495655_0011762_606_992 | 128 |
| 824 | 3300053084 | Ga0495595_0010648 | Ga0495595_0010648_2932_3318 | 128 |
| 825 | 3300053084 | Ga0495595_0093397 | Ga0495595_0093397_727_1113 | 128 |
| 826 | 3300053085 | Ga0495619_0481544 | Ga0495619_0481544_132_518 | 128 |
| 827 | 3300053111 | Ga0500572_121149 | Ga0500572_121149_145_531 | 128 |
| 828 | 3300053130 | Ga0500642_0289263 | Ga0500642_0289263_318_704 | 128 |
| 829 | 3300053136 | Ga0500559_0104698 | Ga0500559_0104698_767_1153 | 128 |
| 830 | 3300053138 | Ga0500564_001786 | Ga0500564_001786_594_980 | 128 |
| 831 | 3300053148 | Ga0500590_298728 | Ga0500590_298728_151_537 | 128 |
| 832 | 3300053163 | Ga0500639_232147 | Ga0500639_232147_96_482 | 128 |
| 833 | 3300053178 | Ga0500637_0077213 | Ga0500637_0077213_351_737 | 128 |
| 834 | 3300053733 | Ga0500552_046751 | Ga0500552_046751_31_417 | 128 |
| 835 | 3300055283 | Ga0500661_028649 | Ga0500661_028649_100_486 | 128 |
| 836 | 3300060353 | Ga0501082_0708921 | Ga0501082_0708921_213_602 | 128 |
| 837 | 3300061734 | Ga0530510_0071062 | Ga0530510_0071062_362_751 | 128 |
| 838 | 3300061734 | Ga0530510_0217832 | Ga0530510_0217832_998_1387 | 128 |
| 839 | 3300061734 | Ga0530510_0370772 | Ga0530510_0370772_72_461 | 128 |
| 840 | 3300005330 | Ga0070690_100088359 | Ga0070690_1000883593 | 129 |
| 841 | 3300005334 | Ga0068869_100378826 | Ga0068869_1003788261 | 129 |
| 842 | 3300005347 | Ga0070668_100191400 | Ga0070668_1001914003 | 129 |
| 843 | 3300005356 | Ga0070674_100017006 | Ga0070674_1000170063 | 129 |
| 844 | 3300005367 | Ga0070667_100384601 | Ga0070667_1003846012 | 129 |
| 845 | 3300005435 | Ga0070714_102044108 | Ga0070714_1020441081 | 129 |
| 846 | 3300005438 | Ga0070701_10536984 | Ga0070701_105369842 | 129 |
| 847 | 3300005455 | Ga0070663_101172429 | Ga0070663_1011724291 | 129 |
| 848 | 3300005456 | Ga0070678_100045346 | Ga0070678_1000453462 | 129 |
| 849 | 3300005457 | Ga0070662_100614437 | Ga0070662_1006144372 | 129 |
| 850 | 3300005539 | Ga0068853_100756326 | Ga0068853_1007563262 | 129 |
| 851 | 3300005578 | Ga0068854_100747574 | Ga0068854_1007475742 | 129 |
| 852 | 3300005719 | Ga0068861_100025418 | Ga0068861_1000254183 | 129 |
| 853 | 3300005843 | Ga0068860_100466032 | Ga0068860_1004660322 | 129 |
| 854 | 3300006881 | Ga0068865_100140089 | Ga0068865_1001400893 | 129 |
| 855 | 3300009101 | Ga0105247_10026444 | Ga0105247_100264443 | 129 |
| 856 | 3300009148 | Ga0105243_10044750 | Ga0105243_100447504 | 129 |
| 857 | 3300009553 | Ga0105249_10249014 | Ga0105249_102490142 | 129 |
| 858 | 3300009553 | Ga0105249_11116190 | Ga0105249_111161902 | 129 |
| 859 | 3300011119 | Ga0105246_11212336 | Ga0105246_112123361 | 129 |
| 860 | 3300013297 | Ga0157378_10959786 | Ga0157378_109597862 | 129 |
| 861 | 3300013306 | Ga0163162_11572114 | Ga0163162_115721142 | 129 |
| 862 | 3300013308 | Ga0157375_10122777 | Ga0157375_101227773 | 129 |
| 863 | 3300014325 | Ga0163163_10224424 | Ga0163163_102244242 | 129 |
| 864 | 3300014326 | Ga0157380_10234797 | Ga0157380_102347972 | 129 |
| 865 | 3300017792 | Ga0163161_10030502 | Ga0163161_100305023 | 129 |
| 866 | 3300025926 | Ga0207659_10217534 | Ga0207659_102175342 | 129 |
| 867 | 3300025933 | Ga0207706_10503785 | Ga0207706_105037852 | 129 |
| 868 | 3300025937 | Ga0207669_10025543 | Ga0207669_100255434 | 129 |
| 869 | 3300025938 | Ga0207704_10112245 | Ga0207704_101122452 | 129 |
| 870 | 3300025942 | Ga0207689_10617156 | Ga0207689_106171561 | 129 |
| 871 | 3300025961 | Ga0207712_10333673 | Ga0207712_103336732 | 129 |
| 872 | 3300025981 | Ga0207640_10478931 | Ga0207640_104789311 | 129 |
| 873 | 3300026041 | Ga0207639_10518047 | Ga0207639_105180472 | 129 |
| 874 | 3300026067 | Ga0207678_10217505 | Ga0207678_102175053 | 129 |
| 875 | 3300026095 | Ga0207676_12101890 | Ga0207676_121018901 | 129 |
| 876 | 3300026118 | Ga0207675_100021239 | Ga0207675_1000212393 | 129 |
| 877 | 3300026121 | Ga0207683_10150269 | Ga0207683_101502692 | 129 |
| 878 | 3300028380 | Ga0268265_10253139 | Ga0268265_102531391 | 129 |
| 879 | 3300028381 | Ga0268264_10034371 | Ga0268264_100343712 | 129 |
| 880 | 3300035120 | Ga0373957_0281580 | Ga0373957_0281580_152_550 | 129 |
| 881 | 3300035695 | Ga0373927_0074339 | Ga0373927_0074339_887_1288 | 129 |
| 882 | 3300035724 | Ga0373933_1161355 | Ga0373933_1161355_31_429 | 129 |
| 883 | 3300035725 | Ga0373947_0017798 | Ga0373947_0017798_1694_2092 | 129 |
| 884 | 3300037068 | Ga0373925_0017902 | Ga0373925_0017902_2511_2912 | 129 |
| 885 | 3300044684 | Ga0466966_0010768 | Ga0466966_0010768_4693_5085 | 129 |
| 886 | 3300044693 | Ga0466961_0055337 | Ga0466961_0055337_694_1086 | 129 |
| 887 | 3300044694 | Ga0466963_0321397 | Ga0466963_0321397_655_1047 | 129 |
| 888 | 3300044719 | Ga0466971_0436487 | Ga0466971_0436487_230_622 | 129 |
| 889 | 3300045049 | Ga0466959_0017621 | Ga0466959_0017621_153_545 | 129 |
| 890 | 3300045836 | Ga0466958_0624209 | Ga0466958_0624209_272_664 | 129 |
| 891 | 3300046452 | Ga0495617_096917 | Ga0495617_096917_443_841 | 129 |
| 892 | 3300046454 | Ga0495592_0380101 | Ga0495592_0380101_476_865 | 129 |
| 893 | 3300046455 | Ga0495603_0180118 | Ga0495603_0180118_551_943 | 129 |
| 894 | 3300046461 | Ga0495641_0026237 | Ga0495641_0026237_1877_2278 | 129 |
| 895 | 3300046472 | Ga0495580_0003171 | Ga0495580_0003171_1913_2314 | 129 |
| 896 | 3300046473 | Ga0495582_0046043 | Ga0495582_0046043_793_1194 | 129 |
| 897 | 3300046475 | Ga0495639_0008643 | Ga0495639_0008643_2460_2858 | 129 |
| 898 | 3300046492 | Ga0495585_0511405 | Ga0495585_0511405_108_500 | 129 |
| 899 | 3300046499 | Ga0495594_0493616 | Ga0495594_0493616_255_653 | 129 |
| 900 | 3300046511 | Ga0495608_0434747 | Ga0495608_0434747_286_684 | 129 |
| 901 | 3300046513 | Ga0495616_0201807 | Ga0495616_0201807_267_656 | 129 |
| 902 | 3300046519 | Ga0495632_0353539 | Ga0495632_0353539_16_414 | 129 |
| 903 | 3300046523 | Ga0495644_0138258 | Ga0495644_0138258_421_813 | 129 |
| 904 | 3300046526 | Ga0495666_0067795 | Ga0495666_0067795_1110_1511 | 129 |
| 905 | 3300046528 | Ga0495642_0394757 | Ga0495642_0394757_96_491 | 129 |
| 906 | 3300046531 | Ga0495665_0023819 | Ga0495665_0023819_304_705 | 129 |
| 907 | 3300046557 | Ga0495622_0008550 | Ga0495622_0008550_1641_2042 | 129 |
| 908 | 3300046615 | Ga0495656_0122773 | Ga0495656_0122773_476_868 | 129 |
| 909 | 3300046663 | Ga0495635_0167448 | Ga0495635_0167448_1047_1445 | 129 |
| 910 | 3300046674 | Ga0495588_0010784 | Ga0495588_0010784_2466_2867 | 129 |
| 911 | 3300046681 | Ga0495647_0312603 | Ga0495647_0312603_28_429 | 129 |
| 912 | 3300046689 | Ga0495613_0001403 | Ga0495613_0001403_12796_13197 | 129 |
| 913 | 3300046694 | Ga0495649_0635620 | Ga0495649_0635620_11_406 | 129 |
| 914 | 3300046794 | Ga0495589_0101403 | Ga0495589_0101403_424_816 | 129 |
| 915 | 3300047315 | Ga0495581_0013206 | Ga0495581_0013206_2017_2418 | 129 |
| 916 | 3300047319 | Ga0495674_0767913 | Ga0495674_0767913_140_538 | 129 |
| 917 | 3300047321 | Ga0495676_0043408 | Ga0495676_0043408_2334_2735 | 129 |
| 918 | 3300047322 | Ga0495680_0030632 | Ga0495680_0030632_2908_3306 | 129 |
| 919 | 3300047673 | Ga0495593_0004337 | Ga0495593_0004337_6094_6495 | 129 |
| 920 | 3300048089 | Ga0495614_0015295 | Ga0495614_0015295_2144_2545 | 129 |
| 921 | 3300048904 | Ga0496101_0031533 | Ga0496101_0031533_825_1217 | 129 |
| 922 | 3300048907 | Ga0496104_0061346 | Ga0496104_0061346_157_549 | 129 |
| 923 | 3300048909 | Ga0496106_0193306 | Ga0496106_0193306_454_846 | 129 |
| 924 | 3300048916 | Ga0496113_0919829 | Ga0496113_0919829_289_681 | 129 |
| 925 | 3300048917 | Ga0496114_0008142 | Ga0496114_0008142_3510_3902 | 129 |
| 926 | 3300048918 | Ga0496115_0051770 | Ga0496115_0051770_2471_2863 | 129 |
| 927 | 3300049571 | Ga0501034_0650400 | Ga0501034_0650400_309_704 | 129 |
| 928 | 3300053077 | Ga0495601_0449289 | Ga0495601_0449289_309_707 | 129 |
| 929 | 3300053084 | Ga0495595_0102385 | Ga0495595_0102385_711_1109 | 129 |
| 930 | 3300053085 | Ga0495619_0018271 | Ga0495619_0018271_1732_2130 | 129 |
| 931 | 3300053119 | Ga0500595_014651 | Ga0500595_014651_1803_2192 | 129 |
| 932 | 3300049758 | Ga0501241_003956 | Ga0501241_003956_127_528 | 130 |
| 933 | 3300006051 | Ga0075364_10236613 | Ga0075364_102366132 | 131 |
| 934 | 3300050491 | nmdc:mga00v17_464197_c1 | nmdc:mga00v17_464197_c1_169_579 | 131 |
| 935 | 3300025945 | Ga0207679_10207922 | Ga0207679_102079224 | 133 |
| 936 | 3300044656 | Ga0466969_0527779 | Ga0466969_0527779_16_486 | 133 |
| 937 | 3300044684 | Ga0466966_0013758 | Ga0466966_0013758_1264_1734 | 133 |
| 938 | 3300044765 | Ga0466970_0433193 | Ga0466970_0433193_150_620 | 133 |
| 939 | 3300045049 | Ga0466959_0009297 | Ga0466959_0009297_189_659 | 133 |
| 940 | 3300001904 | JGI24736J21556_1011817 | JGI24736J21556_10118172 | 134 |
| 941 | 3300003214 | JGI25165J46597_1025647 | JGI25165J46597_10256471 | 134 |
| 942 | 3300005328 | Ga0070676_10249349 | Ga0070676_102493493 | 134 |
| 943 | 3300005331 | Ga0070670_100114975 | Ga0070670_1001149753 | 134 |
| 944 | 3300005335 | Ga0070666_10009187 | Ga0070666_100091873 | 134 |
| 945 | 3300005335 | Ga0070666_10331253 | Ga0070666_103312532 | 134 |
| 946 | 3300005338 | Ga0068868_100133802 | Ga0068868_1001338022 | 134 |
| 947 | 3300005344 | Ga0070661_100131921 | Ga0070661_1001319213 | 134 |
| 948 | 3300005367 | Ga0070667_100140477 | Ga0070667_1001404771 | 134 |
| 949 | 3300005455 | Ga0070663_100003997 | Ga0070663_1000039975 | 134 |
| 950 | 3300005457 | Ga0070662_100190696 | Ga0070662_1001906961 | 134 |
| 951 | 3300005459 | Ga0068867_100612459 | Ga0068867_1006124592 | 134 |
| 952 | 3300005466 | Ga0070685_10001102 | Ga0070685_100011026 | 134 |
| 953 | 3300005539 | Ga0068853_100032986 | Ga0068853_1000329864 | 134 |
| 954 | 3300005548 | Ga0070665_100003534 | Ga0070665_1000035343 | 134 |
| 955 | 3300005563 | Ga0068855_100271538 | Ga0068855_1002715382 | 134 |
| 956 | 3300005563 | Ga0068855_101543241 | Ga0068855_1015432412 | 134 |
| 957 | 3300005578 | Ga0068854_100033413 | Ga0068854_1000334132 | 134 |
| 958 | 3300005616 | Ga0068852_100018450 | Ga0068852_1000184503 | 134 |
| 959 | 3300005834 | Ga0068851_10006423 | Ga0068851_100064236 | 134 |
| 960 | 3300005841 | Ga0068863_100127838 | Ga0068863_1001278383 | 134 |
| 961 | 3300005842 | Ga0068858_100002044 | Ga0068858_10000204414 | 134 |
| 962 | 3300005842 | Ga0068858_100660045 | Ga0068858_1006600452 | 134 |
| 963 | 3300006237 | Ga0097621_100056680 | Ga0097621_1000566803 | 134 |
| 964 | 3300009093 | Ga0105240_10000450 | Ga0105240_1000045016 | 134 |
| 965 | 3300009093 | Ga0105240_10117376 | Ga0105240_101173764 | 134 |
| 966 | 3300009093 | Ga0105240_10727977 | Ga0105240_107279773 | 134 |
| 967 | 3300009174 | Ga0105241_10092165 | Ga0105241_100921652 | 134 |
| 968 | 3300009176 | Ga0105242_10241965 | Ga0105242_102419652 | 134 |
| 969 | 3300009545 | Ga0105237_10051692 | Ga0105237_100516923 | 134 |
| 970 | 3300009545 | Ga0105237_10099929 | Ga0105237_100999291 | 134 |
| 971 | 3300009551 | Ga0105238_10002042 | Ga0105238_100020424 | 134 |
| 972 | 3300009551 | Ga0105238_10013642 | Ga0105238_100136429 | 134 |
| 973 | 3300009553 | Ga0105249_10177317 | Ga0105249_101773173 | 134 |
| 974 | 3300010375 | Ga0105239_10247145 | Ga0105239_102471452 | 134 |
| 975 | 3300010375 | Ga0105239_10614361 | Ga0105239_106143613 | 134 |
| 976 | 3300013105 | Ga0157369_10059628 | Ga0157369_100596284 | 134 |
| 977 | 3300013296 | Ga0157374_10027203 | Ga0157374_100272033 | 134 |
| 978 | 3300013307 | Ga0157372_10219224 | Ga0157372_102192243 | 134 |
| 979 | 3300013307 | Ga0157372_10499714 | Ga0157372_104997142 | 134 |
| 980 | 3300014969 | Ga0157376_10191623 | Ga0157376_101916232 | 134 |
| 981 | 3300025261 | Ga0209233_1008223 | Ga0209233_10082232 | 134 |
| 982 | 3300025321 | Ga0207656_10000840 | Ga0207656_100008407 | 134 |
| 983 | 3300025903 | Ga0207680_10104749 | Ga0207680_101047493 | 134 |
| 984 | 3300025903 | Ga0207680_10176043 | Ga0207680_101760432 | 134 |
| 985 | 3300025904 | Ga0207647_10000425 | Ga0207647_1000042514 | 134 |
| 986 | 3300025911 | Ga0207654_10027666 | Ga0207654_100276663 | 134 |
| 987 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007725 | 134 |
| 988 | 3300025913 | Ga0207695_10099021 | Ga0207695_100990211 | 134 |
| 989 | 3300025913 | Ga0207695_10716574 | Ga0207695_107165741 | 134 |
| 990 | 3300025914 | Ga0207671_10030308 | Ga0207671_100303082 | 134 |
| 991 | 3300025914 | Ga0207671_10213059 | Ga0207671_102130593 | 134 |
| 992 | 3300025920 | Ga0207649_10771306 | Ga0207649_107713062 | 134 |
| 993 | 3300025924 | Ga0207694_10001186 | Ga0207694_100011864 | 134 |
| 994 | 3300025925 | Ga0207650_10085997 | Ga0207650_100859973 | 134 |
| 995 | 3300025931 | Ga0207644_10764961 | Ga0207644_107649611 | 134 |
| 996 | 3300025933 | Ga0207706_10011818 | Ga0207706_100118185 | 134 |
| 997 | 3300025949 | Ga0207667_11373608 | Ga0207667_113736082 | 134 |
| 998 | 3300025961 | Ga0207712_10000291 | Ga0207712_1000029137 | 134 |
| 999 | 3300025981 | Ga0207640_10001052 | Ga0207640_100010522 | 134 |
| 1000 | 3300026023 | Ga0207677_10239593 | Ga0207677_102395932 | 134 |
| 1001 | 3300026035 | Ga0207703_10002746 | Ga0207703_100027463 | 134 |
| 1002 | 3300026041 | Ga0207639_10000161 | Ga0207639_1000016140 | 134 |
| 1003 | 3300026067 | Ga0207678_10005017 | Ga0207678_100050178 | 134 |
| 1004 | 3300026078 | Ga0207702_10201709 | Ga0207702_102017092 | 134 |
| 1005 | 3300026088 | Ga0207641_10129481 | Ga0207641_101294813 | 134 |
| 1006 | 3300026089 | Ga0207648_10325604 | Ga0207648_103256043 | 134 |
| 1007 | 3300026116 | Ga0207674_10125947 | Ga0207674_101259472 | 134 |
| 1008 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013554 | 134 |
| 1009 | 3300048921 | Ga0496118_0030959 | Ga0496118_0030959_344_748 | 134 |
| 1010 | 3300048929 | Ga0496126_0068767 | Ga0496126_0068767_942_1346 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.9631 | 5 | 134 |
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.9555 | 5 | 134 |
| 4qb5-assembly1.cif.gz_C | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8076 | 7 | 132 |
| 4qb5-assembly1.cif.gz_A | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8062 | 7 | 132 |
| 4qb5-assembly2.cif.gz_B | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.7988 | 7 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9631 | 5 | 134 | 3.10.180.10 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9555 | 5 | 134 | 3.10.180.10 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8626 | 73 | 134 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.849 | 71 | 132 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8364 | 71 | 132 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M5CMF1-F1-model_v4 | deleted | 1.009 | 73 | 134 |
|
| AF-A0A0E1X199-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 1.005 | 73 | 134 |
GO:0051213
|
| AF-A0A529X2P7-F1-model_v4 | deleted | 1.004 | 81 | 134 |
|
| AF-A0A2C6ADY8-F1-model_v4 | Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein | 1.004 | 81 | 132 |
|
| AF-A0A7Y2FQG5-F1-model_v4 | VOC family protein | 1.001 | 73 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar