F488122

General Info

Members Datasets Scaffolds Average Seq Length
1010 436 1003 128

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0527779|Ga0466969_0527779_16_486
Length 156
Sequence MPRHGPALVARRFFPLVDSACPQETNVIDHTGVTVSDFQASKRFYTNALAPIGYELLREFPASVTGHTDVAGFGADGVADFWLSKGTPNDPPIHIAFRAKDRGQVDAFYAAAIAAGGKDNGKPGLRPHYHANYYGAFVLDPDGHNVEAVCHDDPGA

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
3 2904699407
4 2922425934
5 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
102 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
103 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
104 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
136 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
137 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
138 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
409 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
410 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
413 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
414 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
423 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
424 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
427 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
430 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
431 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
436 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.3
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 1.78
Rhizoplane 7.13
Rhizosphere 76.24
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011817 3300001904 Bacteria 1418
2 JGI25165J46597_1025647 3300003214 Bacteria 764
3 JGI25165J46597_1029114 3300003214 Bacteria 713
4 JGI25160J50197_1004632 3300003354 Bacteria 5911
5 JGI25404J52841_10005705 3300003659 Bacteria 2576
6 JGI25404J52841_10025828 3300003659 Bacteria 1264
7 JGI25404J52841_10033067 3300003659 Bacteria 1102
8 JGI25404J52841_10084342 3300003659 Bacteria 664
9 JGI25404J52841_10102911 3300003659 Bacteria 599
10 Ga0055525_1000013 3300003759 Bacteria 440870
11 Ga0055542_1013422 3300003762 Bacteria 1377
12 Ga0055529_1008771 3300003763 Bacteria 1339
13 Ga0065165_1090711 3300005262 Bacteria 778
14 Ga0070658_10033059 3300005327 Bacteria 4160
15 Ga0070658_10199322 3300005327 Bacteria 1688
16 Ga0070676_10249349 3300005328 Bacteria 1184
17 Ga0070683_100064888 3300005329 Bacteria 3399
18 Ga0070690_100088359 3300005330 Bacteria 2037
19 Ga0070690_100707735 3300005330 Bacteria 774
20 Ga0070670_100000064 3300005331 Bacteria 110044
21 Ga0070670_100114975 3300005331 Bacteria 2320
22 Ga0070670_100813020 3300005331 Bacteria 844
23 Ga0068869_100199707 3300005334 Bacteria 1576
24 Ga0068869_100378826 3300005334 Bacteria 1159
25 Ga0068869_100401758 3300005334 Bacteria 1127
26 Ga0070666_10009187 3300005335 Bacteria 6162
27 Ga0070666_10024946 3300005335 Bacteria 3897
28 Ga0070666_10330618 3300005335 Bacteria 1088
29 Ga0070666_10331253 3300005335 Bacteria 1087
30 Ga0068868_100093315 3300005338 Bacteria 2427
31 Ga0068868_100133802 3300005338 Bacteria 2031
32 Ga0068868_100158320 3300005338 Bacteria 1869
33 Ga0068868_101251026 3300005338 Bacteria 688
34 Ga0068868_101828918 3300005338 Bacteria 574
35 Ga0070660_100199989 3300005339 Bacteria 1621
36 Ga0070660_100324698 3300005339 Bacteria 1265
37 Ga0070660_100884065 3300005339 Bacteria 753
38 Ga0070689_100000218 3300005340 Bacteria 34123
39 Ga0070689_100241800 3300005340 Bacteria 1487
40 Ga0070691_10093764 3300005341 Bacteria 1483
41 Ga0070691_10162486 3300005341 Bacteria 1152
42 Ga0070687_100042940 3300005343 Bacteria 2294
43 Ga0070687_100553150 3300005343 Bacteria 783
44 Ga0070661_100131921 3300005344 Bacteria 1877
45 Ga0070661_100150817 3300005344 Bacteria 1757
46 Ga0070668_100010504 3300005347 Bacteria 6882
47 Ga0070668_100191400 3300005347 Bacteria 1676
48 Ga0070668_100841909 3300005347 Bacteria 817
49 Ga0070669_100008388 3300005353 Bacteria 7373
50 Ga0070669_100273198 3300005353 Bacteria 1352
51 Ga0070675_100313891 3300005354 Bacteria 1384
52 Ga0070675_100745309 3300005354 Bacteria 893
53 Ga0070675_100909457 3300005354 Bacteria 807
54 Ga0070671_100000025 3300005355 Bacteria 121912
55 Ga0070671_100076587 3300005355 Bacteria 2795
56 Ga0070674_100017006 3300005356 Bacteria 4566
57 Ga0070674_100308270 3300005356 Bacteria 1265
58 Ga0070673_100140442 3300005364 Bacteria 2037
59 Ga0070673_101156388 3300005364 Bacteria 724
60 Ga0070688_100124152 3300005365 Bacteria 1733
61 Ga0070659_100796319 3300005366 Bacteria 822
62 Ga0070659_101972830 3300005366 Bacteria 524
63 Ga0070667_100000095 3300005367 Bacteria 109595
64 Ga0070667_100056278 3300005367 Bacteria 3322
65 Ga0070667_100140477 3300005367 Bacteria 2114
66 Ga0070667_100384601 3300005367 Bacteria 1275
67 Ga0070667_101269099 3300005367 Bacteria 690
68 Ga0070709_10719820 3300005434 Bacteria 778
69 Ga0070709_10814407 3300005434 Bacteria 734
70 Ga0070714_100457006 3300005435 Bacteria 1214
71 Ga0070714_102044108 3300005435 Bacteria 559
72 Ga0070701_10204175 3300005438 Bacteria 1170
73 Ga0070701_10536984 3300005438 Bacteria 765
74 Ga0070701_10698486 3300005438 Bacteria 682
75 Ga0070705_100928012 3300005440 Bacteria 702
76 Ga0070700_100307204 3300005441 Bacteria 1160
77 Ga0070700_101038432 3300005441 Bacteria 676
78 Ga0070694_100129946 3300005444 Bacteria 1818
79 Ga0070694_100149770 3300005444 Bacteria 1703
80 Ga0070708_100096040 3300005445 Bacteria 2707
81 Ga0070663_100003997 3300005455 Bacteria 8599
82 Ga0070663_100096127 3300005455 Bacteria 2203
83 Ga0070663_100194344 3300005455 Bacteria 1581
84 Ga0070663_100214406 3300005455 Bacteria 1509
85 Ga0070663_100285031 3300005455 Bacteria 1317
86 Ga0070663_100878201 3300005455 Bacteria 773
87 Ga0070663_101172429 3300005455 Bacteria 674
88 Ga0070663_101671141 3300005455 Bacteria 569
89 Ga0070678_100045346 3300005456 Bacteria 3145
90 Ga0070662_100143187 3300005457 Bacteria 1855
91 Ga0070662_100190696 3300005457 Bacteria 1621
92 Ga0070662_100614437 3300005457 Bacteria 915
93 Ga0068867_100612459 3300005459 Bacteria 951
94 Ga0070685_10000005 3300005466 Bacteria 190119
95 Ga0070685_10001102 3300005466 Bacteria 14437
96 Ga0070685_10067843 3300005466 Bacteria 2105
97 Ga0070685_10213706 3300005466 Bacteria 1260
98 Ga0070707_100887752 3300005468 Bacteria 856
99 Ga0070699_100280999 3300005518 Bacteria 1491
100 Ga0070699_100521664 3300005518 Bacteria 1080
101 Ga0070684_100012771 3300005535 Bacteria 6745
102 Ga0070684_100573414 3300005535 Bacteria 1048
103 Ga0070697_100224933 3300005536 Bacteria 1600
104 Ga0068853_100032986 3300005539 Bacteria 4390
105 Ga0068853_100316025 3300005539 Bacteria 1447
106 Ga0068853_100756326 3300005539 Bacteria 929
107 Ga0070672_100641985 3300005543 Bacteria 927
108 Ga0070695_100062134 3300005545 Bacteria 2425
109 Ga0070695_100070751 3300005545 Bacteria 2283
110 Ga0070696_100729516 3300005546 Bacteria 810
111 Ga0070665_100003534 3300005548 Bacteria 16618
112 Ga0070665_100037379 3300005548 Bacteria 4883
113 Ga0070665_100130649 3300005548 Bacteria 2513
114 Ga0070665_100167983 3300005548 Bacteria 2196
115 Ga0070665_100212527 3300005548 Bacteria 1935
116 Ga0070665_100574111 3300005548 Bacteria 1140
117 Ga0070704_100030715 3300005549 Bacteria 3603
118 Ga0068855_100271538 3300005563 Bacteria 1886
119 Ga0068855_100549226 3300005563 Bacteria 1251
120 Ga0068855_101543241 3300005563 Bacteria 681
121 Ga0068855_101712331 3300005563 Bacteria 641
122 Ga0070664_100062488 3300005564 Bacteria 3175
123 Ga0070664_100245222 3300005564 Bacteria 1609
124 Ga0070664_100378305 3300005564 Bacteria 1292
125 Ga0070664_101062645 3300005564 Bacteria 762
126 Ga0070664_101373258 3300005564 Bacteria 668
127 Ga0068857_100884596 3300005577 Bacteria 856
128 Ga0068857_100927161 3300005577 Bacteria 836
129 Ga0068854_100033413 3300005578 Bacteria 3586
130 Ga0068854_100747574 3300005578 Bacteria 848
131 Ga0068856_100071936 3300005614 Bacteria 3424
132 Ga0068856_100545639 3300005614 Bacteria 1180
133 Ga0068856_100734886 3300005614 Bacteria 1007
134 Ga0068856_100944819 3300005614 Bacteria 881
135 Ga0068856_101207148 3300005614 Bacteria 773
136 Ga0070702_101091014 3300005615 Bacteria 637
137 Ga0068852_100018450 3300005616 Bacteria 5497
138 Ga0068852_100099851 3300005616 Bacteria 2617
139 Ga0068852_101093894 3300005616 Bacteria 817
140 Ga0068852_101099323 3300005616 Bacteria 815
141 Ga0068859_100121233 3300005617 Bacteria 2681
142 Ga0068859_100593838 3300005617 Bacteria 1201
143 Ga0068859_100757110 3300005617 Bacteria 1060
144 Ga0068859_101236919 3300005617 Bacteria 822
145 Ga0068864_100000073 3300005618 Bacteria 109681
146 Ga0068864_100357216 3300005618 Bacteria 1380
147 Ga0068866_10138942 3300005718 Bacteria 1392
148 Ga0068866_10184305 3300005718 Bacteria 1235
149 Ga0068866_10208917 3300005718 Bacteria 1171
150 Ga0068866_10292221 3300005718 Bacteria 1014
151 Ga0068861_100006933 3300005719 Bacteria 7738
152 Ga0068861_100010562 3300005719 Bacteria 6411
153 Ga0068861_100025418 3300005719 Bacteria 4295
154 Ga0068861_101062731 3300005719 Bacteria 776
155 Ga0068851_10006423 3300005834 Bacteria 5366
156 Ga0068870_10616860 3300005840 Bacteria 739
157 Ga0068863_100117351 3300005841 Bacteria 2536
158 Ga0068863_100127838 3300005841 Bacteria 2425
159 Ga0068858_100002044 3300005842 Bacteria 20565
160 Ga0068858_100053469 3300005842 Bacteria 3735
161 Ga0068858_100141230 3300005842 Bacteria 2261
162 Ga0068858_100244294 3300005842 Bacteria 1704
163 Ga0068858_100341605 3300005842 Bacteria 1433
164 Ga0068858_100611462 3300005842 Bacteria 1058
165 Ga0068858_100660045 3300005842 Bacteria 1016
166 Ga0068858_101954832 3300005842 Bacteria 580
167 Ga0068860_100002476 3300005843 Bacteria 19371
168 Ga0068860_100354647 3300005843 Bacteria 1444
169 Ga0068860_100400160 3300005843 Bacteria 1358
170 Ga0068860_100466032 3300005843 Bacteria 1258
171 Ga0068860_100585771 3300005843 Bacteria 1120
172 Ga0068860_101569913 3300005843 Bacteria 680
173 Ga0068862_100018007 3300005844 Bacteria 5885
174 Ga0068862_100269758 3300005844 Bacteria 1556
175 Ga0068862_100369457 3300005844 Bacteria 1335
176 Ga0068862_100706392 3300005844 Bacteria 977
177 Ga0081455_10066073 3300005937 Bacteria 3022
178 Ga0081455_10427031 3300005937 Bacteria 912
179 Ga0081538_10001222 3300005981 Bacteria 26967
180 Ga0081540_1006755 3300005983 Bacteria 8296
181 Ga0081540_1014175 3300005983 Bacteria 5128
182 Ga0081540_1015865 3300005983 Bacteria 4748
183 Ga0081540_1063026 3300005983 Bacteria 1757
184 Ga0081540_1099549 3300005983 Bacteria 1256
185 Ga0081540_1132526 3300005983 Bacteria 1015
186 Ga0081540_1205164 3300005983 Bacteria 713
187 Ga0081539_10138687 3300005985 Bacteria 1184
188 Ga0070717_11989392 3300006028 Bacteria 524
189 Ga0075365_10059701 3300006038 Bacteria 2543
190 Ga0075365_10111571 3300006038 Bacteria 1879
191 Ga0075365_10226698 3300006038 Bacteria 1311
192 Ga0075365_10300975 3300006038 Bacteria 1129
193 Ga0075365_10464055 3300006038 Bacteria 894
194 Ga0075368_10006038 3300006042 Bacteria 4206
195 Ga0075363_100226531 3300006048 Bacteria 1072
196 Ga0075363_100277487 3300006048 Bacteria 969
197 Ga0075364_10030335 3300006051 Bacteria 3470
198 Ga0075364_10236613 3300006051 Bacteria 1240
199 Ga0075364_10619061 3300006051 Bacteria 740
200 Ga0070715_10306164 3300006163 Bacteria 852
201 Ga0070716_100562523 3300006173 Bacteria 852
202 Ga0075362_10022671 3300006177 Bacteria 2648
203 Ga0075362_10110744 3300006177 Bacteria 1292
204 Ga0075367_10563272 3300006178 Bacteria 724
205 Ga0075369_10034622 3300006186 Bacteria 2144
206 Ga0075369_10088562 3300006186 Bacteria 1379
207 Ga0075366_10047140 3300006195 Bacteria 2554
208 Ga0075366_10545116 3300006195 Bacteria 718
209 Ga0075366_10937820 3300006195 Bacteria 539
210 Ga0097621_100056117 3300006237 Bacteria 3217
211 Ga0097621_100056680 3300006237 Bacteria 3202
212 Ga0097621_102049946 3300006237 Bacteria 547
213 Ga0075370_10229335 3300006353 Bacteria 1099
214 Ga0075370_10668263 3300006353 Bacteria 631
215 Ga0068871_100376434 3300006358 Bacteria 1260
216 Ga0068871_100848913 3300006358 Bacteria 844
217 Ga0068871_101017249 3300006358 Unclassified 772
218 Ga0075428_100007957 3300006844 Bacteria 11759
219 Ga0075428_100092034 3300006844 Bacteria 3306
220 Ga0075428_100956125 3300006844 Bacteria 908
221 Ga0075428_102026561 3300006844 Bacteria 596
222 Ga0075430_100058369 3300006846 Bacteria 3244
223 Ga0075430_100139627 3300006846 Bacteria 2018
224 Ga0075430_100677977 3300006846 Bacteria 850
225 Ga0075430_101640919 3300006846 Bacteria 528
226 Ga0075431_100000003 3300006847 Bacteria 112884
227 Ga0075431_100073780 3300006847 Bacteria 3521
228 Ga0075431_100717136 3300006847 Bacteria 977
229 Ga0075433_10446718 3300006852 Bacteria 1140
230 Ga0075433_10458333 3300006852 Unclassified 1124
231 Ga0075434_100252281 3300006871 Bacteria 1784
232 Ga0075434_101285425 3300006871 Bacteria 743
233 Ga0075429_100086645 3300006880 Bacteria 2729
234 Ga0068865_100140089 3300006881 Bacteria 1823
235 Ga0068865_100584611 3300006881 Bacteria 942
236 Ga0068865_101821739 3300006881 Bacteria 550
237 Ga0097620_100121240 3300006931 Bacteria 2681
238 Ga0097620_100593852 3300006931 Bacteria 1201
239 Ga0097620_100757015 3300006931 Bacteria 1060
240 Ga0097620_101236923 3300006931 Bacteria 822
241 Ga0099825_1034203 3300006941 Bacteria 1909
242 Ga0099824_1008295 3300006942 Bacteria 13346
243 Ga0099822_1047693 3300006943 Bacteria 1936
244 Ga0099823_1082188 3300006944 Bacteria 1225
245 Ga0099823_1128175 3300006944 Bacteria 622
246 Ga0075435_100135066 3300007076 Bacteria 2066
247 Ga0075435_100265617 3300007076 Bacteria 1463
248 Ga0075435_100265959 3300007076 Bacteria 1462
249 Ga0075435_100409109 3300007076 Bacteria 1167
250 Ga0075435_100419858 3300007076 Bacteria 1152
251 Ga0105250_10171171 3300009092 Bacteria 909
252 Ga0105240_10000450 3300009093 Bacteria 75626
253 Ga0105240_10005199 3300009093 Bacteria 19472
254 Ga0105240_10117376 3300009093 Bacteria 3208
255 Ga0105240_10208055 3300009093 Bacteria 2288
256 Ga0105240_10330563 3300009093 Bacteria 1734
257 Ga0105240_10727977 3300009093 Bacteria 1080
258 Ga0105240_11099260 3300009093 Bacteria 846
259 Ga0105240_12709916 3300009093 Bacteria 511
260 Ga0111539_10000504 3300009094 Bacteria 49771
261 Ga0111539_10042598 3300009094 Bacteria 5449
262 Ga0111539_10082019 3300009094 Bacteria 3793
263 Ga0111539_10182458 3300009094 Bacteria 2451
264 Ga0111539_10188945 3300009094 Bacteria 2404
265 Ga0111539_10389385 3300009094 Bacteria 1623
266 Ga0111539_11317867 3300009094 Bacteria 838
267 Ga0105247_10015814 3300009101 Bacteria 4516
268 Ga0105247_10026444 3300009101 Bacteria 3504
269 Ga0105247_10299937 3300009101 Bacteria 1114
270 Ga0105247_11223096 3300009101 Bacteria 599
271 Ga0114129_10000062 3300009147 Bacteria 96507
272 Ga0114129_10126638 3300009147 Bacteria 3511
273 Ga0114129_10443960 3300009147 Bacteria 1703
274 Ga0105243_10044750 3300009148 Bacteria 3475
275 Ga0105243_10092482 3300009148 Bacteria 2494
276 Ga0105243_10145212 3300009148 Bacteria 2029
277 Ga0105241_10067148 3300009174 Bacteria 2775
278 Ga0105241_10092165 3300009174 Bacteria 2392
279 Ga0105241_10134050 3300009174 Bacteria 2009
280 Ga0105241_10367629 3300009174 Bacteria 1253
281 Ga0105241_10559150 3300009174 Bacteria 1028
282 Ga0105241_11772787 3300009174 Bacteria 602
283 Ga0105242_10241965 3300009176 Bacteria 1623
284 Ga0105242_10420308 3300009176 Bacteria 1252
285 Ga0105248_10120204 3300009177 Bacteria 2963
286 Ga0105248_10188067 3300009177 Bacteria 2327
287 Ga0105248_10221684 3300009177 Bacteria 2129
288 Ga0105248_10361332 3300009177 Bacteria 1635
289 Ga0105237_10003771 3300009545 Bacteria 17843
290 Ga0105237_10009728 3300009545 Bacteria 10286
291 Ga0105237_10051692 3300009545 Bacteria 4127
292 Ga0105237_10099929 3300009545 Bacteria 2892
293 Ga0105237_10200368 3300009545 Bacteria 1996
294 Ga0105237_11902621 3300009545 Bacteria 603
295 Ga0105237_12028378 3300009545 Bacteria 584
296 Ga0105238_10002042 3300009551 Bacteria 20365
297 Ga0105238_10013642 3300009551 Bacteria 8205
298 Ga0105238_10205129 3300009551 Bacteria 1947
299 Ga0105238_10274416 3300009551 Bacteria 1667
300 Ga0105238_11976296 3300009551 Bacteria 617
301 Ga0105249_10046667 3300009553 Bacteria 3943
302 Ga0105249_10129837 3300009553 Bacteria 2404
303 Ga0105249_10152947 3300009553 Bacteria 2223
304 Ga0105249_10177317 3300009553 Bacteria 2071
305 Ga0105249_10249014 3300009553 Bacteria 1761
306 Ga0105249_11086502 3300009553 Bacteria 870
307 Ga0105249_11116190 3300009553 Bacteria 859
308 Ga0105249_11878063 3300009553 Bacteria 672
309 Ga0105239_10014317 3300010375 Bacteria 8800
310 Ga0105239_10027503 3300010375 Bacteria 6259
311 Ga0105239_10070819 3300010375 Bacteria 3830
312 Ga0105239_10247145 3300010375 Bacteria 2003
313 Ga0105239_10284074 3300010375 Bacteria 1863
314 Ga0105239_10614361 3300010375 Bacteria 1240
315 Ga0105239_10903292 3300010375 Bacteria 1014
316 Ga0105239_10964878 3300010375 Bacteria 980
317 Ga0105239_11400150 3300010375 Bacteria 807
318 Ga0105246_10072093 3300011119 Bacteria 2434
319 Ga0105246_10766471 3300011119 Bacteria 853
320 Ga0105246_11212336 3300011119 Bacteria 695
321 Ga0105246_11257500 3300011119 Bacteria 684
322 Ga0157370_10064289 3300013104 Bacteria 3474
323 Ga0157369_10000197 3300013105 Bacteria 84466
324 Ga0157369_10059628 3300013105 Bacteria 4115
325 Ga0157369_10389073 3300013105 Bacteria 1447
326 Ga0157374_10027203 3300013296 Bacteria 5156
327 Ga0157374_10061313 3300013296 Bacteria 3522
328 Ga0157374_10135048 3300013296 Bacteria 2391
329 Ga0157374_10514557 3300013296 Bacteria 1202
330 Ga0157374_10724610 3300013296 Unclassified 1008
331 Ga0157374_10793288 3300013296 Bacteria 963
332 Ga0157378_10089921 3300013297 Bacteria 2790
333 Ga0157378_10959786 3300013297 Bacteria 888
334 Ga0157378_11713876 3300013297 Bacteria 676
335 Ga0163162_10483629 3300013306 Bacteria 1369
336 Ga0163162_11182607 3300013306 Bacteria 867
337 Ga0163162_11572114 3300013306 Bacteria 750
338 Ga0157372_10120789 3300013307 Bacteria 3009
339 Ga0157372_10219224 3300013307 Bacteria 2205
340 Ga0157372_10499714 3300013307 Bacteria 1418
341 Ga0157372_13322672 3300013307 Bacteria 512
342 Ga0157375_10122777 3300013308 Bacteria 2709
343 Ga0157375_10554349 3300013308 Bacteria 1311
344 Ga0157375_10641208 3300013308 Bacteria 1219
345 Ga0157375_10689452 3300013308 Bacteria 1176
346 Ga0157375_11185549 3300013308 Bacteria 895
347 Ga0157375_12376244 3300013308 Unclassified 632
348 Ga0157375_12552730 3300013308 Bacteria 610
349 Ga0163163_10001573 3300014325 Bacteria 19239
350 Ga0163163_10008737 3300014325 Bacteria 9015
351 Ga0163163_10108419 3300014325 Bacteria 2804
352 Ga0163163_10224424 3300014325 Bacteria 1928
353 Ga0163163_10420667 3300014325 Bacteria 1395
354 Ga0163163_10430406 3300014325 Bacteria 1379
355 Ga0163163_10764936 3300014325 Unclassified 1029
356 Ga0163163_13248336 3300014325 Bacteria 507
357 Ga0157380_10234797 3300014326 Bacteria 1649
358 Ga0157380_10279675 3300014326 Bacteria 1526
359 Ga0157380_11164888 3300014326 Bacteria 813
360 Ga0157379_10095777 3300014968 Bacteria 2663
361 Ga0157379_10129296 3300014968 Bacteria 2272
362 Ga0157379_10271735 3300014968 Bacteria 1541
363 Ga0157379_10600355 3300014968 Bacteria 1028
364 Ga0157379_12065285 3300014968 Bacteria 564
365 Ga0157376_10191623 3300014969 Bacteria 1875
366 Ga0157376_11071391 3300014969 Bacteria 831
367 Ga0157376_11898049 3300014969 Bacteria 633
368 Ga0157376_13126642 3300014969 Bacteria 501
369 Ga0182007_10191258 3300015262 Bacteria 712
370 Ga0163161_10030502 3300017792 Bacteria 3838
371 Ga0163161_10921818 3300017792 Bacteria 741
372 Ga0206356_10810643 3300020070 Bacteria 2024
373 Ga0206353_10858696 3300020082 Bacteria 6278
374 Ga0214542_1040082 3300021321 Bacteria 1217
375 Ga0214545_1049363 3300021324 Bacteria 865
376 Ga0214543_1040892 3300021327 Bacteria 1218
377 Ga0213874_10138503 3300021377 Bacteria 841
378 Ga0213871_10054984 3300021441 Bacteria 1099
379 Ga0224712_10003411 3300022467 Bacteria 4125
380 Ga0209674_107151 3300025226 Bacteria 1438
381 Ga0209563_100025 3300025230 Bacteria 596456
382 Ga0209026_1013566 3300025250 Bacteria 1385
383 Ga0209148_1001706 3300025254 Bacteria 9700
384 Ga0209148_1001992 3300025254 Bacteria 8061
385 Ga0209759_1003269 3300025256 Bacteria 6551
386 Ga0209759_1003924 3300025256 Bacteria 5734
387 Ga0209233_1001411 3300025261 Bacteria 9473
388 Ga0209233_1008223 3300025261 Bacteria 3242
389 Ga0209233_1014099 3300025261 Bacteria 2262
390 Ga0209233_1017254 3300025261 Bacteria 1970
391 Ga0209233_1019148 3300025261 Bacteria 1825
392 Ga0209455_1002997 3300025272 Bacteria 6203
393 Ga0209455_1059813 3300025272 Bacteria 502
394 Ga0209130_1042214 3300025284 Bacteria 874
395 Ga0209564_1004981 3300025295 Bacteria 7824
396 Ga0209758_1000397 3300025297 Bacteria 75408
397 Ga0209758_1032773 3300025297 Bacteria 2102
398 Ga0209256_1016929 3300025299 Bacteria 2453
399 Ga0209256_1019562 3300025299 Bacteria 2150
400 Ga0209256_1069455 3300025299 Bacteria 797
401 Ga0207426_1000886 3300025302 Bacteria 30736
402 Ga0209257_1080457 3300025304 Bacteria 837
403 Ga0209257_1124311 3300025304 Bacteria 599
404 Ga0207656_10000840 3300025321 Bacteria 10031
405 Ga0207696_1087903 3300025711 Bacteria 853
406 Ga0207682_10043211 3300025893 Bacteria 1844
407 Ga0207642_10111209 3300025899 Bacteria 1395
408 Ga0207642_10535474 3300025899 Bacteria 721
409 Ga0207710_10006552 3300025900 Bacteria 4962
410 Ga0207710_10097910 3300025900 Bacteria 1380
411 Ga0207710_10217379 3300025900 Unclassified 948
412 Ga0207710_10314277 3300025900 Bacteria 793
413 Ga0207688_10077703 3300025901 Bacteria 1892
414 Ga0207680_10104749 3300025903 Bacteria 1824
415 Ga0207680_10176043 3300025903 Bacteria 1444
416 Ga0207680_10184360 3300025903 Bacteria 1413
417 Ga0207680_10606776 3300025903 Bacteria 783
418 Ga0207647_10000425 3300025904 Bacteria 34674
419 Ga0207647_10007446 3300025904 Bacteria 7906
420 Ga0207647_10211354 3300025904 Bacteria 1120
421 Ga0207647_10400278 3300025904 Bacteria 773
422 Ga0207699_10079206 3300025906 Bacteria 2032
423 Ga0207699_10612949 3300025906 Bacteria 793
424 Ga0207699_10711556 3300025906 Bacteria 735
425 Ga0207705_10453777 3300025909 Bacteria 994
426 Ga0207705_10754123 3300025909 Bacteria 756
427 Ga0207654_10027666 3300025911 Bacteria 3084
428 Ga0207654_10044616 3300025911 Bacteria 2519
429 Ga0207654_10047882 3300025911 Bacteria 2444
430 Ga0207654_10112180 3300025911 Bacteria 1698
431 Ga0207695_10000007 3300025913 Bacteria 1092551
432 Ga0207695_10000148 3300025913 Bacteria 208344
433 Ga0207695_10099021 3300025913 Bacteria 2914
434 Ga0207695_10398335 3300025913 Bacteria 1261
435 Ga0207695_10492398 3300025913 Bacteria 1108
436 Ga0207695_10716574 3300025913 Bacteria 881
437 Ga0207671_10002713 3300025914 Bacteria 18544
438 Ga0207671_10030308 3300025914 Bacteria 4035
439 Ga0207671_10151361 3300025914 Bacteria 1792
440 Ga0207671_10213059 3300025914 Bacteria 1512
441 Ga0207660_11213746 3300025917 Bacteria 613
442 Ga0207657_10026602 3300025919 Bacteria 5312
443 Ga0207657_10127631 3300025919 Bacteria 2087
444 Ga0207657_10560766 3300025919 Bacteria 893
445 Ga0207649_10286618 3300025920 Bacteria 1199
446 Ga0207649_10771306 3300025920 Bacteria 749
447 Ga0207649_11068713 3300025920 Bacteria 636
448 Ga0207646_10780842 3300025922 Bacteria 851
449 Ga0207681_10059988 3300025923 Bacteria 2609
450 Ga0207694_10001186 3300025924 Bacteria 22567
451 Ga0207694_10166327 3300025924 Bacteria 1784
452 Ga0207650_10000106 3300025925 Bacteria 110058
453 Ga0207650_10085997 3300025925 Bacteria 2393
454 Ga0207659_10217534 3300025926 Bacteria 1534
455 Ga0207659_10987038 3300025926 Bacteria 724
456 Ga0207659_10987391 3300025926 Bacteria 724
457 Ga0207659_11271871 3300025926 Bacteria 632
458 Ga0207687_10147173 3300025927 Bacteria 1793
459 Ga0207687_10192006 3300025927 Bacteria 1590
460 Ga0207700_11939193 3300025928 Bacteria 515
461 Ga0207644_10000049 3300025931 Bacteria 95260
462 Ga0207644_10152295 3300025931 Bacteria 1790
463 Ga0207644_10764961 3300025931 Bacteria 807
464 Ga0207690_10044661 3300025932 Bacteria 2922
465 Ga0207690_10374053 3300025932 Bacteria 1131
466 Ga0207706_10011818 3300025933 Bacteria 7951
467 Ga0207706_10168661 3300025933 Bacteria 1924
468 Ga0207706_10347683 3300025933 Bacteria 1289
469 Ga0207706_10503785 3300025933 Bacteria 1045
470 Ga0207706_11389754 3300025933 Bacteria 577
471 Ga0207686_10153635 3300025934 Bacteria 1605
472 Ga0207709_10118512 3300025935 Bacteria 1783
473 Ga0207670_10001216 3300025936 Bacteria 13599
474 Ga0207670_11090472 3300025936 Bacteria 674
475 Ga0207669_10025543 3300025937 Bacteria 3195
476 Ga0207669_10488710 3300025937 Bacteria 983
477 Ga0207704_10112245 3300025938 Bacteria 1846
478 Ga0207704_10497220 3300025938 Bacteria 982
479 Ga0207665_10595739 3300025939 Bacteria 863
480 Ga0207691_10107400 3300025940 Bacteria 2485
481 Ga0207691_10174281 3300025940 Bacteria 1882
482 Ga0207711_10000393 3300025941 Bacteria 46458
483 Ga0207711_10181683 3300025941 Bacteria 1913
484 Ga0207689_10139944 3300025942 Bacteria 1994
485 Ga0207689_10238012 3300025942 Bacteria 1505
486 Ga0207689_10384788 3300025942 Bacteria 1168
487 Ga0207689_10485110 3300025942 Bacteria 1035
488 Ga0207689_10617156 3300025942 Bacteria 913
489 Ga0207689_11155791 3300025942 Bacteria 652
490 Ga0207689_11796817 3300025942 Bacteria 506
491 Ga0207661_10049749 3300025944 Bacteria 3337
492 Ga0207679_10156798 3300025945 Bacteria 1860
493 Ga0207679_10207922 3300025945 Bacteria 1639
494 Ga0207679_10348578 3300025945 Bacteria 1290
495 Ga0207679_10404310 3300025945 Bacteria 1202
496 Ga0207679_11125844 3300025945 Bacteria 720
497 Ga0207667_10454558 3300025949 Bacteria 1301
498 Ga0207667_11057383 3300025949 Bacteria 796
499 Ga0207667_11373608 3300025949 Bacteria 681
500 Ga0207651_10989985 3300025960 Bacteria 751
501 Ga0207712_10000291 3300025961 Bacteria 47334
502 Ga0207712_10044794 3300025961 Bacteria 3060
503 Ga0207712_10333673 3300025961 Bacteria 1255
504 Ga0207712_11272880 3300025961 Bacteria 657
505 Ga0207668_10085104 3300025972 Bacteria 2306
506 Ga0207640_10001052 3300025981 Bacteria 15248
507 Ga0207640_10395606 3300025981 Bacteria 1124
508 Ga0207640_10478931 3300025981 Bacteria 1032
509 Ga0207658_10000073 3300025986 Bacteria 111738
510 Ga0207658_10155946 3300025986 Bacteria 1866
511 Ga0207677_10076028 3300026023 Bacteria 2389
512 Ga0207677_10198109 3300026023 Bacteria 1594
513 Ga0207677_10239593 3300026023 Bacteria 1466
514 Ga0207677_10317934 3300026023 Bacteria 1293
515 Ga0207703_10002746 3300026035 Bacteria 15077
516 Ga0207703_10096638 3300026035 Bacteria 2494
517 Ga0207703_10204174 3300026035 Bacteria 1758
518 Ga0207703_10253438 3300026035 Bacteria 1587
519 Ga0207639_10000161 3300026041 Bacteria 51519
520 Ga0207639_10089594 3300026041 Bacteria 2459
521 Ga0207639_10518047 3300026041 Bacteria 1092
522 Ga0207639_10615315 3300026041 Bacteria 1002
523 Ga0207639_11381071 3300026041 Bacteria 661
524 Ga0207678_10005017 3300026067 Bacteria 11877
525 Ga0207678_10142462 3300026067 Bacteria 2046
526 Ga0207678_10217505 3300026067 Bacteria 1635
527 Ga0207678_10240553 3300026067 Bacteria 1550
528 Ga0207678_10328064 3300026067 Bacteria 1317
529 Ga0207678_11484875 3300026067 Bacteria 598
530 Ga0207678_11520632 3300026067 Bacteria 591
531 Ga0207708_10191222 3300026075 Bacteria 1629
532 Ga0207708_10325342 3300026075 Bacteria 1255
533 Ga0207708_11138764 3300026075 Bacteria 681
534 Ga0207702_10107794 3300026078 Bacteria 2471
535 Ga0207702_10112744 3300026078 Bacteria 2420
536 Ga0207702_10201709 3300026078 Bacteria 1844
537 Ga0207702_10216754 3300026078 Bacteria 1782
538 Ga0207702_10224358 3300026078 Bacteria 1752
539 Ga0207702_11003725 3300026078 Bacteria 828
540 Ga0207702_11330873 3300026078 Bacteria 712
541 Ga0207641_10129481 3300026088 Bacteria 2264
542 Ga0207641_10157856 3300026088 Bacteria 2059
543 Ga0207641_10195283 3300026088 Bacteria 1862
544 Ga0207641_10293638 3300026088 Bacteria 1533
545 Ga0207641_10407342 3300026088 Bacteria 1307
546 Ga0207648_10229096 3300026089 Bacteria 1653
547 Ga0207648_10325604 3300026089 Bacteria 1382
548 Ga0207676_10000010 3300026095 Bacteria 519402
549 Ga0207676_10107939 3300026095 Bacteria 2323
550 Ga0207676_10549397 3300026095 Unclassified 1103
551 Ga0207676_12101890 3300026095 Bacteria 563
552 Ga0207674_10125947 3300026116 Bacteria 2527
553 Ga0207674_10238330 3300026116 Bacteria 1766
554 Ga0207675_100003423 3300026118 Bacteria 15497
555 Ga0207675_100021239 3300026118 Bacteria 6046
556 Ga0207675_100025297 3300026118 Bacteria 5525
557 Ga0207675_100665908 3300026118 Bacteria 1048
558 Ga0207683_10150269 3300026121 Bacteria 2102
559 Ga0207683_10162150 3300026121 Bacteria 2022
560 Ga0207698_10914008 3300026142 Bacteria 885
561 Ga0207698_11040750 3300026142 Bacteria 830
562 Ga0207698_11082097 3300026142 Bacteria 814
563 Ga0209389_1000157 3300027296 Bacteria 56696
564 Ga0209389_1002855 3300027296 Bacteria 13519
565 Ga0209589_1006917 3300027357 Bacteria 18508
566 Ga0209489_100045 3300027361 Bacteria 158225
567 Ga0209489_101111 3300027361 Bacteria 54702
568 Ga0209700_100011 3300027363 Bacteria 362159
569 Ga0209813_10023191 3300027866 Bacteria 1763
570 Ga0207428_10003737 3300027907 Bacteria 14610
571 Ga0268266_10000013 3300028379 Bacteria 649715
572 Ga0268266_10189744 3300028379 Bacteria 1876
573 Ga0268266_10371353 3300028379 Bacteria 1347
574 Ga0268266_10751197 3300028379 Unclassified 941
575 Ga0268265_10001308 3300028380 Bacteria 21377
576 Ga0268265_10149880 3300028380 Bacteria 1966
577 Ga0268265_10253139 3300028380 Bacteria 1561
578 Ga0268265_10269682 3300028380 Bacteria 1518
579 Ga0268265_10717852 3300028380 Bacteria 967
580 Ga0268265_10823759 3300028380 Bacteria 906
581 Ga0268265_12143009 3300028380 Bacteria 566
582 Ga0268264_10000123 3300028381 Bacteria 189361
583 Ga0268264_10034371 3300028381 Bacteria 4170
584 Ga0268264_10388154 3300028381 Bacteria 1339
585 Ga0307511_10000923 3300030521 Bacteria 31061
586 Ga0307513_10040464 3300031456 Bacteria 5153
587 Ga0307513_10257961 3300031456 Bacteria 1535
588 Ga0307509_10310000 3300031507 Bacteria 1321
589 Ga0307408_100091188 3300031548 Bacteria 2301
590 Ga0307516_10621194 3300031730 Bacteria 735
591 Ga0307405_11331000 3300031731 Bacteria 626
592 Ga0307409_102150306 3300031995 Bacteria 588
593 Ga0307411_12297872 3300032005 Bacteria 507
594 Ga0307510_10030650 3300033180 Bacteria 6094
595 Ga0307510_10397357 3300033180 Bacteria 822
596 Ga0373928_0095946 3300035084 Bacteria 767
597 Ga0373941_0096459 3300035115 Bacteria 1023
598 Ga0373953_0393845 3300035117 Bacteria 609
599 Ga0373957_0281580 3300035120 Bacteria 703
600 Ga0373960_0318691 3300035121 Bacteria 582
601 Ga0373935_0355102 3300035692 Bacteria 1046
602 Ga0373927_0074339 3300035695 Bacteria 2200
603 Ga0373933_0000068 3300035724 Bacteria 63195
604 Ga0373933_0246808 3300035724 Bacteria 1149
605 Ga0373933_1161355 3300035724 Bacteria 509
606 Ga0373947_0017798 3300035725 Bacteria 4088
607 Ga0373947_0325052 3300035725 Bacteria 1029
608 Ga0373937_0125120 3300036401 Bacteria 2398
609 Ga0373937_1254905 3300036401 Bacteria 689
610 Ga0316584_0860031 3300036712 Bacteria 613
611 Ga0373925_0017902 3300037068 Bacteria 5143
612 Ga0373925_0598776 3300037068 Bacteria 908
613 Ga0395899_0021619 3300037312 Bacteria 4879
614 Ga0395900_0050015 3300037418 Bacteria 4306
615 Ga0395900_0381849 3300037418 Bacteria 1376
616 Ga0395898_1479339 3300037466 Bacteria 605
617 Ga0436364_1404047 3300037853 Bacteria 889
618 Ga0395901_0000173 3300038443 Bacteria 83610
619 Ga0395901_2118230 3300038443 Bacteria 507
620 Ga0436365_0217255 3300039437 Bacteria 937
621 Ga0436365_0362878 3300039437 Bacteria 535
622 Ga0436365_0368099 3300039437 Bacteria 526
623 Ga0436360_0177325 3300039438 Bacteria 1079
624 Ga0436360_0431968 3300039438 Bacteria 1007
625 Ga0436361_1011853 3300039447 Bacteria 3867
626 Ga0436363_1313418 3300039450 Bacteria 712
627 Ga0436363_1540722 3300039450 Bacteria 908
628 Ga0436362_0855659 3300039453 Bacteria 563
629 Ga0436362_1102929 3300039453 Bacteria 1039
630 Ga0439436_0024136 3300041404 Bacteria 1796
631 Ga0439465_0000040 3300041413 Bacteria 26319
632 Ga0451853_1113938 3300041512 Bacteria 1131
633 Ga0451853_2256764 3300041512 Bacteria 627
634 Ga0439431_0212070 3300041997 Bacteria 567
635 Ga0439449_0000398 3300042007 Bacteria 16106
636 Ga0439458_0150967 3300042157 Bacteria 622
637 Ga0439464_0294212 3300042439 Bacteria 529
638 Ga0466969_0007141 3300044656 Bacteria 5947
639 Ga0466969_0527779 3300044656 Bacteria 539
640 Ga0466972_0003163 3300044658 Bacteria 8175
641 Ga0466972_0260021 3300044658 Bacteria 811
642 Ga0466980_0047200 3300044668 Bacteria 3013
643 Ga0466966_0010768 3300044684 Bacteria 6079
644 Ga0466966_0013758 3300044684 Bacteria 5353
645 Ga0466966_0017642 3300044684 Bacteria 4714
646 Ga0466966_0030637 3300044684 Bacteria 3490
647 Ga0466966_0163607 3300044684 Bacteria 1354
648 Ga0466961_0000849 3300044693 Bacteria 19114
649 Ga0466961_0014864 3300044693 Bacteria 5001
650 Ga0466961_0055337 3300044693 Bacteria 2530
651 Ga0466961_0110028 3300044693 Bacteria 1734
652 Ga0466963_0004353 3300044694 Bacteria 8220
653 Ga0466963_0321397 3300044694 Bacteria 1089
654 Ga0466964_0065636 3300044706 Bacteria 1521
655 Ga0466971_0436487 3300044719 Bacteria 641
656 Ga0466968_0080763 3300044735 Bacteria 1428
657 Ga0466968_0311148 3300044735 Bacteria 759
658 Ga0466970_0168601 3300044765 Bacteria 1213
659 Ga0466970_0412746 3300044765 Bacteria 771
660 Ga0466970_0433193 3300044765 Bacteria 752
661 Ga0466959_0009297 3300045049 Bacteria 6983
662 Ga0466959_0017369 3300045049 Bacteria 5274
663 Ga0466959_0017621 3300045049 Bacteria 5237
664 Ga0466959_0025900 3300045049 Bacteria 4350
665 Ga0451576_1071464 3300045051 Bacteria 844
666 Ga0451576_2350413 3300045051 Bacteria 546
667 Ga0466958_0000419 3300045836 Bacteria 17478
668 Ga0466958_0308602 3300045836 Bacteria 1016
669 Ga0466958_0590491 3300045836 Bacteria 722
670 Ga0466958_0624209 3300045836 Bacteria 701
671 Ga0466967_0015071 3300045976 Bacteria 6048
672 Ga0495617_096917 3300046452 Bacteria 960
673 Ga0495592_0380101 3300046454 Bacteria 899
674 Ga0495603_0180118 3300046455 Bacteria 1223
675 Ga0495590_0092190 3300046457 Bacteria 1072
676 Ga0495629_0083216 3300046459 Bacteria 2233
677 Ga0495629_0342721 3300046459 Bacteria 1020
678 Ga0495638_0032658 3300046460 Bacteria 3334
679 Ga0495641_0026237 3300046461 Bacteria 2845
680 Ga0495641_0265799 3300046461 Bacteria 772
681 Ga0495651_0091567 3300046462 Bacteria 2279
682 Ga0495653_0265840 3300046463 Bacteria 1132
683 Ga0495580_0003171 3300046472 Bacteria 14098
684 Ga0495582_0046043 3300046473 Bacteria 2402
685 Ga0495605_0138396 3300046474 Bacteria 1094
686 Ga0495605_0145849 3300046474 Bacteria 1059
687 Ga0495605_0325839 3300046474 Bacteria 647
688 Ga0495639_0008643 3300046475 Bacteria 4367
689 Ga0495639_0317123 3300046475 Bacteria 779
690 Ga0495662_0120272 3300046476 Bacteria 1289
691 Ga0495585_0511405 3300046492 Bacteria 570
692 Ga0495594_0493616 3300046499 Bacteria 695
693 Ga0495596_0096004 3300046500 Bacteria 1151
694 Ga0495596_0254165 3300046500 Bacteria 682
695 Ga0495583_0058267 3300046506 Bacteria 1734
696 Ga0495583_0124159 3300046506 Bacteria 1084
697 Ga0495606_0031017 3300046507 Bacteria 3722
698 Ga0495606_0043113 3300046507 Bacteria 3012
699 Ga0495606_0244358 3300046507 Bacteria 999
700 Ga0495608_0027780 3300046511 Bacteria 3848
701 Ga0495608_0434747 3300046511 Bacteria 800
702 Ga0495610_0076110 3300046512 Bacteria 1553
703 Ga0495616_0030402 3300046513 Bacteria 2839
704 Ga0495616_0150921 3300046513 Bacteria 1051
705 Ga0495616_0201807 3300046513 Bacteria 874
706 Ga0495620_0188813 3300046515 Bacteria 795
707 Ga0495628_0301397 3300046516 Bacteria 1186
708 Ga0495628_0708442 3300046516 Bacteria 710
709 Ga0495632_0300364 3300046519 Bacteria 712
710 Ga0495632_0353539 3300046519 Bacteria 646
711 Ga0495643_0019724 3300046522 Bacteria 3897
712 Ga0495643_0144262 3300046522 Bacteria 1184
713 Ga0495643_0263163 3300046522 Bacteria 800
714 Ga0495644_0138258 3300046523 Bacteria 930
715 Ga0495648_0272860 3300046524 Bacteria 805
716 Ga0495648_0294076 3300046524 Bacteria 764
717 Ga0495648_0461180 3300046524 Bacteria 553
718 Ga0495666_0067795 3300046526 Bacteria 1700
719 Ga0495642_0394757 3300046528 Bacteria 610
720 Ga0495652_0144078 3300046529 Bacteria 1870
721 Ga0495654_0169746 3300046530 Bacteria 952
722 Ga0495665_0023819 3300046531 Bacteria 3289
723 Ga0495640_0065792 3300046533 Bacteria 2447
724 Ga0495587_0104524 3300046536 Bacteria 1630
725 Ga0495609_0209427 3300046538 Bacteria 813
726 Ga0495609_0283019 3300046538 Bacteria 678
727 Ga0495597_0016294 3300046542 Bacteria 3510
728 Ga0495622_0008550 3300046557 Bacteria 4743
729 Ga0495622_0047423 3300046557 Bacteria 1996
730 Ga0495622_0059200 3300046557 Bacteria 1773
731 Ga0495656_0116262 3300046615 Bacteria 1257
732 Ga0495656_0122773 3300046615 Bacteria 1228
733 Ga0495668_0025947 3300046616 Bacteria 3327
734 Ga0495668_0109260 3300046616 Bacteria 1513
735 Ga0495668_0294907 3300046616 Bacteria 889
736 Ga0495634_0295030 3300046642 Bacteria 981
737 Ga0495634_0328065 3300046642 Bacteria 920
738 Ga0495625_0185183 3300046660 Bacteria 1382
739 Ga0495625_0265945 3300046660 Bacteria 1108
740 Ga0495625_0736094 3300046660 Bacteria 579
741 Ga0495635_0007080 3300046663 Bacteria 7840
742 Ga0495635_0167448 3300046663 Bacteria 1495
743 Ga0495635_0249521 3300046663 Bacteria 1197
744 Ga0495661_0019318 3300046665 Bacteria 4468
745 Ga0495588_0010784 3300046674 Bacteria 4265
746 Ga0495588_0120418 3300046674 Bacteria 1383
747 Ga0495588_0134094 3300046674 Bacteria 1307
748 Ga0495657_0082505 3300046675 Bacteria 2077
749 Ga0495646_0062776 3300046680 Bacteria 2208
750 Ga0495647_0312603 3300046681 Bacteria 710
751 Ga0495658_0152049 3300046683 Bacteria 1422
752 Ga0495658_0160461 3300046683 Bacteria 1386
753 Ga0495658_1031471 3300046683 Bacteria 525
754 Ga0495613_0001403 3300046689 Bacteria 18361
755 Ga0495613_0115015 3300046689 Bacteria 1936
756 Ga0495624_0069272 3300046690 Bacteria 2197
757 Ga0495670_0089042 3300046691 Bacteria 1578
758 Ga0495671_0626322 3300046692 Bacteria 511
759 Ga0495649_0007561 3300046694 Bacteria 6612
760 Ga0495649_0118585 3300046694 Bacteria 1400
761 Ga0495649_0132640 3300046694 Bacteria 1314
762 Ga0495649_0635620 3300046694 Bacteria 525
763 Ga0495589_0101403 3300046794 Bacteria 1393
764 Ga0495589_0114758 3300046794 Bacteria 1299
765 Ga0495600_0058329 3300046809 Bacteria 2522
766 Ga0495581_0013206 3300047315 Bacteria 4790
767 Ga0495581_0525418 3300047315 Bacteria 687
768 Ga0495604_0002649 3300047317 Bacteria 14363
769 Ga0495636_0005476 3300047318 Bacteria 4988
770 Ga0495674_0108061 3300047319 Bacteria 2361
771 Ga0495674_0767913 3300047319 Bacteria 752
772 Ga0495674_1117257 3300047319 Bacteria 599
773 Ga0495676_0043408 3300047321 Bacteria 3680
774 Ga0495676_0106528 3300047321 Bacteria 2065
775 Ga0495676_0276381 3300047321 Bacteria 1138
776 Ga0495680_0030632 3300047322 Bacteria 4391
777 Ga0495680_0230504 3300047322 Bacteria 1319
778 Ga0495683_0171618 3300047323 Bacteria 996
779 Ga0495683_0281631 3300047323 Bacteria 719
780 Ga0495687_015370 3300047443 Bacteria 3896
781 Ga0495687_020237 3300047443 Bacteria 3246
782 Ga0495675_0464355 3300047444 Bacteria 731
783 Ga0495677_0422379 3300047445 Bacteria 528
784 Ga0495673_0068596 3300047469 Bacteria 1498
785 Ga0495673_0094867 3300047469 Bacteria 1214
786 Ga0495686_0009742 3300047472 Bacteria 6894
787 Ga0495593_0004337 3300047673 Bacteria 8441
788 Ga0495593_0285275 3300047673 Bacteria 825
789 Ga0495602_0148575 3300048088 Bacteria 1845
790 Ga0495614_0015295 3300048089 Bacteria 3344
791 Ga0496100_0051591 3300048903 Bacteria 2671
792 Ga0496100_0257014 3300048903 Unclassified 1294
793 Ga0496101_0031533 3300048904 Bacteria 3727
794 Ga0496101_0111450 3300048904 Bacteria 2060
795 Ga0496101_0148906 3300048904 Bacteria 1789
796 Ga0496101_0167719 3300048904 Bacteria 1686
797 Ga0496101_0508112 3300048904 Unclassified 952
798 Ga0496101_0816273 3300048904 Bacteria 735
799 Ga0496102_0007791 3300048905 Bacteria 9155
800 Ga0496102_0033503 3300048905 Bacteria 4617
801 Ga0496102_0145385 3300048905 Unclassified 2225
802 Ga0496102_0269762 3300048905 Bacteria 1604
803 Ga0496102_0301397 3300048905 Bacteria 1510
804 Ga0496102_0852831 3300048905 Bacteria 833
805 Ga0496102_1121387 3300048905 Bacteria 706
806 Ga0496103_0003944 3300048906 Bacteria 9015
807 Ga0496103_0080964 3300048906 Bacteria 2042
808 Ga0496103_0324648 3300048906 Bacteria 990
809 Ga0496104_0000896 3300048907 Bacteria 25644
810 Ga0496104_0010154 3300048907 Bacteria 8403
811 Ga0496104_0061346 3300048907 Bacteria 3565
812 Ga0496104_0148887 3300048907 Bacteria 2247
813 Ga0496104_0172657 3300048907 Bacteria 2072
814 Ga0496105_0009605 3300048908 Bacteria 7572
815 Ga0496105_0022007 3300048908 Bacteria 5162
816 Ga0496105_0034201 3300048908 Bacteria 4179
817 Ga0496105_0048155 3300048908 Bacteria 3518
818 Ga0496105_0128979 3300048908 Bacteria 2086
819 Ga0496105_0196347 3300048908 Bacteria 1648
820 Ga0496106_0018282 3300048909 Bacteria 5181
821 Ga0496106_0133527 3300048909 Bacteria 1948
822 Ga0496106_0176907 3300048909 Bacteria 1693
823 Ga0496106_0193306 3300048909 Bacteria 1618
824 Ga0496106_0225514 3300048909 Bacteria 1495
825 Ga0496106_0233591 3300048909 Bacteria 1468
826 Ga0496107_0131081 3300048910 Bacteria 1851
827 Ga0496107_0244165 3300048910 Bacteria 1336
828 Ga0496107_0810164 3300048910 Bacteria 685
829 Ga0496107_0924951 3300048910 Bacteria 635
830 Ga0496107_1013894 3300048910 Bacteria 602
831 Ga0496108_0022480 3300048911 Bacteria 5185
832 Ga0496108_0093896 3300048911 Bacteria 2553
833 Ga0496108_0181189 3300048911 Bacteria 1824
834 Ga0496109_0032965 3300048912 Bacteria 4660
835 Ga0496109_0152816 3300048912 Bacteria 2161
836 Ga0496109_0694419 3300048912 Bacteria 955
837 Ga0496110_0040959 3300048913 Bacteria 4039
838 Ga0496110_0185077 3300048913 Bacteria 1891
839 Ga0496110_0218656 3300048913 Bacteria 1732
840 Ga0496110_0350871 3300048913 Bacteria 1344
841 Ga0496110_0515594 3300048913 Bacteria 1088
842 Ga0496112_0002053 3300048915 Bacteria 15963
843 Ga0496112_0108548 3300048915 Bacteria 2745
844 Ga0496112_0154635 3300048915 Bacteria 2261
845 Ga0496112_0624199 3300048915 Bacteria 1009
846 Ga0496112_0637107 3300048915 Unclassified 996
847 Ga0496113_0008940 3300048916 Bacteria 6557
848 Ga0496113_0019656 3300048916 Bacteria 4730
849 Ga0496113_0055287 3300048916 Bacteria 2975
850 Ga0496113_0133740 3300048916 Bacteria 1948
851 Ga0496113_0399006 3300048916 Unclassified 1104
852 Ga0496113_0919829 3300048916 Bacteria 691
853 Ga0496114_0008142 3300048917 Bacteria 8306
854 Ga0496114_0128797 3300048917 Bacteria 2184
855 Ga0496114_0187411 3300048917 Bacteria 1809
856 Ga0496114_0384536 3300048917 Bacteria 1242
857 Ga0496115_0002618 3300048918 Bacteria 12914
858 Ga0496115_0015633 3300048918 Bacteria 5762
859 Ga0496115_0051770 3300048918 Bacteria 3292
860 Ga0496115_0132308 3300048918 Bacteria 2056
861 Ga0496115_0171231 3300048918 Bacteria 1796
862 Ga0496115_0188586 3300048918 Bacteria 1704
863 Ga0496116_0063313 3300048919 Bacteria 2383
864 Ga0496117_0090930 3300048920 Bacteria 1965
865 Ga0496117_0215132 3300048920 Bacteria 1074
866 Ga0496118_0030959 3300048921 Bacteria 4450
867 Ga0496118_0216629 3300048921 Bacteria 1118
868 Ga0496118_0376014 3300048921 Bacteria 747
869 Ga0496118_0406508 3300048921 Bacteria 705
870 Ga0496119_0010947 3300048922 Bacteria 7574
871 Ga0496119_0057211 3300048922 Bacteria 2358
872 Ga0496119_0141287 3300048922 Bacteria 1300
873 Ga0496119_0384077 3300048922 Bacteria 673
874 Ga0496120_0041739 3300048923 Bacteria 2684
875 Ga0496120_0083996 3300048923 Bacteria 1718
876 Ga0496121_0037690 3300048924 Bacteria 4290
877 Ga0496121_0045625 3300048924 Bacteria 3763
878 Ga0496121_0099679 3300048924 Bacteria 2245
879 Ga0496121_0288166 3300048924 Bacteria 1120
880 Ga0496121_0419972 3300048924 Bacteria 870
881 Ga0496122_0129629 3300048925 Bacteria 1606
882 Ga0496123_0141291 3300048926 Bacteria 1316
883 Ga0496124_0010692 3300048927 Bacteria 9258
884 Ga0496124_0072508 3300048927 Bacteria 2852
885 Ga0496124_0084480 3300048927 Bacteria 2603
886 Ga0496125_0041692 3300048928 Bacteria 3921
887 Ga0496125_0079792 3300048928 Bacteria 2508
888 Ga0496125_0497035 3300048928 Bacteria 687
889 Ga0496126_0068767 3300048929 Bacteria 3161
890 Ga0496126_0082842 3300048929 Bacteria 2833
891 Ga0496126_0112419 3300048929 Bacteria 2371
892 Ga0496126_0163803 3300048929 Bacteria 1899
893 Ga0496126_0373602 3300048929 Bacteria 1162
894 Ga0496126_0566452 3300048929 Bacteria 899
895 Ga0496126_0734975 3300048929 Bacteria 763
896 Ga0496126_1053827 3300048929 Bacteria 607
897 Ga0495682_0056409 3300049460 Bacteria 1424
898 Ga0495682_0182165 3300049460 Bacteria 746
899 Ga0495682_0362092 3300049460 Bacteria 511
900 Ga0501031_0826809 3300049568 Bacteria 594
901 Ga0501032_0141492 3300049569 Bacteria 1584
902 Ga0501034_0177251 3300049571 Bacteria 2097
903 Ga0501034_0650400 3300049571 Bacteria 956
904 Ga0501036_1307695 3300049572 Bacteria 589
905 Ga0501037_0043998 3300049573 Bacteria 3281
906 Ga0501038_0068064 3300049574 Bacteria 3028
907 Ga0501041_0703195 3300049577 Bacteria 647
908 Ga0501043_0936715 3300049579 Bacteria 619
909 Ga0501046_0474030 3300049580 Bacteria 899
910 Ga0501047_0129506 3300049581 Bacteria 2404
911 Ga0501070_0116928 3300049586 Bacteria 2202
912 Ga0501072_0104772 3300049588 Bacteria 2249
913 Ga0501072_0622822 3300049588 Bacteria 850
914 Ga0501075_0165053 3300049591 Bacteria 1690
915 Ga0501075_1326609 3300049591 Bacteria 545
916 Ga0501076_0222417 3300049592 Bacteria 1543
917 Ga0501077_0107165 3300049593 Bacteria 1771
918 Ga0501225_0015607 3300049705 Bacteria 2114
919 Ga0501081_0398107 3300049743 Bacteria 1019
920 Ga0501241_003956 3300049758 Bacteria 2786
921 Ga0501035_0015022 3300049822 Bacteria 7146
922 Ga0501044_0059220 3300049823 Bacteria 3925
923 nmdc:mga03683_60448_c1 3300050489 Bacteria 1600
924 nmdc:mga03n38_439937_c1 3300050490 Bacteria 724
925 nmdc:mga03n38_643743_c1 3300050490 Bacteria 607
926 nmdc:mga00v17_109947_c1 3300050491 Bacteria 1748
927 nmdc:mga00v17_464197_c1 3300050491 Bacteria 822
928 nmdc:mga00v17_492634_c1 3300050491 Bacteria 795
929 nmdc:mga0yw44_14029_c1 3300050492 Bacteria 4240
930 nmdc:mga0yw44_273673_c1 3300050492 Bacteria 1127
931 nmdc:mga0yw44_321852_c1 3300050492 Bacteria 1038
932 nmdc:mga0yw44_53372_c1 3300050492 Bacteria 2455
933 nmdc:mga0yw44_95236_c1 3300050492 Bacteria 1888
934 nmdc:mga0k408_53816_c1 3300050493 Bacteria 2333
935 nmdc:mga06z11_228691_c1 3300050494 Bacteria 1089
936 nmdc:mga06z11_312415_c1 3300050494 Bacteria 936
937 nmdc:mga06z11_68007_c1 3300050494 Bacteria 1877
938 nmdc:mga04h51_30657_c1 3300050495 Bacteria 1694
939 nmdc:mga07m45_180822_c1 3300050496 Bacteria 1226
940 nmdc:mga05p37_1028560_c1 3300050507 Bacteria 872
941 nmdc:mga05p37_311_c1 3300050507 Bacteria 51481
942 nmdc:mga05p37_530232_c1 3300050507 Bacteria 1345
943 nmdc:mga09592_74789_c1 3300050508 Bacteria 2879
944 nmdc:mga0qj67_155511_c1 3300050509 Bacteria 1856
945 nmdc:mga0qj67_164949_c1 3300050509 Bacteria 1798
946 nmdc:mga0qj67_521501_c1 3300050509 Bacteria 954
947 nmdc:mga06r32_1386853_c1 3300050510 Bacteria 645
948 nmdc:mga06r32_54893_c1 3300050510 Bacteria 3821
949 nmdc:mga08y16_1584774_c1 3300050511 Bacteria 613
950 nmdc:mga08y16_165_c1 3300050511 Bacteria 57478
951 nmdc:mga08y16_309090_c1 3300050511 Bacteria 1628
952 nmdc:mga08y16_427382_c1 3300050511 Unclassified 1353
953 nmdc:mga08y16_437247_c1 3300050511 Bacteria 1336
954 nmdc:mga08y16_860179_c1 3300050511 Bacteria 895
955 nmdc:mga0n895_251544_c1 3300050512 Bacteria 1793
956 nmdc:mga0n895_59484_c1 3300050512 Bacteria 3769
957 nmdc:mga0n895_755344_c1 3300050512 Bacteria 965
958 nmdc:mga0rr50_65089_c1 3300050513 Bacteria 2760
959 nmdc:mga0rr50_748081_c1 3300050513 Bacteria 834
960 nmdc:mga0rr50_829547_c1 3300050513 Bacteria 789
961 nmdc:mga0a205_194358_c1 3300050515 Bacteria 1920
962 nmdc:mga0a205_441251_c1 3300050515 Bacteria 1162
963 nmdc:mga0a205_619288_c1 3300050515 Bacteria 935
964 nmdc:mga0sz30_566013_c1 3300050516 Bacteria 513
965 nmdc:mga0sz30_56798_c1 3300050516 Bacteria 1668
966 nmdc:mga0sz30_61894_c1 3300050516 Bacteria 1600
967 nmdc:mga0sz30_97097_c1 3300050516 Bacteria 1285
968 Ga0495601_0014670 3300053077 Bacteria 4725
969 Ga0495601_0449289 3300053077 Bacteria 834
970 Ga0495612_0009372 3300053078 Bacteria 3975
971 Ga0500610_0076022 3300053079 Bacteria 1751
972 Ga0495655_0011762 3300053083 Bacteria 1766
973 Ga0495595_0010648 3300053084 Bacteria 3829
974 Ga0495595_0093397 3300053084 Bacteria 1446
975 Ga0495595_0102385 3300053084 Bacteria 1383
976 Ga0495619_0018271 3300053085 Bacteria 4449
977 Ga0495619_0481544 3300053085 Bacteria 854
978 Ga0500578_0250110 3300053086 Bacteria 1068
979 Ga0500569_008279 3300053109 Bacteria 2373
980 Ga0500572_121149 3300053111 Bacteria 847
981 Ga0500594_0275886 3300053118 Bacteria 562
982 Ga0500595_014651 3300053119 Bacteria 2968
983 Ga0500628_195353 3300053129 Bacteria 582
984 Ga0500642_0027747 3300053130 Bacteria 2327
985 Ga0500642_0289263 3300053130 Bacteria 743
986 Ga0500559_0104698 3300053136 Bacteria 1306
987 Ga0500564_001786 3300053138 Bacteria 7617
988 Ga0500568_0150482 3300053139 Bacteria 861
989 Ga0500577_0300758 3300053142 Bacteria 700
990 Ga0500588_0025865 3300053146 Bacteria 1636
991 Ga0500590_298728 3300053148 Bacteria 607
992 Ga0500604_0005054 3300053151 Bacteria 3490
993 Ga0500639_232147 3300053163 Bacteria 758
994 Ga0500637_0077213 3300053178 Bacteria 1921
995 Ga0500645_127298 3300053730 Bacteria 708
996 Ga0500609_003004 3300053731 Bacteria 2396
997 Ga0500552_046751 3300053733 Bacteria 721
998 Ga0500661_028649 3300055283 Bacteria 982
999 Ga0501082_0708921 3300060353 Bacteria 881
1000 Ga0466962_0073131 3300061719 Bacteria 1638
1001 Ga0530510_0071062 3300061734 Bacteria 2526
1002 Ga0530510_0217832 3300061734 Bacteria 1419
1003 Ga0530510_0370772 3300061734 Bacteria 1077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042439 Ga0439464_0294212 Ga0439464_0294212_52_375 100
2 3300005434 Ga0070709_10814407 Ga0070709_108144072 106
3 3300005435 Ga0070714_100457006 Ga0070714_1004570062 106
4 3300025906 Ga0207699_10079206 Ga0207699_100792062 106
5 iso_pu_bacteria 8019555841 8019561302 109
6 iso_pu_bacteria 8019565922 8019571386 109
7 3300006195 Ga0075366_10937820 Ga0075366_109378201 113
8 3300006038 Ga0075365_10226698 Ga0075365_102266982 114
9 3300025926 Ga0207659_11271871 Ga0207659_112718711 116
10 3300049581 Ga0501047_0129506 Ga0501047_0129506_2018_2377 116
11 3300005329 Ga0070683_100064888 Ga0070683_1000648884 117
12 3300005354 Ga0070675_100909457 Ga0070675_1009094571 117
13 3300005535 Ga0070684_100012771 Ga0070684_1000127719 117
14 3300005564 Ga0070664_100062488 Ga0070664_1000624885 117
15 3300025944 Ga0207661_10049749 Ga0207661_100497492 117
16 3300025945 Ga0207679_10404310 Ga0207679_104043103 117
17 3300031995 Ga0307409_102150306 Ga0307409_1021503061 117
18 iso_pu_bacteria 3005710791 3005711924 117
19 3300009094 Ga0111539_10182458 Ga0111539_101824582 118
20 3300050511 nmdc:mga08y16_427382_c1 nmdc:mga08y16_427382_c1_790_1206 118
21 iso_pu_bacteria 2524023228 2524533006 118
22 iso_pu_bacteria 2904699407 2904711282 118
23 iso_pu_bacteria 2922425934 2922433008 118
24 3300005340 Ga0070689_100000218 Ga0070689_10000021827 119
25 3300005365 Ga0070688_100124152 Ga0070688_1001241521 119
26 3300005615 Ga0070702_101091014 Ga0070702_1010910141 119
27 3300005844 Ga0068862_100706392 Ga0068862_1007063922 119
28 3300025936 Ga0207670_10001216 Ga0207670_100012168 119
29 3300028380 Ga0268265_10823759 Ga0268265_108237592 119
30 3300046683 Ga0495658_1031471 Ga0495658_1031471_10_426 119
31 3300046642 Ga0495634_0328065 Ga0495634_0328065_541_906 120
32 3300049588 Ga0501072_0622822 Ga0501072_0622822_261_671 120
33 3300049591 Ga0501075_1326609 Ga0501075_1326609_111_521 120
34 3300005334 Ga0068869_100401758 Ga0068869_1004017582 121
35 3300005340 Ga0070689_100241800 Ga0070689_1002418002 121
36 3300005438 Ga0070701_10698486 Ga0070701_106984862 121
37 3300005444 Ga0070694_100149770 Ga0070694_1001497702 121
38 3300005545 Ga0070695_100062134 Ga0070695_1000621342 121
39 3300005563 Ga0068855_100549226 Ga0068855_1005492262 121
40 3300005616 Ga0068852_101099323 Ga0068852_1010993232 121
41 3300005617 Ga0068859_100593838 Ga0068859_1005938382 121
42 3300005842 Ga0068858_100141230 Ga0068858_1001412304 121
43 3300006844 Ga0075428_100092034 Ga0075428_1000920345 121
44 3300006844 Ga0075428_102026561 Ga0075428_1020265612 121
45 3300006846 Ga0075430_100139627 Ga0075430_1001396273 121
46 3300006847 Ga0075431_100717136 Ga0075431_1007171362 121
47 3300006931 Ga0097620_100593852 Ga0097620_1005938522 121
48 3300009094 Ga0111539_10082019 Ga0111539_100820194 121
49 3300009101 Ga0105247_11223096 Ga0105247_112230961 121
50 3300009177 Ga0105248_10361332 Ga0105248_103613322 121
51 3300009551 Ga0105238_11976296 Ga0105238_119762962 121
52 3300009553 Ga0105249_11878063 Ga0105249_118780632 121
53 3300011119 Ga0105246_10072093 Ga0105246_100720932 121
54 3300013105 Ga0157369_10389073 Ga0157369_103890732 121
55 3300013296 Ga0157374_10135048 Ga0157374_101350482 121
56 3300014325 Ga0163163_10008737 Ga0163163_100087373 121
57 3300014968 Ga0157379_10129296 Ga0157379_101292962 121
58 3300014969 Ga0157376_11898049 Ga0157376_118980491 121
59 3300025904 Ga0207647_10211354 Ga0207647_102113541 121
60 3300026035 Ga0207703_10253438 Ga0207703_102534382 121
61 3300030521 Ga0307511_10000923 Ga0307511_1000092319 121
62 3300039438 Ga0436360_0177325 Ga0436360_0177325_361_750 121
63 3300039438 Ga0436360_0431968 Ga0436360_0431968_306_695 121
64 3300039453 Ga0436362_1102929 Ga0436362_1102929_442_831 121
65 3300048904 Ga0496101_0148906 Ga0496101_0148906_102_470 121
66 3300048905 Ga0496102_0033503 Ga0496102_0033503_869_1237 121
67 3300048907 Ga0496104_0010154 Ga0496104_0010154_3136_3504 121
68 3300048908 Ga0496105_0022007 Ga0496105_0022007_3381_3749 121
69 3300048909 Ga0496106_0018282 Ga0496106_0018282_1595_1963 121
70 3300048910 Ga0496107_0131081 Ga0496107_0131081_319_687 121
71 3300048911 Ga0496108_0022480 Ga0496108_0022480_1768_2136 121
72 3300048912 Ga0496109_0152816 Ga0496109_0152816_178_546 121
73 3300048913 Ga0496110_0040959 Ga0496110_0040959_2496_2864 121
74 3300048915 Ga0496112_0002053 Ga0496112_0002053_9970_10338 121
75 3300048918 Ga0496115_0015633 Ga0496115_0015633_2730_3098 121
76 3300049571 Ga0501034_0177251 Ga0501034_0177251_1642_2019 121
77 3300050509 nmdc:mga0qj67_164949_c1 nmdc:mga0qj67_164949_c1_1154_1546 121
78 3300050510 nmdc:mga06r32_1386853_c1 nmdc:mga06r32_1386853_c1_40_432 121
79 3300050511 nmdc:mga08y16_437247_c1 nmdc:mga08y16_437247_c1_135_527 121
80 3300003214 JGI25165J46597_1029114 JGI25165J46597_10291141 122
81 3300003659 JGI25404J52841_10005705 JGI25404J52841_100057053 122
82 3300003659 JGI25404J52841_10025828 JGI25404J52841_100258282 122
83 3300003659 JGI25404J52841_10033067 JGI25404J52841_100330672 122
84 3300003659 JGI25404J52841_10084342 JGI25404J52841_100843421 122
85 3300003659 JGI25404J52841_10102911 JGI25404J52841_101029111 122
86 3300003763 Ga0055529_1008771 Ga0055529_10087712 122
87 3300005339 Ga0070660_100324698 Ga0070660_1003246981 122
88 3300005366 Ga0070659_101972830 Ga0070659_1019728301 122
89 3300005434 Ga0070709_10719820 Ga0070709_107198202 122
90 3300005455 Ga0070663_100214406 Ga0070663_1002144062 122
91 3300005535 Ga0070684_100573414 Ga0070684_1005734142 122
92 3300005614 Ga0068856_100734886 Ga0068856_1007348862 122
93 3300005614 Ga0068856_101207148 Ga0068856_1012071482 122
94 3300005618 Ga0068864_100357216 Ga0068864_1003572162 122
95 3300005842 Ga0068858_100341605 Ga0068858_1003416052 122
96 3300005983 Ga0081540_1006755 Ga0081540_10067557 122
97 3300005983 Ga0081540_1014175 Ga0081540_10141755 122
98 3300005983 Ga0081540_1015865 Ga0081540_10158655 122
99 3300005983 Ga0081540_1063026 Ga0081540_10630261 122
100 3300005983 Ga0081540_1099549 Ga0081540_10995492 122
101 3300005983 Ga0081540_1132526 Ga0081540_11325262 122
102 3300006163 Ga0070715_10306164 Ga0070715_103061642 122
103 3300006173 Ga0070716_100562523 Ga0070716_1005625232 122
104 3300006871 Ga0075434_100252281 Ga0075434_1002522812 122
105 3300007076 Ga0075435_100409109 Ga0075435_1004091092 122
106 3300009545 Ga0105237_11902621 Ga0105237_119026211 122
107 3300010375 Ga0105239_10014317 Ga0105239_100143174 122
108 3300011119 Ga0105246_11257500 Ga0105246_112575002 122
109 3300013296 Ga0157374_10514557 Ga0157374_105145572 122
110 3300013297 Ga0157378_11713876 Ga0157378_117138762 122
111 3300013308 Ga0157375_11185549 Ga0157375_111855492 122
112 3300021441 Ga0213871_10054984 Ga0213871_100549841 122
113 3300025254 Ga0209148_1001992 Ga0209148_10019925 122
114 3300025261 Ga0209233_1001411 Ga0209233_10014112 122
115 3300025261 Ga0209233_1014099 Ga0209233_10140993 122
116 3300025272 Ga0209455_1002997 Ga0209455_10029972 122
117 3300025272 Ga0209455_1059813 Ga0209455_10598131 122
118 3300025906 Ga0207699_10711556 Ga0207699_107115562 122
119 3300025909 Ga0207705_10754123 Ga0207705_107541232 122
120 3300025917 Ga0207660_11213746 Ga0207660_112137462 122
121 3300025919 Ga0207657_10560766 Ga0207657_105607662 122
122 3300025960 Ga0207651_10989985 Ga0207651_109899852 122
123 3300025961 Ga0207712_11272880 Ga0207712_112728802 122
124 3300026067 Ga0207678_10240553 Ga0207678_102405532 122
125 3300026078 Ga0207702_10107794 Ga0207702_101077942 122
126 3300026078 Ga0207702_11003725 Ga0207702_110037252 122
127 3300026095 Ga0207676_10107939 Ga0207676_101079392 122
128 3300026121 Ga0207683_10162150 Ga0207683_101621502 122
129 3300031548 Ga0307408_100091188 Ga0307408_1000911882 122
130 3300031731 Ga0307405_11331000 Ga0307405_113310001 122
131 3300035084 Ga0373928_0095946 Ga0373928_0095946_261_641 122
132 3300035692 Ga0373935_0355102 Ga0373935_0355102_251_622 122
133 3300039437 Ga0436365_0217255 Ga0436365_0217255_147_566 122
134 3300039453 Ga0436362_0855659 Ga0436362_0855659_40_408 122
135 3300046500 Ga0495596_0254165 Ga0495596_0254165_199_570 122
136 3300046794 Ga0495589_0114758 Ga0495589_0114758_270_641 122
137 3300047445 Ga0495677_0422379 Ga0495677_0422379_122_493 122
138 3300048906 Ga0496103_0324648 Ga0496103_0324648_436_807 122
139 3300048908 Ga0496105_0128979 Ga0496105_0128979_593_964 122
140 3300048909 Ga0496106_0225514 Ga0496106_0225514_994_1365 122
141 3300048910 Ga0496107_0244165 Ga0496107_0244165_851_1222 122
142 3300048913 Ga0496110_0515594 Ga0496110_0515594_163_534 122
143 3300048915 Ga0496112_0108548 Ga0496112_0108548_1702_2073 122
144 3300048916 Ga0496113_0055287 Ga0496113_0055287_61_432 122
145 3300048918 Ga0496115_0188586 Ga0496115_0188586_1118_1489 122
146 3300048924 Ga0496121_0288166 Ga0496121_0288166_584_955 122
147 3300048929 Ga0496126_0163803 Ga0496126_0163803_1349_1720 122
148 3300048929 Ga0496126_0373602 Ga0496126_0373602_202_573 122
149 3300049569 Ga0501032_0141492 Ga0501032_0141492_1117_1500 122
150 3300049573 Ga0501037_0043998 Ga0501037_0043998_1137_1520 122
151 3300049574 Ga0501038_0068064 Ga0501038_0068064_2282_2665 122
152 3300049579 Ga0501043_0936715 Ga0501043_0936715_216_599 122
153 3300049580 Ga0501046_0474030 Ga0501046_0474030_438_821 122
154 3300049586 Ga0501070_0116928 Ga0501070_0116928_1465_1848 122
155 3300049822 Ga0501035_0015022 Ga0501035_0015022_4539_4922 122
156 3300049823 Ga0501044_0059220 Ga0501044_0059220_3268_3651 122
157 3300050513 nmdc:mga0rr50_829547_c1 nmdc:mga0rr50_829547_c1_203_574 122
158 3300053079 Ga0500610_0076022 Ga0500610_0076022_678_1049 122
159 3300053086 Ga0500578_0250110 Ga0500578_0250110_138_509 122
160 3300053109 Ga0500569_008279 Ga0500569_008279_1865_2236 122
161 3300053142 Ga0500577_0300758 Ga0500577_0300758_194_565 122
162 3300053146 Ga0500588_0025865 Ga0500588_0025865_1082_1453 122
163 3300053730 Ga0500645_127298 Ga0500645_127298_274_645 122
164 3300053731 Ga0500609_003004 Ga0500609_003004_1135_1506 122
165 iso_pu_bacteria 2515154123 2515690549 124
166 3300005445 Ga0070708_100096040 Ga0070708_1000960403 125
167 3300005937 Ga0081455_10066073 Ga0081455_100660732 125
168 3300006353 Ga0075370_10668263 Ga0075370_106682631 125
169 3300009147 Ga0114129_10126638 Ga0114129_101266385 125
170 3300031456 Ga0307513_10040464 Ga0307513_100404645 125
171 3300033180 Ga0307510_10397357 Ga0307510_103973572 125
172 3300037418 Ga0395900_0381849 Ga0395900_0381849_31_426 125
173 3300037466 Ga0395898_1479339 Ga0395898_1479339_54_449 125
174 3300042157 Ga0439458_0150967 Ga0439458_0150967_25_423 125
175 3300047472 Ga0495686_0009742 Ga0495686_0009742_4081_4476 125
176 3300006028 Ga0070717_11989392 Ga0070717_119893921 126
177 3300006038 Ga0075365_10059701 Ga0075365_100597013 126
178 3300006177 Ga0075362_10110744 Ga0075362_101107443 126
179 3300006237 Ga0097621_100056117 Ga0097621_1000561173 126
180 3300025250 Ga0209026_1013566 Ga0209026_10135662 126
181 3300036712 Ga0316584_0860031 Ga0316584_0860031_86_478 126
182 3300038443 Ga0395901_2118230 Ga0395901_2118230_61_459 126
183 3300045051 Ga0451576_2350413 Ga0451576_2350413_155_535 126
184 3300047443 Ga0495687_020237 Ga0495687_020237_423_803 126
185 3300050489 nmdc:mga03683_60448_c1 nmdc:mga03683_60448_c1_383_763 126
186 3300005330 Ga0070690_100707735 Ga0070690_1007077351 127
187 3300005331 Ga0070670_100000064 Ga0070670_10000006477 127
188 3300005334 Ga0068869_100199707 Ga0068869_1001997071 127
189 3300005335 Ga0070666_10024946 Ga0070666_100249463 127
190 3300005338 Ga0068868_100093315 Ga0068868_1000933152 127
191 3300005341 Ga0070691_10093764 Ga0070691_100937642 127
192 3300005341 Ga0070691_10162486 Ga0070691_101624862 127
193 3300005343 Ga0070687_100042940 Ga0070687_1000429401 127
194 3300005343 Ga0070687_100553150 Ga0070687_1005531502 127
195 3300005344 Ga0070661_100150817 Ga0070661_1001508172 127
196 3300005347 Ga0070668_100841909 Ga0070668_1008419092 127
197 3300005353 Ga0070669_100008388 Ga0070669_1000083884 127
198 3300005354 Ga0070675_100313891 Ga0070675_1003138912 127
199 3300005355 Ga0070671_100000025 Ga0070671_10000002591 127
200 3300005356 Ga0070674_100308270 Ga0070674_1003082701 127
201 3300005364 Ga0070673_101156388 Ga0070673_1011563881 127
202 3300005367 Ga0070667_100000095 Ga0070667_10000009525 127
203 3300005438 Ga0070701_10204175 Ga0070701_102041752 127
204 3300005440 Ga0070705_100928012 Ga0070705_1009280121 127
205 3300005441 Ga0070700_100307204 Ga0070700_1003072042 127
206 3300005444 Ga0070694_100129946 Ga0070694_1001299463 127
207 3300005455 Ga0070663_100096127 Ga0070663_1000961272 127
208 3300005455 Ga0070663_100194344 Ga0070663_1001943442 127
209 3300005455 Ga0070663_100878201 Ga0070663_1008782012 127
210 3300005466 Ga0070685_10000005 Ga0070685_1000000519 127
211 3300005466 Ga0070685_10067843 Ga0070685_100678433 127
212 3300005466 Ga0070685_10213706 Ga0070685_102137061 127
213 3300005543 Ga0070672_100641985 Ga0070672_1006419851 127
214 3300005545 Ga0070695_100070751 Ga0070695_1000707513 127
215 3300005546 Ga0070696_100729516 Ga0070696_1007295162 127
216 3300005548 Ga0070665_100037379 Ga0070665_1000373792 127
217 3300005548 Ga0070665_100130649 Ga0070665_1001306493 127
218 3300005564 Ga0070664_100245222 Ga0070664_1002452222 127
219 3300005564 Ga0070664_100378305 Ga0070664_1003783053 127
220 3300005564 Ga0070664_101062645 Ga0070664_1010626452 127
221 3300005564 Ga0070664_101373258 Ga0070664_1013732582 127
222 3300005614 Ga0068856_100944819 Ga0068856_1009448192 127
223 3300005616 Ga0068852_101093894 Ga0068852_1010938942 127
224 3300005617 Ga0068859_100121233 Ga0068859_1001212332 127
225 3300005618 Ga0068864_100000073 Ga0068864_10000007325 127
226 3300005718 Ga0068866_10138942 Ga0068866_101389422 127
227 3300005718 Ga0068866_10292221 Ga0068866_102922211 127
228 3300005719 Ga0068861_100006933 Ga0068861_1000069337 127
229 3300005719 Ga0068861_100010562 Ga0068861_1000105625 127
230 3300005719 Ga0068861_101062731 Ga0068861_1010627312 127
231 3300005840 Ga0068870_10616860 Ga0068870_106168601 127
232 3300005842 Ga0068858_100053469 Ga0068858_1000534692 127
233 3300005842 Ga0068858_101954832 Ga0068858_1019548321 127
234 3300005843 Ga0068860_100002476 Ga0068860_1000024764 127
235 3300005843 Ga0068860_101569913 Ga0068860_1015699131 127
236 3300005844 Ga0068862_100018007 Ga0068862_1000180075 127
237 3300005844 Ga0068862_100369457 Ga0068862_1003694572 127
238 3300006237 Ga0097621_102049946 Ga0097621_1020499461 127
239 3300006358 Ga0068871_100376434 Ga0068871_1003764341 127
240 3300006846 Ga0075430_101640919 Ga0075430_1016409191 127
241 3300006881 Ga0068865_100584611 Ga0068865_1005846112 127
242 3300006931 Ga0097620_100121240 Ga0097620_1001212402 127
243 3300009093 Ga0105240_11099260 Ga0105240_110992602 127
244 3300009094 Ga0111539_10389385 Ga0111539_103893852 127
245 3300009094 Ga0111539_11317867 Ga0111539_113178671 127
246 3300009174 Ga0105241_11772787 Ga0105241_117727872 127
247 3300009177 Ga0105248_10120204 Ga0105248_101202042 127
248 3300009553 Ga0105249_10129837 Ga0105249_101298374 127
249 3300011119 Ga0105246_10766471 Ga0105246_107664712 127
250 3300013104 Ga0157370_10064289 Ga0157370_100642893 127
251 3300013105 Ga0157369_10000197 Ga0157369_1000019760 127
252 3300013307 Ga0157372_10120789 Ga0157372_101207892 127
253 3300013308 Ga0157375_10641208 Ga0157375_106412081 127
254 3300013308 Ga0157375_12552730 Ga0157375_125527301 127
255 3300014325 Ga0163163_10001573 Ga0163163_100015735 127
256 3300014325 Ga0163163_10430406 Ga0163163_104304062 127
257 3300014325 Ga0163163_13248336 Ga0163163_132483361 127
258 3300014326 Ga0157380_10279675 Ga0157380_102796752 127
259 3300014968 Ga0157379_10095777 Ga0157379_100957773 127
260 3300014968 Ga0157379_12065285 Ga0157379_120652851 127
261 3300014969 Ga0157376_11071391 Ga0157376_110713911 127
262 3300017792 Ga0163161_10921818 Ga0163161_109218181 127
263 3300020070 Ga0206356_10810643 Ga0206356_108106432 127
264 3300020082 Ga0206353_10858696 Ga0206353_108586963 127
265 3300021377 Ga0213874_10138503 Ga0213874_101385032 127
266 3300022467 Ga0224712_10003411 Ga0224712_100034112 127
267 3300025893 Ga0207682_10043211 Ga0207682_100432112 127
268 3300025899 Ga0207642_10111209 Ga0207642_101112093 127
269 3300025899 Ga0207642_10535474 Ga0207642_105354742 127
270 3300025900 Ga0207710_10006552 Ga0207710_100065525 127
271 3300025903 Ga0207680_10184360 Ga0207680_101843602 127
272 3300025903 Ga0207680_10606776 Ga0207680_106067761 127
273 3300025913 Ga0207695_10398335 Ga0207695_103983352 127
274 3300025920 Ga0207649_10286618 Ga0207649_102866182 127
275 3300025920 Ga0207649_11068713 Ga0207649_110687132 127
276 3300025923 Ga0207681_10059988 Ga0207681_100599884 127
277 3300025925 Ga0207650_10000106 Ga0207650_1000010675 127
278 3300025926 Ga0207659_10987038 Ga0207659_109870381 127
279 3300025931 Ga0207644_10000049 Ga0207644_1000004964 127
280 3300025937 Ga0207669_10488710 Ga0207669_104887102 127
281 3300025938 Ga0207704_10497220 Ga0207704_104972201 127
282 3300025940 Ga0207691_10107400 Ga0207691_101074003 127
283 3300025940 Ga0207691_10174281 Ga0207691_101742812 127
284 3300025941 Ga0207711_10000393 Ga0207711_1000039332 127
285 3300025942 Ga0207689_10139944 Ga0207689_101399442 127
286 3300025942 Ga0207689_10485110 Ga0207689_104851103 127
287 3300025942 Ga0207689_11155791 Ga0207689_111557911 127
288 3300025945 Ga0207679_10156798 Ga0207679_101567982 127
289 3300025945 Ga0207679_11125844 Ga0207679_111258441 127
290 3300025986 Ga0207658_10000073 Ga0207658_1000007375 127
291 3300026023 Ga0207677_10076028 Ga0207677_100760282 127
292 3300026035 Ga0207703_10096638 Ga0207703_100966382 127
293 3300026041 Ga0207639_10615315 Ga0207639_106153152 127
294 3300026067 Ga0207678_10142462 Ga0207678_101424623 127
295 3300026075 Ga0207708_10325342 Ga0207708_103253422 127
296 3300026078 Ga0207702_10216754 Ga0207702_102167543 127
297 3300026078 Ga0207702_11330873 Ga0207702_113308732 127
298 3300026088 Ga0207641_10157856 Ga0207641_101578562 127
299 3300026088 Ga0207641_10195283 Ga0207641_101952832 127
300 3300026089 Ga0207648_10229096 Ga0207648_102290962 127
301 3300026095 Ga0207676_10000010 Ga0207676_1000001075 127
302 3300026118 Ga0207675_100003423 Ga0207675_10000342310 127
303 3300026118 Ga0207675_100025297 Ga0207675_1000252976 127
304 3300026142 Ga0207698_11040750 Ga0207698_110407501 127
305 3300028380 Ga0268265_10001308 Ga0268265_1000130811 127
306 3300028380 Ga0268265_10717852 Ga0268265_107178522 127
307 3300028381 Ga0268264_10000123 Ga0268264_10000123164 127
308 3300031456 Ga0307513_10257961 Ga0307513_102579613 127
309 3300031507 Ga0307509_10310000 Ga0307509_103100002 127
310 3300031730 Ga0307516_10621194 Ga0307516_106211942 127
311 3300032005 Ga0307411_12297872 Ga0307411_122978721 127
312 3300035115 Ga0373941_0096459 Ga0373941_0096459_351_746 127
313 3300035117 Ga0373953_0393845 Ga0373953_0393845_134_520 127
314 3300035121 Ga0373960_0318691 Ga0373960_0318691_92_487 127
315 3300036401 Ga0373937_0125120 Ga0373937_0125120_1151_1537 127
316 3300037068 Ga0373925_0598776 Ga0373925_0598776_343_729 127
317 3300037312 Ga0395899_0021619 Ga0395899_0021619_338_721 127
318 3300037418 Ga0395900_0050015 Ga0395900_0050015_2840_3223 127
319 3300038443 Ga0395901_0000173 Ga0395901_0000173_44711_45094 127
320 3300039437 Ga0436365_0362878 Ga0436365_0362878_105_488 127
321 3300039450 Ga0436363_1540722 Ga0436363_1540722_357_740 127
322 3300041512 Ga0451853_1113938 Ga0451853_1113938_520_906 127
323 3300041512 Ga0451853_2256764 Ga0451853_2256764_230_613 127
324 3300044684 Ga0466966_0163607 Ga0466966_0163607_162_545 127
325 3300045051 Ga0451576_1071464 Ga0451576_1071464_105_488 127
326 3300045836 Ga0466958_0000419 Ga0466958_0000419_6938_7321 127
327 3300046460 Ga0495638_0032658 Ga0495638_0032658_272_655 127
328 3300046461 Ga0495641_0265799 Ga0495641_0265799_175_561 127
329 3300046615 Ga0495656_0116262 Ga0495656_0116262_179_565 127
330 3300048927 Ga0496124_0084480 Ga0496124_0084480_1971_2354 127
331 3300048929 Ga0496126_0566452 Ga0496126_0566452_282_665 127
332 3300049705 Ga0501225_0015607 Ga0501225_0015607_300_686 127
333 3300050511 nmdc:mga08y16_1584774_c1 nmdc:mga08y16_1584774_c1_57_449 127
334 3300050511 nmdc:mga08y16_860179_c1 nmdc:mga08y16_860179_c1_232_636 127
335 3300050516 nmdc:mga0sz30_566013_c1 nmdc:mga0sz30_566013_c1_78_461 127
336 3300053118 Ga0500594_0275886 Ga0500594_0275886_30_413 127
337 3300053129 Ga0500628_195353 Ga0500628_195353_189_572 127
338 3300053130 Ga0500642_0027747 Ga0500642_0027747_441_824 127
339 3300053139 Ga0500568_0150482 Ga0500568_0150482_352_735 127
340 3300053151 Ga0500604_0005054 Ga0500604_0005054_2769_3152 127
341 3300061719 Ga0466962_0073131 Ga0466962_0073131_624_1007 127
342 3300003354 JGI25160J50197_1004632 JGI25160J50197_10046325 128
343 3300003759 Ga0055525_1000013 Ga0055525_1000013150 128
344 3300003762 Ga0055542_1013422 Ga0055542_10134222 128
345 3300005262 Ga0065165_1090711 Ga0065165_10907112 128
346 3300005327 Ga0070658_10033059 Ga0070658_100330592 128
347 3300005327 Ga0070658_10199322 Ga0070658_101993222 128
348 3300005331 Ga0070670_100813020 Ga0070670_1008130201 128
349 3300005335 Ga0070666_10330618 Ga0070666_103306181 128
350 3300005338 Ga0068868_100158320 Ga0068868_1001583203 128
351 3300005338 Ga0068868_101251026 Ga0068868_1012510262 128
352 3300005338 Ga0068868_101828918 Ga0068868_1018289181 128
353 3300005339 Ga0070660_100199989 Ga0070660_1001999892 128
354 3300005339 Ga0070660_100884065 Ga0070660_1008840652 128
355 3300005347 Ga0070668_100010504 Ga0070668_1000105046 128
356 3300005353 Ga0070669_100273198 Ga0070669_1002731981 128
357 3300005354 Ga0070675_100745309 Ga0070675_1007453092 128
358 3300005355 Ga0070671_100076587 Ga0070671_1000765873 128
359 3300005364 Ga0070673_100140442 Ga0070673_1001404422 128
360 3300005366 Ga0070659_100796319 Ga0070659_1007963191 128
361 3300005367 Ga0070667_100056278 Ga0070667_1000562783 128
362 3300005367 Ga0070667_101269099 Ga0070667_1012690991 128
363 3300005441 Ga0070700_101038432 Ga0070700_1010384321 128
364 3300005455 Ga0070663_100285031 Ga0070663_1002850312 128
365 3300005455 Ga0070663_101671141 Ga0070663_1016711411 128
366 3300005457 Ga0070662_100143187 Ga0070662_1001431872 128
367 3300005468 Ga0070707_100887752 Ga0070707_1008877521 128
368 3300005518 Ga0070699_100280999 Ga0070699_1002809992 128
369 3300005518 Ga0070699_100521664 Ga0070699_1005216642 128
370 3300005536 Ga0070697_100224933 Ga0070697_1002249333 128
371 3300005539 Ga0068853_100316025 Ga0068853_1003160252 128
372 3300005548 Ga0070665_100167983 Ga0070665_1001679832 128
373 3300005548 Ga0070665_100212527 Ga0070665_1002125272 128
374 3300005548 Ga0070665_100574111 Ga0070665_1005741112 128
375 3300005549 Ga0070704_100030715 Ga0070704_1000307154 128
376 3300005563 Ga0068855_101712331 Ga0068855_1017123312 128
377 3300005577 Ga0068857_100884596 Ga0068857_1008845962 128
378 3300005577 Ga0068857_100927161 Ga0068857_1009271612 128
379 3300005614 Ga0068856_100071936 Ga0068856_1000719364 128
380 3300005614 Ga0068856_100545639 Ga0068856_1005456393 128
381 3300005616 Ga0068852_100099851 Ga0068852_1000998512 128
382 3300005617 Ga0068859_100757110 Ga0068859_1007571102 128
383 3300005617 Ga0068859_101236919 Ga0068859_1012369192 128
384 3300005718 Ga0068866_10184305 Ga0068866_101843052 128
385 3300005718 Ga0068866_10208917 Ga0068866_102089172 128
386 3300005841 Ga0068863_100117351 Ga0068863_1001173511 128
387 3300005842 Ga0068858_100244294 Ga0068858_1002442942 128
388 3300005842 Ga0068858_100611462 Ga0068858_1006114622 128
389 3300005843 Ga0068860_100354647 Ga0068860_1003546473 128
390 3300005843 Ga0068860_100400160 Ga0068860_1004001602 128
391 3300005843 Ga0068860_100585771 Ga0068860_1005857711 128
392 3300005844 Ga0068862_100269758 Ga0068862_1002697582 128
393 3300005937 Ga0081455_10427031 Ga0081455_104270312 128
394 3300005981 Ga0081538_10001222 Ga0081538_1000122213 128
395 3300005983 Ga0081540_1205164 Ga0081540_12051641 128
396 3300005985 Ga0081539_10138687 Ga0081539_101386873 128
397 3300006038 Ga0075365_10111571 Ga0075365_101115713 128
398 3300006038 Ga0075365_10300975 Ga0075365_103009752 128
399 3300006038 Ga0075365_10464055 Ga0075365_104640551 128
400 3300006042 Ga0075368_10006038 Ga0075368_100060384 128
401 3300006048 Ga0075363_100226531 Ga0075363_1002265313 128
402 3300006048 Ga0075363_100277487 Ga0075363_1002774872 128
403 3300006051 Ga0075364_10030335 Ga0075364_100303353 128
404 3300006051 Ga0075364_10619061 Ga0075364_106190612 128
405 3300006177 Ga0075362_10022671 Ga0075362_100226711 128
406 3300006178 Ga0075367_10563272 Ga0075367_105632721 128
407 3300006186 Ga0075369_10034622 Ga0075369_100346222 128
408 3300006186 Ga0075369_10088562 Ga0075369_100885623 128
409 3300006195 Ga0075366_10047140 Ga0075366_100471403 128
410 3300006195 Ga0075366_10545116 Ga0075366_105451161 128
411 3300006353 Ga0075370_10229335 Ga0075370_102293351 128
412 3300006358 Ga0068871_100848913 Ga0068871_1008489131 128
413 3300006358 Ga0068871_101017249 Ga0068871_1010172492 128
414 3300006844 Ga0075428_100007957 Ga0075428_1000079573 128
415 3300006844 Ga0075428_100956125 Ga0075428_1009561252 128
416 3300006846 Ga0075430_100058369 Ga0075430_1000583692 128
417 3300006846 Ga0075430_100677977 Ga0075430_1006779772 128
418 3300006847 Ga0075431_100000003 Ga0075431_100000003111 128
419 3300006847 Ga0075431_100073780 Ga0075431_1000737804 128
420 3300006852 Ga0075433_10446718 Ga0075433_104467183 128
421 3300006852 Ga0075433_10458333 Ga0075433_104583332 128
422 3300006871 Ga0075434_101285425 Ga0075434_1012854252 128
423 3300006880 Ga0075429_100086645 Ga0075429_1000866454 128
424 3300006881 Ga0068865_101821739 Ga0068865_1018217392 128
425 3300006931 Ga0097620_100757015 Ga0097620_1007570152 128
426 3300006931 Ga0097620_101236923 Ga0097620_1012369232 128
427 3300006941 Ga0099825_1034203 Ga0099825_10342032 128
428 3300006942 Ga0099824_1008295 Ga0099824_10082953 128
429 3300006943 Ga0099822_1047693 Ga0099822_10476932 128
430 3300006944 Ga0099823_1082188 Ga0099823_10821882 128
431 3300006944 Ga0099823_1128175 Ga0099823_11281752 128
432 3300007076 Ga0075435_100135066 Ga0075435_1001350663 128
433 3300007076 Ga0075435_100265617 Ga0075435_1002656172 128
434 3300007076 Ga0075435_100265959 Ga0075435_1002659592 128
435 3300007076 Ga0075435_100419858 Ga0075435_1004198582 128
436 3300009092 Ga0105250_10171171 Ga0105250_101711712 128
437 3300009093 Ga0105240_10005199 Ga0105240_1000519915 128
438 3300009093 Ga0105240_10208055 Ga0105240_102080554 128
439 3300009093 Ga0105240_10330563 Ga0105240_103305632 128
440 3300009093 Ga0105240_12709916 Ga0105240_127099161 128
441 3300009094 Ga0111539_10000504 Ga0111539_1000050436 128
442 3300009094 Ga0111539_10042598 Ga0111539_100425982 128
443 3300009094 Ga0111539_10188945 Ga0111539_101889451 128
444 3300009101 Ga0105247_10015814 Ga0105247_100158146 128
445 3300009101 Ga0105247_10299937 Ga0105247_102999372 128
446 3300009147 Ga0114129_10000062 Ga0114129_1000006278 128
447 3300009147 Ga0114129_10443960 Ga0114129_104439603 128
448 3300009148 Ga0105243_10092482 Ga0105243_100924822 128
449 3300009148 Ga0105243_10145212 Ga0105243_101452123 128
450 3300009174 Ga0105241_10067148 Ga0105241_100671482 128
451 3300009174 Ga0105241_10134050 Ga0105241_101340502 128
452 3300009174 Ga0105241_10367629 Ga0105241_103676291 128
453 3300009174 Ga0105241_10559150 Ga0105241_105591502 128
454 3300009176 Ga0105242_10420308 Ga0105242_104203082 128
455 3300009177 Ga0105248_10188067 Ga0105248_101880673 128
456 3300009177 Ga0105248_10221684 Ga0105248_102216843 128
457 3300009545 Ga0105237_10003771 Ga0105237_1000377115 128
458 3300009545 Ga0105237_10009728 Ga0105237_100097284 128
459 3300009545 Ga0105237_10200368 Ga0105237_102003682 128
460 3300009545 Ga0105237_12028378 Ga0105237_120283781 128
461 3300009551 Ga0105238_10205129 Ga0105238_102051293 128
462 3300009551 Ga0105238_10274416 Ga0105238_102744162 128
463 3300009553 Ga0105249_10046667 Ga0105249_100466672 128
464 3300009553 Ga0105249_10152947 Ga0105249_101529472 128
465 3300009553 Ga0105249_11086502 Ga0105249_110865021 128
466 3300010375 Ga0105239_10027503 Ga0105239_100275033 128
467 3300010375 Ga0105239_10070819 Ga0105239_100708195 128
468 3300010375 Ga0105239_10284074 Ga0105239_102840742 128
469 3300010375 Ga0105239_10903292 Ga0105239_109032922 128
470 3300010375 Ga0105239_10964878 Ga0105239_109648782 128
471 3300010375 Ga0105239_11400150 Ga0105239_114001502 128
472 3300013296 Ga0157374_10061313 Ga0157374_100613133 128
473 3300013296 Ga0157374_10724610 Ga0157374_107246102 128
474 3300013296 Ga0157374_10793288 Ga0157374_107932882 128
475 3300013297 Ga0157378_10089921 Ga0157378_100899213 128
476 3300013306 Ga0163162_10483629 Ga0163162_104836293 128
477 3300013306 Ga0163162_11182607 Ga0163162_111826071 128
478 3300013307 Ga0157372_13322672 Ga0157372_133226721 128
479 3300013308 Ga0157375_10554349 Ga0157375_105543493 128
480 3300013308 Ga0157375_10689452 Ga0157375_106894522 128
481 3300013308 Ga0157375_12376244 Ga0157375_123762441 128
482 3300014325 Ga0163163_10108419 Ga0163163_101084193 128
483 3300014325 Ga0163163_10420667 Ga0163163_104206672 128
484 3300014325 Ga0163163_10764936 Ga0163163_107649362 128
485 3300014326 Ga0157380_11164888 Ga0157380_111648882 128
486 3300014968 Ga0157379_10271735 Ga0157379_102717352 128
487 3300014968 Ga0157379_10600355 Ga0157379_106003551 128
488 3300014969 Ga0157376_13126642 Ga0157376_131266421 128
489 3300015262 Ga0182007_10191258 Ga0182007_101912581 128
490 3300021321 Ga0214542_1040082 Ga0214542_10400822 128
491 3300021324 Ga0214545_1049363 Ga0214545_10493631 128
492 3300021327 Ga0214543_1040892 Ga0214543_10408922 128
493 3300025226 Ga0209674_107151 Ga0209674_1071513 128
494 3300025230 Ga0209563_100025 Ga0209563_100025436 128
495 3300025254 Ga0209148_1001706 Ga0209148_10017068 128
496 3300025256 Ga0209759_1003269 Ga0209759_10032692 128
497 3300025256 Ga0209759_1003924 Ga0209759_10039243 128
498 3300025261 Ga0209233_1017254 Ga0209233_10172542 128
499 3300025261 Ga0209233_1019148 Ga0209233_10191482 128
500 3300025284 Ga0209130_1042214 Ga0209130_10422142 128
501 3300025295 Ga0209564_1004981 Ga0209564_10049813 128
502 3300025297 Ga0209758_1000397 Ga0209758_100039738 128
503 3300025297 Ga0209758_1032773 Ga0209758_10327732 128
504 3300025299 Ga0209256_1016929 Ga0209256_10169292 128
505 3300025299 Ga0209256_1019562 Ga0209256_10195622 128
506 3300025299 Ga0209256_1069455 Ga0209256_10694552 128
507 3300025302 Ga0207426_1000886 Ga0207426_10008867 128
508 3300025304 Ga0209257_1080457 Ga0209257_10804572 128
509 3300025304 Ga0209257_1124311 Ga0209257_11243112 128
510 3300025711 Ga0207696_1087903 Ga0207696_10879032 128
511 3300025900 Ga0207710_10097910 Ga0207710_100979101 128
512 3300025900 Ga0207710_10217379 Ga0207710_102173792 128
513 3300025900 Ga0207710_10314277 Ga0207710_103142772 128
514 3300025901 Ga0207688_10077703 Ga0207688_100777033 128
515 3300025904 Ga0207647_10007446 Ga0207647_100074464 128
516 3300025904 Ga0207647_10400278 Ga0207647_104002781 128
517 3300025906 Ga0207699_10612949 Ga0207699_106129491 128
518 3300025909 Ga0207705_10453777 Ga0207705_104537772 128
519 3300025911 Ga0207654_10044616 Ga0207654_100446162 128
520 3300025911 Ga0207654_10047882 Ga0207654_100478823 128
521 3300025911 Ga0207654_10112180 Ga0207654_101121802 128
522 3300025913 Ga0207695_10000148 Ga0207695_10000148152 128
523 3300025913 Ga0207695_10492398 Ga0207695_104923982 128
524 3300025914 Ga0207671_10002713 Ga0207671_100027135 128
525 3300025914 Ga0207671_10151361 Ga0207671_101513613 128
526 3300025919 Ga0207657_10026602 Ga0207657_100266024 128
527 3300025919 Ga0207657_10127631 Ga0207657_101276312 128
528 3300025922 Ga0207646_10780842 Ga0207646_107808422 128
529 3300025924 Ga0207694_10166327 Ga0207694_101663272 128
530 3300025926 Ga0207659_10987391 Ga0207659_109873912 128
531 3300025927 Ga0207687_10147173 Ga0207687_101471732 128
532 3300025927 Ga0207687_10192006 Ga0207687_101920062 128
533 3300025928 Ga0207700_11939193 Ga0207700_119391931 128
534 3300025931 Ga0207644_10152295 Ga0207644_101522953 128
535 3300025932 Ga0207690_10044661 Ga0207690_100446614 128
536 3300025932 Ga0207690_10374053 Ga0207690_103740532 128
537 3300025933 Ga0207706_10168661 Ga0207706_101686612 128
538 3300025933 Ga0207706_10347683 Ga0207706_103476832 128
539 3300025933 Ga0207706_11389754 Ga0207706_113897542 128
540 3300025934 Ga0207686_10153635 Ga0207686_101536352 128
541 3300025935 Ga0207709_10118512 Ga0207709_101185122 128
542 3300025936 Ga0207670_11090472 Ga0207670_110904721 128
543 3300025939 Ga0207665_10595739 Ga0207665_105957393 128
544 3300025941 Ga0207711_10181683 Ga0207711_101816832 128
545 3300025942 Ga0207689_10238012 Ga0207689_102380122 128
546 3300025942 Ga0207689_10384788 Ga0207689_103847882 128
547 3300025942 Ga0207689_11796817 Ga0207689_117968171 128
548 3300025945 Ga0207679_10348578 Ga0207679_103485783 128
549 3300025949 Ga0207667_10454558 Ga0207667_104545582 128
550 3300025949 Ga0207667_11057383 Ga0207667_110573832 128
551 3300025961 Ga0207712_10044794 Ga0207712_100447943 128
552 3300025972 Ga0207668_10085104 Ga0207668_100851042 128
553 3300025981 Ga0207640_10395606 Ga0207640_103956061 128
554 3300025986 Ga0207658_10155946 Ga0207658_101559462 128
555 3300026023 Ga0207677_10198109 Ga0207677_101981092 128
556 3300026023 Ga0207677_10317934 Ga0207677_103179342 128
557 3300026035 Ga0207703_10204174 Ga0207703_102041743 128
558 3300026041 Ga0207639_10089594 Ga0207639_100895943 128
559 3300026041 Ga0207639_11381071 Ga0207639_113810711 128
560 3300026067 Ga0207678_10328064 Ga0207678_103280642 128
561 3300026067 Ga0207678_11484875 Ga0207678_114848751 128
562 3300026067 Ga0207678_11520632 Ga0207678_115206321 128
563 3300026075 Ga0207708_10191222 Ga0207708_101912223 128
564 3300026075 Ga0207708_11138764 Ga0207708_111387641 128
565 3300026078 Ga0207702_10112744 Ga0207702_101127443 128
566 3300026078 Ga0207702_10224358 Ga0207702_102243583 128
567 3300026088 Ga0207641_10293638 Ga0207641_102936383 128
568 3300026088 Ga0207641_10407342 Ga0207641_104073422 128
569 3300026095 Ga0207676_10549397 Ga0207676_105493972 128
570 3300026116 Ga0207674_10238330 Ga0207674_102383302 128
571 3300026118 Ga0207675_100665908 Ga0207675_1006659081 128
572 3300026142 Ga0207698_10914008 Ga0207698_109140081 128
573 3300026142 Ga0207698_11082097 Ga0207698_110820972 128
574 3300027296 Ga0209389_1000157 Ga0209389_100015710 128
575 3300027296 Ga0209389_1002855 Ga0209389_10028554 128
576 3300027357 Ga0209589_1006917 Ga0209589_100691710 128
577 3300027361 Ga0209489_100045 Ga0209489_100045146 128
578 3300027361 Ga0209489_101111 Ga0209489_10111150 128
579 3300027363 Ga0209700_100011 Ga0209700_100011308 128
580 3300027866 Ga0209813_10023191 Ga0209813_100231911 128
581 3300027907 Ga0207428_10003737 Ga0207428_1000373710 128
582 3300028379 Ga0268266_10189744 Ga0268266_101897442 128
583 3300028379 Ga0268266_10371353 Ga0268266_103713532 128
584 3300028379 Ga0268266_10751197 Ga0268266_107511972 128
585 3300028380 Ga0268265_10149880 Ga0268265_101498802 128
586 3300028380 Ga0268265_10269682 Ga0268265_102696823 128
587 3300028380 Ga0268265_12143009 Ga0268265_121430092 128
588 3300028381 Ga0268264_10388154 Ga0268264_103881543 128
589 3300033180 Ga0307510_10030650 Ga0307510_100306502 128
590 3300035724 Ga0373933_0000068 Ga0373933_0000068_19825_20214 128
591 3300035724 Ga0373933_0246808 Ga0373933_0246808_472_861 128
592 3300035725 Ga0373947_0325052 Ga0373947_0325052_229_615 128
593 3300036401 Ga0373937_1254905 Ga0373937_1254905_46_432 128
594 3300037853 Ga0436364_1404047 Ga0436364_1404047_219_605 128
595 3300039437 Ga0436365_0368099 Ga0436365_0368099_115_501 128
596 3300039447 Ga0436361_1011853 Ga0436361_1011853_2036_2422 128
597 3300039450 Ga0436363_1313418 Ga0436363_1313418_294_680 128
598 3300041404 Ga0439436_0024136 Ga0439436_0024136_400_789 128
599 3300041413 Ga0439465_0000040 Ga0439465_0000040_23902_24291 128
600 3300041997 Ga0439431_0212070 Ga0439431_0212070_61_450 128
601 3300042007 Ga0439449_0000398 Ga0439449_0000398_12620_13009 128
602 3300044656 Ga0466969_0007141 Ga0466969_0007141_2447_2833 128
603 3300044658 Ga0466972_0003163 Ga0466972_0003163_7046_7432 128
604 3300044658 Ga0466972_0260021 Ga0466972_0260021_228_614 128
605 3300044668 Ga0466980_0047200 Ga0466980_0047200_1559_1951 128
606 3300044684 Ga0466966_0017642 Ga0466966_0017642_1306_1692 128
607 3300044684 Ga0466966_0030637 Ga0466966_0030637_1487_1873 128
608 3300044693 Ga0466961_0000849 Ga0466961_0000849_8430_8816 128
609 3300044693 Ga0466961_0014864 Ga0466961_0014864_4539_4931 128
610 3300044693 Ga0466961_0110028 Ga0466961_0110028_315_701 128
611 3300044694 Ga0466963_0004353 Ga0466963_0004353_5781_6167 128
612 3300044706 Ga0466964_0065636 Ga0466964_0065636_184_570 128
613 3300044735 Ga0466968_0080763 Ga0466968_0080763_600_986 128
614 3300044735 Ga0466968_0311148 Ga0466968_0311148_78_464 128
615 3300044765 Ga0466970_0168601 Ga0466970_0168601_553_939 128
616 3300044765 Ga0466970_0412746 Ga0466970_0412746_64_450 128
617 3300045049 Ga0466959_0017369 Ga0466959_0017369_1297_1683 128
618 3300045049 Ga0466959_0025900 Ga0466959_0025900_1618_2004 128
619 3300045836 Ga0466958_0308602 Ga0466958_0308602_614_1000 128
620 3300045836 Ga0466958_0590491 Ga0466958_0590491_45_437 128
621 3300045976 Ga0466967_0015071 Ga0466967_0015071_2817_3203 128
622 3300046457 Ga0495590_0092190 Ga0495590_0092190_190_576 128
623 3300046459 Ga0495629_0083216 Ga0495629_0083216_798_1184 128
624 3300046459 Ga0495629_0342721 Ga0495629_0342721_617_1003 128
625 3300046462 Ga0495651_0091567 Ga0495651_0091567_918_1304 128
626 3300046463 Ga0495653_0265840 Ga0495653_0265840_469_855 128
627 3300046474 Ga0495605_0138396 Ga0495605_0138396_316_702 128
628 3300046474 Ga0495605_0145849 Ga0495605_0145849_282_668 128
629 3300046474 Ga0495605_0325839 Ga0495605_0325839_10_396 128
630 3300046475 Ga0495639_0317123 Ga0495639_0317123_271_657 128
631 3300046476 Ga0495662_0120272 Ga0495662_0120272_394_780 128
632 3300046500 Ga0495596_0096004 Ga0495596_0096004_128_514 128
633 3300046506 Ga0495583_0058267 Ga0495583_0058267_739_1137 128
634 3300046506 Ga0495583_0124159 Ga0495583_0124159_66_452 128
635 3300046507 Ga0495606_0031017 Ga0495606_0031017_3073_3459 128
636 3300046507 Ga0495606_0043113 Ga0495606_0043113_246_632 128
637 3300046507 Ga0495606_0244358 Ga0495606_0244358_434_820 128
638 3300046511 Ga0495608_0027780 Ga0495608_0027780_1759_2145 128
639 3300046512 Ga0495610_0076110 Ga0495610_0076110_113_499 128
640 3300046513 Ga0495616_0030402 Ga0495616_0030402_763_1149 128
641 3300046513 Ga0495616_0150921 Ga0495616_0150921_526_924 128
642 3300046515 Ga0495620_0188813 Ga0495620_0188813_31_417 128
643 3300046516 Ga0495628_0301397 Ga0495628_0301397_278_664 128
644 3300046516 Ga0495628_0708442 Ga0495628_0708442_252_638 128
645 3300046519 Ga0495632_0300364 Ga0495632_0300364_246_632 128
646 3300046522 Ga0495643_0019724 Ga0495643_0019724_1760_2146 128
647 3300046522 Ga0495643_0144262 Ga0495643_0144262_473_859 128
648 3300046522 Ga0495643_0263163 Ga0495643_0263163_270_656 128
649 3300046524 Ga0495648_0272860 Ga0495648_0272860_44_430 128
650 3300046524 Ga0495648_0294076 Ga0495648_0294076_146_532 128
651 3300046524 Ga0495648_0461180 Ga0495648_0461180_106_492 128
652 3300046529 Ga0495652_0144078 Ga0495652_0144078_455_841 128
653 3300046530 Ga0495654_0169746 Ga0495654_0169746_431_817 128
654 3300046533 Ga0495640_0065792 Ga0495640_0065792_1111_1497 128
655 3300046536 Ga0495587_0104524 Ga0495587_0104524_438_824 128
656 3300046538 Ga0495609_0209427 Ga0495609_0209427_171_557 128
657 3300046538 Ga0495609_0283019 Ga0495609_0283019_73_459 128
658 3300046542 Ga0495597_0016294 Ga0495597_0016294_1583_1969 128
659 3300046557 Ga0495622_0047423 Ga0495622_0047423_1129_1515 128
660 3300046557 Ga0495622_0059200 Ga0495622_0059200_1107_1493 128
661 3300046616 Ga0495668_0025947 Ga0495668_0025947_1949_2335 128
662 3300046616 Ga0495668_0109260 Ga0495668_0109260_236_634 128
663 3300046616 Ga0495668_0294907 Ga0495668_0294907_86_472 128
664 3300046642 Ga0495634_0295030 Ga0495634_0295030_527_913 128
665 3300046660 Ga0495625_0185183 Ga0495625_0185183_801_1187 128
666 3300046660 Ga0495625_0265945 Ga0495625_0265945_386_772 128
667 3300046660 Ga0495625_0736094 Ga0495625_0736094_159_545 128
668 3300046663 Ga0495635_0007080 Ga0495635_0007080_1506_1892 128
669 3300046663 Ga0495635_0249521 Ga0495635_0249521_564_953 128
670 3300046665 Ga0495661_0019318 Ga0495661_0019318_379_777 128
671 3300046674 Ga0495588_0120418 Ga0495588_0120418_295_693 128
672 3300046674 Ga0495588_0134094 Ga0495588_0134094_722_1108 128
673 3300046675 Ga0495657_0082505 Ga0495657_0082505_288_674 128
674 3300046680 Ga0495646_0062776 Ga0495646_0062776_287_673 128
675 3300046683 Ga0495658_0152049 Ga0495658_0152049_982_1371 128
676 3300046683 Ga0495658_0160461 Ga0495658_0160461_285_671 128
677 3300046689 Ga0495613_0115015 Ga0495613_0115015_672_1058 128
678 3300046690 Ga0495624_0069272 Ga0495624_0069272_834_1220 128
679 3300046691 Ga0495670_0089042 Ga0495670_0089042_458_856 128
680 3300046692 Ga0495671_0626322 Ga0495671_0626322_12_398 128
681 3300046694 Ga0495649_0007561 Ga0495649_0007561_5820_6206 128
682 3300046694 Ga0495649_0118585 Ga0495649_0118585_721_1107 128
683 3300046694 Ga0495649_0132640 Ga0495649_0132640_482_868 128
684 3300046809 Ga0495600_0058329 Ga0495600_0058329_678_1064 128
685 3300047315 Ga0495581_0525418 Ga0495581_0525418_76_462 128
686 3300047317 Ga0495604_0002649 Ga0495604_0002649_7791_8177 128
687 3300047318 Ga0495636_0005476 Ga0495636_0005476_2173_2571 128
688 3300047319 Ga0495674_0108061 Ga0495674_0108061_135_521 128
689 3300047319 Ga0495674_1117257 Ga0495674_1117257_129_515 128
690 3300047321 Ga0495676_0106528 Ga0495676_0106528_988_1374 128
691 3300047321 Ga0495676_0276381 Ga0495676_0276381_592_978 128
692 3300047322 Ga0495680_0230504 Ga0495680_0230504_881_1270 128
693 3300047323 Ga0495683_0171618 Ga0495683_0171618_10_396 128
694 3300047323 Ga0495683_0281631 Ga0495683_0281631_144_530 128
695 3300047443 Ga0495687_015370 Ga0495687_015370_1751_2137 128
696 3300047444 Ga0495675_0464355 Ga0495675_0464355_176_562 128
697 3300047469 Ga0495673_0068596 Ga0495673_0068596_299_685 128
698 3300047469 Ga0495673_0094867 Ga0495673_0094867_166_552 128
699 3300047673 Ga0495593_0285275 Ga0495593_0285275_222_608 128
700 3300048088 Ga0495602_0148575 Ga0495602_0148575_637_1023 128
701 3300048903 Ga0496100_0051591 Ga0496100_0051591_561_947 128
702 3300048903 Ga0496100_0257014 Ga0496100_0257014_353_739 128
703 3300048904 Ga0496101_0111450 Ga0496101_0111450_652_1038 128
704 3300048904 Ga0496101_0167719 Ga0496101_0167719_444_830 128
705 3300048904 Ga0496101_0508112 Ga0496101_0508112_36_422 128
706 3300048904 Ga0496101_0816273 Ga0496101_0816273_29_415 128
707 3300048905 Ga0496102_0007791 Ga0496102_0007791_2914_3300 128
708 3300048905 Ga0496102_0145385 Ga0496102_0145385_908_1294 128
709 3300048905 Ga0496102_0269762 Ga0496102_0269762_1007_1405 128
710 3300048905 Ga0496102_0301397 Ga0496102_0301397_97_483 128
711 3300048905 Ga0496102_0852831 Ga0496102_0852831_280_666 128
712 3300048905 Ga0496102_1121387 Ga0496102_1121387_272_658 128
713 3300048906 Ga0496103_0003944 Ga0496103_0003944_1624_2010 128
714 3300048906 Ga0496103_0080964 Ga0496103_0080964_181_579 128
715 3300048907 Ga0496104_0000896 Ga0496104_0000896_4884_5270 128
716 3300048907 Ga0496104_0148887 Ga0496104_0148887_926_1312 128
717 3300048907 Ga0496104_0172657 Ga0496104_0172657_692_1078 128
718 3300048908 Ga0496105_0009605 Ga0496105_0009605_1105_1491 128
719 3300048908 Ga0496105_0034201 Ga0496105_0034201_3372_3758 128
720 3300048908 Ga0496105_0048155 Ga0496105_0048155_969_1355 128
721 3300048908 Ga0496105_0196347 Ga0496105_0196347_18_404 128
722 3300048909 Ga0496106_0133527 Ga0496106_0133527_1542_1928 128
723 3300048909 Ga0496106_0176907 Ga0496106_0176907_926_1324 128
724 3300048909 Ga0496106_0233591 Ga0496106_0233591_955_1341 128
725 3300048910 Ga0496107_0810164 Ga0496107_0810164_263_649 128
726 3300048910 Ga0496107_0924951 Ga0496107_0924951_10_396 128
727 3300048910 Ga0496107_1013894 Ga0496107_1013894_91_477 128
728 3300048911 Ga0496108_0093896 Ga0496108_0093896_210_596 128
729 3300048911 Ga0496108_0181189 Ga0496108_0181189_689_1075 128
730 3300048912 Ga0496109_0032965 Ga0496109_0032965_3998_4384 128
731 3300048912 Ga0496109_0694419 Ga0496109_0694419_209_595 128
732 3300048913 Ga0496110_0185077 Ga0496110_0185077_1426_1812 128
733 3300048913 Ga0496110_0218656 Ga0496110_0218656_36_422 128
734 3300048913 Ga0496110_0350871 Ga0496110_0350871_252_638 128
735 3300048915 Ga0496112_0154635 Ga0496112_0154635_942_1328 128
736 3300048915 Ga0496112_0624199 Ga0496112_0624199_161_547 128
737 3300048915 Ga0496112_0637107 Ga0496112_0637107_129_515 128
738 3300048916 Ga0496113_0008940 Ga0496113_0008940_5187_5573 128
739 3300048916 Ga0496113_0019656 Ga0496113_0019656_695_1081 128
740 3300048916 Ga0496113_0133740 Ga0496113_0133740_684_1070 128
741 3300048916 Ga0496113_0399006 Ga0496113_0399006_291_677 128
742 3300048917 Ga0496114_0128797 Ga0496114_0128797_1371_1757 128
743 3300048917 Ga0496114_0187411 Ga0496114_0187411_61_447 128
744 3300048917 Ga0496114_0384536 Ga0496114_0384536_846_1232 128
745 3300048918 Ga0496115_0002618 Ga0496115_0002618_8782_9168 128
746 3300048918 Ga0496115_0132308 Ga0496115_0132308_61_447 128
747 3300048918 Ga0496115_0171231 Ga0496115_0171231_692_1078 128
748 3300048919 Ga0496116_0063313 Ga0496116_0063313_1500_1886 128
749 3300048920 Ga0496117_0090930 Ga0496117_0090930_1204_1590 128
750 3300048920 Ga0496117_0215132 Ga0496117_0215132_164_550 128
751 3300048921 Ga0496118_0216629 Ga0496118_0216629_267_653 128
752 3300048921 Ga0496118_0376014 Ga0496118_0376014_232_618 128
753 3300048921 Ga0496118_0406508 Ga0496118_0406508_108_494 128
754 3300048922 Ga0496119_0010947 Ga0496119_0010947_1111_1497 128
755 3300048922 Ga0496119_0057211 Ga0496119_0057211_1188_1574 128
756 3300048922 Ga0496119_0141287 Ga0496119_0141287_858_1244 128
757 3300048922 Ga0496119_0384077 Ga0496119_0384077_187_573 128
758 3300048923 Ga0496120_0041739 Ga0496120_0041739_1173_1559 128
759 3300048923 Ga0496120_0083996 Ga0496120_0083996_544_930 128
760 3300048924 Ga0496121_0037690 Ga0496121_0037690_149_535 128
761 3300048924 Ga0496121_0045625 Ga0496121_0045625_2511_2897 128
762 3300048924 Ga0496121_0099679 Ga0496121_0099679_1242_1628 128
763 3300048924 Ga0496121_0419972 Ga0496121_0419972_339_725 128
764 3300048925 Ga0496122_0129629 Ga0496122_0129629_935_1321 128
765 3300048926 Ga0496123_0141291 Ga0496123_0141291_339_725 128
766 3300048927 Ga0496124_0010692 Ga0496124_0010692_8390_8776 128
767 3300048927 Ga0496124_0072508 Ga0496124_0072508_2106_2492 128
768 3300048928 Ga0496125_0041692 Ga0496125_0041692_678_1064 128
769 3300048928 Ga0496125_0079792 Ga0496125_0079792_955_1341 128
770 3300048928 Ga0496125_0497035 Ga0496125_0497035_285_671 128
771 3300048929 Ga0496126_0082842 Ga0496126_0082842_1580_1966 128
772 3300048929 Ga0496126_0112419 Ga0496126_0112419_562_948 128
773 3300048929 Ga0496126_0734975 Ga0496126_0734975_274_660 128
774 3300048929 Ga0496126_1053827 Ga0496126_1053827_186_572 128
775 3300049460 Ga0495682_0056409 Ga0495682_0056409_645_1031 128
776 3300049460 Ga0495682_0182165 Ga0495682_0182165_290_676 128
777 3300049460 Ga0495682_0362092 Ga0495682_0362092_91_477 128
778 3300049568 Ga0501031_0826809 Ga0501031_0826809_154_543 128
779 3300049572 Ga0501036_1307695 Ga0501036_1307695_120_509 128
780 3300049577 Ga0501041_0703195 Ga0501041_0703195_52_438 128
781 3300049588 Ga0501072_0104772 Ga0501072_0104772_1118_1507 128
782 3300049591 Ga0501075_0165053 Ga0501075_0165053_460_849 128
783 3300049592 Ga0501076_0222417 Ga0501076_0222417_633_1022 128
784 3300049593 Ga0501077_0107165 Ga0501077_0107165_531_920 128
785 3300049743 Ga0501081_0398107 Ga0501081_0398107_231_620 128
786 3300050490 nmdc:mga03n38_439937_c1 nmdc:mga03n38_439937_c1_104_490 128
787 3300050490 nmdc:mga03n38_643743_c1 nmdc:mga03n38_643743_c1_142_528 128
788 3300050491 nmdc:mga00v17_109947_c1 nmdc:mga00v17_109947_c1_620_1006 128
789 3300050491 nmdc:mga00v17_492634_c1 nmdc:mga00v17_492634_c1_335_721 128
790 3300050492 nmdc:mga0yw44_14029_c1 nmdc:mga0yw44_14029_c1_2989_3375 128
791 3300050492 nmdc:mga0yw44_273673_c1 nmdc:mga0yw44_273673_c1_516_902 128
792 3300050492 nmdc:mga0yw44_321852_c1 nmdc:mga0yw44_321852_c1_261_647 128
793 3300050492 nmdc:mga0yw44_53372_c1 nmdc:mga0yw44_53372_c1_748_1134 128
794 3300050492 nmdc:mga0yw44_95236_c1 nmdc:mga0yw44_95236_c1_760_1146 128
795 3300050493 nmdc:mga0k408_53816_c1 nmdc:mga0k408_53816_c1_513_899 128
796 3300050494 nmdc:mga06z11_228691_c1 nmdc:mga06z11_228691_c1_666_1055 128
797 3300050494 nmdc:mga06z11_312415_c1 nmdc:mga06z11_312415_c1_500_886 128
798 3300050494 nmdc:mga06z11_68007_c1 nmdc:mga06z11_68007_c1_1424_1810 128
799 3300050495 nmdc:mga04h51_30657_c1 nmdc:mga04h51_30657_c1_946_1332 128
800 3300050496 nmdc:mga07m45_180822_c1 nmdc:mga07m45_180822_c1_484_870 128
801 3300050507 nmdc:mga05p37_1028560_c1 nmdc:mga05p37_1028560_c1_359_748 128
802 3300050507 nmdc:mga05p37_311_c1 nmdc:mga05p37_311_c1_25703_26092 128
803 3300050507 nmdc:mga05p37_530232_c1 nmdc:mga05p37_530232_c1_839_1228 128
804 3300050508 nmdc:mga09592_74789_c1 nmdc:mga09592_74789_c1_2222_2611 128
805 3300050509 nmdc:mga0qj67_155511_c1 nmdc:mga0qj67_155511_c1_955_1344 128
806 3300050509 nmdc:mga0qj67_521501_c1 nmdc:mga0qj67_521501_c1_196_585 128
807 3300050510 nmdc:mga06r32_54893_c1 nmdc:mga06r32_54893_c1_3216_3605 128
808 3300050511 nmdc:mga08y16_165_c1 nmdc:mga08y16_165_c1_27230_27619 128
809 3300050511 nmdc:mga08y16_309090_c1 nmdc:mga08y16_309090_c1_162_551 128
810 3300050512 nmdc:mga0n895_251544_c1 nmdc:mga0n895_251544_c1_738_1127 128
811 3300050512 nmdc:mga0n895_59484_c1 nmdc:mga0n895_59484_c1_196_582 128
812 3300050512 nmdc:mga0n895_755344_c1 nmdc:mga0n895_755344_c1_201_587 128
813 3300050513 nmdc:mga0rr50_65089_c1 nmdc:mga0rr50_65089_c1_1418_1804 128
814 3300050513 nmdc:mga0rr50_748081_c1 nmdc:mga0rr50_748081_c1_354_743 128
815 3300050515 nmdc:mga0a205_194358_c1 nmdc:mga0a205_194358_c1_319_708 128
816 3300050515 nmdc:mga0a205_441251_c1 nmdc:mga0a205_441251_c1_76_462 128
817 3300050515 nmdc:mga0a205_619288_c1 nmdc:mga0a205_619288_c1_124_513 128
818 3300050516 nmdc:mga0sz30_56798_c1 nmdc:mga0sz30_56798_c1_480_866 128
819 3300050516 nmdc:mga0sz30_61894_c1 nmdc:mga0sz30_61894_c1_779_1165 128
820 3300050516 nmdc:mga0sz30_97097_c1 nmdc:mga0sz30_97097_c1_154_540 128
821 3300053077 Ga0495601_0014670 Ga0495601_0014670_1031_1417 128
822 3300053078 Ga0495612_0009372 Ga0495612_0009372_3019_3405 128
823 3300053083 Ga0495655_0011762 Ga0495655_0011762_606_992 128
824 3300053084 Ga0495595_0010648 Ga0495595_0010648_2932_3318 128
825 3300053084 Ga0495595_0093397 Ga0495595_0093397_727_1113 128
826 3300053085 Ga0495619_0481544 Ga0495619_0481544_132_518 128
827 3300053111 Ga0500572_121149 Ga0500572_121149_145_531 128
828 3300053130 Ga0500642_0289263 Ga0500642_0289263_318_704 128
829 3300053136 Ga0500559_0104698 Ga0500559_0104698_767_1153 128
830 3300053138 Ga0500564_001786 Ga0500564_001786_594_980 128
831 3300053148 Ga0500590_298728 Ga0500590_298728_151_537 128
832 3300053163 Ga0500639_232147 Ga0500639_232147_96_482 128
833 3300053178 Ga0500637_0077213 Ga0500637_0077213_351_737 128
834 3300053733 Ga0500552_046751 Ga0500552_046751_31_417 128
835 3300055283 Ga0500661_028649 Ga0500661_028649_100_486 128
836 3300060353 Ga0501082_0708921 Ga0501082_0708921_213_602 128
837 3300061734 Ga0530510_0071062 Ga0530510_0071062_362_751 128
838 3300061734 Ga0530510_0217832 Ga0530510_0217832_998_1387 128
839 3300061734 Ga0530510_0370772 Ga0530510_0370772_72_461 128
840 3300005330 Ga0070690_100088359 Ga0070690_1000883593 129
841 3300005334 Ga0068869_100378826 Ga0068869_1003788261 129
842 3300005347 Ga0070668_100191400 Ga0070668_1001914003 129
843 3300005356 Ga0070674_100017006 Ga0070674_1000170063 129
844 3300005367 Ga0070667_100384601 Ga0070667_1003846012 129
845 3300005435 Ga0070714_102044108 Ga0070714_1020441081 129
846 3300005438 Ga0070701_10536984 Ga0070701_105369842 129
847 3300005455 Ga0070663_101172429 Ga0070663_1011724291 129
848 3300005456 Ga0070678_100045346 Ga0070678_1000453462 129
849 3300005457 Ga0070662_100614437 Ga0070662_1006144372 129
850 3300005539 Ga0068853_100756326 Ga0068853_1007563262 129
851 3300005578 Ga0068854_100747574 Ga0068854_1007475742 129
852 3300005719 Ga0068861_100025418 Ga0068861_1000254183 129
853 3300005843 Ga0068860_100466032 Ga0068860_1004660322 129
854 3300006881 Ga0068865_100140089 Ga0068865_1001400893 129
855 3300009101 Ga0105247_10026444 Ga0105247_100264443 129
856 3300009148 Ga0105243_10044750 Ga0105243_100447504 129
857 3300009553 Ga0105249_10249014 Ga0105249_102490142 129
858 3300009553 Ga0105249_11116190 Ga0105249_111161902 129
859 3300011119 Ga0105246_11212336 Ga0105246_112123361 129
860 3300013297 Ga0157378_10959786 Ga0157378_109597862 129
861 3300013306 Ga0163162_11572114 Ga0163162_115721142 129
862 3300013308 Ga0157375_10122777 Ga0157375_101227773 129
863 3300014325 Ga0163163_10224424 Ga0163163_102244242 129
864 3300014326 Ga0157380_10234797 Ga0157380_102347972 129
865 3300017792 Ga0163161_10030502 Ga0163161_100305023 129
866 3300025926 Ga0207659_10217534 Ga0207659_102175342 129
867 3300025933 Ga0207706_10503785 Ga0207706_105037852 129
868 3300025937 Ga0207669_10025543 Ga0207669_100255434 129
869 3300025938 Ga0207704_10112245 Ga0207704_101122452 129
870 3300025942 Ga0207689_10617156 Ga0207689_106171561 129
871 3300025961 Ga0207712_10333673 Ga0207712_103336732 129
872 3300025981 Ga0207640_10478931 Ga0207640_104789311 129
873 3300026041 Ga0207639_10518047 Ga0207639_105180472 129
874 3300026067 Ga0207678_10217505 Ga0207678_102175053 129
875 3300026095 Ga0207676_12101890 Ga0207676_121018901 129
876 3300026118 Ga0207675_100021239 Ga0207675_1000212393 129
877 3300026121 Ga0207683_10150269 Ga0207683_101502692 129
878 3300028380 Ga0268265_10253139 Ga0268265_102531391 129
879 3300028381 Ga0268264_10034371 Ga0268264_100343712 129
880 3300035120 Ga0373957_0281580 Ga0373957_0281580_152_550 129
881 3300035695 Ga0373927_0074339 Ga0373927_0074339_887_1288 129
882 3300035724 Ga0373933_1161355 Ga0373933_1161355_31_429 129
883 3300035725 Ga0373947_0017798 Ga0373947_0017798_1694_2092 129
884 3300037068 Ga0373925_0017902 Ga0373925_0017902_2511_2912 129
885 3300044684 Ga0466966_0010768 Ga0466966_0010768_4693_5085 129
886 3300044693 Ga0466961_0055337 Ga0466961_0055337_694_1086 129
887 3300044694 Ga0466963_0321397 Ga0466963_0321397_655_1047 129
888 3300044719 Ga0466971_0436487 Ga0466971_0436487_230_622 129
889 3300045049 Ga0466959_0017621 Ga0466959_0017621_153_545 129
890 3300045836 Ga0466958_0624209 Ga0466958_0624209_272_664 129
891 3300046452 Ga0495617_096917 Ga0495617_096917_443_841 129
892 3300046454 Ga0495592_0380101 Ga0495592_0380101_476_865 129
893 3300046455 Ga0495603_0180118 Ga0495603_0180118_551_943 129
894 3300046461 Ga0495641_0026237 Ga0495641_0026237_1877_2278 129
895 3300046472 Ga0495580_0003171 Ga0495580_0003171_1913_2314 129
896 3300046473 Ga0495582_0046043 Ga0495582_0046043_793_1194 129
897 3300046475 Ga0495639_0008643 Ga0495639_0008643_2460_2858 129
898 3300046492 Ga0495585_0511405 Ga0495585_0511405_108_500 129
899 3300046499 Ga0495594_0493616 Ga0495594_0493616_255_653 129
900 3300046511 Ga0495608_0434747 Ga0495608_0434747_286_684 129
901 3300046513 Ga0495616_0201807 Ga0495616_0201807_267_656 129
902 3300046519 Ga0495632_0353539 Ga0495632_0353539_16_414 129
903 3300046523 Ga0495644_0138258 Ga0495644_0138258_421_813 129
904 3300046526 Ga0495666_0067795 Ga0495666_0067795_1110_1511 129
905 3300046528 Ga0495642_0394757 Ga0495642_0394757_96_491 129
906 3300046531 Ga0495665_0023819 Ga0495665_0023819_304_705 129
907 3300046557 Ga0495622_0008550 Ga0495622_0008550_1641_2042 129
908 3300046615 Ga0495656_0122773 Ga0495656_0122773_476_868 129
909 3300046663 Ga0495635_0167448 Ga0495635_0167448_1047_1445 129
910 3300046674 Ga0495588_0010784 Ga0495588_0010784_2466_2867 129
911 3300046681 Ga0495647_0312603 Ga0495647_0312603_28_429 129
912 3300046689 Ga0495613_0001403 Ga0495613_0001403_12796_13197 129
913 3300046694 Ga0495649_0635620 Ga0495649_0635620_11_406 129
914 3300046794 Ga0495589_0101403 Ga0495589_0101403_424_816 129
915 3300047315 Ga0495581_0013206 Ga0495581_0013206_2017_2418 129
916 3300047319 Ga0495674_0767913 Ga0495674_0767913_140_538 129
917 3300047321 Ga0495676_0043408 Ga0495676_0043408_2334_2735 129
918 3300047322 Ga0495680_0030632 Ga0495680_0030632_2908_3306 129
919 3300047673 Ga0495593_0004337 Ga0495593_0004337_6094_6495 129
920 3300048089 Ga0495614_0015295 Ga0495614_0015295_2144_2545 129
921 3300048904 Ga0496101_0031533 Ga0496101_0031533_825_1217 129
922 3300048907 Ga0496104_0061346 Ga0496104_0061346_157_549 129
923 3300048909 Ga0496106_0193306 Ga0496106_0193306_454_846 129
924 3300048916 Ga0496113_0919829 Ga0496113_0919829_289_681 129
925 3300048917 Ga0496114_0008142 Ga0496114_0008142_3510_3902 129
926 3300048918 Ga0496115_0051770 Ga0496115_0051770_2471_2863 129
927 3300049571 Ga0501034_0650400 Ga0501034_0650400_309_704 129
928 3300053077 Ga0495601_0449289 Ga0495601_0449289_309_707 129
929 3300053084 Ga0495595_0102385 Ga0495595_0102385_711_1109 129
930 3300053085 Ga0495619_0018271 Ga0495619_0018271_1732_2130 129
931 3300053119 Ga0500595_014651 Ga0500595_014651_1803_2192 129
932 3300049758 Ga0501241_003956 Ga0501241_003956_127_528 130
933 3300006051 Ga0075364_10236613 Ga0075364_102366132 131
934 3300050491 nmdc:mga00v17_464197_c1 nmdc:mga00v17_464197_c1_169_579 131
935 3300025945 Ga0207679_10207922 Ga0207679_102079224 133
936 3300044656 Ga0466969_0527779 Ga0466969_0527779_16_486 133
937 3300044684 Ga0466966_0013758 Ga0466966_0013758_1264_1734 133
938 3300044765 Ga0466970_0433193 Ga0466970_0433193_150_620 133
939 3300045049 Ga0466959_0009297 Ga0466959_0009297_189_659 133
940 3300001904 JGI24736J21556_1011817 JGI24736J21556_10118172 134
941 3300003214 JGI25165J46597_1025647 JGI25165J46597_10256471 134
942 3300005328 Ga0070676_10249349 Ga0070676_102493493 134
943 3300005331 Ga0070670_100114975 Ga0070670_1001149753 134
944 3300005335 Ga0070666_10009187 Ga0070666_100091873 134
945 3300005335 Ga0070666_10331253 Ga0070666_103312532 134
946 3300005338 Ga0068868_100133802 Ga0068868_1001338022 134
947 3300005344 Ga0070661_100131921 Ga0070661_1001319213 134
948 3300005367 Ga0070667_100140477 Ga0070667_1001404771 134
949 3300005455 Ga0070663_100003997 Ga0070663_1000039975 134
950 3300005457 Ga0070662_100190696 Ga0070662_1001906961 134
951 3300005459 Ga0068867_100612459 Ga0068867_1006124592 134
952 3300005466 Ga0070685_10001102 Ga0070685_100011026 134
953 3300005539 Ga0068853_100032986 Ga0068853_1000329864 134
954 3300005548 Ga0070665_100003534 Ga0070665_1000035343 134
955 3300005563 Ga0068855_100271538 Ga0068855_1002715382 134
956 3300005563 Ga0068855_101543241 Ga0068855_1015432412 134
957 3300005578 Ga0068854_100033413 Ga0068854_1000334132 134
958 3300005616 Ga0068852_100018450 Ga0068852_1000184503 134
959 3300005834 Ga0068851_10006423 Ga0068851_100064236 134
960 3300005841 Ga0068863_100127838 Ga0068863_1001278383 134
961 3300005842 Ga0068858_100002044 Ga0068858_10000204414 134
962 3300005842 Ga0068858_100660045 Ga0068858_1006600452 134
963 3300006237 Ga0097621_100056680 Ga0097621_1000566803 134
964 3300009093 Ga0105240_10000450 Ga0105240_1000045016 134
965 3300009093 Ga0105240_10117376 Ga0105240_101173764 134
966 3300009093 Ga0105240_10727977 Ga0105240_107279773 134
967 3300009174 Ga0105241_10092165 Ga0105241_100921652 134
968 3300009176 Ga0105242_10241965 Ga0105242_102419652 134
969 3300009545 Ga0105237_10051692 Ga0105237_100516923 134
970 3300009545 Ga0105237_10099929 Ga0105237_100999291 134
971 3300009551 Ga0105238_10002042 Ga0105238_100020424 134
972 3300009551 Ga0105238_10013642 Ga0105238_100136429 134
973 3300009553 Ga0105249_10177317 Ga0105249_101773173 134
974 3300010375 Ga0105239_10247145 Ga0105239_102471452 134
975 3300010375 Ga0105239_10614361 Ga0105239_106143613 134
976 3300013105 Ga0157369_10059628 Ga0157369_100596284 134
977 3300013296 Ga0157374_10027203 Ga0157374_100272033 134
978 3300013307 Ga0157372_10219224 Ga0157372_102192243 134
979 3300013307 Ga0157372_10499714 Ga0157372_104997142 134
980 3300014969 Ga0157376_10191623 Ga0157376_101916232 134
981 3300025261 Ga0209233_1008223 Ga0209233_10082232 134
982 3300025321 Ga0207656_10000840 Ga0207656_100008407 134
983 3300025903 Ga0207680_10104749 Ga0207680_101047493 134
984 3300025903 Ga0207680_10176043 Ga0207680_101760432 134
985 3300025904 Ga0207647_10000425 Ga0207647_1000042514 134
986 3300025911 Ga0207654_10027666 Ga0207654_100276663 134
987 3300025913 Ga0207695_10000007 Ga0207695_10000007725 134
988 3300025913 Ga0207695_10099021 Ga0207695_100990211 134
989 3300025913 Ga0207695_10716574 Ga0207695_107165741 134
990 3300025914 Ga0207671_10030308 Ga0207671_100303082 134
991 3300025914 Ga0207671_10213059 Ga0207671_102130593 134
992 3300025920 Ga0207649_10771306 Ga0207649_107713062 134
993 3300025924 Ga0207694_10001186 Ga0207694_100011864 134
994 3300025925 Ga0207650_10085997 Ga0207650_100859973 134
995 3300025931 Ga0207644_10764961 Ga0207644_107649611 134
996 3300025933 Ga0207706_10011818 Ga0207706_100118185 134
997 3300025949 Ga0207667_11373608 Ga0207667_113736082 134
998 3300025961 Ga0207712_10000291 Ga0207712_1000029137 134
999 3300025981 Ga0207640_10001052 Ga0207640_100010522 134
1000 3300026023 Ga0207677_10239593 Ga0207677_102395932 134
1001 3300026035 Ga0207703_10002746 Ga0207703_100027463 134
1002 3300026041 Ga0207639_10000161 Ga0207639_1000016140 134
1003 3300026067 Ga0207678_10005017 Ga0207678_100050178 134
1004 3300026078 Ga0207702_10201709 Ga0207702_102017092 134
1005 3300026088 Ga0207641_10129481 Ga0207641_101294813 134
1006 3300026089 Ga0207648_10325604 Ga0207648_103256043 134
1007 3300026116 Ga0207674_10125947 Ga0207674_101259472 134
1008 3300028379 Ga0268266_10000013 Ga0268266_10000013554 134
1009 3300048921 Ga0496118_0030959 Ga0496118_0030959_344_748 134
1010 3300048929 Ga0496126_0068767 Ga0496126_0068767_942_1346 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

148

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9631 5 134
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9555 5 134
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8076 7 132
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8062 7 132
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.7988 7 130
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9631 5 134 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9555 5 134 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8626 73 134 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.849 71 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8364 71 132 3.30.720.110
ID Description Score Start End GO Terms
AF-M5CMF1-F1-model_v4 deleted 1.009 73 134
AF-A0A0E1X199-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 1.005 73 134 GO:0051213
AF-A0A529X2P7-F1-model_v4 deleted 1.004 81 134
AF-A0A2C6ADY8-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 1.004 81 132
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 1.001 73 132

Feature Viewer

pLDDT pTM Quality
94.33 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map