F488010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1006 | 380 | 1004 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300025937|Ga0207669_10663068|Ga0207669_106630681 |
| Length | 182 |
| Sequence | MWFWKTSSERTMTEMAMTSSGTAKVTLPTDRQILITREFDAPKHLVFKAWTTPELVRRWWTTDRGEMTVCEIDLRVGGTWRYVMVTPTGFEVGFHGEFREIVPDERIVSTEAYEGIPDPDGNASLNTLMLTEEDGRTTMTVLVEHPTTEGRDAHINSGMEAGMQDALDLLEQVAVSLRCPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 2 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 222 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 226 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 231 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 234 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 235 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 236 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 237 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 238 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 239 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 246 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 372 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 376 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0 |
| Rhizoplane | 4.67 |
| Rhizosphere | 92.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10012886 | 3300002077 | Bacteria | 1689 |
| 2 | JGI24034J26672_10046755 | 3300002239 | Bacteria | 737 |
| 3 | JGI24742J22300_10016937 | 3300002244 | Bacteria | 1231 |
| 4 | JGI24751J29686_10014242 | 3300002459 | Bacteria | 1642 |
| 5 | rootL2_10169080 | 3300003322 | Bacteria | 2566 |
| 6 | rootH1_10190481 | 3300003323 | Bacteria | 2054 |
| 7 | JGI25407J50210_10001249 | 3300003373 | Bacteria | 5685 |
| 8 | JGI25407J50210_10001786 | 3300003373 | Bacteria | 4950 |
| 9 | JGI25407J50210_10012016 | 3300003373 | Bacteria | 2218 |
| 10 | JGI25407J50210_10013235 | 3300003373 | Bacteria | 2120 |
| 11 | JGI25407J50210_10030346 | 3300003373 | Bacteria | 1401 |
| 12 | JGI25407J50210_10044455 | 3300003373 | Bacteria | 1134 |
| 13 | JGI25407J50210_10071649 | 3300003373 | Bacteria | 865 |
| 14 | Ga0065704_10356959 | 3300005289 | Bacteria | 802 |
| 15 | Ga0065707_10027577 | 3300005295 | Bacteria | 1183 |
| 16 | Ga0070658_10044365 | 3300005327 | Bacteria | 3594 |
| 17 | Ga0070658_10341023 | 3300005327 | Bacteria | 1282 |
| 18 | Ga0070683_100002180 | 3300005329 | Bacteria | 15490 |
| 19 | Ga0070683_100026791 | 3300005329 | Bacteria | 5194 |
| 20 | Ga0070683_100573030 | 3300005329 | Bacteria | 1080 |
| 21 | Ga0070670_100019042 | 3300005331 | Bacteria | 5886 |
| 22 | Ga0070670_100029292 | 3300005331 | Bacteria | 4738 |
| 23 | Ga0070666_10978875 | 3300005335 | Unclassified | 627 |
| 24 | Ga0070680_100101887 | 3300005336 | Bacteria | 2384 |
| 25 | Ga0070682_100006239 | 3300005337 | Bacteria | 6685 |
| 26 | Ga0070682_100150433 | 3300005337 | Bacteria | 1597 |
| 27 | Ga0070682_100585332 | 3300005337 | Bacteria | 879 |
| 28 | Ga0068868_100028178 | 3300005338 | Bacteria | 4292 |
| 29 | Ga0068868_100139016 | 3300005338 | Bacteria | 1992 |
| 30 | Ga0068868_100388001 | 3300005338 | Bacteria | 1203 |
| 31 | Ga0070660_100025013 | 3300005339 | Bacteria | 4435 |
| 32 | Ga0070660_100079968 | 3300005339 | Bacteria | 2564 |
| 33 | Ga0070660_100354203 | 3300005339 | Bacteria | 1209 |
| 34 | Ga0070689_100043594 | 3300005340 | Bacteria | 3449 |
| 35 | Ga0070689_100874888 | 3300005340 | Bacteria | 794 |
| 36 | Ga0070689_101052385 | 3300005340 | Unclassified | 726 |
| 37 | Ga0070691_10064422 | 3300005341 | Bacteria | 1769 |
| 38 | Ga0070691_10529219 | 3300005341 | Unclassified | 686 |
| 39 | Ga0070661_100312407 | 3300005344 | Unclassified | 1226 |
| 40 | Ga0070692_10056496 | 3300005345 | Bacteria | 2055 |
| 41 | Ga0070692_10112563 | 3300005345 | Bacteria | 1507 |
| 42 | Ga0070692_10290043 | 3300005345 | Bacteria | 995 |
| 43 | Ga0070668_101517915 | 3300005347 | Unclassified | 613 |
| 44 | Ga0070675_100085864 | 3300005354 | Bacteria | 2629 |
| 45 | Ga0070675_100089648 | 3300005354 | Bacteria | 2575 |
| 46 | Ga0070671_100017320 | 3300005355 | Bacteria | 5835 |
| 47 | Ga0070671_100716910 | 3300005355 | Bacteria | 868 |
| 48 | Ga0070674_100068560 | 3300005356 | Bacteria | 2499 |
| 49 | Ga0070674_100145522 | 3300005356 | Bacteria | 1783 |
| 50 | Ga0070674_100851827 | 3300005356 | Bacteria | 791 |
| 51 | Ga0070674_100895523 | 3300005356 | Bacteria | 773 |
| 52 | Ga0070673_100258781 | 3300005364 | Bacteria | 1520 |
| 53 | Ga0070673_101471320 | 3300005364 | Bacteria | 642 |
| 54 | Ga0070688_100003853 | 3300005365 | Bacteria | 7778 |
| 55 | Ga0070688_100010786 | 3300005365 | Bacteria | 5050 |
| 56 | Ga0070688_100266427 | 3300005365 | Bacteria | 1226 |
| 57 | Ga0070659_100100568 | 3300005366 | Bacteria | 2327 |
| 58 | Ga0070659_100180622 | 3300005366 | Bacteria | 1732 |
| 59 | Ga0070659_100512288 | 3300005366 | Unclassified | 1024 |
| 60 | Ga0070667_100150411 | 3300005367 | Bacteria | 2045 |
| 61 | Ga0070667_100860646 | 3300005367 | Bacteria | 843 |
| 62 | Ga0070703_10182562 | 3300005406 | Unclassified | 811 |
| 63 | Ga0070709_10002774 | 3300005434 | Bacteria | 9466 |
| 64 | Ga0070709_10021991 | 3300005434 | Bacteria | 3724 |
| 65 | Ga0070709_10155272 | 3300005434 | Bacteria | 1586 |
| 66 | Ga0070714_100141685 | 3300005435 | Bacteria | 2159 |
| 67 | Ga0070714_100313380 | 3300005435 | Bacteria | 1465 |
| 68 | Ga0070713_100000644 | 3300005436 | Bacteria | 22268 |
| 69 | Ga0070713_100345077 | 3300005436 | Bacteria | 1380 |
| 70 | Ga0070710_10047971 | 3300005437 | Bacteria | 2384 |
| 71 | Ga0070710_10085349 | 3300005437 | Bacteria | 1852 |
| 72 | Ga0070701_10000911 | 3300005438 | Bacteria | 10702 |
| 73 | Ga0070701_10235272 | 3300005438 | Bacteria | 1099 |
| 74 | Ga0070711_100003577 | 3300005439 | Bacteria | 9064 |
| 75 | Ga0070711_100032240 | 3300005439 | Bacteria | 3483 |
| 76 | Ga0070711_100543271 | 3300005439 | Bacteria | 963 |
| 77 | Ga0070705_100165464 | 3300005440 | Bacteria | 1483 |
| 78 | Ga0070705_100220684 | 3300005440 | Bacteria | 1312 |
| 79 | Ga0070700_100000019 | 3300005441 | Bacteria | 137133 |
| 80 | Ga0070700_100001973 | 3300005441 | Bacteria | 10413 |
| 81 | Ga0070700_100474011 | 3300005441 | Bacteria | 957 |
| 82 | Ga0070700_100763868 | 3300005441 | Bacteria | 775 |
| 83 | Ga0070694_100213950 | 3300005444 | Bacteria | 1443 |
| 84 | Ga0070694_100364091 | 3300005444 | Bacteria | 1124 |
| 85 | Ga0070708_100000004 | 3300005445 | Bacteria | 168041 |
| 86 | Ga0070708_100000013 | 3300005445 | Bacteria | 130790 |
| 87 | Ga0070708_100143446 | 3300005445 | Bacteria | 2216 |
| 88 | Ga0070708_100168796 | 3300005445 | Bacteria | 2042 |
| 89 | Ga0070708_100210428 | 3300005445 | Bacteria | 1822 |
| 90 | Ga0070708_100590516 | 3300005445 | Bacteria | 1047 |
| 91 | Ga0070663_100001959 | 3300005455 | Bacteria | 11500 |
| 92 | Ga0070663_100279542 | 3300005455 | Bacteria | 1330 |
| 93 | Ga0070678_100000298 | 3300005456 | Bacteria | 23008 |
| 94 | Ga0070678_101002710 | 3300005456 | Bacteria | 768 |
| 95 | Ga0070662_100234216 | 3300005457 | Bacteria | 1470 |
| 96 | Ga0070662_100333781 | 3300005457 | Bacteria | 1239 |
| 97 | Ga0070662_100497901 | 3300005457 | Unclassified | 1016 |
| 98 | Ga0070681_10105938 | 3300005458 | Bacteria | 2753 |
| 99 | Ga0070681_10198140 | 3300005458 | Bacteria | 1927 |
| 100 | Ga0068867_100002281 | 3300005459 | Bacteria | 13492 |
| 101 | Ga0068867_100217531 | 3300005459 | Bacteria | 1538 |
| 102 | Ga0068867_100245453 | 3300005459 | Bacteria | 1454 |
| 103 | Ga0068867_101403189 | 3300005459 | Bacteria | 648 |
| 104 | Ga0070685_10001824 | 3300005466 | Bacteria | 11086 |
| 105 | Ga0070685_10045060 | 3300005466 | Bacteria | 2527 |
| 106 | Ga0070685_10417112 | 3300005466 | Bacteria | 933 |
| 107 | Ga0070706_100002099 | 3300005467 | Bacteria | 20324 |
| 108 | Ga0070706_100030463 | 3300005467 | Bacteria | 4972 |
| 109 | Ga0070706_100095094 | 3300005467 | Bacteria | 2765 |
| 110 | Ga0070706_100230776 | 3300005467 | Bacteria | 1728 |
| 111 | Ga0070706_100423566 | 3300005467 | Bacteria | 1239 |
| 112 | Ga0070706_100632087 | 3300005467 | Bacteria | 994 |
| 113 | Ga0070706_101324354 | 3300005467 | Unclassified | 660 |
| 114 | Ga0070707_100112202 | 3300005468 | Bacteria | 2644 |
| 115 | Ga0070707_100145063 | 3300005468 | Bacteria | 2311 |
| 116 | Ga0070698_100001121 | 3300005471 | Bacteria | 29567 |
| 117 | Ga0070698_100017945 | 3300005471 | Bacteria | 7452 |
| 118 | Ga0070698_100148954 | 3300005471 | Bacteria | 2289 |
| 119 | Ga0070699_100308970 | 3300005518 | Bacteria | 1419 |
| 120 | Ga0070699_100681427 | 3300005518 | Unclassified | 939 |
| 121 | Ga0070679_100626217 | 3300005530 | Bacteria | 1019 |
| 122 | Ga0070684_100022953 | 3300005535 | Bacteria | 5211 |
| 123 | Ga0070684_100098866 | 3300005535 | Bacteria | 2603 |
| 124 | Ga0070697_100094795 | 3300005536 | Bacteria | 2474 |
| 125 | Ga0070697_100726378 | 3300005536 | Bacteria | 877 |
| 126 | Ga0070697_101141678 | 3300005536 | Bacteria | 694 |
| 127 | Ga0068853_100085008 | 3300005539 | Bacteria | 2773 |
| 128 | Ga0068853_100451004 | 3300005539 | Unclassified | 1210 |
| 129 | Ga0068853_100737097 | 3300005539 | Bacteria | 941 |
| 130 | Ga0070672_100156526 | 3300005543 | Bacteria | 1887 |
| 131 | Ga0070672_100189705 | 3300005543 | Bacteria | 1716 |
| 132 | Ga0070672_100425849 | 3300005543 | Bacteria | 1140 |
| 133 | Ga0070672_101629960 | 3300005543 | Bacteria | 579 |
| 134 | Ga0070686_100007440 | 3300005544 | Bacteria | 6112 |
| 135 | Ga0070686_100177881 | 3300005544 | Bacteria | 1510 |
| 136 | Ga0070686_100194418 | 3300005544 | Bacteria | 1450 |
| 137 | Ga0070695_100161779 | 3300005545 | Bacteria | 1572 |
| 138 | Ga0070695_100332414 | 3300005545 | Bacteria | 1133 |
| 139 | Ga0070695_100686036 | 3300005545 | Bacteria | 812 |
| 140 | Ga0070696_100033756 | 3300005546 | Bacteria | 3518 |
| 141 | Ga0070696_100838396 | 3300005546 | Bacteria | 759 |
| 142 | Ga0070696_101063089 | 3300005546 | Unclassified | 679 |
| 143 | Ga0070696_101652092 | 3300005546 | Unclassified | 551 |
| 144 | Ga0070693_100023513 | 3300005547 | Bacteria | 3295 |
| 145 | Ga0070693_100566900 | 3300005547 | Bacteria | 815 |
| 146 | Ga0070665_100010077 | 3300005548 | Bacteria | 9564 |
| 147 | Ga0070665_100664306 | 3300005548 | Bacteria | 1055 |
| 148 | Ga0070704_100061756 | 3300005549 | Bacteria | 2683 |
| 149 | Ga0070704_100159925 | 3300005549 | Bacteria | 1780 |
| 150 | Ga0068855_100099227 | 3300005563 | Bacteria | 3354 |
| 151 | Ga0068855_100360924 | 3300005563 | Bacteria | 1598 |
| 152 | Ga0068855_100370838 | 3300005563 | Bacteria | 1573 |
| 153 | Ga0070664_100213661 | 3300005564 | Bacteria | 1724 |
| 154 | Ga0070664_100398876 | 3300005564 | Bacteria | 1258 |
| 155 | Ga0070664_100859025 | 3300005564 | Bacteria | 850 |
| 156 | Ga0068857_100048398 | 3300005577 | Bacteria | 3775 |
| 157 | Ga0068857_100875854 | 3300005577 | Bacteria | 860 |
| 158 | Ga0068854_100680788 | 3300005578 | Bacteria | 886 |
| 159 | Ga0068854_101147992 | 3300005578 | Bacteria | 694 |
| 160 | Ga0068856_100064387 | 3300005614 | Bacteria | 3622 |
| 161 | Ga0068856_100132897 | 3300005614 | Bacteria | 2494 |
| 162 | Ga0070702_100023431 | 3300005615 | Bacteria | 3280 |
| 163 | Ga0070702_100201556 | 3300005615 | Bacteria | 1318 |
| 164 | Ga0068852_100002120 | 3300005616 | Bacteria | 13586 |
| 165 | Ga0068859_100090293 | 3300005617 | Bacteria | 3115 |
| 166 | Ga0068859_100187945 | 3300005617 | Bacteria | 2150 |
| 167 | Ga0068864_100031233 | 3300005618 | Bacteria | 4518 |
| 168 | Ga0068864_100449674 | 3300005618 | Bacteria | 1232 |
| 169 | Ga0068866_10014980 | 3300005718 | Bacteria | 3436 |
| 170 | Ga0068866_10687073 | 3300005718 | Bacteria | 701 |
| 171 | Ga0068861_100129398 | 3300005719 | Bacteria | 2047 |
| 172 | Ga0068861_100173532 | 3300005719 | Bacteria | 1789 |
| 173 | Ga0068861_100754414 | 3300005719 | Bacteria | 909 |
| 174 | Ga0068870_10013058 | 3300005840 | Bacteria | 3893 |
| 175 | Ga0068870_10071825 | 3300005840 | Unclassified | 1890 |
| 176 | Ga0068870_10314353 | 3300005840 | Bacteria | 993 |
| 177 | Ga0068858_100457092 | 3300005842 | Bacteria | 1231 |
| 178 | Ga0068860_100585852 | 3300005843 | Bacteria | 1120 |
| 179 | Ga0068860_100941495 | 3300005843 | Bacteria | 881 |
| 180 | Ga0068862_100537714 | 3300005844 | Bacteria | 1114 |
| 181 | Ga0081455_10002336 | 3300005937 | Bacteria | 22640 |
| 182 | Ga0081455_10010331 | 3300005937 | Bacteria | 9489 |
| 183 | Ga0081455_10033792 | 3300005937 | Bacteria | 4590 |
| 184 | Ga0081455_10164872 | 3300005937 | Bacteria | 1694 |
| 185 | Ga0081455_10253055 | 3300005937 | Bacteria | 1287 |
| 186 | Ga0081455_10306136 | 3300005937 | Bacteria | 1138 |
| 187 | Ga0081455_10435948 | 3300005937 | Unclassified | 899 |
| 188 | Ga0081455_10746875 | 3300005937 | Bacteria | 619 |
| 189 | Ga0081455_10801988 | 3300005937 | Bacteria | 591 |
| 190 | Ga0081538_10000080 | 3300005981 | Bacteria | 92392 |
| 191 | Ga0081538_10001298 | 3300005981 | Bacteria | 25847 |
| 192 | Ga0081538_10004845 | 3300005981 | Bacteria | 12261 |
| 193 | Ga0081538_10005194 | 3300005981 | Bacteria | 11778 |
| 194 | Ga0081538_10012727 | 3300005981 | Bacteria | 6722 |
| 195 | Ga0081538_10033686 | 3300005981 | Bacteria | 3404 |
| 196 | Ga0081538_10037456 | 3300005981 | Bacteria | 3146 |
| 197 | Ga0081538_10047783 | 3300005981 | Bacteria | 2620 |
| 198 | Ga0081538_10064994 | 3300005981 | Bacteria | 2058 |
| 199 | Ga0081538_10069277 | 3300005981 | Bacteria | 1955 |
| 200 | Ga0081538_10093919 | 3300005981 | Bacteria | 1538 |
| 201 | Ga0081540_1089780 | 3300005983 | Bacteria | 1355 |
| 202 | Ga0081539_10004373 | 3300005985 | Bacteria | 15725 |
| 203 | Ga0081539_10004479 | 3300005985 | Bacteria | 15387 |
| 204 | Ga0081539_10004534 | 3300005985 | Bacteria | 15241 |
| 205 | Ga0081539_10021672 | 3300005985 | Bacteria | 4282 |
| 206 | Ga0070717_10026595 | 3300006028 | Bacteria | 4617 |
| 207 | Ga0070717_10043111 | 3300006028 | Bacteria | 3682 |
| 208 | Ga0070717_10416523 | 3300006028 | Unclassified | 1208 |
| 209 | Ga0075365_10094395 | 3300006038 | Bacteria | 2042 |
| 210 | Ga0075365_10291808 | 3300006038 | Bacteria | 1147 |
| 211 | Ga0075363_100004072 | 3300006048 | Bacteria | 6331 |
| 212 | Ga0075364_10104373 | 3300006051 | Bacteria | 1888 |
| 213 | Ga0075432_10074702 | 3300006058 | Bacteria | 1221 |
| 214 | Ga0070715_10030275 | 3300006163 | Bacteria | 2186 |
| 215 | Ga0070712_100010895 | 3300006175 | Bacteria | 5751 |
| 216 | Ga0070712_100019749 | 3300006175 | Bacteria | 4400 |
| 217 | Ga0097621_100035448 | 3300006237 | Bacteria | 3987 |
| 218 | Ga0097621_100275461 | 3300006237 | Bacteria | 1480 |
| 219 | Ga0097621_100676068 | 3300006237 | Bacteria | 949 |
| 220 | Ga0068871_100111604 | 3300006358 | Bacteria | 2300 |
| 221 | Ga0068871_101562352 | 3300006358 | Bacteria | 624 |
| 222 | Ga0075428_100000001 | 3300006844 | Bacteria | 772630 |
| 223 | Ga0075428_100001400 | 3300006844 | Bacteria | 25647 |
| 224 | Ga0075428_100011261 | 3300006844 | Bacteria | 9948 |
| 225 | Ga0075428_100018653 | 3300006844 | Bacteria | 7669 |
| 226 | Ga0075428_100030501 | 3300006844 | Bacteria | 5963 |
| 227 | Ga0075428_100031225 | 3300006844 | Bacteria | 5891 |
| 228 | Ga0075428_100037399 | 3300006844 | Bacteria | 5344 |
| 229 | Ga0075428_100188821 | 3300006844 | Bacteria | 2229 |
| 230 | Ga0075428_100689963 | 3300006844 | Bacteria | 1088 |
| 231 | Ga0075428_101143079 | 3300006844 | Bacteria | 822 |
| 232 | Ga0075430_100011247 | 3300006846 | Bacteria | 7592 |
| 233 | Ga0075430_100012632 | 3300006846 | Bacteria | 7192 |
| 234 | Ga0075430_100013658 | 3300006846 | Bacteria | 6925 |
| 235 | Ga0075430_100020823 | 3300006846 | Bacteria | 5575 |
| 236 | Ga0075430_100046260 | 3300006846 | Bacteria | 3675 |
| 237 | Ga0075430_100065973 | 3300006846 | Bacteria | 3040 |
| 238 | Ga0075430_100180353 | 3300006846 | Bacteria | 1757 |
| 239 | Ga0075431_100001828 | 3300006847 | Bacteria | 20111 |
| 240 | Ga0075431_100002312 | 3300006847 | Bacteria | 18308 |
| 241 | Ga0075431_100002400 | 3300006847 | Bacteria | 18025 |
| 242 | Ga0075431_100051929 | 3300006847 | Bacteria | 4227 |
| 243 | Ga0075431_100156012 | 3300006847 | Bacteria | 2348 |
| 244 | Ga0075431_100251724 | 3300006847 | Bacteria | 1795 |
| 245 | Ga0075431_100321009 | 3300006847 | Bacteria | 1562 |
| 246 | Ga0075431_100664114 | 3300006847 | Bacteria | 1022 |
| 247 | Ga0075431_101064587 | 3300006847 | Unclassified | 774 |
| 248 | Ga0075431_101138462 | 3300006847 | Bacteria | 744 |
| 249 | Ga0075431_101246906 | 3300006847 | Bacteria | 705 |
| 250 | Ga0075433_10105815 | 3300006852 | Bacteria | 2493 |
| 251 | Ga0075434_100021747 | 3300006871 | Bacteria | 6238 |
| 252 | Ga0075434_100106982 | 3300006871 | Bacteria | 2807 |
| 253 | Ga0075434_100423453 | 3300006871 | Bacteria | 1352 |
| 254 | Ga0075434_101015932 | 3300006871 | Unclassified | 843 |
| 255 | Ga0075429_100001668 | 3300006880 | Bacteria | 18367 |
| 256 | Ga0075429_100002220 | 3300006880 | Bacteria | 16257 |
| 257 | Ga0075429_100007437 | 3300006880 | Bacteria | 9505 |
| 258 | Ga0075429_100016078 | 3300006880 | Bacteria | 6482 |
| 259 | Ga0075429_100074312 | 3300006880 | Bacteria | 2961 |
| 260 | Ga0075429_100153414 | 3300006880 | Bacteria | 2017 |
| 261 | Ga0075429_100389805 | 3300006880 | Bacteria | 1220 |
| 262 | Ga0075429_100815983 | 3300006880 | Bacteria | 817 |
| 263 | Ga0068865_100031672 | 3300006881 | Bacteria | 3527 |
| 264 | Ga0068865_100383659 | 3300006881 | Bacteria | 1147 |
| 265 | Ga0097620_100090295 | 3300006931 | Bacteria | 3115 |
| 266 | Ga0097620_100187940 | 3300006931 | Bacteria | 2150 |
| 267 | Ga0111539_10142030 | 3300009094 | Bacteria | 2810 |
| 268 | Ga0111539_10629365 | 3300009094 | Bacteria | 1249 |
| 269 | Ga0111539_11149348 | 3300009094 | Bacteria | 902 |
| 270 | Ga0111539_11853150 | 3300009094 | Bacteria | 699 |
| 271 | Ga0105245_10013977 | 3300009098 | Bacteria | 6992 |
| 272 | Ga0105245_10016782 | 3300009098 | Bacteria | 6393 |
| 273 | Ga0105245_10019026 | 3300009098 | Bacteria | 6011 |
| 274 | Ga0105245_10062343 | 3300009098 | Bacteria | 3364 |
| 275 | Ga0105245_10097378 | 3300009098 | Bacteria | 2717 |
| 276 | Ga0105245_10145432 | 3300009098 | Bacteria | 2236 |
| 277 | Ga0105245_10213229 | 3300009098 | Bacteria | 1860 |
| 278 | Ga0105245_10353315 | 3300009098 | Bacteria | 1457 |
| 279 | Ga0105245_10880896 | 3300009098 | Bacteria | 936 |
| 280 | Ga0105247_10135707 | 3300009101 | Bacteria | 1607 |
| 281 | Ga0105247_10586989 | 3300009101 | Bacteria | 824 |
| 282 | Ga0105247_10812925 | 3300009101 | Unclassified | 714 |
| 283 | Ga0114129_10000558 | 3300009147 | Bacteria | 45754 |
| 284 | Ga0114129_10004745 | 3300009147 | Bacteria | 19205 |
| 285 | Ga0114129_10008295 | 3300009147 | Bacteria | 14818 |
| 286 | Ga0114129_10029537 | 3300009147 | Bacteria | 7763 |
| 287 | Ga0114129_10132970 | 3300009147 | Bacteria | 3415 |
| 288 | Ga0114129_10228966 | 3300009147 | Bacteria | 2504 |
| 289 | Ga0114129_10259684 | 3300009147 | Bacteria | 2329 |
| 290 | Ga0114129_10411171 | 3300009147 | Bacteria | 1781 |
| 291 | Ga0114129_10444623 | 3300009147 | Bacteria | 1701 |
| 292 | Ga0105243_10002101 | 3300009148 | Bacteria | 16849 |
| 293 | Ga0105243_10047430 | 3300009148 | Bacteria | 3382 |
| 294 | Ga0105243_10050894 | 3300009148 | Bacteria | 3274 |
| 295 | Ga0105243_10458124 | 3300009148 | Bacteria | 1198 |
| 296 | Ga0105243_10749142 | 3300009148 | Bacteria | 957 |
| 297 | Ga0105243_11518320 | 3300009148 | Bacteria | 694 |
| 298 | Ga0105241_10019097 | 3300009174 | Bacteria | 5055 |
| 299 | Ga0105241_10604290 | 3300009174 | Unclassified | 991 |
| 300 | Ga0105242_10003124 | 3300009176 | Bacteria | 12921 |
| 301 | Ga0105242_10046650 | 3300009176 | Bacteria | 3516 |
| 302 | Ga0105242_10383298 | 3300009176 | Bacteria | 1307 |
| 303 | Ga0105242_10514869 | 3300009176 | Bacteria | 1140 |
| 304 | Ga0105242_10645926 | 3300009176 | Bacteria | 1028 |
| 305 | Ga0105242_10737790 | 3300009176 | Bacteria | 968 |
| 306 | Ga0105248_10021005 | 3300009177 | Bacteria | 7235 |
| 307 | Ga0105248_10384003 | 3300009177 | Bacteria | 1581 |
| 308 | Ga0105237_10126329 | 3300009545 | Unclassified | 2552 |
| 309 | Ga0105237_11415897 | 3300009545 | Unclassified | 702 |
| 310 | Ga0105238_10020762 | 3300009551 | Bacteria | 6688 |
| 311 | Ga0105238_10347713 | 3300009551 | Bacteria | 1471 |
| 312 | Ga0105238_10812284 | 3300009551 | Bacteria | 951 |
| 313 | Ga0105238_11096088 | 3300009551 | Bacteria | 819 |
| 314 | Ga0105249_10002268 | 3300009553 | Bacteria | 16680 |
| 315 | Ga0105249_10175295 | 3300009553 | Bacteria | 2082 |
| 316 | Ga0105249_10255158 | 3300009553 | Bacteria | 1740 |
| 317 | Ga0105239_10006994 | 3300010375 | Bacteria | 12987 |
| 318 | Ga0105239_10061108 | 3300010375 | Bacteria | 4135 |
| 319 | Ga0105239_10077288 | 3300010375 | Bacteria | 3663 |
| 320 | Ga0105239_11083337 | 3300010375 | Bacteria | 922 |
| 321 | Ga0105246_10008465 | 3300011119 | Bacteria | 6323 |
| 322 | Ga0105246_10239241 | 3300011119 | Bacteria | 1434 |
| 323 | Ga0105246_10287054 | 3300011119 | Bacteria | 1323 |
| 324 | Ga0105246_10299589 | 3300011119 | Bacteria | 1297 |
| 325 | Ga0157373_10117165 | 3300013100 | Unclassified | 1872 |
| 326 | Ga0157373_10512682 | 3300013100 | Bacteria | 867 |
| 327 | Ga0157370_10201730 | 3300013104 | Bacteria | 1845 |
| 328 | Ga0157369_10044282 | 3300013105 | Bacteria | 4845 |
| 329 | Ga0157369_10432933 | 3300013105 | Bacteria | 1363 |
| 330 | Ga0157374_10001932 | 3300013296 | Bacteria | 17377 |
| 331 | Ga0157374_10200014 | 3300013296 | Bacteria | 1956 |
| 332 | Ga0157378_10002234 | 3300013297 | Bacteria | 17171 |
| 333 | Ga0157378_10073432 | 3300013297 | Bacteria | 3075 |
| 334 | Ga0157378_10232654 | 3300013297 | Bacteria | 1757 |
| 335 | Ga0163162_10021305 | 3300013306 | Bacteria | 6381 |
| 336 | Ga0163162_10173270 | 3300013306 | Bacteria | 2282 |
| 337 | Ga0163162_10478743 | 3300013306 | Bacteria | 1376 |
| 338 | Ga0157372_10000044 | 3300013307 | Bacteria | 152637 |
| 339 | Ga0157372_10038513 | 3300013307 | Bacteria | 5276 |
| 340 | Ga0157372_10560345 | 3300013307 | Bacteria | 1332 |
| 341 | Ga0157372_10654395 | 3300013307 | Bacteria | 1223 |
| 342 | Ga0157372_10743521 | 3300013307 | Bacteria | 1140 |
| 343 | Ga0157372_11225526 | 3300013307 | Bacteria | 867 |
| 344 | Ga0157375_10055648 | 3300013308 | Bacteria | 3902 |
| 345 | Ga0157375_10081823 | 3300013308 | Bacteria | 3270 |
| 346 | Ga0157375_12047958 | 3300013308 | Unclassified | 681 |
| 347 | Ga0163163_10959857 | 3300014325 | Bacteria | 918 |
| 348 | Ga0163163_10964860 | 3300014325 | Bacteria | 916 |
| 349 | Ga0163163_11734607 | 3300014325 | Unclassified | 685 |
| 350 | Ga0157380_10017866 | 3300014326 | Bacteria | 5257 |
| 351 | Ga0157380_10048637 | 3300014326 | Bacteria | 3341 |
| 352 | Ga0157380_10098071 | 3300014326 | Bacteria | 2434 |
| 353 | Ga0157380_10344463 | 3300014326 | Bacteria | 1392 |
| 354 | Ga0157377_10001693 | 3300014745 | Bacteria | 9609 |
| 355 | Ga0157377_10002176 | 3300014745 | Bacteria | 8615 |
| 356 | Ga0157376_10005356 | 3300014969 | Bacteria | 8964 |
| 357 | Ga0157376_10338043 | 3300014969 | Bacteria | 1437 |
| 358 | Ga0157376_10656357 | 3300014969 | Bacteria | 1050 |
| 359 | Ga0182007_10180910 | 3300015262 | Unclassified | 729 |
| 360 | Ga0163161_10237211 | 3300017792 | Bacteria | 1417 |
| 361 | Ga0206352_11045972 | 3300020078 | Unclassified | 1276 |
| 362 | Ga0213876_10001139 | 3300021384 | Bacteria | 16937 |
| 363 | Ga0213876_10061765 | 3300021384 | Bacteria | 1977 |
| 364 | Ga0213876_10429575 | 3300021384 | Bacteria | 703 |
| 365 | Ga0207692_10113928 | 3300025898 | Bacteria | 1504 |
| 366 | Ga0207692_10142735 | 3300025898 | Bacteria | 1363 |
| 367 | Ga0207642_10054953 | 3300025899 | Bacteria | 1818 |
| 368 | Ga0207688_10001062 | 3300025901 | Bacteria | 14061 |
| 369 | Ga0207688_10030283 | 3300025901 | Bacteria | 2984 |
| 370 | Ga0207688_10140322 | 3300025901 | Bacteria | 1422 |
| 371 | Ga0207680_10023379 | 3300025903 | Bacteria | 3374 |
| 372 | Ga0207685_10049871 | 3300025905 | Bacteria | 1610 |
| 373 | Ga0207699_10030727 | 3300025906 | Bacteria | 3009 |
| 374 | Ga0207699_10046025 | 3300025906 | Bacteria | 2549 |
| 375 | Ga0207643_10038160 | 3300025908 | Bacteria | 2698 |
| 376 | Ga0207643_10273428 | 3300025908 | Bacteria | 1046 |
| 377 | Ga0207643_10343757 | 3300025908 | Unclassified | 936 |
| 378 | Ga0207705_10041106 | 3300025909 | Bacteria | 3316 |
| 379 | Ga0207684_10002784 | 3300025910 | Bacteria | 17391 |
| 380 | Ga0207684_10025581 | 3300025910 | Bacteria | 5030 |
| 381 | Ga0207684_10080635 | 3300025910 | Bacteria | 2769 |
| 382 | Ga0207684_10229690 | 3300025910 | Bacteria | 1601 |
| 383 | Ga0207684_10551004 | 3300025910 | Bacteria | 986 |
| 384 | Ga0207654_10107294 | 3300025911 | Bacteria | 1731 |
| 385 | Ga0207707_10232707 | 3300025912 | Bacteria | 1603 |
| 386 | Ga0207707_10577817 | 3300025912 | Bacteria | 953 |
| 387 | Ga0207695_10017361 | 3300025913 | Bacteria | 8375 |
| 388 | Ga0207671_10061600 | 3300025914 | Unclassified | 2784 |
| 389 | Ga0207693_10007175 | 3300025915 | Bacteria | 9179 |
| 390 | Ga0207693_10027303 | 3300025915 | Bacteria | 4513 |
| 391 | Ga0207693_11135111 | 3300025915 | Bacteria | 592 |
| 392 | Ga0207663_10023106 | 3300025916 | Bacteria | 3564 |
| 393 | Ga0207663_10033549 | 3300025916 | Bacteria | 3059 |
| 394 | Ga0207660_10213841 | 3300025917 | Bacteria | 1511 |
| 395 | Ga0207660_10327152 | 3300025917 | Unclassified | 1225 |
| 396 | Ga0207662_10074295 | 3300025918 | Bacteria | 2063 |
| 397 | Ga0207657_10004070 | 3300025919 | Bacteria | 15518 |
| 398 | Ga0207657_10042720 | 3300025919 | Bacteria | 3997 |
| 399 | Ga0207649_10192131 | 3300025920 | Bacteria | 1437 |
| 400 | Ga0207652_10203122 | 3300025921 | Bacteria | 1783 |
| 401 | Ga0207646_10093355 | 3300025922 | Bacteria | 2695 |
| 402 | Ga0207646_10190259 | 3300025922 | Bacteria | 1853 |
| 403 | Ga0207646_10731728 | 3300025922 | Unclassified | 883 |
| 404 | Ga0207681_10430321 | 3300025923 | Bacteria | 1071 |
| 405 | Ga0207681_10662037 | 3300025923 | Bacteria | 866 |
| 406 | Ga0207694_10439139 | 3300025924 | Bacteria | 1089 |
| 407 | Ga0207650_10001896 | 3300025925 | Bacteria | 14752 |
| 408 | Ga0207687_10019617 | 3300025927 | Bacteria | 4481 |
| 409 | Ga0207687_10105522 | 3300025927 | Bacteria | 2082 |
| 410 | Ga0207687_10114233 | 3300025927 | Bacteria | 2009 |
| 411 | Ga0207687_10139571 | 3300025927 | Bacteria | 1837 |
| 412 | Ga0207687_10300688 | 3300025927 | Bacteria | 1292 |
| 413 | Ga0207687_10688647 | 3300025927 | Bacteria | 867 |
| 414 | Ga0207687_10792171 | 3300025927 | Bacteria | 808 |
| 415 | Ga0207700_10004542 | 3300025928 | Bacteria | 8202 |
| 416 | Ga0207700_10291486 | 3300025928 | Bacteria | 1406 |
| 417 | Ga0207664_10336965 | 3300025929 | Unclassified | 1333 |
| 418 | Ga0207664_11222528 | 3300025929 | Bacteria | 670 |
| 419 | Ga0207690_10103134 | 3300025932 | Bacteria | 2041 |
| 420 | Ga0207690_10153400 | 3300025932 | Bacteria | 1710 |
| 421 | Ga0207706_10065047 | 3300025933 | Bacteria | 3211 |
| 422 | Ga0207706_10252095 | 3300025933 | Bacteria | 1542 |
| 423 | Ga0207686_10014856 | 3300025934 | Bacteria | 4346 |
| 424 | Ga0207686_10130155 | 3300025934 | Bacteria | 1725 |
| 425 | Ga0207686_10174443 | 3300025934 | Bacteria | 1519 |
| 426 | Ga0207686_10263006 | 3300025934 | Bacteria | 1266 |
| 427 | Ga0207686_10359231 | 3300025934 | Bacteria | 1099 |
| 428 | Ga0207686_10554642 | 3300025934 | Bacteria | 899 |
| 429 | Ga0207709_10053457 | 3300025935 | Bacteria | 2486 |
| 430 | Ga0207709_10078175 | 3300025935 | Bacteria | 2123 |
| 431 | Ga0207709_10202272 | 3300025935 | Bacteria | 1419 |
| 432 | Ga0207709_11151089 | 3300025935 | Bacteria | 638 |
| 433 | Ga0207669_10192844 | 3300025937 | Bacteria | 1471 |
| 434 | Ga0207669_10483661 | 3300025937 | Bacteria | 987 |
| 435 | Ga0207669_10545664 | 3300025937 | Bacteria | 935 |
| 436 | Ga0207669_10663068 | 3300025937 | Bacteria | 854 |
| 437 | Ga0207669_11056327 | 3300025937 | Bacteria | 684 |
| 438 | Ga0207669_11361251 | 3300025937 | Bacteria | 604 |
| 439 | Ga0207704_10068214 | 3300025938 | Bacteria | 2241 |
| 440 | Ga0207704_10089184 | 3300025938 | Bacteria | 2020 |
| 441 | Ga0207704_10814641 | 3300025938 | Bacteria | 780 |
| 442 | Ga0207704_11249173 | 3300025938 | Unclassified | 634 |
| 443 | Ga0207691_10044054 | 3300025940 | Bacteria | 4109 |
| 444 | Ga0207691_10081295 | 3300025940 | Bacteria | 2913 |
| 445 | Ga0207691_11541098 | 3300025940 | Bacteria | 542 |
| 446 | Ga0207711_10027079 | 3300025941 | Bacteria | 4813 |
| 447 | Ga0207711_10550662 | 3300025941 | Bacteria | 1076 |
| 448 | Ga0207689_10063901 | 3300025942 | Bacteria | 3028 |
| 449 | Ga0207661_10088693 | 3300025944 | Bacteria | 2571 |
| 450 | Ga0207661_10116773 | 3300025944 | Bacteria | 2266 |
| 451 | Ga0207661_10942868 | 3300025944 | Unclassified | 795 |
| 452 | Ga0207667_10059198 | 3300025949 | Bacteria | 4013 |
| 453 | Ga0207667_10342945 | 3300025949 | Bacteria | 1524 |
| 454 | Ga0207667_11327642 | 3300025949 | Bacteria | 695 |
| 455 | Ga0207651_10074966 | 3300025960 | Bacteria | 2412 |
| 456 | Ga0207651_10225155 | 3300025960 | Bacteria | 1519 |
| 457 | Ga0207651_10257702 | 3300025960 | Bacteria | 1430 |
| 458 | Ga0207651_11003958 | 3300025960 | Unclassified | 746 |
| 459 | Ga0207712_10047091 | 3300025961 | Bacteria | 2992 |
| 460 | Ga0207712_10124430 | 3300025961 | Bacteria | 1956 |
| 461 | Ga0207712_10337687 | 3300025961 | Bacteria | 1248 |
| 462 | Ga0207668_10284371 | 3300025972 | Bacteria | 1358 |
| 463 | Ga0207668_10587553 | 3300025972 | Bacteria | 969 |
| 464 | Ga0207658_10165417 | 3300025986 | Bacteria | 1817 |
| 465 | Ga0207658_10886884 | 3300025986 | Unclassified | 812 |
| 466 | Ga0207677_10096602 | 3300026023 | Bacteria | 2162 |
| 467 | Ga0207677_10697802 | 3300026023 | Bacteria | 900 |
| 468 | Ga0207639_10266393 | 3300026041 | Unclassified | 1501 |
| 469 | Ga0207639_10382465 | 3300026041 | Bacteria | 1264 |
| 470 | Ga0207639_11831952 | 3300026041 | Bacteria | 567 |
| 471 | Ga0207678_10007751 | 3300026067 | Bacteria | 9486 |
| 472 | Ga0207708_10000038 | 3300026075 | Bacteria | 137212 |
| 473 | Ga0207708_10000352 | 3300026075 | Bacteria | 36059 |
| 474 | Ga0207708_10120002 | 3300026075 | Bacteria | 2048 |
| 475 | Ga0207708_10553482 | 3300026075 | Bacteria | 970 |
| 476 | Ga0207708_10843214 | 3300026075 | Bacteria | 791 |
| 477 | Ga0207702_10077337 | 3300026078 | Bacteria | 2878 |
| 478 | Ga0207702_10179997 | 3300026078 | Bacteria | 1946 |
| 479 | Ga0207702_10344670 | 3300026078 | Bacteria | 1424 |
| 480 | Ga0207648_10010765 | 3300026089 | Bacteria | 8641 |
| 481 | Ga0207648_10033696 | 3300026089 | Bacteria | 4517 |
| 482 | Ga0207648_10628997 | 3300026089 | Bacteria | 991 |
| 483 | Ga0207648_10720867 | 3300026089 | Bacteria | 925 |
| 484 | Ga0207676_10085256 | 3300026095 | Bacteria | 2577 |
| 485 | Ga0207676_10839413 | 3300026095 | Bacteria | 898 |
| 486 | Ga0207674_10056049 | 3300026116 | Bacteria | 4004 |
| 487 | Ga0207674_11062369 | 3300026116 | Bacteria | 779 |
| 488 | Ga0207675_100015239 | 3300026118 | Bacteria | 7171 |
| 489 | Ga0207675_100093033 | 3300026118 | Bacteria | 2835 |
| 490 | Ga0207675_100095937 | 3300026118 | Bacteria | 2791 |
| 491 | Ga0207675_100774065 | 3300026118 | Bacteria | 972 |
| 492 | Ga0207675_101005988 | 3300026118 | Bacteria | 852 |
| 493 | Ga0207683_10000598 | 3300026121 | Bacteria | 33267 |
| 494 | Ga0207683_10018999 | 3300026121 | Bacteria | 5864 |
| 495 | Ga0207683_10027452 | 3300026121 | Bacteria | 4919 |
| 496 | Ga0207683_10081091 | 3300026121 | Bacteria | 2879 |
| 497 | Ga0207683_11324708 | 3300026121 | Unclassified | 666 |
| 498 | Ga0207698_11522714 | 3300026142 | Bacteria | 684 |
| 499 | Ga0209971_1115614 | 3300027682 | Bacteria | 658 |
| 500 | Ga0207428_10003848 | 3300027907 | Bacteria | 14396 |
| 501 | Ga0268266_10178244 | 3300028379 | Bacteria | 1933 |
| 502 | Ga0268266_10699066 | 3300028379 | Unclassified | 977 |
| 503 | Ga0268264_10460718 | 3300028381 | Bacteria | 1233 |
| 504 | Ga0268264_10536801 | 3300028381 | Bacteria | 1145 |
| 505 | Ga0307515_10085249 | 3300028794 | Bacteria | 4045 |
| 506 | Ga0307509_10205105 | 3300031507 | Bacteria | 1803 |
| 507 | Ga0307408_100308202 | 3300031548 | Bacteria | 1329 |
| 508 | Ga0307508_10000420 | 3300031616 | Bacteria | 50353 |
| 509 | Ga0307405_10020279 | 3300031731 | Bacteria | 3711 |
| 510 | Ga0307405_10146058 | 3300031731 | Unclassified | 1657 |
| 511 | Ga0307405_10489545 | 3300031731 | Bacteria | 983 |
| 512 | Ga0307405_10591707 | 3300031731 | Bacteria | 904 |
| 513 | Ga0307413_10298435 | 3300031824 | Bacteria | 1221 |
| 514 | Ga0307413_10623271 | 3300031824 | Unclassified | 886 |
| 515 | Ga0307413_10930033 | 3300031824 | Bacteria | 740 |
| 516 | Ga0307410_10077373 | 3300031852 | Bacteria | 2325 |
| 517 | Ga0307410_10093012 | 3300031852 | Bacteria | 2145 |
| 518 | Ga0307410_10102890 | 3300031852 | Bacteria | 2050 |
| 519 | Ga0307410_10171128 | 3300031852 | Bacteria | 1637 |
| 520 | Ga0307410_11133093 | 3300031852 | Bacteria | 679 |
| 521 | Ga0307410_11486261 | 3300031852 | Bacteria | 596 |
| 522 | Ga0307410_11635313 | 3300031852 | Bacteria | 570 |
| 523 | Ga0307410_11916135 | 3300031852 | Bacteria | 528 |
| 524 | Ga0307406_10035066 | 3300031901 | Bacteria | 3083 |
| 525 | Ga0307406_10059659 | 3300031901 | Bacteria | 2457 |
| 526 | Ga0307406_10110519 | 3300031901 | Bacteria | 1891 |
| 527 | Ga0307406_10405464 | 3300031901 | Bacteria | 1082 |
| 528 | Ga0307406_10670829 | 3300031901 | Bacteria | 863 |
| 529 | Ga0307406_10749251 | 3300031901 | Bacteria | 820 |
| 530 | Ga0307407_10178165 | 3300031903 | Bacteria | 1406 |
| 531 | Ga0307407_10262193 | 3300031903 | Unclassified | 1189 |
| 532 | Ga0307407_10553151 | 3300031903 | Bacteria | 851 |
| 533 | Ga0307412_10022635 | 3300031911 | Bacteria | 3856 |
| 534 | Ga0307412_10062126 | 3300031911 | Bacteria | 2514 |
| 535 | Ga0307412_10161211 | 3300031911 | Bacteria | 1667 |
| 536 | Ga0307412_10187220 | 3300031911 | Bacteria | 1562 |
| 537 | Ga0307412_11330258 | 3300031911 | Bacteria | 648 |
| 538 | Ga0307412_11554237 | 3300031911 | Bacteria | 603 |
| 539 | Ga0307409_100031389 | 3300031995 | Bacteria | 3833 |
| 540 | Ga0307409_100040222 | 3300031995 | Bacteria | 3478 |
| 541 | Ga0307409_100045072 | 3300031995 | Bacteria | 3327 |
| 542 | Ga0307409_100093471 | 3300031995 | Bacteria | 2471 |
| 543 | Ga0307409_100108160 | 3300031995 | Bacteria | 2325 |
| 544 | Ga0307409_100191056 | 3300031995 | Bacteria | 1823 |
| 545 | Ga0307409_100239054 | 3300031995 | Bacteria | 1652 |
| 546 | Ga0307409_100241814 | 3300031995 | Bacteria | 1644 |
| 547 | Ga0307409_100519116 | 3300031995 | Bacteria | 1163 |
| 548 | Ga0307409_100598443 | 3300031995 | Bacteria | 1089 |
| 549 | Ga0307409_101190019 | 3300031995 | Bacteria | 785 |
| 550 | Ga0307409_101676653 | 3300031995 | Bacteria | 664 |
| 551 | Ga0307416_100029255 | 3300032002 | Bacteria | 4112 |
| 552 | Ga0307416_100073605 | 3300032002 | Bacteria | 2849 |
| 553 | Ga0307416_100130404 | 3300032002 | Bacteria | 2262 |
| 554 | Ga0307416_100143683 | 3300032002 | Bacteria | 2174 |
| 555 | Ga0307416_100213536 | 3300032002 | Bacteria | 1843 |
| 556 | Ga0307416_100308578 | 3300032002 | Bacteria | 1577 |
| 557 | Ga0307416_100498224 | 3300032002 | Bacteria | 1282 |
| 558 | Ga0307416_100550000 | 3300032002 | Bacteria | 1227 |
| 559 | Ga0307411_10406606 | 3300032005 | Bacteria | 1127 |
| 560 | Ga0307411_10849615 | 3300032005 | Bacteria | 807 |
| 561 | Ga0307411_10986276 | 3300032005 | Bacteria | 753 |
| 562 | Ga0307411_11406160 | 3300032005 | Bacteria | 639 |
| 563 | Ga0307415_100005505 | 3300032126 | Bacteria | 6729 |
| 564 | Ga0307415_100051927 | 3300032126 | Bacteria | 2785 |
| 565 | Ga0307415_100094098 | 3300032126 | Bacteria | 2178 |
| 566 | Ga0307415_100139539 | 3300032126 | Bacteria | 1849 |
| 567 | Ga0307415_100166071 | 3300032126 | Bacteria | 1716 |
| 568 | Ga0307415_100257601 | 3300032126 | Bacteria | 1421 |
| 569 | Ga0307415_100260585 | 3300032126 | Bacteria | 1414 |
| 570 | Ga0307415_100385068 | 3300032126 | Bacteria | 1192 |
| 571 | Ga0307415_100545366 | 3300032126 | Bacteria | 1022 |
| 572 | Ga0307415_100707410 | 3300032126 | Bacteria | 910 |
| 573 | Ga0307415_101054377 | 3300032126 | Bacteria | 759 |
| 574 | Ga0307415_102047336 | 3300032126 | Bacteria | 558 |
| 575 | Ga0307507_10006095 | 3300033179 | Bacteria | 18924 |
| 576 | Ga0307510_10106425 | 3300033180 | Bacteria | 2568 |
| 577 | Ga0373953_0051218 | 3300035117 | Bacteria | 1669 |
| 578 | Ga0373946_0041328 | 3300035171 | Bacteria | 1891 |
| 579 | Ga0373955_0045691 | 3300035172 | Bacteria | 2364 |
| 580 | Ga0373942_0352692 | 3300035207 | Unclassified | 520 |
| 581 | Ga0373924_0043545 | 3300035410 | Bacteria | 1844 |
| 582 | Ga0373927_0038793 | 3300035695 | Bacteria | 3092 |
| 583 | Ga0373927_0693319 | 3300035695 | Bacteria | 673 |
| 584 | Ga0373933_0083969 | 3300035724 | Bacteria | 1956 |
| 585 | Ga0373937_0056651 | 3300036401 | Bacteria | 3600 |
| 586 | Ga0373925_0195437 | 3300037068 | Bacteria | 1607 |
| 587 | Ga0395899_0056100 | 3300037312 | Bacteria | 2912 |
| 588 | Ga0395899_0059451 | 3300037312 | Bacteria | 2818 |
| 589 | Ga0395899_0092453 | 3300037312 | Bacteria | 2191 |
| 590 | Ga0395899_0101868 | 3300037312 | Bacteria | 2072 |
| 591 | Ga0395899_0448408 | 3300037312 | Bacteria | 845 |
| 592 | Ga0395899_0853607 | 3300037312 | Bacteria | 559 |
| 593 | Ga0395900_0016596 | 3300037418 | Bacteria | 7510 |
| 594 | Ga0395900_0035185 | 3300037418 | Bacteria | 5159 |
| 595 | Ga0395900_0039392 | 3300037418 | Bacteria | 4869 |
| 596 | Ga0395900_0094308 | 3300037418 | Bacteria | 3074 |
| 597 | Ga0395900_0100100 | 3300037418 | Bacteria | 2977 |
| 598 | Ga0395900_0130454 | 3300037418 | Bacteria | 2576 |
| 599 | Ga0395900_0159169 | 3300037418 | Bacteria | 2304 |
| 600 | Ga0395900_0212058 | 3300037418 | Bacteria | 1955 |
| 601 | Ga0395900_0478768 | 3300037418 | Bacteria | 1198 |
| 602 | Ga0395900_0855945 | 3300037418 | Bacteria | 834 |
| 603 | Ga0395900_1154486 | 3300037418 | Bacteria | 691 |
| 604 | Ga0395898_0029101 | 3300037466 | Bacteria | 5534 |
| 605 | Ga0395898_0062093 | 3300037466 | Bacteria | 3629 |
| 606 | Ga0395898_0063831 | 3300037466 | Bacteria | 3573 |
| 607 | Ga0395898_0137269 | 3300037466 | Bacteria | 2342 |
| 608 | Ga0395898_0149856 | 3300037466 | Bacteria | 2232 |
| 609 | Ga0395898_0201796 | 3300037466 | Bacteria | 1898 |
| 610 | Ga0395898_0573287 | 3300037466 | Bacteria | 1071 |
| 611 | Ga0395898_0859038 | 3300037466 | Bacteria | 846 |
| 612 | Ga0395905_0008903 | 3300037471 | Bacteria | 9860 |
| 613 | Ga0395905_0038521 | 3300037471 | Bacteria | 4487 |
| 614 | Ga0395905_0062434 | 3300037471 | Bacteria | 3485 |
| 615 | Ga0395905_0072180 | 3300037471 | Bacteria | 3236 |
| 616 | Ga0395905_0090769 | 3300037471 | Bacteria | 2864 |
| 617 | Ga0395905_0465040 | 3300037471 | Bacteria | 1163 |
| 618 | Ga0395905_0769759 | 3300037471 | Bacteria | 865 |
| 619 | Ga0395905_1201340 | 3300037471 | Bacteria | 662 |
| 620 | Ga0436364_0143458 | 3300037853 | Bacteria | 2145 |
| 621 | Ga0436364_0911004 | 3300037853 | Bacteria | 1273 |
| 622 | Ga0395901_0012719 | 3300038443 | Bacteria | 8536 |
| 623 | Ga0395901_0024059 | 3300038443 | Bacteria | 6248 |
| 624 | Ga0395901_0024817 | 3300038443 | Bacteria | 6153 |
| 625 | Ga0395901_0029263 | 3300038443 | Bacteria | 5669 |
| 626 | Ga0395901_0052447 | 3300038443 | Bacteria | 4239 |
| 627 | Ga0395901_0141289 | 3300038443 | Bacteria | 2530 |
| 628 | Ga0395901_0169160 | 3300038443 | Bacteria | 2293 |
| 629 | Ga0395901_0176181 | 3300038443 | Bacteria | 2243 |
| 630 | Ga0395901_0182201 | 3300038443 | Bacteria | 2203 |
| 631 | Ga0395901_0263037 | 3300038443 | Bacteria | 1795 |
| 632 | Ga0395901_0285204 | 3300038443 | Bacteria | 1715 |
| 633 | Ga0395901_0527102 | 3300038443 | Bacteria | 1199 |
| 634 | Ga0395901_0600834 | 3300038443 | Bacteria | 1109 |
| 635 | Ga0395901_0760556 | 3300038443 | Bacteria | 961 |
| 636 | Ga0395901_0857553 | 3300038443 | Bacteria | 893 |
| 637 | Ga0242420_088805 | 3300038996 | Bacteria | 646 |
| 638 | Ga0436365_0572677 | 3300039437 | Bacteria | 1499 |
| 639 | Ga0436365_0714445 | 3300039437 | Bacteria | 7977 |
| 640 | Ga0436365_1125982 | 3300039437 | Bacteria | 14552 |
| 641 | Ga0436365_1558885 | 3300039437 | Bacteria | 1011 |
| 642 | Ga0436363_1330717 | 3300039450 | Bacteria | 882 |
| 643 | Ga0436362_0098660 | 3300039453 | Bacteria | 3230 |
| 644 | Ga0436362_0551951 | 3300039453 | Bacteria | 1181 |
| 645 | Ga0439438_021921 | 3300041405 | Bacteria | 1777 |
| 646 | Ga0439447_150276 | 3300041407 | Bacteria | 536 |
| 647 | Ga0439461_0032900 | 3300041410 | Bacteria | 1089 |
| 648 | Ga0451804_0061489 | 3300041463 | Unclassified | 761 |
| 649 | Ga0439431_0125074 | 3300041997 | Bacteria | 719 |
| 650 | Ga0439433_0003967 | 3300041999 | Bacteria | 3184 |
| 651 | Ga0439448_0000638 | 3300042005 | Bacteria | 8281 |
| 652 | Ga0439448_0043240 | 3300042005 | Bacteria | 1462 |
| 653 | Ga0439448_0075642 | 3300042005 | Bacteria | 1126 |
| 654 | Ga0439448_0200857 | 3300042005 | Bacteria | 699 |
| 655 | Ga0439432_045521 | 3300042006 | Bacteria | 1380 |
| 656 | Ga0439449_0058991 | 3300042007 | Bacteria | 1417 |
| 657 | Ga0439450_003970 | 3300042008 | Bacteria | 2490 |
| 658 | Ga0439451_028332 | 3300042009 | Bacteria | 1129 |
| 659 | Ga0439455_0065293 | 3300042012 | Bacteria | 970 |
| 660 | Ga0439457_108745 | 3300042014 | Bacteria | 650 |
| 661 | Ga0439463_000138 | 3300042016 | Bacteria | 18502 |
| 662 | Ga0439463_020750 | 3300042016 | Bacteria | 1640 |
| 663 | Ga0450914_005594 | 3300042118 | Bacteria | 1070 |
| 664 | Ga0450900_005689 | 3300042136 | Bacteria | 1482 |
| 665 | Ga0450902_030115 | 3300042137 | Bacteria | 912 |
| 666 | Ga0450904_003174 | 3300042139 | Bacteria | 1811 |
| 667 | Ga0450889_002415 | 3300042144 | Bacteria | 1862 |
| 668 | Ga0439446_0000936 | 3300042156 | Bacteria | 6300 |
| 669 | Ga0439434_0014120 | 3300042435 | Bacteria | 2376 |
| 670 | Ga0439434_0034967 | 3300042435 | Bacteria | 1535 |
| 671 | Ga0439444_0000198 | 3300042437 | Bacteria | 5670 |
| 672 | Ga0439464_0000722 | 3300042439 | Bacteria | 7178 |
| 673 | Ga0439464_0017288 | 3300042439 | Bacteria | 1955 |
| 674 | Ga0439460_0003898 | 3300042461 | Bacteria | 3622 |
| 675 | Ga0450916_001215 | 3300042530 | Bacteria | 2540 |
| 676 | Ga0450916_003373 | 3300042530 | Bacteria | 1753 |
| 677 | Ga0439440_0000034 | 3300042993 | Bacteria | 17266 |
| 678 | Ga0439440_0225506 | 3300042993 | Bacteria | 563 |
| 679 | Ga0466969_0174477 | 3300044656 | Unclassified | 985 |
| 680 | Ga0466972_0000769 | 3300044658 | Bacteria | 15255 |
| 681 | Ga0466965_0013377 | 3300044683 | Bacteria | 3872 |
| 682 | Ga0466966_0090811 | 3300044684 | Unclassified | 1896 |
| 683 | Ga0466963_0034613 | 3300044694 | Bacteria | 3287 |
| 684 | Ga0466963_0084521 | 3300044694 | Unclassified | 2153 |
| 685 | Ga0466963_0593965 | 3300044694 | Bacteria | 782 |
| 686 | Ga0466964_0071603 | 3300044706 | Unclassified | 1467 |
| 687 | Ga0466968_0004226 | 3300044735 | Bacteria | 5353 |
| 688 | Ga0466968_0199385 | 3300044735 | Bacteria | 937 |
| 689 | Ga0466970_0052317 | 3300044765 | Bacteria | 2180 |
| 690 | Ga0466960_0008951 | 3300044901 | Bacteria | 4115 |
| 691 | Ga0466959_0030167 | 3300045049 | Bacteria | 4016 |
| 692 | Ga0466959_0401799 | 3300045049 | Unclassified | 931 |
| 693 | Ga0451576_0029001 | 3300045051 | Bacteria | 5925 |
| 694 | Ga0466958_0113222 | 3300045836 | Bacteria | 1695 |
| 695 | Ga0466967_0121170 | 3300045976 | Bacteria | 2417 |
| 696 | Ga0466967_0172412 | 3300045976 | Bacteria | 2036 |
| 697 | Ga0466967_0213264 | 3300045976 | Unclassified | 1832 |
| 698 | Ga0466967_0251925 | 3300045976 | Bacteria | 1687 |
| 699 | Ga0466967_0361282 | 3300045976 | Bacteria | 1407 |
| 700 | Ga0466967_0399820 | 3300045976 | Bacteria | 1336 |
| 701 | Ga0466967_0427373 | 3300045976 | Bacteria | 1292 |
| 702 | Ga0466967_0814679 | 3300045976 | Bacteria | 927 |
| 703 | Ga0466967_1450103 | 3300045976 | Bacteria | 684 |
| 704 | Ga0495592_0010454 | 3300046454 | Bacteria | 6999 |
| 705 | Ga0495651_0015955 | 3300046462 | Bacteria | 5818 |
| 706 | Ga0495651_0044088 | 3300046462 | Bacteria | 3457 |
| 707 | Ga0495653_0014736 | 3300046463 | Bacteria | 6377 |
| 708 | Ga0495653_0097888 | 3300046463 | Bacteria | 2130 |
| 709 | Ga0495580_0021154 | 3300046472 | Bacteria | 4803 |
| 710 | Ga0495580_0074948 | 3300046472 | Bacteria | 2362 |
| 711 | Ga0495582_0711659 | 3300046473 | Bacteria | 581 |
| 712 | Ga0495639_0028748 | 3300046475 | Bacteria | 2463 |
| 713 | Ga0495662_0025272 | 3300046476 | Bacteria | 2867 |
| 714 | Ga0495664_0071104 | 3300046477 | Bacteria | 2078 |
| 715 | Ga0495664_0073997 | 3300046477 | Bacteria | 2037 |
| 716 | Ga0495664_0283595 | 3300046477 | Bacteria | 1001 |
| 717 | Ga0495584_0045009 | 3300046491 | Bacteria | 2226 |
| 718 | Ga0495608_0002082 | 3300046511 | Bacteria | 14416 |
| 719 | Ga0495608_0044868 | 3300046511 | Bacteria | 2948 |
| 720 | Ga0495628_0489342 | 3300046516 | Bacteria | 889 |
| 721 | Ga0495630_0133541 | 3300046517 | Bacteria | 1885 |
| 722 | Ga0495644_0096346 | 3300046523 | Bacteria | 1118 |
| 723 | Ga0495644_0136571 | 3300046523 | Bacteria | 936 |
| 724 | Ga0495663_0286773 | 3300046525 | Bacteria | 591 |
| 725 | Ga0495666_0000798 | 3300046526 | Bacteria | 14607 |
| 726 | Ga0495642_0089651 | 3300046528 | Bacteria | 1301 |
| 727 | Ga0495642_0211741 | 3300046528 | Bacteria | 846 |
| 728 | Ga0495652_0010929 | 3300046529 | Bacteria | 8224 |
| 729 | Ga0495652_0105011 | 3300046529 | Bacteria | 2283 |
| 730 | Ga0495665_0077748 | 3300046531 | Bacteria | 1746 |
| 731 | Ga0495665_0550079 | 3300046531 | Bacteria | 579 |
| 732 | Ga0495640_0020058 | 3300046533 | Bacteria | 4927 |
| 733 | Ga0495640_0021401 | 3300046533 | Bacteria | 4746 |
| 734 | Ga0495586_0029272 | 3300046535 | Bacteria | 2947 |
| 735 | Ga0495586_0030028 | 3300046535 | Bacteria | 2910 |
| 736 | Ga0495586_0034843 | 3300046535 | Bacteria | 2704 |
| 737 | Ga0495587_0005692 | 3300046536 | Bacteria | 8126 |
| 738 | Ga0495587_0062017 | 3300046536 | Bacteria | 2190 |
| 739 | Ga0495609_0023638 | 3300046538 | Bacteria | 2824 |
| 740 | Ga0495645_0062774 | 3300046543 | Bacteria | 2690 |
| 741 | Ga0495667_0001758 | 3300046559 | Bacteria | 14385 |
| 742 | Ga0495667_0200964 | 3300046559 | Bacteria | 1275 |
| 743 | Ga0495668_0044275 | 3300046616 | Bacteria | 2474 |
| 744 | Ga0495634_0042531 | 3300046642 | Bacteria | 3081 |
| 745 | Ga0495635_0000652 | 3300046663 | Bacteria | 22295 |
| 746 | Ga0495635_0077088 | 3300046663 | Bacteria | 2283 |
| 747 | Ga0495661_0447651 | 3300046665 | Bacteria | 622 |
| 748 | Ga0495657_0010805 | 3300046675 | Bacteria | 6856 |
| 749 | Ga0495657_0029227 | 3300046675 | Bacteria | 3867 |
| 750 | Ga0495599_0233927 | 3300046678 | Unclassified | 1121 |
| 751 | Ga0495623_0046457 | 3300046679 | Bacteria | 2755 |
| 752 | Ga0495623_0296496 | 3300046679 | Bacteria | 895 |
| 753 | Ga0495646_0012623 | 3300046680 | Bacteria | 5368 |
| 754 | Ga0495646_0040290 | 3300046680 | Bacteria | 2878 |
| 755 | Ga0495658_0310073 | 3300046683 | Bacteria | 999 |
| 756 | Ga0495613_0245919 | 3300046689 | Unclassified | 1249 |
| 757 | Ga0495670_0185005 | 3300046691 | Bacteria | 1101 |
| 758 | Ga0495589_0037555 | 3300046794 | Bacteria | 2427 |
| 759 | Ga0495589_0587703 | 3300046794 | Bacteria | 507 |
| 760 | Ga0495600_0002592 | 3300046809 | Bacteria | 10421 |
| 761 | Ga0495600_0116295 | 3300046809 | Unclassified | 1740 |
| 762 | Ga0495581_0001162 | 3300047315 | Bacteria | 14417 |
| 763 | Ga0495581_0009944 | 3300047315 | Bacteria | 5503 |
| 764 | Ga0495604_0001127 | 3300047317 | Bacteria | 22177 |
| 765 | Ga0495604_0048073 | 3300047317 | Bacteria | 3319 |
| 766 | Ga0495636_0170135 | 3300047318 | Bacteria | 985 |
| 767 | Ga0495674_0031369 | 3300047319 | Bacteria | 4828 |
| 768 | Ga0495674_0353634 | 3300047319 | Bacteria | 1192 |
| 769 | Ga0495676_0041890 | 3300047321 | Bacteria | 3765 |
| 770 | Ga0495676_0074415 | 3300047321 | Bacteria | 2601 |
| 771 | Ga0495676_0390601 | 3300047321 | Bacteria | 925 |
| 772 | Ga0495680_0007779 | 3300047322 | Bacteria | 9787 |
| 773 | Ga0495683_0152228 | 3300047323 | Bacteria | 1076 |
| 774 | Ga0495675_0121623 | 3300047444 | Bacteria | 1625 |
| 775 | Ga0495685_103414 | 3300047447 | Bacteria | 940 |
| 776 | Ga0495684_0176382 | 3300047471 | Unclassified | 1586 |
| 777 | Ga0495593_0037005 | 3300047673 | Bacteria | 2643 |
| 778 | Ga0495602_0029482 | 3300048088 | Bacteria | 5223 |
| 779 | Ga0495602_0031985 | 3300048088 | Bacteria | 4961 |
| 780 | Ga0496100_0007236 | 3300048903 | Bacteria | 6104 |
| 781 | Ga0496100_0154411 | 3300048903 | Bacteria | 1640 |
| 782 | Ga0496101_0007633 | 3300048904 | Bacteria | 7024 |
| 783 | Ga0496101_0203559 | 3300048904 | Bacteria | 1531 |
| 784 | Ga0496102_0001033 | 3300048905 | Bacteria | 25892 |
| 785 | Ga0496102_0032594 | 3300048905 | Bacteria | 4680 |
| 786 | Ga0496102_0046025 | 3300048905 | Bacteria | 3962 |
| 787 | Ga0496102_0580131 | 3300048905 | Bacteria | 1044 |
| 788 | Ga0496103_0002529 | 3300048906 | Bacteria | 11459 |
| 789 | Ga0496103_0018803 | 3300048906 | Bacteria | 4148 |
| 790 | Ga0496104_0111596 | 3300048907 | Bacteria | 2622 |
| 791 | Ga0496104_0418076 | 3300048907 | Unclassified | 1253 |
| 792 | Ga0496104_0456123 | 3300048907 | Bacteria | 1190 |
| 793 | Ga0496105_0038149 | 3300048908 | Bacteria | 3958 |
| 794 | Ga0496105_0194167 | 3300048908 | Bacteria | 1659 |
| 795 | Ga0496106_0000412 | 3300048909 | Bacteria | 30346 |
| 796 | Ga0496106_0000909 | 3300048909 | Bacteria | 21550 |
| 797 | Ga0496106_0480971 | 3300048909 | Bacteria | 998 |
| 798 | Ga0496107_0004852 | 3300048910 | Bacteria | 9134 |
| 799 | Ga0496107_0024165 | 3300048910 | Bacteria | 4298 |
| 800 | Ga0496108_0119825 | 3300048911 | Bacteria | 2256 |
| 801 | Ga0496108_1019163 | 3300048911 | Bacteria | 706 |
| 802 | Ga0496109_0015252 | 3300048912 | Bacteria | 6690 |
| 803 | Ga0496109_0023202 | 3300048912 | Bacteria | 5505 |
| 804 | Ga0496109_0093771 | 3300048912 | Bacteria | 2778 |
| 805 | Ga0496109_0300273 | 3300048912 | Bacteria | 1514 |
| 806 | Ga0496109_0468462 | 3300048912 | Bacteria | 1190 |
| 807 | Ga0496109_0956571 | 3300048912 | Bacteria | 794 |
| 808 | Ga0496110_0333080 | 3300048913 | Bacteria | 1383 |
| 809 | Ga0496110_0888893 | 3300048913 | Bacteria | 797 |
| 810 | Ga0496111_0336399 | 3300048914 | Bacteria | 1118 |
| 811 | Ga0496111_0421973 | 3300048914 | Bacteria | 985 |
| 812 | Ga0496111_0529795 | 3300048914 | Bacteria | 866 |
| 813 | Ga0496111_1105673 | 3300048914 | Bacteria | 565 |
| 814 | Ga0496112_0019479 | 3300048915 | Bacteria | 6406 |
| 815 | Ga0496112_0039644 | 3300048915 | Bacteria | 4604 |
| 816 | Ga0496112_0055459 | 3300048915 | Bacteria | 3897 |
| 817 | Ga0496112_0161569 | 3300048915 | Bacteria | 2207 |
| 818 | Ga0496112_0626369 | 3300048915 | Bacteria | 1006 |
| 819 | Ga0496112_0698845 | 3300048915 | Bacteria | 942 |
| 820 | Ga0496113_0230116 | 3300048916 | Bacteria | 1478 |
| 821 | Ga0496113_0590657 | 3300048916 | Bacteria | 889 |
| 822 | Ga0496113_1194662 | 3300048916 | Bacteria | 594 |
| 823 | Ga0496114_0044843 | 3300048917 | Bacteria | 3671 |
| 824 | Ga0496114_0087925 | 3300048917 | Bacteria | 2635 |
| 825 | Ga0496115_0032095 | 3300048918 | Bacteria | 4142 |
| 826 | Ga0496124_0118037 | 3300048927 | Bacteria | 2124 |
| 827 | Ga0496125_0402036 | 3300048928 | Bacteria | 800 |
| 828 | Ga0496126_0512794 | 3300048929 | Bacteria | 957 |
| 829 | Ga0501031_0001473 | 3300049568 | Bacteria | 14623 |
| 830 | Ga0501031_0006569 | 3300049568 | Bacteria | 7589 |
| 831 | Ga0501031_0292848 | 3300049568 | Bacteria | 1055 |
| 832 | Ga0501031_0403576 | 3300049568 | Bacteria | 884 |
| 833 | Ga0501032_0175907 | 3300049569 | Bacteria | 1402 |
| 834 | Ga0501032_0248400 | 3300049569 | Bacteria | 1155 |
| 835 | Ga0501032_0662884 | 3300049569 | Bacteria | 662 |
| 836 | Ga0501033_0015102 | 3300049570 | Bacteria | 5860 |
| 837 | Ga0501033_0045546 | 3300049570 | Bacteria | 3264 |
| 838 | Ga0501036_0005119 | 3300049572 | Bacteria | 10597 |
| 839 | Ga0501036_0269524 | 3300049572 | Bacteria | 1425 |
| 840 | Ga0501036_0424466 | 3300049572 | Bacteria | 1108 |
| 841 | Ga0501036_0565577 | 3300049572 | Unclassified | 944 |
| 842 | Ga0501037_0036644 | 3300049573 | Bacteria | 3614 |
| 843 | Ga0501037_0133862 | 3300049573 | Bacteria | 1776 |
| 844 | Ga0501038_0018052 | 3300049574 | Bacteria | 6373 |
| 845 | Ga0501038_0029451 | 3300049574 | Bacteria | 4864 |
| 846 | Ga0501038_0070139 | 3300049574 | Bacteria | 2976 |
| 847 | Ga0501038_0275907 | 3300049574 | Bacteria | 1324 |
| 848 | Ga0501039_0007983 | 3300049575 | Bacteria | 8064 |
| 849 | Ga0501039_0012794 | 3300049575 | Bacteria | 6414 |
| 850 | Ga0501039_0099563 | 3300049575 | Bacteria | 2268 |
| 851 | Ga0501039_0369702 | 3300049575 | Bacteria | 1126 |
| 852 | Ga0501040_0001208 | 3300049576 | Bacteria | 16453 |
| 853 | Ga0501040_0054526 | 3300049576 | Bacteria | 2740 |
| 854 | Ga0501040_0095196 | 3300049576 | Bacteria | 2072 |
| 855 | Ga0501040_0320034 | 3300049576 | Bacteria | 1109 |
| 856 | Ga0501040_0323348 | 3300049576 | Bacteria | 1103 |
| 857 | Ga0501040_1039554 | 3300049576 | Bacteria | 594 |
| 858 | Ga0501041_0000325 | 3300049577 | Bacteria | 23165 |
| 859 | Ga0501041_0026009 | 3300049577 | Bacteria | 3518 |
| 860 | Ga0501041_0057263 | 3300049577 | Bacteria | 2383 |
| 861 | Ga0501041_0306163 | 3300049577 | Bacteria | 1001 |
| 862 | Ga0501041_0379992 | 3300049577 | Bacteria | 894 |
| 863 | Ga0501042_0003275 | 3300049578 | Bacteria | 10133 |
| 864 | Ga0501042_0018833 | 3300049578 | Bacteria | 4785 |
| 865 | Ga0501042_0380820 | 3300049578 | Bacteria | 1021 |
| 866 | Ga0501043_0021978 | 3300049579 | Bacteria | 5004 |
| 867 | Ga0501043_0374801 | 3300049579 | Bacteria | 1078 |
| 868 | Ga0501046_0000797 | 3300049580 | Bacteria | 30550 |
| 869 | Ga0501046_0024599 | 3300049580 | Bacteria | 4938 |
| 870 | Ga0501046_0128032 | 3300049580 | Bacteria | 1927 |
| 871 | Ga0501047_0034089 | 3300049581 | Bacteria | 4916 |
| 872 | Ga0501048_0000036 | 3300049582 | Bacteria | 64488 |
| 873 | Ga0501048_0007617 | 3300049582 | Bacteria | 8206 |
| 874 | Ga0501048_0010777 | 3300049582 | Bacteria | 6816 |
| 875 | Ga0501048_0056682 | 3300049582 | Bacteria | 2779 |
| 876 | Ga0501067_0243415 | 3300049583 | Bacteria | 1001 |
| 877 | Ga0501067_0316772 | 3300049583 | Bacteria | 869 |
| 878 | Ga0501067_0516524 | 3300049583 | Unclassified | 668 |
| 879 | Ga0501068_0000766 | 3300049584 | Bacteria | 16539 |
| 880 | Ga0501068_0006144 | 3300049584 | Bacteria | 6606 |
| 881 | Ga0501068_0006916 | 3300049584 | Bacteria | 6275 |
| 882 | Ga0501068_0061878 | 3300049584 | Bacteria | 2275 |
| 883 | Ga0501068_0068378 | 3300049584 | Bacteria | 2165 |
| 884 | Ga0501069_0053634 | 3300049585 | Bacteria | 2245 |
| 885 | Ga0501070_0474160 | 3300049586 | Bacteria | 1007 |
| 886 | Ga0501071_0007395 | 3300049587 | Bacteria | 7207 |
| 887 | Ga0501071_0013741 | 3300049587 | Bacteria | 5522 |
| 888 | Ga0501071_0015621 | 3300049587 | Bacteria | 5213 |
| 889 | Ga0501071_0051052 | 3300049587 | Bacteria | 2979 |
| 890 | Ga0501071_0302647 | 3300049587 | Bacteria | 1212 |
| 891 | Ga0501072_0003418 | 3300049588 | Bacteria | 11959 |
| 892 | Ga0501072_0008710 | 3300049588 | Bacteria | 7702 |
| 893 | Ga0501072_0030449 | 3300049588 | Bacteria | 4220 |
| 894 | Ga0501072_0313163 | 3300049588 | Bacteria | 1247 |
| 895 | Ga0501073_0171185 | 3300049589 | Bacteria | 1503 |
| 896 | Ga0501073_0359240 | 3300049589 | Bacteria | 1006 |
| 897 | Ga0501073_0597059 | 3300049589 | Bacteria | 762 |
| 898 | Ga0501074_0000150 | 3300049590 | Bacteria | 36162 |
| 899 | Ga0501074_0013240 | 3300049590 | Bacteria | 5997 |
| 900 | Ga0501074_0020627 | 3300049590 | Bacteria | 4790 |
| 901 | Ga0501074_0021310 | 3300049590 | Bacteria | 4706 |
| 902 | Ga0501074_0571226 | 3300049590 | Bacteria | 800 |
| 903 | Ga0501075_0001381 | 3300049591 | Bacteria | 15784 |
| 904 | Ga0501075_0056996 | 3300049591 | Bacteria | 2941 |
| 905 | Ga0501075_0190484 | 3300049591 | Bacteria | 1564 |
| 906 | Ga0501075_0230449 | 3300049591 | Bacteria | 1412 |
| 907 | Ga0501076_0001172 | 3300049592 | Bacteria | 17362 |
| 908 | Ga0501076_0004230 | 3300049592 | Bacteria | 10157 |
| 909 | Ga0501076_0022415 | 3300049592 | Bacteria | 4854 |
| 910 | Ga0501076_0033773 | 3300049592 | Bacteria | 3995 |
| 911 | Ga0501076_0267969 | 3300049592 | Bacteria | 1398 |
| 912 | Ga0501076_0571377 | 3300049592 | Bacteria | 932 |
| 913 | Ga0501076_0691081 | 3300049592 | Bacteria | 842 |
| 914 | Ga0501077_0001661 | 3300049593 | Bacteria | 13376 |
| 915 | Ga0501077_0020161 | 3300049593 | Bacteria | 4220 |
| 916 | Ga0501077_0025569 | 3300049593 | Bacteria | 3749 |
| 917 | Ga0501077_0391911 | 3300049593 | Bacteria | 887 |
| 918 | Ga0501079_0000484 | 3300049741 | Bacteria | 26174 |
| 919 | Ga0501079_0002866 | 3300049741 | Bacteria | 12579 |
| 920 | Ga0501079_0029292 | 3300049741 | Bacteria | 4227 |
| 921 | Ga0501079_0033079 | 3300049741 | Bacteria | 3976 |
| 922 | Ga0501080_0014998 | 3300049742 | Bacteria | 7137 |
| 923 | Ga0501080_0016052 | 3300049742 | Bacteria | 6911 |
| 924 | Ga0501080_0185757 | 3300049742 | Bacteria | 1911 |
| 925 | Ga0501081_0001297 | 3300049743 | Bacteria | 15225 |
| 926 | Ga0501081_0001718 | 3300049743 | Bacteria | 13595 |
| 927 | Ga0501081_0010006 | 3300049743 | Bacteria | 6184 |
| 928 | Ga0501081_0186675 | 3300049743 | Bacteria | 1500 |
| 929 | Ga0501083_0023285 | 3300049744 | Bacteria | 4297 |
| 930 | Ga0501083_0045121 | 3300049744 | Bacteria | 2982 |
| 931 | Ga0501083_0538079 | 3300049744 | Bacteria | 760 |
| 932 | Ga0501035_0095957 | 3300049822 | Bacteria | 2606 |
| 933 | Ga0501035_0172327 | 3300049822 | Bacteria | 1869 |
| 934 | Ga0501035_0187618 | 3300049822 | Bacteria | 1779 |
| 935 | Ga0501045_0001086 | 3300049824 | Bacteria | 17975 |
| 936 | Ga0501045_0002214 | 3300049824 | Bacteria | 13191 |
| 937 | Ga0501045_0013896 | 3300049824 | Bacteria | 5695 |
| 938 | Ga0501045_0178403 | 3300049824 | Bacteria | 1582 |
| 939 | Ga0501045_1167912 | 3300049824 | Bacteria | 562 |
| 940 | nmdc:mga03n38_412430_c1 | 3300050490 | Bacteria | 745 |
| 941 | nmdc:mga00v17_209835_c1 | 3300050491 | Bacteria | 1260 |
| 942 | nmdc:mga0yw44_308747_c1 | 3300050492 | Bacteria | 1061 |
| 943 | nmdc:mga05p37_126487_c1 | 3300050507 | Bacteria | 3139 |
| 944 | nmdc:mga05p37_1526_c2 | 3300050507 | Bacteria | 4825 |
| 945 | nmdc:mga05p37_19939_c1 | 3300050507 | Bacteria | 8113 |
| 946 | nmdc:mga05p37_288519_c1 | 3300050507 | Bacteria | 1954 |
| 947 | nmdc:mga05p37_5072_c1 | 3300050507 | Bacteria | 15436 |
| 948 | nmdc:mga05p37_755588_c1 | 3300050507 | Bacteria | 1071 |
| 949 | nmdc:mga05p37_906041_c1 | 3300050507 | Bacteria | 950 |
| 950 | nmdc:mga09592_10687_c1 | 3300050508 | Bacteria | 7472 |
| 951 | nmdc:mga09592_12562_c1 | 3300050508 | Bacteria | 6900 |
| 952 | nmdc:mga09592_147271_c1 | 3300050508 | Bacteria | 2030 |
| 953 | nmdc:mga09592_23642_c1 | 3300050508 | Bacteria | 5076 |
| 954 | nmdc:mga09592_69089_c1 | 3300050508 | Bacteria | 2997 |
| 955 | nmdc:mga0qj67_12451_c1 | 3300050509 | Bacteria | 6407 |
| 956 | nmdc:mga0qj67_215072_c1 | 3300050509 | Bacteria | 1561 |
| 957 | nmdc:mga0qj67_256849_c1 | 3300050509 | Bacteria | 1418 |
| 958 | nmdc:mga0qj67_682_c1 | 3300050509 | Bacteria | 23124 |
| 959 | nmdc:mga0qj67_79852_c1 | 3300050509 | Bacteria | 2620 |
| 960 | nmdc:mga0qj67_8890_c1 | 3300050509 | Bacteria | 7452 |
| 961 | nmdc:mga06r32_1013178_c1 | 3300050510 | Bacteria | 783 |
| 962 | nmdc:mga06r32_101792_c1 | 3300050510 | Bacteria | 2819 |
| 963 | nmdc:mga06r32_1033851_c1 | 3300050510 | Unclassified | 773 |
| 964 | nmdc:mga06r32_1159967_c1 | 3300050510 | Bacteria | 720 |
| 965 | nmdc:mga06r32_121285_c1 | 3300050510 | Bacteria | 2579 |
| 966 | nmdc:mga06r32_17560_c1 | 3300050510 | Bacteria | 6533 |
| 967 | nmdc:mga06r32_270066_c1 | 3300050510 | Bacteria | 1688 |
| 968 | nmdc:mga06r32_47948_c1 | 3300050510 | Bacteria | 4083 |
| 969 | nmdc:mga06r32_513974_c1 | 3300050510 | Bacteria | 1174 |
| 970 | nmdc:mga06r32_529362_c1 | 3300050510 | Bacteria | 1154 |
| 971 | nmdc:mga06r32_8661_c1 | 3300050510 | Bacteria | 9168 |
| 972 | nmdc:mga08y16_183889_c1 | 3300050511 | Bacteria | 2169 |
| 973 | nmdc:mga08y16_71787_c1 | 3300050511 | Bacteria | 3608 |
| 974 | nmdc:mga08y16_860166_c1 | 3300050511 | Bacteria | 895 |
| 975 | nmdc:mga0n895_107760_c1 | 3300050512 | Bacteria | 2800 |
| 976 | nmdc:mga0n895_285588_c1 | 3300050512 | Bacteria | 1673 |
| 977 | nmdc:mga0rr50_345043_c1 | 3300050513 | Bacteria | 1251 |
| 978 | Ga0495601_0021975 | 3300053077 | Bacteria | 3913 |
| 979 | Ga0495619_0030537 | 3300053085 | Bacteria | 3489 |
| 980 | Ga0495619_0032124 | 3300053085 | Bacteria | 3405 |
| 981 | Ga0500573_0432977 | 3300053140 | Unclassified | 613 |
| 982 | Ga0500624_066243 | 3300053157 | Unclassified | 699 |
| 983 | Ga0501084_0000305 | 3300054114 | Bacteria | 37251 |
| 984 | Ga0501084_0226242 | 3300054114 | Bacteria | 1578 |
| 985 | Ga0501084_0364084 | 3300054114 | Bacteria | 1222 |
| 986 | Ga0501084_0438989 | 3300054114 | Bacteria | 1103 |
| 987 | Ga0501084_0590748 | 3300054114 | Bacteria | 938 |
| 988 | Ga0501084_0817489 | 3300054114 | Bacteria | 785 |
| 989 | Ga0590071_009882 | 3300059421 | Bacteria | 2237 |
| 990 | Ga0590074_003839 | 3300059423 | Bacteria | 2490 |
| 991 | Ga0590075_001480 | 3300059424 | Bacteria | 5863 |
| 992 | Ga0590077_033627 | 3300059426 | Bacteria | 1125 |
| 993 | Ga0501082_0000727 | 3300060353 | Bacteria | 29005 |
| 994 | Ga0501082_0018363 | 3300060353 | Bacteria | 6023 |
| 995 | Ga0501082_0019758 | 3300060353 | Bacteria | 5810 |
| 996 | Ga0501082_0043028 | 3300060353 | Bacteria | 3893 |
| 997 | Ga0501082_0123879 | 3300060353 | Bacteria | 2241 |
| 998 | Ga0501082_0226125 | 3300060353 | Bacteria | 1628 |
| 999 | Ga0501082_0257680 | 3300060353 | Bacteria | 1517 |
| 1000 | Ga0466962_0211267 | 3300061719 | Bacteria | 949 |
| 1001 | Ga0530510_0002334 | 3300061734 | Bacteria | 13021 |
| 1002 | Ga0530510_0057210 | 3300061734 | Bacteria | 2817 |
| 1003 | Ga0530510_0087182 | 3300061734 | Bacteria | 2275 |
| 1004 | Ga0530510_0379047 | 3300061734 | Bacteria | 1064 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10064994 | Ga0081538_100649943 | 133 |
| 2 | 3300009148 | Ga0105243_10749142 | Ga0105243_107491421 | 136 |
| 3 | 3300046462 | Ga0495651_0044088 | Ga0495651_0044088_2029_2514 | 137 |
| 4 | 3300046463 | Ga0495653_0097888 | Ga0495653_0097888_1361_1846 | 137 |
| 5 | 3300046472 | Ga0495580_0021154 | Ga0495580_0021154_2378_2863 | 137 |
| 6 | 3300046476 | Ga0495662_0025272 | Ga0495662_0025272_1654_2139 | 137 |
| 7 | 3300046477 | Ga0495664_0073997 | Ga0495664_0073997_1081_1566 | 137 |
| 8 | 3300046511 | Ga0495608_0044868 | Ga0495608_0044868_1326_1811 | 137 |
| 9 | 3300046517 | Ga0495630_0133541 | Ga0495630_0133541_479_964 | 137 |
| 10 | 3300046526 | Ga0495666_0000798 | Ga0495666_0000798_1349_1834 | 137 |
| 11 | 3300046529 | Ga0495652_0105011 | Ga0495652_0105011_855_1340 | 137 |
| 12 | 3300046533 | Ga0495640_0020058 | Ga0495640_0020058_2726_3211 | 137 |
| 13 | 3300046535 | Ga0495586_0029272 | Ga0495586_0029272_694_1179 | 137 |
| 14 | 3300046536 | Ga0495587_0005692 | Ga0495587_0005692_205_690 | 137 |
| 15 | 3300046543 | Ga0495645_0062774 | Ga0495645_0062774_1068_1553 | 137 |
| 16 | 3300046559 | Ga0495667_0200964 | Ga0495667_0200964_440_925 | 137 |
| 17 | 3300046642 | Ga0495634_0042531 | Ga0495634_0042531_1242_1727 | 137 |
| 18 | 3300046663 | Ga0495635_0077088 | Ga0495635_0077088_944_1429 | 137 |
| 19 | 3300046675 | Ga0495657_0010805 | Ga0495657_0010805_158_643 | 137 |
| 20 | 3300046678 | Ga0495599_0233927 | Ga0495599_0233927_286_771 | 137 |
| 21 | 3300046679 | Ga0495623_0046457 | Ga0495623_0046457_1327_1812 | 137 |
| 22 | 3300046680 | Ga0495646_0012623 | Ga0495646_0012623_4598_5083 | 137 |
| 23 | 3300046689 | Ga0495613_0245919 | Ga0495613_0245919_479_964 | 137 |
| 24 | 3300046809 | Ga0495600_0116295 | Ga0495600_0116295_312_797 | 137 |
| 25 | 3300047317 | Ga0495604_0001127 | Ga0495604_0001127_17811_18296 | 137 |
| 26 | 3300047444 | Ga0495675_0121623 | Ga0495675_0121623_351_836 | 137 |
| 27 | 3300047471 | Ga0495684_0176382 | Ga0495684_0176382_944_1429 | 137 |
| 28 | 3300047673 | Ga0495593_0037005 | Ga0495593_0037005_286_771 | 137 |
| 29 | 3300048088 | Ga0495602_0031985 | Ga0495602_0031985_1238_1723 | 137 |
| 30 | 3300053077 | Ga0495601_0021975 | Ga0495601_0021975_1110_1595 | 137 |
| 31 | 3300053085 | Ga0495619_0032124 | Ga0495619_0032124_369_854 | 137 |
| 32 | 3300053140 | Ga0500573_0432977 | Ga0500573_0432977_86_571 | 137 |
| 33 | 3300053157 | Ga0500624_066243 | Ga0500624_066243_112_597 | 137 |
| 34 | 3300006846 | Ga0075430_100046260 | Ga0075430_1000462603 | 138 |
| 35 | 3300006880 | Ga0075429_100153414 | Ga0075429_1001534142 | 138 |
| 36 | 3300050508 | nmdc:mga09592_147271_c1 | nmdc:mga09592_147271_c1_482_985 | 138 |
| 37 | 3300050509 | nmdc:mga0qj67_12451_c1 | nmdc:mga0qj67_12451_c1_2144_2647 | 138 |
| 38 | 3300005937 | Ga0081455_10253055 | Ga0081455_102530552 | 139 |
| 39 | 3300037418 | Ga0395900_0100100 | Ga0395900_0100100_1972_2427 | 141 |
| 40 | 3300061719 | Ga0466962_0211267 | Ga0466962_0211267_80_577 | 142 |
| 41 | 3300009147 | Ga0114129_10228966 | Ga0114129_102289662 | 143 |
| 42 | 3300050508 | nmdc:mga09592_23642_c1 | nmdc:mga09592_23642_c1_3383_3883 | 143 |
| 43 | 3300050509 | nmdc:mga0qj67_256849_c1 | nmdc:mga0qj67_256849_c1_81_581 | 143 |
| 44 | 3300050510 | nmdc:mga06r32_47948_c1 | nmdc:mga06r32_47948_c1_3214_3714 | 143 |
| 45 | 3300005981 | Ga0081538_10005194 | Ga0081538_100051948 | 144 |
| 46 | 3300014325 | Ga0163163_10964860 | Ga0163163_109648601 | 144 |
| 47 | 3300025901 | Ga0207688_10030283 | Ga0207688_100302832 | 144 |
| 48 | 3300026116 | Ga0207674_11062369 | Ga0207674_110623692 | 144 |
| 49 | 3300050511 | nmdc:mga08y16_860166_c1 | nmdc:mga08y16_860166_c1_356_835 | 144 |
| 50 | 3300009094 | Ga0111539_11853150 | Ga0111539_118531501 | 145 |
| 51 | 3300042005 | Ga0439448_0000638 | Ga0439448_0000638_3095_3589 | 145 |
| 52 | 3300042005 | Ga0439448_0075642 | Ga0439448_0075642_572_1060 | 145 |
| 53 | 3300042008 | Ga0439450_003970 | Ga0439450_003970_1816_2310 | 145 |
| 54 | 3300042009 | Ga0439451_028332 | Ga0439451_028332_489_983 | 145 |
| 55 | 3300042012 | Ga0439455_0065293 | Ga0439455_0065293_244_738 | 145 |
| 56 | 3300042016 | Ga0439463_000138 | Ga0439463_000138_128_622 | 145 |
| 57 | 3300042118 | Ga0450914_005594 | Ga0450914_005594_161_655 | 145 |
| 58 | 3300042136 | Ga0450900_005689 | Ga0450900_005689_844_1338 | 145 |
| 59 | 3300042137 | Ga0450902_030115 | Ga0450902_030115_321_815 | 145 |
| 60 | 3300042139 | Ga0450904_003174 | Ga0450904_003174_876_1370 | 145 |
| 61 | 3300042144 | Ga0450889_002415 | Ga0450889_002415_1191_1685 | 145 |
| 62 | 3300042437 | Ga0439444_0000198 | Ga0439444_0000198_2994_3488 | 145 |
| 63 | 3300042439 | Ga0439464_0000722 | Ga0439464_0000722_4245_4739 | 145 |
| 64 | 3300042461 | Ga0439460_0003898 | Ga0439460_0003898_2295_2789 | 145 |
| 65 | 3300042530 | Ga0450916_001215 | Ga0450916_001215_64_558 | 145 |
| 66 | 3300042993 | Ga0439440_0000034 | Ga0439440_0000034_2617_3111 | 145 |
| 67 | 3300044694 | Ga0466963_0084521 | Ga0466963_0084521_1587_2084 | 145 |
| 68 | 3300044706 | Ga0466964_0071603 | Ga0466964_0071603_430_927 | 145 |
| 69 | 3300045049 | Ga0466959_0401799 | Ga0466959_0401799_306_803 | 145 |
| 70 | 3300045976 | Ga0466967_0213264 | Ga0466967_0213264_623_1120 | 145 |
| 71 | 3300005435 | Ga0070714_100141685 | Ga0070714_1001416852 | 146 |
| 72 | 3300005937 | Ga0081455_10010331 | Ga0081455_100103315 | 146 |
| 73 | 3300031852 | Ga0307410_11133093 | Ga0307410_111330932 | 146 |
| 74 | 3300031995 | Ga0307409_100239054 | Ga0307409_1002390543 | 146 |
| 75 | 3300032126 | Ga0307415_100707410 | Ga0307415_1007074102 | 146 |
| 76 | 3300006847 | Ga0075431_100251724 | Ga0075431_1002517243 | 147 |
| 77 | 3300013307 | Ga0157372_10000044 | Ga0157372_1000004493 | 147 |
| 78 | 3300031731 | Ga0307405_10146058 | Ga0307405_101460582 | 147 |
| 79 | 3300031824 | Ga0307413_10623271 | Ga0307413_106232712 | 147 |
| 80 | 3300031852 | Ga0307410_10102890 | Ga0307410_101028903 | 147 |
| 81 | 3300031903 | Ga0307407_10262193 | Ga0307407_102621932 | 147 |
| 82 | 3300031995 | Ga0307409_100045072 | Ga0307409_1000450724 | 147 |
| 83 | 3300032126 | Ga0307415_100051927 | Ga0307415_1000519272 | 147 |
| 84 | 3300032126 | Ga0307415_102047336 | Ga0307415_1020473361 | 147 |
| 85 | 3300047321 | Ga0495676_0390601 | Ga0495676_0390601_298_801 | 147 |
| 86 | 3300005437 | Ga0070710_10085349 | Ga0070710_100853492 | 148 |
| 87 | 3300025898 | Ga0207692_10113928 | Ga0207692_101139282 | 148 |
| 88 | 3300044694 | Ga0466963_0593965 | Ga0466963_0593965_190_675 | 148 |
| 89 | 3300046794 | Ga0495589_0587703 | Ga0495589_0587703_47_493 | 148 |
| 90 | 3300037466 | Ga0395898_0137269 | Ga0395898_0137269_1779_2282 | 149 |
| 91 | 3300006844 | Ga0075428_100031225 | Ga0075428_1000312251 | 150 |
| 92 | 3300006846 | Ga0075430_100012632 | Ga0075430_1000126328 | 150 |
| 93 | 3300006847 | Ga0075431_100156012 | Ga0075431_1001560122 | 150 |
| 94 | 3300006880 | Ga0075429_100007437 | Ga0075429_1000074379 | 150 |
| 95 | 3300049584 | Ga0501068_0061878 | Ga0501068_0061878_336_824 | 150 |
| 96 | 3300009147 | Ga0114129_10259684 | Ga0114129_102596842 | 151 |
| 97 | 3300041407 | Ga0439447_150276 | Ga0439447_150276_53_508 | 151 |
| 98 | 3300042156 | Ga0439446_0000936 | Ga0439446_0000936_2446_2901 | 151 |
| 99 | 3300049583 | Ga0501067_0516524 | Ga0501067_0516524_144_638 | 151 |
| 100 | 3300050507 | nmdc:mga05p37_288519_c1 | nmdc:mga05p37_288519_c1_646_1134 | 151 |
| 101 | 3300002459 | JGI24751J29686_10014242 | JGI24751J29686_100142421 | 152 |
| 102 | 3300005331 | Ga0070670_100019042 | Ga0070670_1000190428 | 152 |
| 103 | 3300005341 | Ga0070691_10529219 | Ga0070691_105292191 | 152 |
| 104 | 3300005577 | Ga0068857_100048398 | Ga0068857_1000483982 | 152 |
| 105 | 3300005840 | Ga0068870_10013058 | Ga0068870_100130582 | 152 |
| 106 | 3300006358 | Ga0068871_100111604 | Ga0068871_1001116042 | 152 |
| 107 | 3300006844 | Ga0075428_100037399 | Ga0075428_1000373992 | 152 |
| 108 | 3300006847 | Ga0075431_100664114 | Ga0075431_1006641142 | 152 |
| 109 | 3300009147 | Ga0114129_10029537 | Ga0114129_1002953710 | 152 |
| 110 | 3300009147 | Ga0114129_10132970 | Ga0114129_101329703 | 152 |
| 111 | 3300011119 | Ga0105246_10299589 | Ga0105246_102995892 | 152 |
| 112 | 3300025908 | Ga0207643_10038160 | Ga0207643_100381605 | 152 |
| 113 | 3300025925 | Ga0207650_10001896 | Ga0207650_1000189612 | 152 |
| 114 | 3300026075 | Ga0207708_10843214 | Ga0207708_108432142 | 152 |
| 115 | 3300026089 | Ga0207648_10720867 | Ga0207648_107208672 | 152 |
| 116 | 3300037418 | Ga0395900_1154486 | Ga0395900_1154486_166_660 | 152 |
| 117 | 3300049591 | Ga0501075_0190484 | Ga0501075_0190484_13_501 | 152 |
| 118 | 3300050507 | nmdc:mga05p37_19939_c1 | nmdc:mga05p37_19939_c1_4554_5087 | 152 |
| 119 | 3300050510 | nmdc:mga06r32_513974_c1 | nmdc:mga06r32_513974_c1_332_826 | 152 |
| 120 | 3300050510 | nmdc:mga06r32_8661_c1 | nmdc:mga06r32_8661_c1_8501_9013 | 152 |
| 121 | 3300050511 | nmdc:mga08y16_183889_c1 | nmdc:mga08y16_183889_c1_522_1016 | 152 |
| 122 | 3300003373 | JGI25407J50210_10071649 | JGI25407J50210_100716492 | 153 |
| 123 | 3300005338 | Ga0068868_100388001 | Ga0068868_1003880011 | 153 |
| 124 | 3300005347 | Ga0070668_101517915 | Ga0070668_1015179151 | 153 |
| 125 | 3300005459 | Ga0068867_100245453 | Ga0068867_1002454532 | 153 |
| 126 | 3300005466 | Ga0070685_10417112 | Ga0070685_104171122 | 153 |
| 127 | 3300005981 | Ga0081538_10037456 | Ga0081538_100374564 | 153 |
| 128 | 3300006237 | Ga0097621_100676068 | Ga0097621_1006760683 | 153 |
| 129 | 3300009098 | Ga0105245_10213229 | Ga0105245_102132292 | 153 |
| 130 | 3300013308 | Ga0157375_10055648 | Ga0157375_100556487 | 153 |
| 131 | 3300014325 | Ga0163163_10959857 | Ga0163163_109598572 | 153 |
| 132 | 3300025927 | Ga0207687_10688647 | Ga0207687_106886471 | 153 |
| 133 | 3300025934 | Ga0207686_10263006 | Ga0207686_102630061 | 153 |
| 134 | 3300025937 | Ga0207669_11361251 | Ga0207669_113612511 | 153 |
| 135 | 3300025938 | Ga0207704_10814641 | Ga0207704_108146411 | 153 |
| 136 | 3300026116 | Ga0207674_10056049 | Ga0207674_100560493 | 153 |
| 137 | 3300037471 | Ga0395905_0769759 | Ga0395905_0769759_207_674 | 153 |
| 138 | 3300038443 | Ga0395901_0760556 | Ga0395901_0760556_300_803 | 153 |
| 139 | 3300042014 | Ga0439457_108745 | Ga0439457_108745_167_631 | 153 |
| 140 | 3300049590 | Ga0501074_0571226 | Ga0501074_0571226_258_788 | 153 |
| 141 | 3300049592 | Ga0501076_0571377 | Ga0501076_0571377_242_772 | 153 |
| 142 | 3300050507 | nmdc:mga05p37_755588_c1 | nmdc:mga05p37_755588_c1_370_864 | 153 |
| 143 | iso_pu_bacteria | 2870782633 | 2870789165 | 153 |
| 144 | 3300005329 | Ga0070683_100026791 | Ga0070683_1000267919 | 154 |
| 145 | 3300005331 | Ga0070670_100029292 | Ga0070670_1000292928 | 154 |
| 146 | 3300005335 | Ga0070666_10978875 | Ga0070666_109788751 | 154 |
| 147 | 3300005337 | Ga0070682_100150433 | Ga0070682_1001504333 | 154 |
| 148 | 3300005338 | Ga0068868_100139016 | Ga0068868_1001390163 | 154 |
| 149 | 3300005340 | Ga0070689_100043594 | Ga0070689_1000435947 | 154 |
| 150 | 3300005354 | Ga0070675_100089648 | Ga0070675_1000896483 | 154 |
| 151 | 3300005355 | Ga0070671_100017320 | Ga0070671_1000173201 | 154 |
| 152 | 3300005356 | Ga0070674_100145522 | Ga0070674_1001455222 | 154 |
| 153 | 3300005364 | Ga0070673_100258781 | Ga0070673_1002587812 | 154 |
| 154 | 3300005365 | Ga0070688_100010786 | Ga0070688_1000107868 | 154 |
| 155 | 3300005366 | Ga0070659_100180622 | Ga0070659_1001806221 | 154 |
| 156 | 3300005367 | Ga0070667_100860646 | Ga0070667_1008606461 | 154 |
| 157 | 3300005441 | Ga0070700_100474011 | Ga0070700_1004740112 | 154 |
| 158 | 3300005455 | Ga0070663_100279542 | Ga0070663_1002795423 | 154 |
| 159 | 3300005459 | Ga0068867_100217531 | Ga0068867_1002175313 | 154 |
| 160 | 3300005466 | Ga0070685_10001824 | Ga0070685_1000182410 | 154 |
| 161 | 3300005535 | Ga0070684_100098866 | Ga0070684_1000988662 | 154 |
| 162 | 3300005543 | Ga0070672_100156526 | Ga0070672_1001565262 | 154 |
| 163 | 3300005544 | Ga0070686_100177881 | Ga0070686_1001778811 | 154 |
| 164 | 3300005545 | Ga0070695_100686036 | Ga0070695_1006860362 | 154 |
| 165 | 3300005548 | Ga0070665_100010077 | Ga0070665_10001007712 | 154 |
| 166 | 3300005549 | Ga0070704_100061756 | Ga0070704_1000617562 | 154 |
| 167 | 3300005564 | Ga0070664_100398876 | Ga0070664_1003988762 | 154 |
| 168 | 3300005617 | Ga0068859_100187945 | Ga0068859_1001879452 | 154 |
| 169 | 3300005618 | Ga0068864_100031233 | Ga0068864_1000312333 | 154 |
| 170 | 3300005718 | Ga0068866_10687073 | Ga0068866_106870731 | 154 |
| 171 | 3300005719 | Ga0068861_100129398 | Ga0068861_1001293982 | 154 |
| 172 | 3300005840 | Ga0068870_10071825 | Ga0068870_100718254 | 154 |
| 173 | 3300005842 | Ga0068858_100457092 | Ga0068858_1004570922 | 154 |
| 174 | 3300006237 | Ga0097621_100275461 | Ga0097621_1002754612 | 154 |
| 175 | 3300006846 | Ga0075430_100020823 | Ga0075430_1000208232 | 154 |
| 176 | 3300006881 | Ga0068865_100383659 | Ga0068865_1003836591 | 154 |
| 177 | 3300006931 | Ga0097620_100187940 | Ga0097620_1001879402 | 154 |
| 178 | 3300009098 | Ga0105245_10062343 | Ga0105245_100623434 | 154 |
| 179 | 3300009098 | Ga0105245_10880896 | Ga0105245_108808962 | 154 |
| 180 | 3300009148 | Ga0105243_10050894 | Ga0105243_100508943 | 154 |
| 181 | 3300009176 | Ga0105242_10046650 | Ga0105242_100466507 | 154 |
| 182 | 3300009177 | Ga0105248_10384003 | Ga0105248_103840033 | 154 |
| 183 | 3300011119 | Ga0105246_10008465 | Ga0105246_100084659 | 154 |
| 184 | 3300011119 | Ga0105246_10239241 | Ga0105246_102392412 | 154 |
| 185 | 3300013296 | Ga0157374_10200014 | Ga0157374_102000141 | 154 |
| 186 | 3300013297 | Ga0157378_10073432 | Ga0157378_100734324 | 154 |
| 187 | 3300013306 | Ga0163162_10478743 | Ga0163162_104787433 | 154 |
| 188 | 3300013307 | Ga0157372_10654395 | Ga0157372_106543952 | 154 |
| 189 | 3300014326 | Ga0157380_10048637 | Ga0157380_100486374 | 154 |
| 190 | 3300014745 | Ga0157377_10002176 | Ga0157377_1000217610 | 154 |
| 191 | 3300014969 | Ga0157376_10656357 | Ga0157376_106563571 | 154 |
| 192 | 3300025901 | Ga0207688_10001062 | Ga0207688_100010627 | 154 |
| 193 | 3300025908 | Ga0207643_10343757 | Ga0207643_103437571 | 154 |
| 194 | 3300025923 | Ga0207681_10430321 | Ga0207681_104303211 | 154 |
| 195 | 3300025927 | Ga0207687_10105522 | Ga0207687_101055222 | 154 |
| 196 | 3300025938 | Ga0207704_11249173 | Ga0207704_112491731 | 154 |
| 197 | 3300025940 | Ga0207691_10044054 | Ga0207691_100440547 | 154 |
| 198 | 3300025941 | Ga0207711_10550662 | Ga0207711_105506622 | 154 |
| 199 | 3300025960 | Ga0207651_10074966 | Ga0207651_100749661 | 154 |
| 200 | 3300026023 | Ga0207677_10697802 | Ga0207677_106978021 | 154 |
| 201 | 3300026075 | Ga0207708_10553482 | Ga0207708_105534821 | 154 |
| 202 | 3300026089 | Ga0207648_10010765 | Ga0207648_1001076512 | 154 |
| 203 | 3300026095 | Ga0207676_10085256 | Ga0207676_100852564 | 154 |
| 204 | 3300026118 | Ga0207675_100093033 | Ga0207675_1000930334 | 154 |
| 205 | 3300026118 | Ga0207675_101005988 | Ga0207675_1010059881 | 154 |
| 206 | 3300026121 | Ga0207683_10018999 | Ga0207683_100189991 | 154 |
| 207 | 3300028379 | Ga0268266_10699066 | Ga0268266_106990662 | 154 |
| 208 | 3300035207 | Ga0373942_0352692 | Ga0373942_0352692_16_480 | 154 |
| 209 | 3300037853 | Ga0436364_0911004 | Ga0436364_0911004_421_894 | 154 |
| 210 | 3300041463 | Ga0451804_0061489 | Ga0451804_0061489_69_533 | 154 |
| 211 | 3300044735 | Ga0466968_0199385 | Ga0466968_0199385_305_805 | 154 |
| 212 | 3300048912 | Ga0496109_0023202 | Ga0496109_0023202_390_884 | 154 |
| 213 | 3300048913 | Ga0496110_0888893 | Ga0496110_0888893_95_559 | 154 |
| 214 | 3300048914 | Ga0496111_0529795 | Ga0496111_0529795_110_604 | 154 |
| 215 | 3300049574 | Ga0501038_0029451 | Ga0501038_0029451_4103_4573 | 154 |
| 216 | 3300049585 | Ga0501069_0053634 | Ga0501069_0053634_1587_2057 | 154 |
| 217 | 3300049593 | Ga0501077_0391911 | Ga0501077_0391911_145_615 | 154 |
| 218 | 3300005337 | Ga0070682_100585332 | Ga0070682_1005853322 | 155 |
| 219 | 3300005345 | Ga0070692_10290043 | Ga0070692_102900432 | 155 |
| 220 | 3300005615 | Ga0070702_100201556 | Ga0070702_1002015562 | 155 |
| 221 | 3300005985 | Ga0081539_10004479 | Ga0081539_1000447912 | 155 |
| 222 | 3300006038 | Ga0075365_10291808 | Ga0075365_102918082 | 155 |
| 223 | 3300009094 | Ga0111539_10142030 | Ga0111539_101420306 | 155 |
| 224 | 3300009098 | Ga0105245_10097378 | Ga0105245_100973781 | 155 |
| 225 | 3300014326 | Ga0157380_10098071 | Ga0157380_100980712 | 155 |
| 226 | 3300014326 | Ga0157380_10344463 | Ga0157380_103444633 | 155 |
| 227 | 3300025927 | Ga0207687_10792171 | Ga0207687_107921712 | 155 |
| 228 | 3300037853 | Ga0436364_0143458 | Ga0436364_0143458_384_872 | 155 |
| 229 | 3300045051 | Ga0451576_0029001 | Ga0451576_0029001_4192_4662 | 155 |
| 230 | 3300049576 | Ga0501040_1039554 | Ga0501040_1039554_96_569 | 155 |
| 231 | 3300050512 | nmdc:mga0n895_285588_c1 | nmdc:mga0n895_285588_c1_703_1173 | 155 |
| 232 | 3300031731 | Ga0307405_10020279 | Ga0307405_100202794 | 156 |
| 233 | 3300044694 | Ga0466963_0034613 | Ga0466963_0034613_1932_2408 | 156 |
| 234 | 3300045976 | Ga0466967_0361282 | Ga0466967_0361282_185_661 | 156 |
| 235 | 3300048915 | Ga0496112_0698845 | Ga0496112_0698845_271_744 | 156 |
| 236 | 3300048916 | Ga0496113_0590657 | Ga0496113_0590657_266_739 | 156 |
| 237 | 3300005327 | Ga0070658_10341023 | Ga0070658_103410232 | 157 |
| 238 | 3300005439 | Ga0070711_100543271 | Ga0070711_1005432712 | 157 |
| 239 | 3300005445 | Ga0070708_100000004 | Ga0070708_10000000444 | 157 |
| 240 | 3300005467 | Ga0070706_100095094 | Ga0070706_1000950943 | 157 |
| 241 | 3300005468 | Ga0070707_100112202 | Ga0070707_1001122024 | 157 |
| 242 | 3300005564 | Ga0070664_100213661 | Ga0070664_1002136611 | 157 |
| 243 | 3300005719 | Ga0068861_100754414 | Ga0068861_1007544142 | 157 |
| 244 | 3300006844 | Ga0075428_100030501 | Ga0075428_1000305013 | 157 |
| 245 | 3300006847 | Ga0075431_101246906 | Ga0075431_1012469062 | 157 |
| 246 | 3300006852 | Ga0075433_10105815 | Ga0075433_101058156 | 157 |
| 247 | 3300006871 | Ga0075434_100021747 | Ga0075434_1000217477 | 157 |
| 248 | 3300006880 | Ga0075429_100074312 | Ga0075429_1000743127 | 157 |
| 249 | 3300009147 | Ga0114129_10000558 | Ga0114129_1000055822 | 157 |
| 250 | 3300009147 | Ga0114129_10008295 | Ga0114129_100082959 | 157 |
| 251 | 3300009551 | Ga0105238_10812284 | Ga0105238_108122841 | 157 |
| 252 | 3300025910 | Ga0207684_10080635 | Ga0207684_100806353 | 157 |
| 253 | 3300025922 | Ga0207646_10731728 | Ga0207646_107317282 | 157 |
| 254 | 3300026118 | Ga0207675_100774065 | Ga0207675_1007740652 | 157 |
| 255 | 3300045976 | Ga0466967_1450103 | Ga0466967_1450103_138_611 | 157 |
| 256 | 3300046477 | Ga0495664_0283595 | Ga0495664_0283595_500_988 | 157 |
| 257 | 3300046535 | Ga0495586_0034843 | Ga0495586_0034843_1255_1743 | 157 |
| 258 | 3300050507 | nmdc:mga05p37_1526_c2 | nmdc:mga05p37_1526_c2_128_622 | 157 |
| 259 | 3300050508 | nmdc:mga09592_69089_c1 | nmdc:mga09592_69089_c1_2420_2908 | 157 |
| 260 | 3300050510 | nmdc:mga06r32_1159967_c1 | nmdc:mga06r32_1159967_c1_55_543 | 157 |
| 261 | 3300050512 | nmdc:mga0n895_107760_c1 | nmdc:mga0n895_107760_c1_1547_2035 | 157 |
| 262 | 3300005937 | Ga0081455_10033792 | Ga0081455_100337924 | 158 |
| 263 | 3300006844 | Ga0075428_100011261 | Ga0075428_1000112616 | 158 |
| 264 | 3300006846 | Ga0075430_100065973 | Ga0075430_1000659733 | 158 |
| 265 | 3300031852 | Ga0307410_10093012 | Ga0307410_100930122 | 158 |
| 266 | 3300031901 | Ga0307406_10035066 | Ga0307406_100350663 | 158 |
| 267 | 3300031995 | Ga0307409_100519116 | Ga0307409_1005191162 | 158 |
| 268 | 3300031995 | Ga0307409_101676653 | Ga0307409_1016766531 | 158 |
| 269 | 3300032002 | Ga0307416_100308578 | Ga0307416_1003085783 | 158 |
| 270 | 3300032005 | Ga0307411_11406160 | Ga0307411_114061601 | 158 |
| 271 | 3300032126 | Ga0307415_100139539 | Ga0307415_1001395392 | 158 |
| 272 | 3300032126 | Ga0307415_100257601 | Ga0307415_1002576012 | 158 |
| 273 | 3300032126 | Ga0307415_100260585 | Ga0307415_1002605853 | 158 |
| 274 | 3300042016 | Ga0439463_020750 | Ga0439463_020750_50_532 | 158 |
| 275 | 3300042530 | Ga0450916_003373 | Ga0450916_003373_61_543 | 158 |
| 276 | 3300048907 | Ga0496104_0111596 | Ga0496104_0111596_259_735 | 158 |
| 277 | 3300048911 | Ga0496108_1019163 | Ga0496108_1019163_176_652 | 158 |
| 278 | 3300048915 | Ga0496112_0055459 | Ga0496112_0055459_2885_3361 | 158 |
| 279 | 3300049583 | Ga0501067_0243415 | Ga0501067_0243415_208_684 | 158 |
| 280 | 3300050509 | nmdc:mga0qj67_79852_c1 | nmdc:mga0qj67_79852_c1_1013_1489 | 158 |
| 281 | 3300050510 | nmdc:mga06r32_1033851_c1 | nmdc:mga06r32_1033851_c1_194_673 | 158 |
| 282 | 3300005539 | Ga0068853_100451004 | Ga0068853_1004510042 | 159 |
| 283 | 3300005577 | Ga0068857_100875854 | Ga0068857_1008758542 | 159 |
| 284 | 3300005937 | Ga0081455_10435948 | Ga0081455_104359482 | 159 |
| 285 | 3300006038 | Ga0075365_10094395 | Ga0075365_100943953 | 159 |
| 286 | 3300006051 | Ga0075364_10104373 | Ga0075364_101043732 | 159 |
| 287 | 3300010375 | Ga0105239_10006994 | Ga0105239_100069945 | 159 |
| 288 | 3300013104 | Ga0157370_10201730 | Ga0157370_102017303 | 159 |
| 289 | 3300013297 | Ga0157378_10232654 | Ga0157378_102326542 | 159 |
| 290 | 3300013307 | Ga0157372_10743521 | Ga0157372_107435212 | 159 |
| 291 | 3300026041 | Ga0207639_10266393 | Ga0207639_102663932 | 159 |
| 292 | 3300031911 | Ga0307412_11330258 | Ga0307412_113302582 | 159 |
| 293 | 3300048913 | Ga0496110_0333080 | Ga0496110_0333080_540_1019 | 159 |
| 294 | 3300048915 | Ga0496112_0626369 | Ga0496112_0626369_462_941 | 159 |
| 295 | 3300048927 | Ga0496124_0118037 | Ga0496124_0118037_149_628 | 159 |
| 296 | 3300048928 | Ga0496125_0402036 | Ga0496125_0402036_113_592 | 159 |
| 297 | iso_pu_bacteria | 2899359706 | 2899367525 | 159 |
| 298 | 3300005436 | Ga0070713_100345077 | Ga0070713_1003450773 | 160 |
| 299 | 3300005467 | Ga0070706_100030463 | Ga0070706_1000304636 | 160 |
| 300 | 3300005937 | Ga0081455_10801988 | Ga0081455_108019881 | 160 |
| 301 | 3300005981 | Ga0081538_10000080 | Ga0081538_1000008060 | 160 |
| 302 | 3300005983 | Ga0081540_1089780 | Ga0081540_10897802 | 160 |
| 303 | 3300005985 | Ga0081539_10004373 | Ga0081539_1000437312 | 160 |
| 304 | 3300005985 | Ga0081539_10004534 | Ga0081539_1000453411 | 160 |
| 305 | 3300006028 | Ga0070717_10026595 | Ga0070717_100265953 | 160 |
| 306 | 3300006028 | Ga0070717_10416523 | Ga0070717_104165232 | 160 |
| 307 | 3300021384 | Ga0213876_10429575 | Ga0213876_104295751 | 160 |
| 308 | 3300025910 | Ga0207684_10025581 | Ga0207684_100255812 | 160 |
| 309 | 3300025928 | Ga0207700_10291486 | Ga0207700_102914863 | 160 |
| 310 | 3300031731 | Ga0307405_10591707 | Ga0307405_105917072 | 160 |
| 311 | 3300031824 | Ga0307413_10298435 | Ga0307413_102984352 | 160 |
| 312 | 3300031852 | Ga0307410_10077373 | Ga0307410_100773733 | 160 |
| 313 | 3300031911 | Ga0307412_10022635 | Ga0307412_100226353 | 160 |
| 314 | 3300031911 | Ga0307412_10161211 | Ga0307412_101612112 | 160 |
| 315 | 3300031911 | Ga0307412_11554237 | Ga0307412_115542371 | 160 |
| 316 | 3300031995 | Ga0307409_100031389 | Ga0307409_1000313892 | 160 |
| 317 | 3300032005 | Ga0307411_10986276 | Ga0307411_109862762 | 160 |
| 318 | 3300032126 | Ga0307415_100545366 | Ga0307415_1005453662 | 160 |
| 319 | 3300037312 | Ga0395899_0056100 | Ga0395899_0056100_1592_2092 | 160 |
| 320 | 3300037418 | Ga0395900_0130454 | Ga0395900_0130454_351_851 | 160 |
| 321 | 3300037466 | Ga0395898_0063831 | Ga0395898_0063831_1319_1819 | 160 |
| 322 | 3300037471 | Ga0395905_0062434 | Ga0395905_0062434_1168_1668 | 160 |
| 323 | 3300038443 | Ga0395901_0527102 | Ga0395901_0527102_500_1000 | 160 |
| 324 | 3300039437 | Ga0436365_0572677 | Ga0436365_0572677_815_1300 | 160 |
| 325 | 3300042005 | Ga0439448_0043240 | Ga0439448_0043240_727_1242 | 160 |
| 326 | 3300042439 | Ga0439464_0017288 | Ga0439464_0017288_1018_1506 | 160 |
| 327 | 3300042993 | Ga0439440_0225506 | Ga0439440_0225506_45_533 | 160 |
| 328 | 3300044765 | Ga0466970_0052317 | Ga0466970_0052317_946_1428 | 160 |
| 329 | 3300048907 | Ga0496104_0418076 | Ga0496104_0418076_518_1018 | 160 |
| 330 | 3300049568 | Ga0501031_0006569 | Ga0501031_0006569_6752_7240 | 160 |
| 331 | 3300049569 | Ga0501032_0175907 | Ga0501032_0175907_806_1294 | 160 |
| 332 | 3300049569 | Ga0501032_0662884 | Ga0501032_0662884_33_533 | 160 |
| 333 | 3300049570 | Ga0501033_0045546 | Ga0501033_0045546_1656_2144 | 160 |
| 334 | 3300049572 | Ga0501036_0005119 | Ga0501036_0005119_9679_10167 | 160 |
| 335 | 3300049574 | Ga0501038_0018052 | Ga0501038_0018052_3102_3590 | 160 |
| 336 | 3300049575 | Ga0501039_0012794 | Ga0501039_0012794_2846_3334 | 160 |
| 337 | 3300049576 | Ga0501040_0001208 | Ga0501040_0001208_13181_13669 | 160 |
| 338 | 3300049576 | Ga0501040_0323348 | Ga0501040_0323348_202_702 | 160 |
| 339 | 3300049577 | Ga0501041_0000325 | Ga0501041_0000325_12136_12624 | 160 |
| 340 | 3300049577 | Ga0501041_0379992 | Ga0501041_0379992_86_598 | 160 |
| 341 | 3300049578 | Ga0501042_0380820 | Ga0501042_0380820_386_886 | 160 |
| 342 | 3300049579 | Ga0501043_0021978 | Ga0501043_0021978_3297_3785 | 160 |
| 343 | 3300049580 | Ga0501046_0000797 | Ga0501046_0000797_27158_27646 | 160 |
| 344 | 3300049581 | Ga0501047_0034089 | Ga0501047_0034089_4412_4900 | 160 |
| 345 | 3300049582 | Ga0501048_0000036 | Ga0501048_0000036_4338_4826 | 160 |
| 346 | 3300049584 | Ga0501068_0006916 | Ga0501068_0006916_305_793 | 160 |
| 347 | 3300049586 | Ga0501070_0474160 | Ga0501070_0474160_326_814 | 160 |
| 348 | 3300049587 | Ga0501071_0015621 | Ga0501071_0015621_3469_3957 | 160 |
| 349 | 3300049588 | Ga0501072_0003418 | Ga0501072_0003418_488_976 | 160 |
| 350 | 3300049590 | Ga0501074_0000150 | Ga0501074_0000150_5728_6216 | 160 |
| 351 | 3300049591 | Ga0501075_0001381 | Ga0501075_0001381_99_587 | 160 |
| 352 | 3300049592 | Ga0501076_0022415 | Ga0501076_0022415_211_699 | 160 |
| 353 | 3300049592 | Ga0501076_0033773 | Ga0501076_0033773_2611_3111 | 160 |
| 354 | 3300049593 | Ga0501077_0025569 | Ga0501077_0025569_1040_1528 | 160 |
| 355 | 3300049741 | Ga0501079_0000484 | Ga0501079_0000484_11600_12088 | 160 |
| 356 | 3300049741 | Ga0501079_0029292 | Ga0501079_0029292_170_670 | 160 |
| 357 | 3300049743 | Ga0501081_0001297 | Ga0501081_0001297_11366_11854 | 160 |
| 358 | 3300049744 | Ga0501083_0023285 | Ga0501083_0023285_3048_3536 | 160 |
| 359 | 3300049822 | Ga0501035_0095957 | Ga0501035_0095957_657_1145 | 160 |
| 360 | 3300049824 | Ga0501045_0013896 | Ga0501045_0013896_1252_1740 | 160 |
| 361 | 3300054114 | Ga0501084_0000305 | Ga0501084_0000305_19223_19711 | 160 |
| 362 | 3300054114 | Ga0501084_0590748 | Ga0501084_0590748_19_519 | 160 |
| 363 | 3300060353 | Ga0501082_0000727 | Ga0501082_0000727_17547_18035 | 160 |
| 364 | 3300060353 | Ga0501082_0019758 | Ga0501082_0019758_342_842 | 160 |
| 365 | 3300060353 | Ga0501082_0226125 | Ga0501082_0226125_381_893 | 160 |
| 366 | 3300061734 | Ga0530510_0002334 | Ga0530510_0002334_4093_4581 | 160 |
| 367 | 3300061734 | Ga0530510_0087182 | Ga0530510_0087182_799_1311 | 160 |
| 368 | 3300003323 | rootH1_10190481 | rootH1_101904812 | 161 |
| 369 | 3300003373 | JGI25407J50210_10001249 | JGI25407J50210_100012497 | 161 |
| 370 | 3300003373 | JGI25407J50210_10013235 | JGI25407J50210_100132352 | 161 |
| 371 | 3300003373 | JGI25407J50210_10044455 | JGI25407J50210_100444552 | 161 |
| 372 | 3300005329 | Ga0070683_100002180 | Ga0070683_1000021803 | 161 |
| 373 | 3300005441 | Ga0070700_100000019 | Ga0070700_100000019129 | 161 |
| 374 | 3300005535 | Ga0070684_100022953 | Ga0070684_1000229533 | 161 |
| 375 | 3300005543 | Ga0070672_100189705 | Ga0070672_1001897053 | 161 |
| 376 | 3300005546 | Ga0070696_101063089 | Ga0070696_1010630891 | 161 |
| 377 | 3300005548 | Ga0070665_100664306 | Ga0070665_1006643062 | 161 |
| 378 | 3300005563 | Ga0068855_100099227 | Ga0068855_1000992273 | 161 |
| 379 | 3300005937 | Ga0081455_10002336 | Ga0081455_1000233617 | 161 |
| 380 | 3300005937 | Ga0081455_10164872 | Ga0081455_101648722 | 161 |
| 381 | 3300005937 | Ga0081455_10306136 | Ga0081455_103061362 | 161 |
| 382 | 3300005937 | Ga0081455_10746875 | Ga0081455_107468751 | 161 |
| 383 | 3300005981 | Ga0081538_10001298 | Ga0081538_1000129830 | 161 |
| 384 | 3300005981 | Ga0081538_10004845 | Ga0081538_100048456 | 161 |
| 385 | 3300005985 | Ga0081539_10021672 | Ga0081539_100216725 | 161 |
| 386 | 3300006844 | Ga0075428_100000001 | Ga0075428_100000001346 | 161 |
| 387 | 3300006844 | Ga0075428_100188821 | Ga0075428_1001888213 | 161 |
| 388 | 3300006846 | Ga0075430_100011247 | Ga0075430_1000112475 | 161 |
| 389 | 3300006847 | Ga0075431_100002312 | Ga0075431_1000023123 | 161 |
| 390 | 3300006847 | Ga0075431_100002400 | Ga0075431_10000240012 | 161 |
| 391 | 3300006847 | Ga0075431_101064587 | Ga0075431_1010645872 | 161 |
| 392 | 3300006847 | Ga0075431_101138462 | Ga0075431_1011384621 | 161 |
| 393 | 3300006871 | Ga0075434_100106982 | Ga0075434_1001069823 | 161 |
| 394 | 3300006880 | Ga0075429_100001668 | Ga0075429_1000016689 | 161 |
| 395 | 3300009094 | Ga0111539_10629365 | Ga0111539_106293651 | 161 |
| 396 | 3300009098 | Ga0105245_10145432 | Ga0105245_101454322 | 161 |
| 397 | 3300009101 | Ga0105247_10586989 | Ga0105247_105869892 | 161 |
| 398 | 3300009147 | Ga0114129_10411171 | Ga0114129_104111713 | 161 |
| 399 | 3300009148 | Ga0105243_11518320 | Ga0105243_115183202 | 161 |
| 400 | 3300009176 | Ga0105242_10383298 | Ga0105242_103832982 | 161 |
| 401 | 3300009176 | Ga0105242_10737790 | Ga0105242_107377903 | 161 |
| 402 | 3300009545 | Ga0105237_10126329 | Ga0105237_101263293 | 161 |
| 403 | 3300013100 | Ga0157373_10117165 | Ga0157373_101171654 | 161 |
| 404 | 3300013105 | Ga0157369_10044282 | Ga0157369_100442825 | 161 |
| 405 | 3300013307 | Ga0157372_10560345 | Ga0157372_105603453 | 161 |
| 406 | 3300020078 | Ga0206352_11045972 | Ga0206352_110459722 | 161 |
| 407 | 3300021384 | Ga0213876_10001139 | Ga0213876_1000113911 | 161 |
| 408 | 3300025913 | Ga0207695_10017361 | Ga0207695_100173613 | 161 |
| 409 | 3300025914 | Ga0207671_10061600 | Ga0207671_100616005 | 161 |
| 410 | 3300025927 | Ga0207687_10114233 | Ga0207687_101142332 | 161 |
| 411 | 3300025934 | Ga0207686_10174443 | Ga0207686_101744433 | 161 |
| 412 | 3300025935 | Ga0207709_11151089 | Ga0207709_111510891 | 161 |
| 413 | 3300025937 | Ga0207669_10545664 | Ga0207669_105456642 | 161 |
| 414 | 3300025944 | Ga0207661_10088693 | Ga0207661_100886931 | 161 |
| 415 | 3300025949 | Ga0207667_10059198 | Ga0207667_100591985 | 161 |
| 416 | 3300026075 | Ga0207708_10000038 | Ga0207708_10000038127 | 161 |
| 417 | 3300028379 | Ga0268266_10178244 | Ga0268266_101782442 | 161 |
| 418 | 3300031852 | Ga0307410_11486261 | Ga0307410_114862612 | 161 |
| 419 | 3300031852 | Ga0307410_11916135 | Ga0307410_119161351 | 161 |
| 420 | 3300031901 | Ga0307406_10670829 | Ga0307406_106708292 | 161 |
| 421 | 3300031901 | Ga0307406_10749251 | Ga0307406_107492512 | 161 |
| 422 | 3300031903 | Ga0307407_10553151 | Ga0307407_105531511 | 161 |
| 423 | 3300031995 | Ga0307409_100241814 | Ga0307409_1002418143 | 161 |
| 424 | 3300031995 | Ga0307409_101190019 | Ga0307409_1011900192 | 161 |
| 425 | 3300032002 | Ga0307416_100213536 | Ga0307416_1002135362 | 161 |
| 426 | 3300032002 | Ga0307416_100498224 | Ga0307416_1004982242 | 161 |
| 427 | 3300032005 | Ga0307411_10406606 | Ga0307411_104066062 | 161 |
| 428 | 3300032126 | Ga0307415_100385068 | Ga0307415_1003850681 | 161 |
| 429 | 3300032126 | Ga0307415_101054377 | Ga0307415_1010543771 | 161 |
| 430 | 3300033179 | Ga0307507_10006095 | Ga0307507_1000609510 | 161 |
| 431 | 3300033180 | Ga0307510_10106425 | Ga0307510_101064252 | 161 |
| 432 | 3300035117 | Ga0373953_0051218 | Ga0373953_0051218_170_655 | 161 |
| 433 | 3300035172 | Ga0373955_0045691 | Ga0373955_0045691_940_1425 | 161 |
| 434 | 3300035410 | Ga0373924_0043545 | Ga0373924_0043545_542_1027 | 161 |
| 435 | 3300035724 | Ga0373933_0083969 | Ga0373933_0083969_270_755 | 161 |
| 436 | 3300036401 | Ga0373937_0056651 | Ga0373937_0056651_376_861 | 161 |
| 437 | 3300037418 | Ga0395900_0212058 | Ga0395900_0212058_215_709 | 161 |
| 438 | 3300037466 | Ga0395898_0859038 | Ga0395898_0859038_337_831 | 161 |
| 439 | 3300038443 | Ga0395901_0857553 | Ga0395901_0857553_208_693 | 161 |
| 440 | 3300039437 | Ga0436365_1125982 | Ga0436365_1125982_3365_3853 | 161 |
| 441 | 3300039437 | Ga0436365_1558885 | Ga0436365_1558885_371_856 | 161 |
| 442 | 3300039453 | Ga0436362_0551951 | Ga0436362_0551951_438_926 | 161 |
| 443 | 3300041405 | Ga0439438_021921 | Ga0439438_021921_622_1107 | 161 |
| 444 | 3300042006 | Ga0439432_045521 | Ga0439432_045521_176_661 | 161 |
| 445 | 3300042435 | Ga0439434_0014120 | Ga0439434_0014120_57_542 | 161 |
| 446 | 3300044658 | Ga0466972_0000769 | Ga0466972_0000769_9068_9556 | 161 |
| 447 | 3300044683 | Ga0466965_0013377 | Ga0466965_0013377_3151_3639 | 161 |
| 448 | 3300044684 | Ga0466966_0090811 | Ga0466966_0090811_87_575 | 161 |
| 449 | 3300044735 | Ga0466968_0004226 | Ga0466968_0004226_806_1294 | 161 |
| 450 | 3300044901 | Ga0466960_0008951 | Ga0466960_0008951_3216_3704 | 161 |
| 451 | 3300045976 | Ga0466967_0251925 | Ga0466967_0251925_145_630 | 161 |
| 452 | 3300046454 | Ga0495592_0010454 | Ga0495592_0010454_3638_4123 | 161 |
| 453 | 3300046462 | Ga0495651_0015955 | Ga0495651_0015955_3443_3928 | 161 |
| 454 | 3300046463 | Ga0495653_0014736 | Ga0495653_0014736_151_636 | 161 |
| 455 | 3300046477 | Ga0495664_0071104 | Ga0495664_0071104_1523_2008 | 161 |
| 456 | 3300046511 | Ga0495608_0002082 | Ga0495608_0002082_1815_2300 | 161 |
| 457 | 3300046516 | Ga0495628_0489342 | Ga0495628_0489342_385_870 | 161 |
| 458 | 3300046529 | Ga0495652_0010929 | Ga0495652_0010929_3321_3806 | 161 |
| 459 | 3300046533 | Ga0495640_0021401 | Ga0495640_0021401_1911_2396 | 161 |
| 460 | 3300046536 | Ga0495587_0062017 | Ga0495587_0062017_1377_1862 | 161 |
| 461 | 3300046559 | Ga0495667_0001758 | Ga0495667_0001758_9461_9946 | 161 |
| 462 | 3300046663 | Ga0495635_0000652 | Ga0495635_0000652_16523_17008 | 161 |
| 463 | 3300046675 | Ga0495657_0029227 | Ga0495657_0029227_470_955 | 161 |
| 464 | 3300046679 | Ga0495623_0296496 | Ga0495623_0296496_345_830 | 161 |
| 465 | 3300046680 | Ga0495646_0040290 | Ga0495646_0040290_296_781 | 161 |
| 466 | 3300046809 | Ga0495600_0002592 | Ga0495600_0002592_4732_5217 | 161 |
| 467 | 3300047317 | Ga0495604_0048073 | Ga0495604_0048073_2571_3056 | 161 |
| 468 | 3300047318 | Ga0495636_0170135 | Ga0495636_0170135_301_792 | 161 |
| 469 | 3300047319 | Ga0495674_0031369 | Ga0495674_0031369_1001_1486 | 161 |
| 470 | 3300047322 | Ga0495680_0007779 | Ga0495680_0007779_4831_5316 | 161 |
| 471 | 3300048088 | Ga0495602_0029482 | Ga0495602_0029482_104_589 | 161 |
| 472 | 3300048904 | Ga0496101_0203559 | Ga0496101_0203559_412_900 | 161 |
| 473 | 3300048905 | Ga0496102_0046025 | Ga0496102_0046025_2057_2545 | 161 |
| 474 | 3300048905 | Ga0496102_0580131 | Ga0496102_0580131_80_568 | 161 |
| 475 | 3300048907 | Ga0496104_0456123 | Ga0496104_0456123_635_1120 | 161 |
| 476 | 3300048912 | Ga0496109_0015252 | Ga0496109_0015252_3895_4383 | 161 |
| 477 | 3300048912 | Ga0496109_0300273 | Ga0496109_0300273_918_1403 | 161 |
| 478 | 3300048912 | Ga0496109_0956571 | Ga0496109_0956571_94_582 | 161 |
| 479 | 3300048914 | Ga0496111_0421973 | Ga0496111_0421973_422_910 | 161 |
| 480 | 3300048914 | Ga0496111_1105673 | Ga0496111_1105673_26_514 | 161 |
| 481 | 3300048916 | Ga0496113_1194662 | Ga0496113_1194662_26_514 | 161 |
| 482 | 3300048917 | Ga0496114_0044843 | Ga0496114_0044843_2839_3327 | 161 |
| 483 | 3300049583 | Ga0501067_0316772 | Ga0501067_0316772_327_827 | 161 |
| 484 | 3300049589 | Ga0501073_0597059 | Ga0501073_0597059_239_724 | 161 |
| 485 | 3300050490 | nmdc:mga03n38_412430_c1 | nmdc:mga03n38_412430_c1_167_658 | 161 |
| 486 | 3300050491 | nmdc:mga00v17_209835_c1 | nmdc:mga00v17_209835_c1_522_1013 | 161 |
| 487 | 3300050492 | nmdc:mga0yw44_308747_c1 | nmdc:mga0yw44_308747_c1_544_1035 | 161 |
| 488 | 3300050507 | nmdc:mga05p37_906041_c1 | nmdc:mga05p37_906041_c1_427_912 | 161 |
| 489 | 3300050508 | nmdc:mga09592_10687_c1 | nmdc:mga09592_10687_c1_2283_2777 | 161 |
| 490 | 3300050509 | nmdc:mga0qj67_682_c1 | nmdc:mga0qj67_682_c1_9741_10235 | 161 |
| 491 | 3300050510 | nmdc:mga06r32_1013178_c1 | nmdc:mga06r32_1013178_c1_195_683 | 161 |
| 492 | 3300053085 | Ga0495619_0030537 | Ga0495619_0030537_111_596 | 161 |
| 493 | 3300003373 | JGI25407J50210_10001786 | JGI25407J50210_100017862 | 162 |
| 494 | 3300003373 | JGI25407J50210_10012016 | JGI25407J50210_100120162 | 162 |
| 495 | 3300005329 | Ga0070683_100573030 | Ga0070683_1005730302 | 162 |
| 496 | 3300005340 | Ga0070689_101052385 | Ga0070689_1010523852 | 162 |
| 497 | 3300005457 | Ga0070662_100333781 | Ga0070662_1003337812 | 162 |
| 498 | 3300005459 | Ga0068867_101403189 | Ga0068867_1014031891 | 162 |
| 499 | 3300005467 | Ga0070706_100002099 | Ga0070706_10000209912 | 162 |
| 500 | 3300005544 | Ga0070686_100194418 | Ga0070686_1001944183 | 162 |
| 501 | 3300005578 | Ga0068854_100680788 | Ga0068854_1006807882 | 162 |
| 502 | 3300005719 | Ga0068861_100173532 | Ga0068861_1001735322 | 162 |
| 503 | 3300005840 | Ga0068870_10314353 | Ga0068870_103143532 | 162 |
| 504 | 3300005843 | Ga0068860_100941495 | Ga0068860_1009414952 | 162 |
| 505 | 3300005981 | Ga0081538_10033686 | Ga0081538_100336863 | 162 |
| 506 | 3300005981 | Ga0081538_10069277 | Ga0081538_100692773 | 162 |
| 507 | 3300006048 | Ga0075363_100004072 | Ga0075363_1000040728 | 162 |
| 508 | 3300006847 | Ga0075431_100051929 | Ga0075431_1000519297 | 162 |
| 509 | 3300006880 | Ga0075429_100002220 | Ga0075429_10000222016 | 162 |
| 510 | 3300009098 | Ga0105245_10353315 | Ga0105245_103533152 | 162 |
| 511 | 3300009101 | Ga0105247_10812925 | Ga0105247_108129252 | 162 |
| 512 | 3300009148 | Ga0105243_10458124 | Ga0105243_104581243 | 162 |
| 513 | 3300009176 | Ga0105242_10645926 | Ga0105242_106459262 | 162 |
| 514 | 3300009545 | Ga0105237_11415897 | Ga0105237_114158972 | 162 |
| 515 | 3300009551 | Ga0105238_11096088 | Ga0105238_110960882 | 162 |
| 516 | 3300009553 | Ga0105249_10255158 | Ga0105249_102551583 | 162 |
| 517 | 3300013307 | Ga0157372_11225526 | Ga0157372_112255262 | 162 |
| 518 | 3300014325 | Ga0163163_11734607 | Ga0163163_117346072 | 162 |
| 519 | 3300014969 | Ga0157376_10338043 | Ga0157376_103380432 | 162 |
| 520 | 3300017792 | Ga0163161_10237211 | Ga0163161_102372112 | 162 |
| 521 | 3300025908 | Ga0207643_10273428 | Ga0207643_102734282 | 162 |
| 522 | 3300025910 | Ga0207684_10002784 | Ga0207684_1000278412 | 162 |
| 523 | 3300025917 | Ga0207660_10327152 | Ga0207660_103271523 | 162 |
| 524 | 3300025922 | Ga0207646_10093355 | Ga0207646_100933555 | 162 |
| 525 | 3300025934 | Ga0207686_10554642 | Ga0207686_105546422 | 162 |
| 526 | 3300025935 | Ga0207709_10202272 | Ga0207709_102022723 | 162 |
| 527 | 3300025942 | Ga0207689_10063901 | Ga0207689_100639014 | 162 |
| 528 | 3300025944 | Ga0207661_10942868 | Ga0207661_109428682 | 162 |
| 529 | 3300025949 | Ga0207667_11327642 | Ga0207667_113276422 | 162 |
| 530 | 3300025960 | Ga0207651_11003958 | Ga0207651_110039582 | 162 |
| 531 | 3300025972 | Ga0207668_10587553 | Ga0207668_105875532 | 162 |
| 532 | 3300025986 | Ga0207658_10886884 | Ga0207658_108868841 | 162 |
| 533 | 3300026118 | Ga0207675_100095937 | Ga0207675_1000959372 | 162 |
| 534 | 3300026121 | Ga0207683_10027452 | Ga0207683_100274523 | 162 |
| 535 | 3300026121 | Ga0207683_10081091 | Ga0207683_100810912 | 162 |
| 536 | 3300026121 | Ga0207683_11324708 | Ga0207683_113247082 | 162 |
| 537 | 3300028381 | Ga0268264_10460718 | Ga0268264_104607182 | 162 |
| 538 | 3300028794 | Ga0307515_10085249 | Ga0307515_100852494 | 162 |
| 539 | 3300031548 | Ga0307408_100308202 | Ga0307408_1003082023 | 162 |
| 540 | 3300031731 | Ga0307405_10489545 | Ga0307405_104895452 | 162 |
| 541 | 3300031852 | Ga0307410_10171128 | Ga0307410_101711282 | 162 |
| 542 | 3300031852 | Ga0307410_11635313 | Ga0307410_116353131 | 162 |
| 543 | 3300031901 | Ga0307406_10110519 | Ga0307406_101105192 | 162 |
| 544 | 3300031911 | Ga0307412_10187220 | Ga0307412_101872202 | 162 |
| 545 | 3300031995 | Ga0307409_100040222 | Ga0307409_1000402224 | 162 |
| 546 | 3300031995 | Ga0307409_100108160 | Ga0307409_1001081603 | 162 |
| 547 | 3300031995 | Ga0307409_100598443 | Ga0307409_1005984431 | 162 |
| 548 | 3300032002 | Ga0307416_100073605 | Ga0307416_1000736052 | 162 |
| 549 | 3300032002 | Ga0307416_100130404 | Ga0307416_1001304043 | 162 |
| 550 | 3300032126 | Ga0307415_100005505 | Ga0307415_1000055058 | 162 |
| 551 | 3300032126 | Ga0307415_100094098 | Ga0307415_1000940983 | 162 |
| 552 | 3300037312 | Ga0395899_0101868 | Ga0395899_0101868_806_1303 | 162 |
| 553 | 3300037312 | Ga0395899_0448408 | Ga0395899_0448408_98_595 | 162 |
| 554 | 3300037418 | Ga0395900_0159169 | Ga0395900_0159169_1210_1707 | 162 |
| 555 | 3300037418 | Ga0395900_0855945 | Ga0395900_0855945_48_545 | 162 |
| 556 | 3300037466 | Ga0395898_0149856 | Ga0395898_0149856_283_780 | 162 |
| 557 | 3300037471 | Ga0395905_0465040 | Ga0395905_0465040_461_958 | 162 |
| 558 | 3300038443 | Ga0395901_0012719 | Ga0395901_0012719_7898_8395 | 162 |
| 559 | 3300038443 | Ga0395901_0176181 | Ga0395901_0176181_292_789 | 162 |
| 560 | 3300038443 | Ga0395901_0600834 | Ga0395901_0600834_295_792 | 162 |
| 561 | 3300038996 | Ga0242420_088805 | Ga0242420_088805_123_623 | 162 |
| 562 | 3300045976 | Ga0466967_0814679 | Ga0466967_0814679_254_757 | 162 |
| 563 | 3300048904 | Ga0496101_0007633 | Ga0496101_0007633_2348_2836 | 162 |
| 564 | 3300048905 | Ga0496102_0001033 | Ga0496102_0001033_23490_23978 | 162 |
| 565 | 3300048910 | Ga0496107_0024165 | Ga0496107_0024165_1872_2360 | 162 |
| 566 | 3300048912 | Ga0496109_0468462 | Ga0496109_0468462_484_972 | 162 |
| 567 | 3300048916 | Ga0496113_0230116 | Ga0496113_0230116_343_843 | 162 |
| 568 | 3300048929 | Ga0496126_0512794 | Ga0496126_0512794_230_718 | 162 |
| 569 | 3300049568 | Ga0501031_0292848 | Ga0501031_0292848_375_863 | 162 |
| 570 | 3300049572 | Ga0501036_0269524 | Ga0501036_0269524_41_529 | 162 |
| 571 | 3300049573 | Ga0501037_0133862 | Ga0501037_0133862_1207_1695 | 162 |
| 572 | 3300049574 | Ga0501038_0070139 | Ga0501038_0070139_1310_1798 | 162 |
| 573 | 3300049575 | Ga0501039_0099563 | Ga0501039_0099563_221_709 | 162 |
| 574 | 3300049576 | Ga0501040_0095196 | Ga0501040_0095196_198_686 | 162 |
| 575 | 3300049577 | Ga0501041_0026009 | Ga0501041_0026009_30_518 | 162 |
| 576 | 3300049578 | Ga0501042_0018833 | Ga0501042_0018833_2183_2671 | 162 |
| 577 | 3300049580 | Ga0501046_0128032 | Ga0501046_0128032_471_959 | 162 |
| 578 | 3300049582 | Ga0501048_0010777 | Ga0501048_0010777_2603_3091 | 162 |
| 579 | 3300049584 | Ga0501068_0068378 | Ga0501068_0068378_135_623 | 162 |
| 580 | 3300049587 | Ga0501071_0013741 | Ga0501071_0013741_3687_4175 | 162 |
| 581 | 3300049588 | Ga0501072_0008710 | Ga0501072_0008710_158_646 | 162 |
| 582 | 3300049590 | Ga0501074_0020627 | Ga0501074_0020627_1397_1885 | 162 |
| 583 | 3300049592 | Ga0501076_0001172 | Ga0501076_0001172_2657_3145 | 162 |
| 584 | 3300049593 | Ga0501077_0001661 | Ga0501077_0001661_1534_2022 | 162 |
| 585 | 3300049741 | Ga0501079_0002866 | Ga0501079_0002866_9813_10301 | 162 |
| 586 | 3300049742 | Ga0501080_0014998 | Ga0501080_0014998_368_856 | 162 |
| 587 | 3300049743 | Ga0501081_0010006 | Ga0501081_0010006_2380_2868 | 162 |
| 588 | 3300049744 | Ga0501083_0538079 | Ga0501083_0538079_97_585 | 162 |
| 589 | 3300049822 | Ga0501035_0187618 | Ga0501035_0187618_1240_1728 | 162 |
| 590 | 3300049824 | Ga0501045_0001086 | Ga0501045_0001086_2727_3215 | 162 |
| 591 | 3300050509 | nmdc:mga0qj67_215072_c1 | nmdc:mga0qj67_215072_c1_943_1440 | 162 |
| 592 | 3300050510 | nmdc:mga06r32_270066_c1 | nmdc:mga06r32_270066_c1_1048_1539 | 162 |
| 593 | 3300050510 | nmdc:mga06r32_529362_c1 | nmdc:mga06r32_529362_c1_74_571 | 162 |
| 594 | 3300059421 | Ga0590071_009882 | Ga0590071_009882_1310_1804 | 162 |
| 595 | 3300059423 | Ga0590074_003839 | Ga0590074_003839_1612_2106 | 162 |
| 596 | 3300059424 | Ga0590075_001480 | Ga0590075_001480_1491_1985 | 162 |
| 597 | 3300059426 | Ga0590077_033627 | Ga0590077_033627_244_738 | 162 |
| 598 | 3300060353 | Ga0501082_0018363 | Ga0501082_0018363_2541_3029 | 162 |
| 599 | 3300061734 | Ga0530510_0057210 | Ga0530510_0057210_209_697 | 162 |
| 600 | 3300005289 | Ga0065704_10356959 | Ga0065704_103569592 | 163 |
| 601 | 3300005295 | Ga0065707_10027577 | Ga0065707_100275772 | 163 |
| 602 | 3300005340 | Ga0070689_100874888 | Ga0070689_1008748881 | 163 |
| 603 | 3300005434 | Ga0070709_10002774 | Ga0070709_100027746 | 163 |
| 604 | 3300005438 | Ga0070701_10235272 | Ga0070701_102352721 | 163 |
| 605 | 3300005439 | Ga0070711_100032240 | Ga0070711_1000322403 | 163 |
| 606 | 3300005444 | Ga0070694_100213950 | Ga0070694_1002139502 | 163 |
| 607 | 3300005445 | Ga0070708_100000013 | Ga0070708_10000001360 | 163 |
| 608 | 3300005445 | Ga0070708_100143446 | Ga0070708_1001434464 | 163 |
| 609 | 3300005457 | Ga0070662_100497901 | Ga0070662_1004979012 | 163 |
| 610 | 3300005467 | Ga0070706_100230776 | Ga0070706_1002307763 | 163 |
| 611 | 3300005467 | Ga0070706_101324354 | Ga0070706_1013243541 | 163 |
| 612 | 3300005471 | Ga0070698_100001121 | Ga0070698_10000112116 | 163 |
| 613 | 3300005536 | Ga0070697_100726378 | Ga0070697_1007263781 | 163 |
| 614 | 3300005545 | Ga0070695_100332414 | Ga0070695_1003324142 | 163 |
| 615 | 3300005617 | Ga0068859_100090293 | Ga0068859_1000902933 | 163 |
| 616 | 3300005844 | Ga0068862_100537714 | Ga0068862_1005377142 | 163 |
| 617 | 3300005981 | Ga0081538_10047783 | Ga0081538_100477832 | 163 |
| 618 | 3300005981 | Ga0081538_10093919 | Ga0081538_100939193 | 163 |
| 619 | 3300006844 | Ga0075428_100689963 | Ga0075428_1006899632 | 163 |
| 620 | 3300006844 | Ga0075428_101143079 | Ga0075428_1011430792 | 163 |
| 621 | 3300006846 | Ga0075430_100180353 | Ga0075430_1001803532 | 163 |
| 622 | 3300006847 | Ga0075431_100321009 | Ga0075431_1003210094 | 163 |
| 623 | 3300006880 | Ga0075429_100389805 | Ga0075429_1003898052 | 163 |
| 624 | 3300006931 | Ga0097620_100090295 | Ga0097620_1000902953 | 163 |
| 625 | 3300009174 | Ga0105241_10604290 | Ga0105241_106042902 | 163 |
| 626 | 3300013308 | Ga0157375_12047958 | Ga0157375_120479581 | 163 |
| 627 | 3300015262 | Ga0182007_10180910 | Ga0182007_101809102 | 163 |
| 628 | 3300025910 | Ga0207684_10229690 | Ga0207684_102296903 | 163 |
| 629 | 3300025916 | Ga0207663_10023106 | Ga0207663_100231063 | 163 |
| 630 | 3300025921 | Ga0207652_10203122 | Ga0207652_102031223 | 163 |
| 631 | 3300025922 | Ga0207646_10190259 | Ga0207646_101902593 | 163 |
| 632 | 3300025927 | Ga0207687_10300688 | Ga0207687_103006883 | 163 |
| 633 | 3300025940 | Ga0207691_11541098 | Ga0207691_115410981 | 163 |
| 634 | 3300025944 | Ga0207661_10116773 | Ga0207661_101167733 | 163 |
| 635 | 3300031507 | Ga0307509_10205105 | Ga0307509_102051054 | 163 |
| 636 | 3300031616 | Ga0307508_10000420 | Ga0307508_1000042010 | 163 |
| 637 | 3300037312 | Ga0395899_0092453 | Ga0395899_0092453_288_791 | 163 |
| 638 | 3300037312 | Ga0395899_0853607 | Ga0395899_0853607_44_544 | 163 |
| 639 | 3300037418 | Ga0395900_0035185 | Ga0395900_0035185_3431_3934 | 163 |
| 640 | 3300037418 | Ga0395900_0094308 | Ga0395900_0094308_1177_1680 | 163 |
| 641 | 3300037466 | Ga0395898_0062093 | Ga0395898_0062093_566_1069 | 163 |
| 642 | 3300037466 | Ga0395898_0573287 | Ga0395898_0573287_199_699 | 163 |
| 643 | 3300037471 | Ga0395905_0008903 | Ga0395905_0008903_9297_9800 | 163 |
| 644 | 3300037471 | Ga0395905_0090769 | Ga0395905_0090769_2336_2839 | 163 |
| 645 | 3300038443 | Ga0395901_0024059 | Ga0395901_0024059_1343_1843 | 163 |
| 646 | 3300038443 | Ga0395901_0029263 | Ga0395901_0029263_3990_4493 | 163 |
| 647 | 3300038443 | Ga0395901_0052447 | Ga0395901_0052447_3500_4018 | 163 |
| 648 | 3300038443 | Ga0395901_0141289 | Ga0395901_0141289_801_1304 | 163 |
| 649 | 3300038443 | Ga0395901_0285204 | Ga0395901_0285204_449_949 | 163 |
| 650 | 3300041410 | Ga0439461_0032900 | Ga0439461_0032900_47_541 | 163 |
| 651 | 3300041997 | Ga0439431_0125074 | Ga0439431_0125074_166_660 | 163 |
| 652 | 3300041999 | Ga0439433_0003967 | Ga0439433_0003967_2316_2810 | 163 |
| 653 | 3300042005 | Ga0439448_0200857 | Ga0439448_0200857_166_657 | 163 |
| 654 | 3300042007 | Ga0439449_0058991 | Ga0439449_0058991_510_1004 | 163 |
| 655 | 3300042435 | Ga0439434_0034967 | Ga0439434_0034967_392_886 | 163 |
| 656 | 3300045976 | Ga0466967_0172412 | Ga0466967_0172412_39_545 | 163 |
| 657 | 3300045976 | Ga0466967_0427373 | Ga0466967_0427373_552_1052 | 163 |
| 658 | 3300049572 | Ga0501036_0565577 | Ga0501036_0565577_408_911 | 163 |
| 659 | 3300049587 | Ga0501071_0302647 | Ga0501071_0302647_404_907 | 163 |
| 660 | 3300049592 | Ga0501076_0691081 | Ga0501076_0691081_137_640 | 163 |
| 661 | 3300050510 | nmdc:mga06r32_121285_c1 | nmdc:mga06r32_121285_c1_1126_1617 | 163 |
| 662 | 3300054114 | Ga0501084_0364084 | Ga0501084_0364084_92_595 | 163 |
| 663 | 3300054114 | Ga0501084_0817489 | Ga0501084_0817489_239_754 | 163 |
| 664 | 3300060353 | Ga0501082_0123879 | Ga0501082_0123879_905_1408 | 163 |
| 665 | 3300002077 | JGI24744J21845_10012886 | JGI24744J21845_100128863 | 164 |
| 666 | 3300002239 | JGI24034J26672_10046755 | JGI24034J26672_100467552 | 164 |
| 667 | 3300002244 | JGI24742J22300_10016937 | JGI24742J22300_100169372 | 164 |
| 668 | 3300003322 | rootL2_10169080 | rootL2_101690802 | 164 |
| 669 | 3300003373 | JGI25407J50210_10030346 | JGI25407J50210_100303462 | 164 |
| 670 | 3300005327 | Ga0070658_10044365 | Ga0070658_100443653 | 164 |
| 671 | 3300005336 | Ga0070680_100101887 | Ga0070680_1001018872 | 164 |
| 672 | 3300005337 | Ga0070682_100006239 | Ga0070682_1000062392 | 164 |
| 673 | 3300005338 | Ga0068868_100028178 | Ga0068868_1000281781 | 164 |
| 674 | 3300005339 | Ga0070660_100025013 | Ga0070660_1000250134 | 164 |
| 675 | 3300005339 | Ga0070660_100079968 | Ga0070660_1000799682 | 164 |
| 676 | 3300005339 | Ga0070660_100354203 | Ga0070660_1003542032 | 164 |
| 677 | 3300005341 | Ga0070691_10064422 | Ga0070691_100644224 | 164 |
| 678 | 3300005344 | Ga0070661_100312407 | Ga0070661_1003124073 | 164 |
| 679 | 3300005345 | Ga0070692_10056496 | Ga0070692_100564962 | 164 |
| 680 | 3300005345 | Ga0070692_10112563 | Ga0070692_101125633 | 164 |
| 681 | 3300005354 | Ga0070675_100085864 | Ga0070675_1000858644 | 164 |
| 682 | 3300005355 | Ga0070671_100716910 | Ga0070671_1007169101 | 164 |
| 683 | 3300005356 | Ga0070674_100068560 | Ga0070674_1000685602 | 164 |
| 684 | 3300005356 | Ga0070674_100851827 | Ga0070674_1008518272 | 164 |
| 685 | 3300005356 | Ga0070674_100895523 | Ga0070674_1008955232 | 164 |
| 686 | 3300005364 | Ga0070673_101471320 | Ga0070673_1014713201 | 164 |
| 687 | 3300005365 | Ga0070688_100003853 | Ga0070688_1000038537 | 164 |
| 688 | 3300005365 | Ga0070688_100266427 | Ga0070688_1002664272 | 164 |
| 689 | 3300005366 | Ga0070659_100100568 | Ga0070659_1001005682 | 164 |
| 690 | 3300005366 | Ga0070659_100512288 | Ga0070659_1005122882 | 164 |
| 691 | 3300005367 | Ga0070667_100150411 | Ga0070667_1001504113 | 164 |
| 692 | 3300005406 | Ga0070703_10182562 | Ga0070703_101825622 | 164 |
| 693 | 3300005434 | Ga0070709_10021991 | Ga0070709_100219915 | 164 |
| 694 | 3300005434 | Ga0070709_10155272 | Ga0070709_101552723 | 164 |
| 695 | 3300005435 | Ga0070714_100313380 | Ga0070714_1003133802 | 164 |
| 696 | 3300005436 | Ga0070713_100000644 | Ga0070713_1000006449 | 164 |
| 697 | 3300005437 | Ga0070710_10047971 | Ga0070710_100479712 | 164 |
| 698 | 3300005438 | Ga0070701_10000911 | Ga0070701_100009115 | 164 |
| 699 | 3300005439 | Ga0070711_100003577 | Ga0070711_1000035779 | 164 |
| 700 | 3300005440 | Ga0070705_100165464 | Ga0070705_1001654642 | 164 |
| 701 | 3300005440 | Ga0070705_100220684 | Ga0070705_1002206842 | 164 |
| 702 | 3300005441 | Ga0070700_100001973 | Ga0070700_1000019734 | 164 |
| 703 | 3300005441 | Ga0070700_100763868 | Ga0070700_1007638682 | 164 |
| 704 | 3300005444 | Ga0070694_100364091 | Ga0070694_1003640912 | 164 |
| 705 | 3300005445 | Ga0070708_100168796 | Ga0070708_1001687965 | 164 |
| 706 | 3300005445 | Ga0070708_100210428 | Ga0070708_1002104282 | 164 |
| 707 | 3300005445 | Ga0070708_100590516 | Ga0070708_1005905162 | 164 |
| 708 | 3300005455 | Ga0070663_100001959 | Ga0070663_1000019598 | 164 |
| 709 | 3300005456 | Ga0070678_100000298 | Ga0070678_10000029830 | 164 |
| 710 | 3300005456 | Ga0070678_101002710 | Ga0070678_1010027102 | 164 |
| 711 | 3300005457 | Ga0070662_100234216 | Ga0070662_1002342162 | 164 |
| 712 | 3300005458 | Ga0070681_10105938 | Ga0070681_101059384 | 164 |
| 713 | 3300005458 | Ga0070681_10198140 | Ga0070681_101981402 | 164 |
| 714 | 3300005459 | Ga0068867_100002281 | Ga0068867_10000228116 | 164 |
| 715 | 3300005466 | Ga0070685_10045060 | Ga0070685_100450603 | 164 |
| 716 | 3300005467 | Ga0070706_100423566 | Ga0070706_1004235662 | 164 |
| 717 | 3300005467 | Ga0070706_100632087 | Ga0070706_1006320872 | 164 |
| 718 | 3300005468 | Ga0070707_100145063 | Ga0070707_1001450632 | 164 |
| 719 | 3300005471 | Ga0070698_100017945 | Ga0070698_1000179457 | 164 |
| 720 | 3300005471 | Ga0070698_100148954 | Ga0070698_1001489542 | 164 |
| 721 | 3300005518 | Ga0070699_100308970 | Ga0070699_1003089702 | 164 |
| 722 | 3300005518 | Ga0070699_100681427 | Ga0070699_1006814272 | 164 |
| 723 | 3300005530 | Ga0070679_100626217 | Ga0070679_1006262172 | 164 |
| 724 | 3300005536 | Ga0070697_100094795 | Ga0070697_1000947954 | 164 |
| 725 | 3300005536 | Ga0070697_101141678 | Ga0070697_1011416781 | 164 |
| 726 | 3300005539 | Ga0068853_100085008 | Ga0068853_1000850083 | 164 |
| 727 | 3300005539 | Ga0068853_100737097 | Ga0068853_1007370972 | 164 |
| 728 | 3300005543 | Ga0070672_100425849 | Ga0070672_1004258492 | 164 |
| 729 | 3300005543 | Ga0070672_101629960 | Ga0070672_1016299602 | 164 |
| 730 | 3300005544 | Ga0070686_100007440 | Ga0070686_1000074404 | 164 |
| 731 | 3300005545 | Ga0070695_100161779 | Ga0070695_1001617792 | 164 |
| 732 | 3300005546 | Ga0070696_100033756 | Ga0070696_1000337562 | 164 |
| 733 | 3300005546 | Ga0070696_100838396 | Ga0070696_1008383962 | 164 |
| 734 | 3300005546 | Ga0070696_101652092 | Ga0070696_1016520921 | 164 |
| 735 | 3300005547 | Ga0070693_100023513 | Ga0070693_1000235134 | 164 |
| 736 | 3300005547 | Ga0070693_100566900 | Ga0070693_1005669001 | 164 |
| 737 | 3300005549 | Ga0070704_100159925 | Ga0070704_1001599253 | 164 |
| 738 | 3300005563 | Ga0068855_100360924 | Ga0068855_1003609242 | 164 |
| 739 | 3300005563 | Ga0068855_100370838 | Ga0068855_1003708382 | 164 |
| 740 | 3300005564 | Ga0070664_100859025 | Ga0070664_1008590252 | 164 |
| 741 | 3300005578 | Ga0068854_101147992 | Ga0068854_1011479922 | 164 |
| 742 | 3300005614 | Ga0068856_100064387 | Ga0068856_1000643874 | 164 |
| 743 | 3300005614 | Ga0068856_100132897 | Ga0068856_1001328972 | 164 |
| 744 | 3300005615 | Ga0070702_100023431 | Ga0070702_1000234313 | 164 |
| 745 | 3300005616 | Ga0068852_100002120 | Ga0068852_10000212010 | 164 |
| 746 | 3300005618 | Ga0068864_100449674 | Ga0068864_1004496742 | 164 |
| 747 | 3300005718 | Ga0068866_10014980 | Ga0068866_100149804 | 164 |
| 748 | 3300005843 | Ga0068860_100585852 | Ga0068860_1005858522 | 164 |
| 749 | 3300005981 | Ga0081538_10012727 | Ga0081538_100127276 | 164 |
| 750 | 3300006028 | Ga0070717_10043111 | Ga0070717_100431114 | 164 |
| 751 | 3300006058 | Ga0075432_10074702 | Ga0075432_100747022 | 164 |
| 752 | 3300006163 | Ga0070715_10030275 | Ga0070715_100302752 | 164 |
| 753 | 3300006175 | Ga0070712_100010895 | Ga0070712_1000108957 | 164 |
| 754 | 3300006175 | Ga0070712_100019749 | Ga0070712_1000197494 | 164 |
| 755 | 3300006237 | Ga0097621_100035448 | Ga0097621_1000354482 | 164 |
| 756 | 3300006358 | Ga0068871_101562352 | Ga0068871_1015623521 | 164 |
| 757 | 3300006844 | Ga0075428_100001400 | Ga0075428_10000140017 | 164 |
| 758 | 3300006844 | Ga0075428_100018653 | Ga0075428_1000186535 | 164 |
| 759 | 3300006846 | Ga0075430_100013658 | Ga0075430_1000136583 | 164 |
| 760 | 3300006847 | Ga0075431_100001828 | Ga0075431_1000018286 | 164 |
| 761 | 3300006871 | Ga0075434_100423453 | Ga0075434_1004234532 | 164 |
| 762 | 3300006871 | Ga0075434_101015932 | Ga0075434_1010159321 | 164 |
| 763 | 3300006880 | Ga0075429_100016078 | Ga0075429_1000160782 | 164 |
| 764 | 3300006880 | Ga0075429_100815983 | Ga0075429_1008159831 | 164 |
| 765 | 3300006881 | Ga0068865_100031672 | Ga0068865_1000316724 | 164 |
| 766 | 3300009094 | Ga0111539_11149348 | Ga0111539_111493482 | 164 |
| 767 | 3300009098 | Ga0105245_10013977 | Ga0105245_100139776 | 164 |
| 768 | 3300009098 | Ga0105245_10016782 | Ga0105245_100167824 | 164 |
| 769 | 3300009098 | Ga0105245_10019026 | Ga0105245_100190263 | 164 |
| 770 | 3300009101 | Ga0105247_10135707 | Ga0105247_101357072 | 164 |
| 771 | 3300009147 | Ga0114129_10004745 | Ga0114129_1000474518 | 164 |
| 772 | 3300009147 | Ga0114129_10444623 | Ga0114129_104446235 | 164 |
| 773 | 3300009148 | Ga0105243_10002101 | Ga0105243_1000210111 | 164 |
| 774 | 3300009148 | Ga0105243_10047430 | Ga0105243_100474302 | 164 |
| 775 | 3300009174 | Ga0105241_10019097 | Ga0105241_100190977 | 164 |
| 776 | 3300009176 | Ga0105242_10003124 | Ga0105242_100031245 | 164 |
| 777 | 3300009176 | Ga0105242_10514869 | Ga0105242_105148692 | 164 |
| 778 | 3300009177 | Ga0105248_10021005 | Ga0105248_100210054 | 164 |
| 779 | 3300009551 | Ga0105238_10020762 | Ga0105238_100207624 | 164 |
| 780 | 3300009551 | Ga0105238_10347713 | Ga0105238_103477132 | 164 |
| 781 | 3300009553 | Ga0105249_10002268 | Ga0105249_1000226817 | 164 |
| 782 | 3300009553 | Ga0105249_10175295 | Ga0105249_101752954 | 164 |
| 783 | 3300010375 | Ga0105239_10061108 | Ga0105239_100611084 | 164 |
| 784 | 3300010375 | Ga0105239_10077288 | Ga0105239_100772883 | 164 |
| 785 | 3300010375 | Ga0105239_11083337 | Ga0105239_110833372 | 164 |
| 786 | 3300011119 | Ga0105246_10287054 | Ga0105246_102870542 | 164 |
| 787 | 3300013100 | Ga0157373_10512682 | Ga0157373_105126822 | 164 |
| 788 | 3300013105 | Ga0157369_10432933 | Ga0157369_104329333 | 164 |
| 789 | 3300013296 | Ga0157374_10001932 | Ga0157374_1000193211 | 164 |
| 790 | 3300013297 | Ga0157378_10002234 | Ga0157378_100022343 | 164 |
| 791 | 3300013306 | Ga0163162_10021305 | Ga0163162_100213056 | 164 |
| 792 | 3300013306 | Ga0163162_10173270 | Ga0163162_101732705 | 164 |
| 793 | 3300013307 | Ga0157372_10038513 | Ga0157372_100385135 | 164 |
| 794 | 3300013308 | Ga0157375_10081823 | Ga0157375_100818234 | 164 |
| 795 | 3300014326 | Ga0157380_10017866 | Ga0157380_100178662 | 164 |
| 796 | 3300014745 | Ga0157377_10001693 | Ga0157377_100016934 | 164 |
| 797 | 3300014969 | Ga0157376_10005356 | Ga0157376_1000535610 | 164 |
| 798 | 3300021384 | Ga0213876_10061765 | Ga0213876_100617653 | 164 |
| 799 | 3300025898 | Ga0207692_10142735 | Ga0207692_101427353 | 164 |
| 800 | 3300025899 | Ga0207642_10054953 | Ga0207642_100549533 | 164 |
| 801 | 3300025901 | Ga0207688_10140322 | Ga0207688_101403222 | 164 |
| 802 | 3300025903 | Ga0207680_10023379 | Ga0207680_100233793 | 164 |
| 803 | 3300025905 | Ga0207685_10049871 | Ga0207685_100498712 | 164 |
| 804 | 3300025906 | Ga0207699_10030727 | Ga0207699_100307272 | 164 |
| 805 | 3300025906 | Ga0207699_10046025 | Ga0207699_100460252 | 164 |
| 806 | 3300025909 | Ga0207705_10041106 | Ga0207705_100411064 | 164 |
| 807 | 3300025910 | Ga0207684_10551004 | Ga0207684_105510042 | 164 |
| 808 | 3300025911 | Ga0207654_10107294 | Ga0207654_101072943 | 164 |
| 809 | 3300025912 | Ga0207707_10232707 | Ga0207707_102327073 | 164 |
| 810 | 3300025912 | Ga0207707_10577817 | Ga0207707_105778172 | 164 |
| 811 | 3300025915 | Ga0207693_10007175 | Ga0207693_1000717512 | 164 |
| 812 | 3300025915 | Ga0207693_10027303 | Ga0207693_100273034 | 164 |
| 813 | 3300025915 | Ga0207693_11135111 | Ga0207693_111351111 | 164 |
| 814 | 3300025916 | Ga0207663_10033549 | Ga0207663_100335493 | 164 |
| 815 | 3300025917 | Ga0207660_10213841 | Ga0207660_102138412 | 164 |
| 816 | 3300025918 | Ga0207662_10074295 | Ga0207662_100742953 | 164 |
| 817 | 3300025919 | Ga0207657_10004070 | Ga0207657_1000407011 | 164 |
| 818 | 3300025919 | Ga0207657_10042720 | Ga0207657_100427204 | 164 |
| 819 | 3300025920 | Ga0207649_10192131 | Ga0207649_101921312 | 164 |
| 820 | 3300025923 | Ga0207681_10662037 | Ga0207681_106620372 | 164 |
| 821 | 3300025924 | Ga0207694_10439139 | Ga0207694_104391392 | 164 |
| 822 | 3300025927 | Ga0207687_10019617 | Ga0207687_100196173 | 164 |
| 823 | 3300025927 | Ga0207687_10139571 | Ga0207687_101395712 | 164 |
| 824 | 3300025928 | Ga0207700_10004542 | Ga0207700_100045424 | 164 |
| 825 | 3300025929 | Ga0207664_10336965 | Ga0207664_103369652 | 164 |
| 826 | 3300025929 | Ga0207664_11222528 | Ga0207664_112225281 | 164 |
| 827 | 3300025932 | Ga0207690_10103134 | Ga0207690_101031342 | 164 |
| 828 | 3300025932 | Ga0207690_10153400 | Ga0207690_101534002 | 164 |
| 829 | 3300025933 | Ga0207706_10065047 | Ga0207706_100650474 | 164 |
| 830 | 3300025933 | Ga0207706_10252095 | Ga0207706_102520952 | 164 |
| 831 | 3300025934 | Ga0207686_10014856 | Ga0207686_100148565 | 164 |
| 832 | 3300025934 | Ga0207686_10130155 | Ga0207686_101301552 | 164 |
| 833 | 3300025934 | Ga0207686_10359231 | Ga0207686_103592312 | 164 |
| 834 | 3300025935 | Ga0207709_10053457 | Ga0207709_100534573 | 164 |
| 835 | 3300025935 | Ga0207709_10078175 | Ga0207709_100781753 | 164 |
| 836 | 3300025937 | Ga0207669_10192844 | Ga0207669_101928441 | 164 |
| 837 | 3300025937 | Ga0207669_10483661 | Ga0207669_104836612 | 164 |
| 838 | 3300025937 | Ga0207669_10663068 | Ga0207669_106630681 | 164 |
| 839 | 3300025937 | Ga0207669_11056327 | Ga0207669_110563272 | 164 |
| 840 | 3300025938 | Ga0207704_10068214 | Ga0207704_100682142 | 164 |
| 841 | 3300025938 | Ga0207704_10089184 | Ga0207704_100891844 | 164 |
| 842 | 3300025940 | Ga0207691_10081295 | Ga0207691_100812952 | 164 |
| 843 | 3300025941 | Ga0207711_10027079 | Ga0207711_100270797 | 164 |
| 844 | 3300025949 | Ga0207667_10342945 | Ga0207667_103429452 | 164 |
| 845 | 3300025960 | Ga0207651_10225155 | Ga0207651_102251552 | 164 |
| 846 | 3300025960 | Ga0207651_10257702 | Ga0207651_102577022 | 164 |
| 847 | 3300025961 | Ga0207712_10047091 | Ga0207712_100470913 | 164 |
| 848 | 3300025961 | Ga0207712_10124430 | Ga0207712_101244303 | 164 |
| 849 | 3300025961 | Ga0207712_10337687 | Ga0207712_103376871 | 164 |
| 850 | 3300025972 | Ga0207668_10284371 | Ga0207668_102843712 | 164 |
| 851 | 3300025986 | Ga0207658_10165417 | Ga0207658_101654174 | 164 |
| 852 | 3300026023 | Ga0207677_10096602 | Ga0207677_100966023 | 164 |
| 853 | 3300026041 | Ga0207639_10382465 | Ga0207639_103824653 | 164 |
| 854 | 3300026041 | Ga0207639_11831952 | Ga0207639_118319521 | 164 |
| 855 | 3300026067 | Ga0207678_10007751 | Ga0207678_1000775112 | 164 |
| 856 | 3300026075 | Ga0207708_10000352 | Ga0207708_1000035240 | 164 |
| 857 | 3300026075 | Ga0207708_10120002 | Ga0207708_101200021 | 164 |
| 858 | 3300026078 | Ga0207702_10077337 | Ga0207702_100773373 | 164 |
| 859 | 3300026078 | Ga0207702_10179997 | Ga0207702_101799972 | 164 |
| 860 | 3300026078 | Ga0207702_10344670 | Ga0207702_103446702 | 164 |
| 861 | 3300026089 | Ga0207648_10033696 | Ga0207648_100336962 | 164 |
| 862 | 3300026089 | Ga0207648_10628997 | Ga0207648_106289971 | 164 |
| 863 | 3300026095 | Ga0207676_10839413 | Ga0207676_108394132 | 164 |
| 864 | 3300026118 | Ga0207675_100015239 | Ga0207675_1000152392 | 164 |
| 865 | 3300026121 | Ga0207683_10000598 | Ga0207683_1000059825 | 164 |
| 866 | 3300026142 | Ga0207698_11522714 | Ga0207698_115227141 | 164 |
| 867 | 3300027682 | Ga0209971_1115614 | Ga0209971_11156141 | 164 |
| 868 | 3300027907 | Ga0207428_10003848 | Ga0207428_1000384816 | 164 |
| 869 | 3300028381 | Ga0268264_10536801 | Ga0268264_105368012 | 164 |
| 870 | 3300031824 | Ga0307413_10930033 | Ga0307413_109300332 | 164 |
| 871 | 3300031901 | Ga0307406_10059659 | Ga0307406_100596593 | 164 |
| 872 | 3300031901 | Ga0307406_10405464 | Ga0307406_104054642 | 164 |
| 873 | 3300031903 | Ga0307407_10178165 | Ga0307407_101781653 | 164 |
| 874 | 3300031911 | Ga0307412_10062126 | Ga0307412_100621264 | 164 |
| 875 | 3300031995 | Ga0307409_100093471 | Ga0307409_1000934713 | 164 |
| 876 | 3300031995 | Ga0307409_100191056 | Ga0307409_1001910563 | 164 |
| 877 | 3300032002 | Ga0307416_100029255 | Ga0307416_1000292553 | 164 |
| 878 | 3300032002 | Ga0307416_100143683 | Ga0307416_1001436833 | 164 |
| 879 | 3300032002 | Ga0307416_100550000 | Ga0307416_1005500002 | 164 |
| 880 | 3300032005 | Ga0307411_10849615 | Ga0307411_108496152 | 164 |
| 881 | 3300032126 | Ga0307415_100166071 | Ga0307415_1001660712 | 164 |
| 882 | 3300035171 | Ga0373946_0041328 | Ga0373946_0041328_939_1433 | 164 |
| 883 | 3300035695 | Ga0373927_0038793 | Ga0373927_0038793_1720_2220 | 164 |
| 884 | 3300035695 | Ga0373927_0693319 | Ga0373927_0693319_35_535 | 164 |
| 885 | 3300037068 | Ga0373925_0195437 | Ga0373925_0195437_155_649 | 164 |
| 886 | 3300037312 | Ga0395899_0059451 | Ga0395899_0059451_1291_1788 | 164 |
| 887 | 3300037418 | Ga0395900_0016596 | Ga0395900_0016596_4279_4776 | 164 |
| 888 | 3300037418 | Ga0395900_0039392 | Ga0395900_0039392_2789_3328 | 164 |
| 889 | 3300037418 | Ga0395900_0478768 | Ga0395900_0478768_450_953 | 164 |
| 890 | 3300037466 | Ga0395898_0029101 | Ga0395898_0029101_1340_1879 | 164 |
| 891 | 3300037466 | Ga0395898_0201796 | Ga0395898_0201796_1173_1670 | 164 |
| 892 | 3300037471 | Ga0395905_0038521 | Ga0395905_0038521_2735_3232 | 164 |
| 893 | 3300037471 | Ga0395905_0072180 | Ga0395905_0072180_1495_2034 | 164 |
| 894 | 3300037471 | Ga0395905_1201340 | Ga0395905_1201340_82_621 | 164 |
| 895 | 3300038443 | Ga0395901_0024817 | Ga0395901_0024817_1758_2297 | 164 |
| 896 | 3300038443 | Ga0395901_0169160 | Ga0395901_0169160_826_1323 | 164 |
| 897 | 3300038443 | Ga0395901_0182201 | Ga0395901_0182201_485_988 | 164 |
| 898 | 3300038443 | Ga0395901_0263037 | Ga0395901_0263037_1184_1681 | 164 |
| 899 | 3300039437 | Ga0436365_0714445 | Ga0436365_0714445_6600_7103 | 164 |
| 900 | 3300039450 | Ga0436363_1330717 | Ga0436363_1330717_367_870 | 164 |
| 901 | 3300039453 | Ga0436362_0098660 | Ga0436362_0098660_492_995 | 164 |
| 902 | 3300044656 | Ga0466969_0174477 | Ga0466969_0174477_406_906 | 164 |
| 903 | 3300045049 | Ga0466959_0030167 | Ga0466959_0030167_1335_1835 | 164 |
| 904 | 3300045836 | Ga0466958_0113222 | Ga0466958_0113222_1053_1559 | 164 |
| 905 | 3300045976 | Ga0466967_0121170 | Ga0466967_0121170_1838_2338 | 164 |
| 906 | 3300045976 | Ga0466967_0399820 | Ga0466967_0399820_511_1011 | 164 |
| 907 | 3300046472 | Ga0495580_0074948 | Ga0495580_0074948_794_1288 | 164 |
| 908 | 3300046473 | Ga0495582_0711659 | Ga0495582_0711659_38_559 | 164 |
| 909 | 3300046475 | Ga0495639_0028748 | Ga0495639_0028748_1172_1666 | 164 |
| 910 | 3300046491 | Ga0495584_0045009 | Ga0495584_0045009_542_1036 | 164 |
| 911 | 3300046523 | Ga0495644_0096346 | Ga0495644_0096346_72_566 | 164 |
| 912 | 3300046523 | Ga0495644_0136571 | Ga0495644_0136571_393_887 | 164 |
| 913 | 3300046525 | Ga0495663_0286773 | Ga0495663_0286773_28_522 | 164 |
| 914 | 3300046528 | Ga0495642_0089651 | Ga0495642_0089651_683_1177 | 164 |
| 915 | 3300046528 | Ga0495642_0211741 | Ga0495642_0211741_177_671 | 164 |
| 916 | 3300046531 | Ga0495665_0077748 | Ga0495665_0077748_333_827 | 164 |
| 917 | 3300046531 | Ga0495665_0550079 | Ga0495665_0550079_18_512 | 164 |
| 918 | 3300046535 | Ga0495586_0030028 | Ga0495586_0030028_630_1130 | 164 |
| 919 | 3300046538 | Ga0495609_0023638 | Ga0495609_0023638_327_821 | 164 |
| 920 | 3300046616 | Ga0495668_0044275 | Ga0495668_0044275_1486_1980 | 164 |
| 921 | 3300046665 | Ga0495661_0447651 | Ga0495661_0447651_79_573 | 164 |
| 922 | 3300046683 | Ga0495658_0310073 | Ga0495658_0310073_40_534 | 164 |
| 923 | 3300046691 | Ga0495670_0185005 | Ga0495670_0185005_379_873 | 164 |
| 924 | 3300046794 | Ga0495589_0037555 | Ga0495589_0037555_1360_1854 | 164 |
| 925 | 3300047315 | Ga0495581_0001162 | Ga0495581_0001162_11575_12069 | 164 |
| 926 | 3300047315 | Ga0495581_0009944 | Ga0495581_0009944_4570_5064 | 164 |
| 927 | 3300047319 | Ga0495674_0353634 | Ga0495674_0353634_431_931 | 164 |
| 928 | 3300047321 | Ga0495676_0041890 | Ga0495676_0041890_208_702 | 164 |
| 929 | 3300047321 | Ga0495676_0074415 | Ga0495676_0074415_302_796 | 164 |
| 930 | 3300047323 | Ga0495683_0152228 | Ga0495683_0152228_259_753 | 164 |
| 931 | 3300047447 | Ga0495685_103414 | Ga0495685_103414_158_652 | 164 |
| 932 | 3300048903 | Ga0496100_0007236 | Ga0496100_0007236_4623_5117 | 164 |
| 933 | 3300048903 | Ga0496100_0154411 | Ga0496100_0154411_1004_1540 | 164 |
| 934 | 3300048905 | Ga0496102_0032594 | Ga0496102_0032594_2914_3408 | 164 |
| 935 | 3300048906 | Ga0496103_0002529 | Ga0496103_0002529_10108_10602 | 164 |
| 936 | 3300048906 | Ga0496103_0018803 | Ga0496103_0018803_1940_2476 | 164 |
| 937 | 3300048908 | Ga0496105_0038149 | Ga0496105_0038149_1837_2358 | 164 |
| 938 | 3300048908 | Ga0496105_0194167 | Ga0496105_0194167_35_571 | 164 |
| 939 | 3300048909 | Ga0496106_0000412 | Ga0496106_0000412_22271_22807 | 164 |
| 940 | 3300048909 | Ga0496106_0000909 | Ga0496106_0000909_8361_8882 | 164 |
| 941 | 3300048909 | Ga0496106_0480971 | Ga0496106_0480971_29_535 | 164 |
| 942 | 3300048910 | Ga0496107_0004852 | Ga0496107_0004852_6974_7495 | 164 |
| 943 | 3300048911 | Ga0496108_0119825 | Ga0496108_0119825_683_1204 | 164 |
| 944 | 3300048912 | Ga0496109_0093771 | Ga0496109_0093771_1179_1700 | 164 |
| 945 | 3300048914 | Ga0496111_0336399 | Ga0496111_0336399_474_980 | 164 |
| 946 | 3300048915 | Ga0496112_0019479 | Ga0496112_0019479_1290_1811 | 164 |
| 947 | 3300048915 | Ga0496112_0039644 | Ga0496112_0039644_3746_4243 | 164 |
| 948 | 3300048915 | Ga0496112_0161569 | Ga0496112_0161569_156_662 | 164 |
| 949 | 3300048917 | Ga0496114_0087925 | Ga0496114_0087925_1251_1772 | 164 |
| 950 | 3300048918 | Ga0496115_0032095 | Ga0496115_0032095_1449_1970 | 164 |
| 951 | 3300049568 | Ga0501031_0001473 | Ga0501031_0001473_10603_11097 | 164 |
| 952 | 3300049568 | Ga0501031_0403576 | Ga0501031_0403576_256_756 | 164 |
| 953 | 3300049569 | Ga0501032_0248400 | Ga0501032_0248400_506_1006 | 164 |
| 954 | 3300049570 | Ga0501033_0015102 | Ga0501033_0015102_4403_4897 | 164 |
| 955 | 3300049572 | Ga0501036_0424466 | Ga0501036_0424466_138_638 | 164 |
| 956 | 3300049573 | Ga0501037_0036644 | Ga0501037_0036644_2432_2926 | 164 |
| 957 | 3300049574 | Ga0501038_0275907 | Ga0501038_0275907_303_797 | 164 |
| 958 | 3300049575 | Ga0501039_0007983 | Ga0501039_0007983_5573_6067 | 164 |
| 959 | 3300049575 | Ga0501039_0369702 | Ga0501039_0369702_142_642 | 164 |
| 960 | 3300049576 | Ga0501040_0054526 | Ga0501040_0054526_2140_2634 | 164 |
| 961 | 3300049576 | Ga0501040_0320034 | Ga0501040_0320034_149_649 | 164 |
| 962 | 3300049577 | Ga0501041_0057263 | Ga0501041_0057263_1235_1729 | 164 |
| 963 | 3300049577 | Ga0501041_0306163 | Ga0501041_0306163_373_873 | 164 |
| 964 | 3300049578 | Ga0501042_0003275 | Ga0501042_0003275_7402_7896 | 164 |
| 965 | 3300049579 | Ga0501043_0374801 | Ga0501043_0374801_441_941 | 164 |
| 966 | 3300049580 | Ga0501046_0024599 | Ga0501046_0024599_4256_4750 | 164 |
| 967 | 3300049582 | Ga0501048_0007617 | Ga0501048_0007617_1843_2337 | 164 |
| 968 | 3300049582 | Ga0501048_0056682 | Ga0501048_0056682_1369_1869 | 164 |
| 969 | 3300049584 | Ga0501068_0000766 | Ga0501068_0000766_10022_10516 | 164 |
| 970 | 3300049584 | Ga0501068_0006144 | Ga0501068_0006144_193_693 | 164 |
| 971 | 3300049587 | Ga0501071_0007395 | Ga0501071_0007395_888_1382 | 164 |
| 972 | 3300049587 | Ga0501071_0051052 | Ga0501071_0051052_1588_2088 | 164 |
| 973 | 3300049588 | Ga0501072_0030449 | Ga0501072_0030449_3521_4015 | 164 |
| 974 | 3300049588 | Ga0501072_0313163 | Ga0501072_0313163_285_785 | 164 |
| 975 | 3300049589 | Ga0501073_0171185 | Ga0501073_0171185_16_510 | 164 |
| 976 | 3300049589 | Ga0501073_0359240 | Ga0501073_0359240_384_884 | 164 |
| 977 | 3300049590 | Ga0501074_0013240 | Ga0501074_0013240_4418_4912 | 164 |
| 978 | 3300049590 | Ga0501074_0021310 | Ga0501074_0021310_491_991 | 164 |
| 979 | 3300049591 | Ga0501075_0056996 | Ga0501075_0056996_656_1150 | 164 |
| 980 | 3300049591 | Ga0501075_0230449 | Ga0501075_0230449_777_1277 | 164 |
| 981 | 3300049592 | Ga0501076_0004230 | Ga0501076_0004230_7165_7659 | 164 |
| 982 | 3300049592 | Ga0501076_0267969 | Ga0501076_0267969_485_985 | 164 |
| 983 | 3300049593 | Ga0501077_0020161 | Ga0501077_0020161_3350_3844 | 164 |
| 984 | 3300049741 | Ga0501079_0033079 | Ga0501079_0033079_210_704 | 164 |
| 985 | 3300049742 | Ga0501080_0016052 | Ga0501080_0016052_1168_1662 | 164 |
| 986 | 3300049742 | Ga0501080_0185757 | Ga0501080_0185757_1067_1567 | 164 |
| 987 | 3300049743 | Ga0501081_0001718 | Ga0501081_0001718_176_670 | 164 |
| 988 | 3300049743 | Ga0501081_0186675 | Ga0501081_0186675_892_1392 | 164 |
| 989 | 3300049744 | Ga0501083_0045121 | Ga0501083_0045121_124_624 | 164 |
| 990 | 3300049822 | Ga0501035_0172327 | Ga0501035_0172327_516_1010 | 164 |
| 991 | 3300049824 | Ga0501045_0002214 | Ga0501045_0002214_333_827 | 164 |
| 992 | 3300049824 | Ga0501045_0178403 | Ga0501045_0178403_94_594 | 164 |
| 993 | 3300049824 | Ga0501045_1167912 | Ga0501045_1167912_26_520 | 164 |
| 994 | 3300050507 | nmdc:mga05p37_126487_c1 | nmdc:mga05p37_126487_c1_251_754 | 164 |
| 995 | 3300050507 | nmdc:mga05p37_5072_c1 | nmdc:mga05p37_5072_c1_3316_3834 | 164 |
| 996 | 3300050508 | nmdc:mga09592_12562_c1 | nmdc:mga09592_12562_c1_3498_4001 | 164 |
| 997 | 3300050509 | nmdc:mga0qj67_8890_c1 | nmdc:mga0qj67_8890_c1_2301_2804 | 164 |
| 998 | 3300050510 | nmdc:mga06r32_101792_c1 | nmdc:mga06r32_101792_c1_531_1034 | 164 |
| 999 | 3300050510 | nmdc:mga06r32_17560_c1 | nmdc:mga06r32_17560_c1_3266_3769 | 164 |
| 1000 | 3300050511 | nmdc:mga08y16_71787_c1 | nmdc:mga08y16_71787_c1_2341_2844 | 164 |
| 1001 | 3300050513 | nmdc:mga0rr50_345043_c1 | nmdc:mga0rr50_345043_c1_433_969 | 164 |
| 1002 | 3300054114 | Ga0501084_0226242 | Ga0501084_0226242_144_638 | 164 |
| 1003 | 3300054114 | Ga0501084_0438989 | Ga0501084_0438989_492_992 | 164 |
| 1004 | 3300060353 | Ga0501082_0043028 | Ga0501082_0043028_1162_1656 | 164 |
| 1005 | 3300060353 | Ga0501082_0257680 | Ga0501082_0257680_766_1266 | 164 |
| 1006 | 3300061734 | Ga0530510_0379047 | Ga0530510_0379047_96_596 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xuv-assembly2.cif.gz_B-2 | x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. | 0.9483 | 9 | 163 |
| 3pu2-assembly4.cif.gz_D | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9435 | 9 | 162 |
| 3pu2-assembly8.cif.gz_H | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9414 | 9 | 164 |
| 3pu2-assembly1.cif.gz_A | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9393 | 9 | 162 |
| 3pu2-assembly7.cif.gz_G | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9391 | 10 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9384 | 9 | 160 | 3.30.530.20 |
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9283 | 9 | 161 | 3.30.530.20 |
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9038 | 9 | 161 | 3.30.530.20 |
| af_Q2G1U9_1_155_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8877 | 10 | 160 | 3.30.530.20 |
| 2ldkA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8871 | 10 | 162 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9FGY1-F1-model_v4 | ATPase | 0.987 | 7 | 139 |
|
| AF-A0A1H5FJA9-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9805 | 7 | 164 |
|
| AF-A0A537FJU4-F1-model_v4 | ATPase | 0.9795 | 10 | 164 |
|
| AF-A0A4Q5NTU3-F1-model_v4 | ATPase | 0.9782 | 12 | 164 |
|
| AF-A0A0N9I7Y6-F1-model_v4 | ATPase | 0.9781 | 10 | 163 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar