F488010

General Info

Members Datasets Scaffolds Average Seq Length
1006 380 1004 161

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10663068|Ga0207669_106630681
Length 182
Sequence MWFWKTSSERTMTEMAMTSSGTAKVTLPTDRQILITREFDAPKHLVFKAWTTPELVRRWWTTDRGEMTVCEIDLRVGGTWRYVMVTPTGFEVGFHGEFREIVPDERIVSTEAYEGIPDPDGNASLNTLMLTEEDGRTTMTVLVEHPTTEGRDAHINSGMEAGMQDALDLLEQVAVSLRCPPG

Samples

Sample ID Description Type Environment
1 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
2 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
231 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
234 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
235 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
236 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
237 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
238 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
239 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
372 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.1
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 4.67
Rhizosphere 92.25
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10012886 3300002077 Bacteria 1689
2 JGI24034J26672_10046755 3300002239 Bacteria 737
3 JGI24742J22300_10016937 3300002244 Bacteria 1231
4 JGI24751J29686_10014242 3300002459 Bacteria 1642
5 rootL2_10169080 3300003322 Bacteria 2566
6 rootH1_10190481 3300003323 Bacteria 2054
7 JGI25407J50210_10001249 3300003373 Bacteria 5685
8 JGI25407J50210_10001786 3300003373 Bacteria 4950
9 JGI25407J50210_10012016 3300003373 Bacteria 2218
10 JGI25407J50210_10013235 3300003373 Bacteria 2120
11 JGI25407J50210_10030346 3300003373 Bacteria 1401
12 JGI25407J50210_10044455 3300003373 Bacteria 1134
13 JGI25407J50210_10071649 3300003373 Bacteria 865
14 Ga0065704_10356959 3300005289 Bacteria 802
15 Ga0065707_10027577 3300005295 Bacteria 1183
16 Ga0070658_10044365 3300005327 Bacteria 3594
17 Ga0070658_10341023 3300005327 Bacteria 1282
18 Ga0070683_100002180 3300005329 Bacteria 15490
19 Ga0070683_100026791 3300005329 Bacteria 5194
20 Ga0070683_100573030 3300005329 Bacteria 1080
21 Ga0070670_100019042 3300005331 Bacteria 5886
22 Ga0070670_100029292 3300005331 Bacteria 4738
23 Ga0070666_10978875 3300005335 Unclassified 627
24 Ga0070680_100101887 3300005336 Bacteria 2384
25 Ga0070682_100006239 3300005337 Bacteria 6685
26 Ga0070682_100150433 3300005337 Bacteria 1597
27 Ga0070682_100585332 3300005337 Bacteria 879
28 Ga0068868_100028178 3300005338 Bacteria 4292
29 Ga0068868_100139016 3300005338 Bacteria 1992
30 Ga0068868_100388001 3300005338 Bacteria 1203
31 Ga0070660_100025013 3300005339 Bacteria 4435
32 Ga0070660_100079968 3300005339 Bacteria 2564
33 Ga0070660_100354203 3300005339 Bacteria 1209
34 Ga0070689_100043594 3300005340 Bacteria 3449
35 Ga0070689_100874888 3300005340 Bacteria 794
36 Ga0070689_101052385 3300005340 Unclassified 726
37 Ga0070691_10064422 3300005341 Bacteria 1769
38 Ga0070691_10529219 3300005341 Unclassified 686
39 Ga0070661_100312407 3300005344 Unclassified 1226
40 Ga0070692_10056496 3300005345 Bacteria 2055
41 Ga0070692_10112563 3300005345 Bacteria 1507
42 Ga0070692_10290043 3300005345 Bacteria 995
43 Ga0070668_101517915 3300005347 Unclassified 613
44 Ga0070675_100085864 3300005354 Bacteria 2629
45 Ga0070675_100089648 3300005354 Bacteria 2575
46 Ga0070671_100017320 3300005355 Bacteria 5835
47 Ga0070671_100716910 3300005355 Bacteria 868
48 Ga0070674_100068560 3300005356 Bacteria 2499
49 Ga0070674_100145522 3300005356 Bacteria 1783
50 Ga0070674_100851827 3300005356 Bacteria 791
51 Ga0070674_100895523 3300005356 Bacteria 773
52 Ga0070673_100258781 3300005364 Bacteria 1520
53 Ga0070673_101471320 3300005364 Bacteria 642
54 Ga0070688_100003853 3300005365 Bacteria 7778
55 Ga0070688_100010786 3300005365 Bacteria 5050
56 Ga0070688_100266427 3300005365 Bacteria 1226
57 Ga0070659_100100568 3300005366 Bacteria 2327
58 Ga0070659_100180622 3300005366 Bacteria 1732
59 Ga0070659_100512288 3300005366 Unclassified 1024
60 Ga0070667_100150411 3300005367 Bacteria 2045
61 Ga0070667_100860646 3300005367 Bacteria 843
62 Ga0070703_10182562 3300005406 Unclassified 811
63 Ga0070709_10002774 3300005434 Bacteria 9466
64 Ga0070709_10021991 3300005434 Bacteria 3724
65 Ga0070709_10155272 3300005434 Bacteria 1586
66 Ga0070714_100141685 3300005435 Bacteria 2159
67 Ga0070714_100313380 3300005435 Bacteria 1465
68 Ga0070713_100000644 3300005436 Bacteria 22268
69 Ga0070713_100345077 3300005436 Bacteria 1380
70 Ga0070710_10047971 3300005437 Bacteria 2384
71 Ga0070710_10085349 3300005437 Bacteria 1852
72 Ga0070701_10000911 3300005438 Bacteria 10702
73 Ga0070701_10235272 3300005438 Bacteria 1099
74 Ga0070711_100003577 3300005439 Bacteria 9064
75 Ga0070711_100032240 3300005439 Bacteria 3483
76 Ga0070711_100543271 3300005439 Bacteria 963
77 Ga0070705_100165464 3300005440 Bacteria 1483
78 Ga0070705_100220684 3300005440 Bacteria 1312
79 Ga0070700_100000019 3300005441 Bacteria 137133
80 Ga0070700_100001973 3300005441 Bacteria 10413
81 Ga0070700_100474011 3300005441 Bacteria 957
82 Ga0070700_100763868 3300005441 Bacteria 775
83 Ga0070694_100213950 3300005444 Bacteria 1443
84 Ga0070694_100364091 3300005444 Bacteria 1124
85 Ga0070708_100000004 3300005445 Bacteria 168041
86 Ga0070708_100000013 3300005445 Bacteria 130790
87 Ga0070708_100143446 3300005445 Bacteria 2216
88 Ga0070708_100168796 3300005445 Bacteria 2042
89 Ga0070708_100210428 3300005445 Bacteria 1822
90 Ga0070708_100590516 3300005445 Bacteria 1047
91 Ga0070663_100001959 3300005455 Bacteria 11500
92 Ga0070663_100279542 3300005455 Bacteria 1330
93 Ga0070678_100000298 3300005456 Bacteria 23008
94 Ga0070678_101002710 3300005456 Bacteria 768
95 Ga0070662_100234216 3300005457 Bacteria 1470
96 Ga0070662_100333781 3300005457 Bacteria 1239
97 Ga0070662_100497901 3300005457 Unclassified 1016
98 Ga0070681_10105938 3300005458 Bacteria 2753
99 Ga0070681_10198140 3300005458 Bacteria 1927
100 Ga0068867_100002281 3300005459 Bacteria 13492
101 Ga0068867_100217531 3300005459 Bacteria 1538
102 Ga0068867_100245453 3300005459 Bacteria 1454
103 Ga0068867_101403189 3300005459 Bacteria 648
104 Ga0070685_10001824 3300005466 Bacteria 11086
105 Ga0070685_10045060 3300005466 Bacteria 2527
106 Ga0070685_10417112 3300005466 Bacteria 933
107 Ga0070706_100002099 3300005467 Bacteria 20324
108 Ga0070706_100030463 3300005467 Bacteria 4972
109 Ga0070706_100095094 3300005467 Bacteria 2765
110 Ga0070706_100230776 3300005467 Bacteria 1728
111 Ga0070706_100423566 3300005467 Bacteria 1239
112 Ga0070706_100632087 3300005467 Bacteria 994
113 Ga0070706_101324354 3300005467 Unclassified 660
114 Ga0070707_100112202 3300005468 Bacteria 2644
115 Ga0070707_100145063 3300005468 Bacteria 2311
116 Ga0070698_100001121 3300005471 Bacteria 29567
117 Ga0070698_100017945 3300005471 Bacteria 7452
118 Ga0070698_100148954 3300005471 Bacteria 2289
119 Ga0070699_100308970 3300005518 Bacteria 1419
120 Ga0070699_100681427 3300005518 Unclassified 939
121 Ga0070679_100626217 3300005530 Bacteria 1019
122 Ga0070684_100022953 3300005535 Bacteria 5211
123 Ga0070684_100098866 3300005535 Bacteria 2603
124 Ga0070697_100094795 3300005536 Bacteria 2474
125 Ga0070697_100726378 3300005536 Bacteria 877
126 Ga0070697_101141678 3300005536 Bacteria 694
127 Ga0068853_100085008 3300005539 Bacteria 2773
128 Ga0068853_100451004 3300005539 Unclassified 1210
129 Ga0068853_100737097 3300005539 Bacteria 941
130 Ga0070672_100156526 3300005543 Bacteria 1887
131 Ga0070672_100189705 3300005543 Bacteria 1716
132 Ga0070672_100425849 3300005543 Bacteria 1140
133 Ga0070672_101629960 3300005543 Bacteria 579
134 Ga0070686_100007440 3300005544 Bacteria 6112
135 Ga0070686_100177881 3300005544 Bacteria 1510
136 Ga0070686_100194418 3300005544 Bacteria 1450
137 Ga0070695_100161779 3300005545 Bacteria 1572
138 Ga0070695_100332414 3300005545 Bacteria 1133
139 Ga0070695_100686036 3300005545 Bacteria 812
140 Ga0070696_100033756 3300005546 Bacteria 3518
141 Ga0070696_100838396 3300005546 Bacteria 759
142 Ga0070696_101063089 3300005546 Unclassified 679
143 Ga0070696_101652092 3300005546 Unclassified 551
144 Ga0070693_100023513 3300005547 Bacteria 3295
145 Ga0070693_100566900 3300005547 Bacteria 815
146 Ga0070665_100010077 3300005548 Bacteria 9564
147 Ga0070665_100664306 3300005548 Bacteria 1055
148 Ga0070704_100061756 3300005549 Bacteria 2683
149 Ga0070704_100159925 3300005549 Bacteria 1780
150 Ga0068855_100099227 3300005563 Bacteria 3354
151 Ga0068855_100360924 3300005563 Bacteria 1598
152 Ga0068855_100370838 3300005563 Bacteria 1573
153 Ga0070664_100213661 3300005564 Bacteria 1724
154 Ga0070664_100398876 3300005564 Bacteria 1258
155 Ga0070664_100859025 3300005564 Bacteria 850
156 Ga0068857_100048398 3300005577 Bacteria 3775
157 Ga0068857_100875854 3300005577 Bacteria 860
158 Ga0068854_100680788 3300005578 Bacteria 886
159 Ga0068854_101147992 3300005578 Bacteria 694
160 Ga0068856_100064387 3300005614 Bacteria 3622
161 Ga0068856_100132897 3300005614 Bacteria 2494
162 Ga0070702_100023431 3300005615 Bacteria 3280
163 Ga0070702_100201556 3300005615 Bacteria 1318
164 Ga0068852_100002120 3300005616 Bacteria 13586
165 Ga0068859_100090293 3300005617 Bacteria 3115
166 Ga0068859_100187945 3300005617 Bacteria 2150
167 Ga0068864_100031233 3300005618 Bacteria 4518
168 Ga0068864_100449674 3300005618 Bacteria 1232
169 Ga0068866_10014980 3300005718 Bacteria 3436
170 Ga0068866_10687073 3300005718 Bacteria 701
171 Ga0068861_100129398 3300005719 Bacteria 2047
172 Ga0068861_100173532 3300005719 Bacteria 1789
173 Ga0068861_100754414 3300005719 Bacteria 909
174 Ga0068870_10013058 3300005840 Bacteria 3893
175 Ga0068870_10071825 3300005840 Unclassified 1890
176 Ga0068870_10314353 3300005840 Bacteria 993
177 Ga0068858_100457092 3300005842 Bacteria 1231
178 Ga0068860_100585852 3300005843 Bacteria 1120
179 Ga0068860_100941495 3300005843 Bacteria 881
180 Ga0068862_100537714 3300005844 Bacteria 1114
181 Ga0081455_10002336 3300005937 Bacteria 22640
182 Ga0081455_10010331 3300005937 Bacteria 9489
183 Ga0081455_10033792 3300005937 Bacteria 4590
184 Ga0081455_10164872 3300005937 Bacteria 1694
185 Ga0081455_10253055 3300005937 Bacteria 1287
186 Ga0081455_10306136 3300005937 Bacteria 1138
187 Ga0081455_10435948 3300005937 Unclassified 899
188 Ga0081455_10746875 3300005937 Bacteria 619
189 Ga0081455_10801988 3300005937 Bacteria 591
190 Ga0081538_10000080 3300005981 Bacteria 92392
191 Ga0081538_10001298 3300005981 Bacteria 25847
192 Ga0081538_10004845 3300005981 Bacteria 12261
193 Ga0081538_10005194 3300005981 Bacteria 11778
194 Ga0081538_10012727 3300005981 Bacteria 6722
195 Ga0081538_10033686 3300005981 Bacteria 3404
196 Ga0081538_10037456 3300005981 Bacteria 3146
197 Ga0081538_10047783 3300005981 Bacteria 2620
198 Ga0081538_10064994 3300005981 Bacteria 2058
199 Ga0081538_10069277 3300005981 Bacteria 1955
200 Ga0081538_10093919 3300005981 Bacteria 1538
201 Ga0081540_1089780 3300005983 Bacteria 1355
202 Ga0081539_10004373 3300005985 Bacteria 15725
203 Ga0081539_10004479 3300005985 Bacteria 15387
204 Ga0081539_10004534 3300005985 Bacteria 15241
205 Ga0081539_10021672 3300005985 Bacteria 4282
206 Ga0070717_10026595 3300006028 Bacteria 4617
207 Ga0070717_10043111 3300006028 Bacteria 3682
208 Ga0070717_10416523 3300006028 Unclassified 1208
209 Ga0075365_10094395 3300006038 Bacteria 2042
210 Ga0075365_10291808 3300006038 Bacteria 1147
211 Ga0075363_100004072 3300006048 Bacteria 6331
212 Ga0075364_10104373 3300006051 Bacteria 1888
213 Ga0075432_10074702 3300006058 Bacteria 1221
214 Ga0070715_10030275 3300006163 Bacteria 2186
215 Ga0070712_100010895 3300006175 Bacteria 5751
216 Ga0070712_100019749 3300006175 Bacteria 4400
217 Ga0097621_100035448 3300006237 Bacteria 3987
218 Ga0097621_100275461 3300006237 Bacteria 1480
219 Ga0097621_100676068 3300006237 Bacteria 949
220 Ga0068871_100111604 3300006358 Bacteria 2300
221 Ga0068871_101562352 3300006358 Bacteria 624
222 Ga0075428_100000001 3300006844 Bacteria 772630
223 Ga0075428_100001400 3300006844 Bacteria 25647
224 Ga0075428_100011261 3300006844 Bacteria 9948
225 Ga0075428_100018653 3300006844 Bacteria 7669
226 Ga0075428_100030501 3300006844 Bacteria 5963
227 Ga0075428_100031225 3300006844 Bacteria 5891
228 Ga0075428_100037399 3300006844 Bacteria 5344
229 Ga0075428_100188821 3300006844 Bacteria 2229
230 Ga0075428_100689963 3300006844 Bacteria 1088
231 Ga0075428_101143079 3300006844 Bacteria 822
232 Ga0075430_100011247 3300006846 Bacteria 7592
233 Ga0075430_100012632 3300006846 Bacteria 7192
234 Ga0075430_100013658 3300006846 Bacteria 6925
235 Ga0075430_100020823 3300006846 Bacteria 5575
236 Ga0075430_100046260 3300006846 Bacteria 3675
237 Ga0075430_100065973 3300006846 Bacteria 3040
238 Ga0075430_100180353 3300006846 Bacteria 1757
239 Ga0075431_100001828 3300006847 Bacteria 20111
240 Ga0075431_100002312 3300006847 Bacteria 18308
241 Ga0075431_100002400 3300006847 Bacteria 18025
242 Ga0075431_100051929 3300006847 Bacteria 4227
243 Ga0075431_100156012 3300006847 Bacteria 2348
244 Ga0075431_100251724 3300006847 Bacteria 1795
245 Ga0075431_100321009 3300006847 Bacteria 1562
246 Ga0075431_100664114 3300006847 Bacteria 1022
247 Ga0075431_101064587 3300006847 Unclassified 774
248 Ga0075431_101138462 3300006847 Bacteria 744
249 Ga0075431_101246906 3300006847 Bacteria 705
250 Ga0075433_10105815 3300006852 Bacteria 2493
251 Ga0075434_100021747 3300006871 Bacteria 6238
252 Ga0075434_100106982 3300006871 Bacteria 2807
253 Ga0075434_100423453 3300006871 Bacteria 1352
254 Ga0075434_101015932 3300006871 Unclassified 843
255 Ga0075429_100001668 3300006880 Bacteria 18367
256 Ga0075429_100002220 3300006880 Bacteria 16257
257 Ga0075429_100007437 3300006880 Bacteria 9505
258 Ga0075429_100016078 3300006880 Bacteria 6482
259 Ga0075429_100074312 3300006880 Bacteria 2961
260 Ga0075429_100153414 3300006880 Bacteria 2017
261 Ga0075429_100389805 3300006880 Bacteria 1220
262 Ga0075429_100815983 3300006880 Bacteria 817
263 Ga0068865_100031672 3300006881 Bacteria 3527
264 Ga0068865_100383659 3300006881 Bacteria 1147
265 Ga0097620_100090295 3300006931 Bacteria 3115
266 Ga0097620_100187940 3300006931 Bacteria 2150
267 Ga0111539_10142030 3300009094 Bacteria 2810
268 Ga0111539_10629365 3300009094 Bacteria 1249
269 Ga0111539_11149348 3300009094 Bacteria 902
270 Ga0111539_11853150 3300009094 Bacteria 699
271 Ga0105245_10013977 3300009098 Bacteria 6992
272 Ga0105245_10016782 3300009098 Bacteria 6393
273 Ga0105245_10019026 3300009098 Bacteria 6011
274 Ga0105245_10062343 3300009098 Bacteria 3364
275 Ga0105245_10097378 3300009098 Bacteria 2717
276 Ga0105245_10145432 3300009098 Bacteria 2236
277 Ga0105245_10213229 3300009098 Bacteria 1860
278 Ga0105245_10353315 3300009098 Bacteria 1457
279 Ga0105245_10880896 3300009098 Bacteria 936
280 Ga0105247_10135707 3300009101 Bacteria 1607
281 Ga0105247_10586989 3300009101 Bacteria 824
282 Ga0105247_10812925 3300009101 Unclassified 714
283 Ga0114129_10000558 3300009147 Bacteria 45754
284 Ga0114129_10004745 3300009147 Bacteria 19205
285 Ga0114129_10008295 3300009147 Bacteria 14818
286 Ga0114129_10029537 3300009147 Bacteria 7763
287 Ga0114129_10132970 3300009147 Bacteria 3415
288 Ga0114129_10228966 3300009147 Bacteria 2504
289 Ga0114129_10259684 3300009147 Bacteria 2329
290 Ga0114129_10411171 3300009147 Bacteria 1781
291 Ga0114129_10444623 3300009147 Bacteria 1701
292 Ga0105243_10002101 3300009148 Bacteria 16849
293 Ga0105243_10047430 3300009148 Bacteria 3382
294 Ga0105243_10050894 3300009148 Bacteria 3274
295 Ga0105243_10458124 3300009148 Bacteria 1198
296 Ga0105243_10749142 3300009148 Bacteria 957
297 Ga0105243_11518320 3300009148 Bacteria 694
298 Ga0105241_10019097 3300009174 Bacteria 5055
299 Ga0105241_10604290 3300009174 Unclassified 991
300 Ga0105242_10003124 3300009176 Bacteria 12921
301 Ga0105242_10046650 3300009176 Bacteria 3516
302 Ga0105242_10383298 3300009176 Bacteria 1307
303 Ga0105242_10514869 3300009176 Bacteria 1140
304 Ga0105242_10645926 3300009176 Bacteria 1028
305 Ga0105242_10737790 3300009176 Bacteria 968
306 Ga0105248_10021005 3300009177 Bacteria 7235
307 Ga0105248_10384003 3300009177 Bacteria 1581
308 Ga0105237_10126329 3300009545 Unclassified 2552
309 Ga0105237_11415897 3300009545 Unclassified 702
310 Ga0105238_10020762 3300009551 Bacteria 6688
311 Ga0105238_10347713 3300009551 Bacteria 1471
312 Ga0105238_10812284 3300009551 Bacteria 951
313 Ga0105238_11096088 3300009551 Bacteria 819
314 Ga0105249_10002268 3300009553 Bacteria 16680
315 Ga0105249_10175295 3300009553 Bacteria 2082
316 Ga0105249_10255158 3300009553 Bacteria 1740
317 Ga0105239_10006994 3300010375 Bacteria 12987
318 Ga0105239_10061108 3300010375 Bacteria 4135
319 Ga0105239_10077288 3300010375 Bacteria 3663
320 Ga0105239_11083337 3300010375 Bacteria 922
321 Ga0105246_10008465 3300011119 Bacteria 6323
322 Ga0105246_10239241 3300011119 Bacteria 1434
323 Ga0105246_10287054 3300011119 Bacteria 1323
324 Ga0105246_10299589 3300011119 Bacteria 1297
325 Ga0157373_10117165 3300013100 Unclassified 1872
326 Ga0157373_10512682 3300013100 Bacteria 867
327 Ga0157370_10201730 3300013104 Bacteria 1845
328 Ga0157369_10044282 3300013105 Bacteria 4845
329 Ga0157369_10432933 3300013105 Bacteria 1363
330 Ga0157374_10001932 3300013296 Bacteria 17377
331 Ga0157374_10200014 3300013296 Bacteria 1956
332 Ga0157378_10002234 3300013297 Bacteria 17171
333 Ga0157378_10073432 3300013297 Bacteria 3075
334 Ga0157378_10232654 3300013297 Bacteria 1757
335 Ga0163162_10021305 3300013306 Bacteria 6381
336 Ga0163162_10173270 3300013306 Bacteria 2282
337 Ga0163162_10478743 3300013306 Bacteria 1376
338 Ga0157372_10000044 3300013307 Bacteria 152637
339 Ga0157372_10038513 3300013307 Bacteria 5276
340 Ga0157372_10560345 3300013307 Bacteria 1332
341 Ga0157372_10654395 3300013307 Bacteria 1223
342 Ga0157372_10743521 3300013307 Bacteria 1140
343 Ga0157372_11225526 3300013307 Bacteria 867
344 Ga0157375_10055648 3300013308 Bacteria 3902
345 Ga0157375_10081823 3300013308 Bacteria 3270
346 Ga0157375_12047958 3300013308 Unclassified 681
347 Ga0163163_10959857 3300014325 Bacteria 918
348 Ga0163163_10964860 3300014325 Bacteria 916
349 Ga0163163_11734607 3300014325 Unclassified 685
350 Ga0157380_10017866 3300014326 Bacteria 5257
351 Ga0157380_10048637 3300014326 Bacteria 3341
352 Ga0157380_10098071 3300014326 Bacteria 2434
353 Ga0157380_10344463 3300014326 Bacteria 1392
354 Ga0157377_10001693 3300014745 Bacteria 9609
355 Ga0157377_10002176 3300014745 Bacteria 8615
356 Ga0157376_10005356 3300014969 Bacteria 8964
357 Ga0157376_10338043 3300014969 Bacteria 1437
358 Ga0157376_10656357 3300014969 Bacteria 1050
359 Ga0182007_10180910 3300015262 Unclassified 729
360 Ga0163161_10237211 3300017792 Bacteria 1417
361 Ga0206352_11045972 3300020078 Unclassified 1276
362 Ga0213876_10001139 3300021384 Bacteria 16937
363 Ga0213876_10061765 3300021384 Bacteria 1977
364 Ga0213876_10429575 3300021384 Bacteria 703
365 Ga0207692_10113928 3300025898 Bacteria 1504
366 Ga0207692_10142735 3300025898 Bacteria 1363
367 Ga0207642_10054953 3300025899 Bacteria 1818
368 Ga0207688_10001062 3300025901 Bacteria 14061
369 Ga0207688_10030283 3300025901 Bacteria 2984
370 Ga0207688_10140322 3300025901 Bacteria 1422
371 Ga0207680_10023379 3300025903 Bacteria 3374
372 Ga0207685_10049871 3300025905 Bacteria 1610
373 Ga0207699_10030727 3300025906 Bacteria 3009
374 Ga0207699_10046025 3300025906 Bacteria 2549
375 Ga0207643_10038160 3300025908 Bacteria 2698
376 Ga0207643_10273428 3300025908 Bacteria 1046
377 Ga0207643_10343757 3300025908 Unclassified 936
378 Ga0207705_10041106 3300025909 Bacteria 3316
379 Ga0207684_10002784 3300025910 Bacteria 17391
380 Ga0207684_10025581 3300025910 Bacteria 5030
381 Ga0207684_10080635 3300025910 Bacteria 2769
382 Ga0207684_10229690 3300025910 Bacteria 1601
383 Ga0207684_10551004 3300025910 Bacteria 986
384 Ga0207654_10107294 3300025911 Bacteria 1731
385 Ga0207707_10232707 3300025912 Bacteria 1603
386 Ga0207707_10577817 3300025912 Bacteria 953
387 Ga0207695_10017361 3300025913 Bacteria 8375
388 Ga0207671_10061600 3300025914 Unclassified 2784
389 Ga0207693_10007175 3300025915 Bacteria 9179
390 Ga0207693_10027303 3300025915 Bacteria 4513
391 Ga0207693_11135111 3300025915 Bacteria 592
392 Ga0207663_10023106 3300025916 Bacteria 3564
393 Ga0207663_10033549 3300025916 Bacteria 3059
394 Ga0207660_10213841 3300025917 Bacteria 1511
395 Ga0207660_10327152 3300025917 Unclassified 1225
396 Ga0207662_10074295 3300025918 Bacteria 2063
397 Ga0207657_10004070 3300025919 Bacteria 15518
398 Ga0207657_10042720 3300025919 Bacteria 3997
399 Ga0207649_10192131 3300025920 Bacteria 1437
400 Ga0207652_10203122 3300025921 Bacteria 1783
401 Ga0207646_10093355 3300025922 Bacteria 2695
402 Ga0207646_10190259 3300025922 Bacteria 1853
403 Ga0207646_10731728 3300025922 Unclassified 883
404 Ga0207681_10430321 3300025923 Bacteria 1071
405 Ga0207681_10662037 3300025923 Bacteria 866
406 Ga0207694_10439139 3300025924 Bacteria 1089
407 Ga0207650_10001896 3300025925 Bacteria 14752
408 Ga0207687_10019617 3300025927 Bacteria 4481
409 Ga0207687_10105522 3300025927 Bacteria 2082
410 Ga0207687_10114233 3300025927 Bacteria 2009
411 Ga0207687_10139571 3300025927 Bacteria 1837
412 Ga0207687_10300688 3300025927 Bacteria 1292
413 Ga0207687_10688647 3300025927 Bacteria 867
414 Ga0207687_10792171 3300025927 Bacteria 808
415 Ga0207700_10004542 3300025928 Bacteria 8202
416 Ga0207700_10291486 3300025928 Bacteria 1406
417 Ga0207664_10336965 3300025929 Unclassified 1333
418 Ga0207664_11222528 3300025929 Bacteria 670
419 Ga0207690_10103134 3300025932 Bacteria 2041
420 Ga0207690_10153400 3300025932 Bacteria 1710
421 Ga0207706_10065047 3300025933 Bacteria 3211
422 Ga0207706_10252095 3300025933 Bacteria 1542
423 Ga0207686_10014856 3300025934 Bacteria 4346
424 Ga0207686_10130155 3300025934 Bacteria 1725
425 Ga0207686_10174443 3300025934 Bacteria 1519
426 Ga0207686_10263006 3300025934 Bacteria 1266
427 Ga0207686_10359231 3300025934 Bacteria 1099
428 Ga0207686_10554642 3300025934 Bacteria 899
429 Ga0207709_10053457 3300025935 Bacteria 2486
430 Ga0207709_10078175 3300025935 Bacteria 2123
431 Ga0207709_10202272 3300025935 Bacteria 1419
432 Ga0207709_11151089 3300025935 Bacteria 638
433 Ga0207669_10192844 3300025937 Bacteria 1471
434 Ga0207669_10483661 3300025937 Bacteria 987
435 Ga0207669_10545664 3300025937 Bacteria 935
436 Ga0207669_10663068 3300025937 Bacteria 854
437 Ga0207669_11056327 3300025937 Bacteria 684
438 Ga0207669_11361251 3300025937 Bacteria 604
439 Ga0207704_10068214 3300025938 Bacteria 2241
440 Ga0207704_10089184 3300025938 Bacteria 2020
441 Ga0207704_10814641 3300025938 Bacteria 780
442 Ga0207704_11249173 3300025938 Unclassified 634
443 Ga0207691_10044054 3300025940 Bacteria 4109
444 Ga0207691_10081295 3300025940 Bacteria 2913
445 Ga0207691_11541098 3300025940 Bacteria 542
446 Ga0207711_10027079 3300025941 Bacteria 4813
447 Ga0207711_10550662 3300025941 Bacteria 1076
448 Ga0207689_10063901 3300025942 Bacteria 3028
449 Ga0207661_10088693 3300025944 Bacteria 2571
450 Ga0207661_10116773 3300025944 Bacteria 2266
451 Ga0207661_10942868 3300025944 Unclassified 795
452 Ga0207667_10059198 3300025949 Bacteria 4013
453 Ga0207667_10342945 3300025949 Bacteria 1524
454 Ga0207667_11327642 3300025949 Bacteria 695
455 Ga0207651_10074966 3300025960 Bacteria 2412
456 Ga0207651_10225155 3300025960 Bacteria 1519
457 Ga0207651_10257702 3300025960 Bacteria 1430
458 Ga0207651_11003958 3300025960 Unclassified 746
459 Ga0207712_10047091 3300025961 Bacteria 2992
460 Ga0207712_10124430 3300025961 Bacteria 1956
461 Ga0207712_10337687 3300025961 Bacteria 1248
462 Ga0207668_10284371 3300025972 Bacteria 1358
463 Ga0207668_10587553 3300025972 Bacteria 969
464 Ga0207658_10165417 3300025986 Bacteria 1817
465 Ga0207658_10886884 3300025986 Unclassified 812
466 Ga0207677_10096602 3300026023 Bacteria 2162
467 Ga0207677_10697802 3300026023 Bacteria 900
468 Ga0207639_10266393 3300026041 Unclassified 1501
469 Ga0207639_10382465 3300026041 Bacteria 1264
470 Ga0207639_11831952 3300026041 Bacteria 567
471 Ga0207678_10007751 3300026067 Bacteria 9486
472 Ga0207708_10000038 3300026075 Bacteria 137212
473 Ga0207708_10000352 3300026075 Bacteria 36059
474 Ga0207708_10120002 3300026075 Bacteria 2048
475 Ga0207708_10553482 3300026075 Bacteria 970
476 Ga0207708_10843214 3300026075 Bacteria 791
477 Ga0207702_10077337 3300026078 Bacteria 2878
478 Ga0207702_10179997 3300026078 Bacteria 1946
479 Ga0207702_10344670 3300026078 Bacteria 1424
480 Ga0207648_10010765 3300026089 Bacteria 8641
481 Ga0207648_10033696 3300026089 Bacteria 4517
482 Ga0207648_10628997 3300026089 Bacteria 991
483 Ga0207648_10720867 3300026089 Bacteria 925
484 Ga0207676_10085256 3300026095 Bacteria 2577
485 Ga0207676_10839413 3300026095 Bacteria 898
486 Ga0207674_10056049 3300026116 Bacteria 4004
487 Ga0207674_11062369 3300026116 Bacteria 779
488 Ga0207675_100015239 3300026118 Bacteria 7171
489 Ga0207675_100093033 3300026118 Bacteria 2835
490 Ga0207675_100095937 3300026118 Bacteria 2791
491 Ga0207675_100774065 3300026118 Bacteria 972
492 Ga0207675_101005988 3300026118 Bacteria 852
493 Ga0207683_10000598 3300026121 Bacteria 33267
494 Ga0207683_10018999 3300026121 Bacteria 5864
495 Ga0207683_10027452 3300026121 Bacteria 4919
496 Ga0207683_10081091 3300026121 Bacteria 2879
497 Ga0207683_11324708 3300026121 Unclassified 666
498 Ga0207698_11522714 3300026142 Bacteria 684
499 Ga0209971_1115614 3300027682 Bacteria 658
500 Ga0207428_10003848 3300027907 Bacteria 14396
501 Ga0268266_10178244 3300028379 Bacteria 1933
502 Ga0268266_10699066 3300028379 Unclassified 977
503 Ga0268264_10460718 3300028381 Bacteria 1233
504 Ga0268264_10536801 3300028381 Bacteria 1145
505 Ga0307515_10085249 3300028794 Bacteria 4045
506 Ga0307509_10205105 3300031507 Bacteria 1803
507 Ga0307408_100308202 3300031548 Bacteria 1329
508 Ga0307508_10000420 3300031616 Bacteria 50353
509 Ga0307405_10020279 3300031731 Bacteria 3711
510 Ga0307405_10146058 3300031731 Unclassified 1657
511 Ga0307405_10489545 3300031731 Bacteria 983
512 Ga0307405_10591707 3300031731 Bacteria 904
513 Ga0307413_10298435 3300031824 Bacteria 1221
514 Ga0307413_10623271 3300031824 Unclassified 886
515 Ga0307413_10930033 3300031824 Bacteria 740
516 Ga0307410_10077373 3300031852 Bacteria 2325
517 Ga0307410_10093012 3300031852 Bacteria 2145
518 Ga0307410_10102890 3300031852 Bacteria 2050
519 Ga0307410_10171128 3300031852 Bacteria 1637
520 Ga0307410_11133093 3300031852 Bacteria 679
521 Ga0307410_11486261 3300031852 Bacteria 596
522 Ga0307410_11635313 3300031852 Bacteria 570
523 Ga0307410_11916135 3300031852 Bacteria 528
524 Ga0307406_10035066 3300031901 Bacteria 3083
525 Ga0307406_10059659 3300031901 Bacteria 2457
526 Ga0307406_10110519 3300031901 Bacteria 1891
527 Ga0307406_10405464 3300031901 Bacteria 1082
528 Ga0307406_10670829 3300031901 Bacteria 863
529 Ga0307406_10749251 3300031901 Bacteria 820
530 Ga0307407_10178165 3300031903 Bacteria 1406
531 Ga0307407_10262193 3300031903 Unclassified 1189
532 Ga0307407_10553151 3300031903 Bacteria 851
533 Ga0307412_10022635 3300031911 Bacteria 3856
534 Ga0307412_10062126 3300031911 Bacteria 2514
535 Ga0307412_10161211 3300031911 Bacteria 1667
536 Ga0307412_10187220 3300031911 Bacteria 1562
537 Ga0307412_11330258 3300031911 Bacteria 648
538 Ga0307412_11554237 3300031911 Bacteria 603
539 Ga0307409_100031389 3300031995 Bacteria 3833
540 Ga0307409_100040222 3300031995 Bacteria 3478
541 Ga0307409_100045072 3300031995 Bacteria 3327
542 Ga0307409_100093471 3300031995 Bacteria 2471
543 Ga0307409_100108160 3300031995 Bacteria 2325
544 Ga0307409_100191056 3300031995 Bacteria 1823
545 Ga0307409_100239054 3300031995 Bacteria 1652
546 Ga0307409_100241814 3300031995 Bacteria 1644
547 Ga0307409_100519116 3300031995 Bacteria 1163
548 Ga0307409_100598443 3300031995 Bacteria 1089
549 Ga0307409_101190019 3300031995 Bacteria 785
550 Ga0307409_101676653 3300031995 Bacteria 664
551 Ga0307416_100029255 3300032002 Bacteria 4112
552 Ga0307416_100073605 3300032002 Bacteria 2849
553 Ga0307416_100130404 3300032002 Bacteria 2262
554 Ga0307416_100143683 3300032002 Bacteria 2174
555 Ga0307416_100213536 3300032002 Bacteria 1843
556 Ga0307416_100308578 3300032002 Bacteria 1577
557 Ga0307416_100498224 3300032002 Bacteria 1282
558 Ga0307416_100550000 3300032002 Bacteria 1227
559 Ga0307411_10406606 3300032005 Bacteria 1127
560 Ga0307411_10849615 3300032005 Bacteria 807
561 Ga0307411_10986276 3300032005 Bacteria 753
562 Ga0307411_11406160 3300032005 Bacteria 639
563 Ga0307415_100005505 3300032126 Bacteria 6729
564 Ga0307415_100051927 3300032126 Bacteria 2785
565 Ga0307415_100094098 3300032126 Bacteria 2178
566 Ga0307415_100139539 3300032126 Bacteria 1849
567 Ga0307415_100166071 3300032126 Bacteria 1716
568 Ga0307415_100257601 3300032126 Bacteria 1421
569 Ga0307415_100260585 3300032126 Bacteria 1414
570 Ga0307415_100385068 3300032126 Bacteria 1192
571 Ga0307415_100545366 3300032126 Bacteria 1022
572 Ga0307415_100707410 3300032126 Bacteria 910
573 Ga0307415_101054377 3300032126 Bacteria 759
574 Ga0307415_102047336 3300032126 Bacteria 558
575 Ga0307507_10006095 3300033179 Bacteria 18924
576 Ga0307510_10106425 3300033180 Bacteria 2568
577 Ga0373953_0051218 3300035117 Bacteria 1669
578 Ga0373946_0041328 3300035171 Bacteria 1891
579 Ga0373955_0045691 3300035172 Bacteria 2364
580 Ga0373942_0352692 3300035207 Unclassified 520
581 Ga0373924_0043545 3300035410 Bacteria 1844
582 Ga0373927_0038793 3300035695 Bacteria 3092
583 Ga0373927_0693319 3300035695 Bacteria 673
584 Ga0373933_0083969 3300035724 Bacteria 1956
585 Ga0373937_0056651 3300036401 Bacteria 3600
586 Ga0373925_0195437 3300037068 Bacteria 1607
587 Ga0395899_0056100 3300037312 Bacteria 2912
588 Ga0395899_0059451 3300037312 Bacteria 2818
589 Ga0395899_0092453 3300037312 Bacteria 2191
590 Ga0395899_0101868 3300037312 Bacteria 2072
591 Ga0395899_0448408 3300037312 Bacteria 845
592 Ga0395899_0853607 3300037312 Bacteria 559
593 Ga0395900_0016596 3300037418 Bacteria 7510
594 Ga0395900_0035185 3300037418 Bacteria 5159
595 Ga0395900_0039392 3300037418 Bacteria 4869
596 Ga0395900_0094308 3300037418 Bacteria 3074
597 Ga0395900_0100100 3300037418 Bacteria 2977
598 Ga0395900_0130454 3300037418 Bacteria 2576
599 Ga0395900_0159169 3300037418 Bacteria 2304
600 Ga0395900_0212058 3300037418 Bacteria 1955
601 Ga0395900_0478768 3300037418 Bacteria 1198
602 Ga0395900_0855945 3300037418 Bacteria 834
603 Ga0395900_1154486 3300037418 Bacteria 691
604 Ga0395898_0029101 3300037466 Bacteria 5534
605 Ga0395898_0062093 3300037466 Bacteria 3629
606 Ga0395898_0063831 3300037466 Bacteria 3573
607 Ga0395898_0137269 3300037466 Bacteria 2342
608 Ga0395898_0149856 3300037466 Bacteria 2232
609 Ga0395898_0201796 3300037466 Bacteria 1898
610 Ga0395898_0573287 3300037466 Bacteria 1071
611 Ga0395898_0859038 3300037466 Bacteria 846
612 Ga0395905_0008903 3300037471 Bacteria 9860
613 Ga0395905_0038521 3300037471 Bacteria 4487
614 Ga0395905_0062434 3300037471 Bacteria 3485
615 Ga0395905_0072180 3300037471 Bacteria 3236
616 Ga0395905_0090769 3300037471 Bacteria 2864
617 Ga0395905_0465040 3300037471 Bacteria 1163
618 Ga0395905_0769759 3300037471 Bacteria 865
619 Ga0395905_1201340 3300037471 Bacteria 662
620 Ga0436364_0143458 3300037853 Bacteria 2145
621 Ga0436364_0911004 3300037853 Bacteria 1273
622 Ga0395901_0012719 3300038443 Bacteria 8536
623 Ga0395901_0024059 3300038443 Bacteria 6248
624 Ga0395901_0024817 3300038443 Bacteria 6153
625 Ga0395901_0029263 3300038443 Bacteria 5669
626 Ga0395901_0052447 3300038443 Bacteria 4239
627 Ga0395901_0141289 3300038443 Bacteria 2530
628 Ga0395901_0169160 3300038443 Bacteria 2293
629 Ga0395901_0176181 3300038443 Bacteria 2243
630 Ga0395901_0182201 3300038443 Bacteria 2203
631 Ga0395901_0263037 3300038443 Bacteria 1795
632 Ga0395901_0285204 3300038443 Bacteria 1715
633 Ga0395901_0527102 3300038443 Bacteria 1199
634 Ga0395901_0600834 3300038443 Bacteria 1109
635 Ga0395901_0760556 3300038443 Bacteria 961
636 Ga0395901_0857553 3300038443 Bacteria 893
637 Ga0242420_088805 3300038996 Bacteria 646
638 Ga0436365_0572677 3300039437 Bacteria 1499
639 Ga0436365_0714445 3300039437 Bacteria 7977
640 Ga0436365_1125982 3300039437 Bacteria 14552
641 Ga0436365_1558885 3300039437 Bacteria 1011
642 Ga0436363_1330717 3300039450 Bacteria 882
643 Ga0436362_0098660 3300039453 Bacteria 3230
644 Ga0436362_0551951 3300039453 Bacteria 1181
645 Ga0439438_021921 3300041405 Bacteria 1777
646 Ga0439447_150276 3300041407 Bacteria 536
647 Ga0439461_0032900 3300041410 Bacteria 1089
648 Ga0451804_0061489 3300041463 Unclassified 761
649 Ga0439431_0125074 3300041997 Bacteria 719
650 Ga0439433_0003967 3300041999 Bacteria 3184
651 Ga0439448_0000638 3300042005 Bacteria 8281
652 Ga0439448_0043240 3300042005 Bacteria 1462
653 Ga0439448_0075642 3300042005 Bacteria 1126
654 Ga0439448_0200857 3300042005 Bacteria 699
655 Ga0439432_045521 3300042006 Bacteria 1380
656 Ga0439449_0058991 3300042007 Bacteria 1417
657 Ga0439450_003970 3300042008 Bacteria 2490
658 Ga0439451_028332 3300042009 Bacteria 1129
659 Ga0439455_0065293 3300042012 Bacteria 970
660 Ga0439457_108745 3300042014 Bacteria 650
661 Ga0439463_000138 3300042016 Bacteria 18502
662 Ga0439463_020750 3300042016 Bacteria 1640
663 Ga0450914_005594 3300042118 Bacteria 1070
664 Ga0450900_005689 3300042136 Bacteria 1482
665 Ga0450902_030115 3300042137 Bacteria 912
666 Ga0450904_003174 3300042139 Bacteria 1811
667 Ga0450889_002415 3300042144 Bacteria 1862
668 Ga0439446_0000936 3300042156 Bacteria 6300
669 Ga0439434_0014120 3300042435 Bacteria 2376
670 Ga0439434_0034967 3300042435 Bacteria 1535
671 Ga0439444_0000198 3300042437 Bacteria 5670
672 Ga0439464_0000722 3300042439 Bacteria 7178
673 Ga0439464_0017288 3300042439 Bacteria 1955
674 Ga0439460_0003898 3300042461 Bacteria 3622
675 Ga0450916_001215 3300042530 Bacteria 2540
676 Ga0450916_003373 3300042530 Bacteria 1753
677 Ga0439440_0000034 3300042993 Bacteria 17266
678 Ga0439440_0225506 3300042993 Bacteria 563
679 Ga0466969_0174477 3300044656 Unclassified 985
680 Ga0466972_0000769 3300044658 Bacteria 15255
681 Ga0466965_0013377 3300044683 Bacteria 3872
682 Ga0466966_0090811 3300044684 Unclassified 1896
683 Ga0466963_0034613 3300044694 Bacteria 3287
684 Ga0466963_0084521 3300044694 Unclassified 2153
685 Ga0466963_0593965 3300044694 Bacteria 782
686 Ga0466964_0071603 3300044706 Unclassified 1467
687 Ga0466968_0004226 3300044735 Bacteria 5353
688 Ga0466968_0199385 3300044735 Bacteria 937
689 Ga0466970_0052317 3300044765 Bacteria 2180
690 Ga0466960_0008951 3300044901 Bacteria 4115
691 Ga0466959_0030167 3300045049 Bacteria 4016
692 Ga0466959_0401799 3300045049 Unclassified 931
693 Ga0451576_0029001 3300045051 Bacteria 5925
694 Ga0466958_0113222 3300045836 Bacteria 1695
695 Ga0466967_0121170 3300045976 Bacteria 2417
696 Ga0466967_0172412 3300045976 Bacteria 2036
697 Ga0466967_0213264 3300045976 Unclassified 1832
698 Ga0466967_0251925 3300045976 Bacteria 1687
699 Ga0466967_0361282 3300045976 Bacteria 1407
700 Ga0466967_0399820 3300045976 Bacteria 1336
701 Ga0466967_0427373 3300045976 Bacteria 1292
702 Ga0466967_0814679 3300045976 Bacteria 927
703 Ga0466967_1450103 3300045976 Bacteria 684
704 Ga0495592_0010454 3300046454 Bacteria 6999
705 Ga0495651_0015955 3300046462 Bacteria 5818
706 Ga0495651_0044088 3300046462 Bacteria 3457
707 Ga0495653_0014736 3300046463 Bacteria 6377
708 Ga0495653_0097888 3300046463 Bacteria 2130
709 Ga0495580_0021154 3300046472 Bacteria 4803
710 Ga0495580_0074948 3300046472 Bacteria 2362
711 Ga0495582_0711659 3300046473 Bacteria 581
712 Ga0495639_0028748 3300046475 Bacteria 2463
713 Ga0495662_0025272 3300046476 Bacteria 2867
714 Ga0495664_0071104 3300046477 Bacteria 2078
715 Ga0495664_0073997 3300046477 Bacteria 2037
716 Ga0495664_0283595 3300046477 Bacteria 1001
717 Ga0495584_0045009 3300046491 Bacteria 2226
718 Ga0495608_0002082 3300046511 Bacteria 14416
719 Ga0495608_0044868 3300046511 Bacteria 2948
720 Ga0495628_0489342 3300046516 Bacteria 889
721 Ga0495630_0133541 3300046517 Bacteria 1885
722 Ga0495644_0096346 3300046523 Bacteria 1118
723 Ga0495644_0136571 3300046523 Bacteria 936
724 Ga0495663_0286773 3300046525 Bacteria 591
725 Ga0495666_0000798 3300046526 Bacteria 14607
726 Ga0495642_0089651 3300046528 Bacteria 1301
727 Ga0495642_0211741 3300046528 Bacteria 846
728 Ga0495652_0010929 3300046529 Bacteria 8224
729 Ga0495652_0105011 3300046529 Bacteria 2283
730 Ga0495665_0077748 3300046531 Bacteria 1746
731 Ga0495665_0550079 3300046531 Bacteria 579
732 Ga0495640_0020058 3300046533 Bacteria 4927
733 Ga0495640_0021401 3300046533 Bacteria 4746
734 Ga0495586_0029272 3300046535 Bacteria 2947
735 Ga0495586_0030028 3300046535 Bacteria 2910
736 Ga0495586_0034843 3300046535 Bacteria 2704
737 Ga0495587_0005692 3300046536 Bacteria 8126
738 Ga0495587_0062017 3300046536 Bacteria 2190
739 Ga0495609_0023638 3300046538 Bacteria 2824
740 Ga0495645_0062774 3300046543 Bacteria 2690
741 Ga0495667_0001758 3300046559 Bacteria 14385
742 Ga0495667_0200964 3300046559 Bacteria 1275
743 Ga0495668_0044275 3300046616 Bacteria 2474
744 Ga0495634_0042531 3300046642 Bacteria 3081
745 Ga0495635_0000652 3300046663 Bacteria 22295
746 Ga0495635_0077088 3300046663 Bacteria 2283
747 Ga0495661_0447651 3300046665 Bacteria 622
748 Ga0495657_0010805 3300046675 Bacteria 6856
749 Ga0495657_0029227 3300046675 Bacteria 3867
750 Ga0495599_0233927 3300046678 Unclassified 1121
751 Ga0495623_0046457 3300046679 Bacteria 2755
752 Ga0495623_0296496 3300046679 Bacteria 895
753 Ga0495646_0012623 3300046680 Bacteria 5368
754 Ga0495646_0040290 3300046680 Bacteria 2878
755 Ga0495658_0310073 3300046683 Bacteria 999
756 Ga0495613_0245919 3300046689 Unclassified 1249
757 Ga0495670_0185005 3300046691 Bacteria 1101
758 Ga0495589_0037555 3300046794 Bacteria 2427
759 Ga0495589_0587703 3300046794 Bacteria 507
760 Ga0495600_0002592 3300046809 Bacteria 10421
761 Ga0495600_0116295 3300046809 Unclassified 1740
762 Ga0495581_0001162 3300047315 Bacteria 14417
763 Ga0495581_0009944 3300047315 Bacteria 5503
764 Ga0495604_0001127 3300047317 Bacteria 22177
765 Ga0495604_0048073 3300047317 Bacteria 3319
766 Ga0495636_0170135 3300047318 Bacteria 985
767 Ga0495674_0031369 3300047319 Bacteria 4828
768 Ga0495674_0353634 3300047319 Bacteria 1192
769 Ga0495676_0041890 3300047321 Bacteria 3765
770 Ga0495676_0074415 3300047321 Bacteria 2601
771 Ga0495676_0390601 3300047321 Bacteria 925
772 Ga0495680_0007779 3300047322 Bacteria 9787
773 Ga0495683_0152228 3300047323 Bacteria 1076
774 Ga0495675_0121623 3300047444 Bacteria 1625
775 Ga0495685_103414 3300047447 Bacteria 940
776 Ga0495684_0176382 3300047471 Unclassified 1586
777 Ga0495593_0037005 3300047673 Bacteria 2643
778 Ga0495602_0029482 3300048088 Bacteria 5223
779 Ga0495602_0031985 3300048088 Bacteria 4961
780 Ga0496100_0007236 3300048903 Bacteria 6104
781 Ga0496100_0154411 3300048903 Bacteria 1640
782 Ga0496101_0007633 3300048904 Bacteria 7024
783 Ga0496101_0203559 3300048904 Bacteria 1531
784 Ga0496102_0001033 3300048905 Bacteria 25892
785 Ga0496102_0032594 3300048905 Bacteria 4680
786 Ga0496102_0046025 3300048905 Bacteria 3962
787 Ga0496102_0580131 3300048905 Bacteria 1044
788 Ga0496103_0002529 3300048906 Bacteria 11459
789 Ga0496103_0018803 3300048906 Bacteria 4148
790 Ga0496104_0111596 3300048907 Bacteria 2622
791 Ga0496104_0418076 3300048907 Unclassified 1253
792 Ga0496104_0456123 3300048907 Bacteria 1190
793 Ga0496105_0038149 3300048908 Bacteria 3958
794 Ga0496105_0194167 3300048908 Bacteria 1659
795 Ga0496106_0000412 3300048909 Bacteria 30346
796 Ga0496106_0000909 3300048909 Bacteria 21550
797 Ga0496106_0480971 3300048909 Bacteria 998
798 Ga0496107_0004852 3300048910 Bacteria 9134
799 Ga0496107_0024165 3300048910 Bacteria 4298
800 Ga0496108_0119825 3300048911 Bacteria 2256
801 Ga0496108_1019163 3300048911 Bacteria 706
802 Ga0496109_0015252 3300048912 Bacteria 6690
803 Ga0496109_0023202 3300048912 Bacteria 5505
804 Ga0496109_0093771 3300048912 Bacteria 2778
805 Ga0496109_0300273 3300048912 Bacteria 1514
806 Ga0496109_0468462 3300048912 Bacteria 1190
807 Ga0496109_0956571 3300048912 Bacteria 794
808 Ga0496110_0333080 3300048913 Bacteria 1383
809 Ga0496110_0888893 3300048913 Bacteria 797
810 Ga0496111_0336399 3300048914 Bacteria 1118
811 Ga0496111_0421973 3300048914 Bacteria 985
812 Ga0496111_0529795 3300048914 Bacteria 866
813 Ga0496111_1105673 3300048914 Bacteria 565
814 Ga0496112_0019479 3300048915 Bacteria 6406
815 Ga0496112_0039644 3300048915 Bacteria 4604
816 Ga0496112_0055459 3300048915 Bacteria 3897
817 Ga0496112_0161569 3300048915 Bacteria 2207
818 Ga0496112_0626369 3300048915 Bacteria 1006
819 Ga0496112_0698845 3300048915 Bacteria 942
820 Ga0496113_0230116 3300048916 Bacteria 1478
821 Ga0496113_0590657 3300048916 Bacteria 889
822 Ga0496113_1194662 3300048916 Bacteria 594
823 Ga0496114_0044843 3300048917 Bacteria 3671
824 Ga0496114_0087925 3300048917 Bacteria 2635
825 Ga0496115_0032095 3300048918 Bacteria 4142
826 Ga0496124_0118037 3300048927 Bacteria 2124
827 Ga0496125_0402036 3300048928 Bacteria 800
828 Ga0496126_0512794 3300048929 Bacteria 957
829 Ga0501031_0001473 3300049568 Bacteria 14623
830 Ga0501031_0006569 3300049568 Bacteria 7589
831 Ga0501031_0292848 3300049568 Bacteria 1055
832 Ga0501031_0403576 3300049568 Bacteria 884
833 Ga0501032_0175907 3300049569 Bacteria 1402
834 Ga0501032_0248400 3300049569 Bacteria 1155
835 Ga0501032_0662884 3300049569 Bacteria 662
836 Ga0501033_0015102 3300049570 Bacteria 5860
837 Ga0501033_0045546 3300049570 Bacteria 3264
838 Ga0501036_0005119 3300049572 Bacteria 10597
839 Ga0501036_0269524 3300049572 Bacteria 1425
840 Ga0501036_0424466 3300049572 Bacteria 1108
841 Ga0501036_0565577 3300049572 Unclassified 944
842 Ga0501037_0036644 3300049573 Bacteria 3614
843 Ga0501037_0133862 3300049573 Bacteria 1776
844 Ga0501038_0018052 3300049574 Bacteria 6373
845 Ga0501038_0029451 3300049574 Bacteria 4864
846 Ga0501038_0070139 3300049574 Bacteria 2976
847 Ga0501038_0275907 3300049574 Bacteria 1324
848 Ga0501039_0007983 3300049575 Bacteria 8064
849 Ga0501039_0012794 3300049575 Bacteria 6414
850 Ga0501039_0099563 3300049575 Bacteria 2268
851 Ga0501039_0369702 3300049575 Bacteria 1126
852 Ga0501040_0001208 3300049576 Bacteria 16453
853 Ga0501040_0054526 3300049576 Bacteria 2740
854 Ga0501040_0095196 3300049576 Bacteria 2072
855 Ga0501040_0320034 3300049576 Bacteria 1109
856 Ga0501040_0323348 3300049576 Bacteria 1103
857 Ga0501040_1039554 3300049576 Bacteria 594
858 Ga0501041_0000325 3300049577 Bacteria 23165
859 Ga0501041_0026009 3300049577 Bacteria 3518
860 Ga0501041_0057263 3300049577 Bacteria 2383
861 Ga0501041_0306163 3300049577 Bacteria 1001
862 Ga0501041_0379992 3300049577 Bacteria 894
863 Ga0501042_0003275 3300049578 Bacteria 10133
864 Ga0501042_0018833 3300049578 Bacteria 4785
865 Ga0501042_0380820 3300049578 Bacteria 1021
866 Ga0501043_0021978 3300049579 Bacteria 5004
867 Ga0501043_0374801 3300049579 Bacteria 1078
868 Ga0501046_0000797 3300049580 Bacteria 30550
869 Ga0501046_0024599 3300049580 Bacteria 4938
870 Ga0501046_0128032 3300049580 Bacteria 1927
871 Ga0501047_0034089 3300049581 Bacteria 4916
872 Ga0501048_0000036 3300049582 Bacteria 64488
873 Ga0501048_0007617 3300049582 Bacteria 8206
874 Ga0501048_0010777 3300049582 Bacteria 6816
875 Ga0501048_0056682 3300049582 Bacteria 2779
876 Ga0501067_0243415 3300049583 Bacteria 1001
877 Ga0501067_0316772 3300049583 Bacteria 869
878 Ga0501067_0516524 3300049583 Unclassified 668
879 Ga0501068_0000766 3300049584 Bacteria 16539
880 Ga0501068_0006144 3300049584 Bacteria 6606
881 Ga0501068_0006916 3300049584 Bacteria 6275
882 Ga0501068_0061878 3300049584 Bacteria 2275
883 Ga0501068_0068378 3300049584 Bacteria 2165
884 Ga0501069_0053634 3300049585 Bacteria 2245
885 Ga0501070_0474160 3300049586 Bacteria 1007
886 Ga0501071_0007395 3300049587 Bacteria 7207
887 Ga0501071_0013741 3300049587 Bacteria 5522
888 Ga0501071_0015621 3300049587 Bacteria 5213
889 Ga0501071_0051052 3300049587 Bacteria 2979
890 Ga0501071_0302647 3300049587 Bacteria 1212
891 Ga0501072_0003418 3300049588 Bacteria 11959
892 Ga0501072_0008710 3300049588 Bacteria 7702
893 Ga0501072_0030449 3300049588 Bacteria 4220
894 Ga0501072_0313163 3300049588 Bacteria 1247
895 Ga0501073_0171185 3300049589 Bacteria 1503
896 Ga0501073_0359240 3300049589 Bacteria 1006
897 Ga0501073_0597059 3300049589 Bacteria 762
898 Ga0501074_0000150 3300049590 Bacteria 36162
899 Ga0501074_0013240 3300049590 Bacteria 5997
900 Ga0501074_0020627 3300049590 Bacteria 4790
901 Ga0501074_0021310 3300049590 Bacteria 4706
902 Ga0501074_0571226 3300049590 Bacteria 800
903 Ga0501075_0001381 3300049591 Bacteria 15784
904 Ga0501075_0056996 3300049591 Bacteria 2941
905 Ga0501075_0190484 3300049591 Bacteria 1564
906 Ga0501075_0230449 3300049591 Bacteria 1412
907 Ga0501076_0001172 3300049592 Bacteria 17362
908 Ga0501076_0004230 3300049592 Bacteria 10157
909 Ga0501076_0022415 3300049592 Bacteria 4854
910 Ga0501076_0033773 3300049592 Bacteria 3995
911 Ga0501076_0267969 3300049592 Bacteria 1398
912 Ga0501076_0571377 3300049592 Bacteria 932
913 Ga0501076_0691081 3300049592 Bacteria 842
914 Ga0501077_0001661 3300049593 Bacteria 13376
915 Ga0501077_0020161 3300049593 Bacteria 4220
916 Ga0501077_0025569 3300049593 Bacteria 3749
917 Ga0501077_0391911 3300049593 Bacteria 887
918 Ga0501079_0000484 3300049741 Bacteria 26174
919 Ga0501079_0002866 3300049741 Bacteria 12579
920 Ga0501079_0029292 3300049741 Bacteria 4227
921 Ga0501079_0033079 3300049741 Bacteria 3976
922 Ga0501080_0014998 3300049742 Bacteria 7137
923 Ga0501080_0016052 3300049742 Bacteria 6911
924 Ga0501080_0185757 3300049742 Bacteria 1911
925 Ga0501081_0001297 3300049743 Bacteria 15225
926 Ga0501081_0001718 3300049743 Bacteria 13595
927 Ga0501081_0010006 3300049743 Bacteria 6184
928 Ga0501081_0186675 3300049743 Bacteria 1500
929 Ga0501083_0023285 3300049744 Bacteria 4297
930 Ga0501083_0045121 3300049744 Bacteria 2982
931 Ga0501083_0538079 3300049744 Bacteria 760
932 Ga0501035_0095957 3300049822 Bacteria 2606
933 Ga0501035_0172327 3300049822 Bacteria 1869
934 Ga0501035_0187618 3300049822 Bacteria 1779
935 Ga0501045_0001086 3300049824 Bacteria 17975
936 Ga0501045_0002214 3300049824 Bacteria 13191
937 Ga0501045_0013896 3300049824 Bacteria 5695
938 Ga0501045_0178403 3300049824 Bacteria 1582
939 Ga0501045_1167912 3300049824 Bacteria 562
940 nmdc:mga03n38_412430_c1 3300050490 Bacteria 745
941 nmdc:mga00v17_209835_c1 3300050491 Bacteria 1260
942 nmdc:mga0yw44_308747_c1 3300050492 Bacteria 1061
943 nmdc:mga05p37_126487_c1 3300050507 Bacteria 3139
944 nmdc:mga05p37_1526_c2 3300050507 Bacteria 4825
945 nmdc:mga05p37_19939_c1 3300050507 Bacteria 8113
946 nmdc:mga05p37_288519_c1 3300050507 Bacteria 1954
947 nmdc:mga05p37_5072_c1 3300050507 Bacteria 15436
948 nmdc:mga05p37_755588_c1 3300050507 Bacteria 1071
949 nmdc:mga05p37_906041_c1 3300050507 Bacteria 950
950 nmdc:mga09592_10687_c1 3300050508 Bacteria 7472
951 nmdc:mga09592_12562_c1 3300050508 Bacteria 6900
952 nmdc:mga09592_147271_c1 3300050508 Bacteria 2030
953 nmdc:mga09592_23642_c1 3300050508 Bacteria 5076
954 nmdc:mga09592_69089_c1 3300050508 Bacteria 2997
955 nmdc:mga0qj67_12451_c1 3300050509 Bacteria 6407
956 nmdc:mga0qj67_215072_c1 3300050509 Bacteria 1561
957 nmdc:mga0qj67_256849_c1 3300050509 Bacteria 1418
958 nmdc:mga0qj67_682_c1 3300050509 Bacteria 23124
959 nmdc:mga0qj67_79852_c1 3300050509 Bacteria 2620
960 nmdc:mga0qj67_8890_c1 3300050509 Bacteria 7452
961 nmdc:mga06r32_1013178_c1 3300050510 Bacteria 783
962 nmdc:mga06r32_101792_c1 3300050510 Bacteria 2819
963 nmdc:mga06r32_1033851_c1 3300050510 Unclassified 773
964 nmdc:mga06r32_1159967_c1 3300050510 Bacteria 720
965 nmdc:mga06r32_121285_c1 3300050510 Bacteria 2579
966 nmdc:mga06r32_17560_c1 3300050510 Bacteria 6533
967 nmdc:mga06r32_270066_c1 3300050510 Bacteria 1688
968 nmdc:mga06r32_47948_c1 3300050510 Bacteria 4083
969 nmdc:mga06r32_513974_c1 3300050510 Bacteria 1174
970 nmdc:mga06r32_529362_c1 3300050510 Bacteria 1154
971 nmdc:mga06r32_8661_c1 3300050510 Bacteria 9168
972 nmdc:mga08y16_183889_c1 3300050511 Bacteria 2169
973 nmdc:mga08y16_71787_c1 3300050511 Bacteria 3608
974 nmdc:mga08y16_860166_c1 3300050511 Bacteria 895
975 nmdc:mga0n895_107760_c1 3300050512 Bacteria 2800
976 nmdc:mga0n895_285588_c1 3300050512 Bacteria 1673
977 nmdc:mga0rr50_345043_c1 3300050513 Bacteria 1251
978 Ga0495601_0021975 3300053077 Bacteria 3913
979 Ga0495619_0030537 3300053085 Bacteria 3489
980 Ga0495619_0032124 3300053085 Bacteria 3405
981 Ga0500573_0432977 3300053140 Unclassified 613
982 Ga0500624_066243 3300053157 Unclassified 699
983 Ga0501084_0000305 3300054114 Bacteria 37251
984 Ga0501084_0226242 3300054114 Bacteria 1578
985 Ga0501084_0364084 3300054114 Bacteria 1222
986 Ga0501084_0438989 3300054114 Bacteria 1103
987 Ga0501084_0590748 3300054114 Bacteria 938
988 Ga0501084_0817489 3300054114 Bacteria 785
989 Ga0590071_009882 3300059421 Bacteria 2237
990 Ga0590074_003839 3300059423 Bacteria 2490
991 Ga0590075_001480 3300059424 Bacteria 5863
992 Ga0590077_033627 3300059426 Bacteria 1125
993 Ga0501082_0000727 3300060353 Bacteria 29005
994 Ga0501082_0018363 3300060353 Bacteria 6023
995 Ga0501082_0019758 3300060353 Bacteria 5810
996 Ga0501082_0043028 3300060353 Bacteria 3893
997 Ga0501082_0123879 3300060353 Bacteria 2241
998 Ga0501082_0226125 3300060353 Bacteria 1628
999 Ga0501082_0257680 3300060353 Bacteria 1517
1000 Ga0466962_0211267 3300061719 Bacteria 949
1001 Ga0530510_0002334 3300061734 Bacteria 13021
1002 Ga0530510_0057210 3300061734 Bacteria 2817
1003 Ga0530510_0087182 3300061734 Bacteria 2275
1004 Ga0530510_0379047 3300061734 Bacteria 1064

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10064994 Ga0081538_100649943 133
2 3300009148 Ga0105243_10749142 Ga0105243_107491421 136
3 3300046462 Ga0495651_0044088 Ga0495651_0044088_2029_2514 137
4 3300046463 Ga0495653_0097888 Ga0495653_0097888_1361_1846 137
5 3300046472 Ga0495580_0021154 Ga0495580_0021154_2378_2863 137
6 3300046476 Ga0495662_0025272 Ga0495662_0025272_1654_2139 137
7 3300046477 Ga0495664_0073997 Ga0495664_0073997_1081_1566 137
8 3300046511 Ga0495608_0044868 Ga0495608_0044868_1326_1811 137
9 3300046517 Ga0495630_0133541 Ga0495630_0133541_479_964 137
10 3300046526 Ga0495666_0000798 Ga0495666_0000798_1349_1834 137
11 3300046529 Ga0495652_0105011 Ga0495652_0105011_855_1340 137
12 3300046533 Ga0495640_0020058 Ga0495640_0020058_2726_3211 137
13 3300046535 Ga0495586_0029272 Ga0495586_0029272_694_1179 137
14 3300046536 Ga0495587_0005692 Ga0495587_0005692_205_690 137
15 3300046543 Ga0495645_0062774 Ga0495645_0062774_1068_1553 137
16 3300046559 Ga0495667_0200964 Ga0495667_0200964_440_925 137
17 3300046642 Ga0495634_0042531 Ga0495634_0042531_1242_1727 137
18 3300046663 Ga0495635_0077088 Ga0495635_0077088_944_1429 137
19 3300046675 Ga0495657_0010805 Ga0495657_0010805_158_643 137
20 3300046678 Ga0495599_0233927 Ga0495599_0233927_286_771 137
21 3300046679 Ga0495623_0046457 Ga0495623_0046457_1327_1812 137
22 3300046680 Ga0495646_0012623 Ga0495646_0012623_4598_5083 137
23 3300046689 Ga0495613_0245919 Ga0495613_0245919_479_964 137
24 3300046809 Ga0495600_0116295 Ga0495600_0116295_312_797 137
25 3300047317 Ga0495604_0001127 Ga0495604_0001127_17811_18296 137
26 3300047444 Ga0495675_0121623 Ga0495675_0121623_351_836 137
27 3300047471 Ga0495684_0176382 Ga0495684_0176382_944_1429 137
28 3300047673 Ga0495593_0037005 Ga0495593_0037005_286_771 137
29 3300048088 Ga0495602_0031985 Ga0495602_0031985_1238_1723 137
30 3300053077 Ga0495601_0021975 Ga0495601_0021975_1110_1595 137
31 3300053085 Ga0495619_0032124 Ga0495619_0032124_369_854 137
32 3300053140 Ga0500573_0432977 Ga0500573_0432977_86_571 137
33 3300053157 Ga0500624_066243 Ga0500624_066243_112_597 137
34 3300006846 Ga0075430_100046260 Ga0075430_1000462603 138
35 3300006880 Ga0075429_100153414 Ga0075429_1001534142 138
36 3300050508 nmdc:mga09592_147271_c1 nmdc:mga09592_147271_c1_482_985 138
37 3300050509 nmdc:mga0qj67_12451_c1 nmdc:mga0qj67_12451_c1_2144_2647 138
38 3300005937 Ga0081455_10253055 Ga0081455_102530552 139
39 3300037418 Ga0395900_0100100 Ga0395900_0100100_1972_2427 141
40 3300061719 Ga0466962_0211267 Ga0466962_0211267_80_577 142
41 3300009147 Ga0114129_10228966 Ga0114129_102289662 143
42 3300050508 nmdc:mga09592_23642_c1 nmdc:mga09592_23642_c1_3383_3883 143
43 3300050509 nmdc:mga0qj67_256849_c1 nmdc:mga0qj67_256849_c1_81_581 143
44 3300050510 nmdc:mga06r32_47948_c1 nmdc:mga06r32_47948_c1_3214_3714 143
45 3300005981 Ga0081538_10005194 Ga0081538_100051948 144
46 3300014325 Ga0163163_10964860 Ga0163163_109648601 144
47 3300025901 Ga0207688_10030283 Ga0207688_100302832 144
48 3300026116 Ga0207674_11062369 Ga0207674_110623692 144
49 3300050511 nmdc:mga08y16_860166_c1 nmdc:mga08y16_860166_c1_356_835 144
50 3300009094 Ga0111539_11853150 Ga0111539_118531501 145
51 3300042005 Ga0439448_0000638 Ga0439448_0000638_3095_3589 145
52 3300042005 Ga0439448_0075642 Ga0439448_0075642_572_1060 145
53 3300042008 Ga0439450_003970 Ga0439450_003970_1816_2310 145
54 3300042009 Ga0439451_028332 Ga0439451_028332_489_983 145
55 3300042012 Ga0439455_0065293 Ga0439455_0065293_244_738 145
56 3300042016 Ga0439463_000138 Ga0439463_000138_128_622 145
57 3300042118 Ga0450914_005594 Ga0450914_005594_161_655 145
58 3300042136 Ga0450900_005689 Ga0450900_005689_844_1338 145
59 3300042137 Ga0450902_030115 Ga0450902_030115_321_815 145
60 3300042139 Ga0450904_003174 Ga0450904_003174_876_1370 145
61 3300042144 Ga0450889_002415 Ga0450889_002415_1191_1685 145
62 3300042437 Ga0439444_0000198 Ga0439444_0000198_2994_3488 145
63 3300042439 Ga0439464_0000722 Ga0439464_0000722_4245_4739 145
64 3300042461 Ga0439460_0003898 Ga0439460_0003898_2295_2789 145
65 3300042530 Ga0450916_001215 Ga0450916_001215_64_558 145
66 3300042993 Ga0439440_0000034 Ga0439440_0000034_2617_3111 145
67 3300044694 Ga0466963_0084521 Ga0466963_0084521_1587_2084 145
68 3300044706 Ga0466964_0071603 Ga0466964_0071603_430_927 145
69 3300045049 Ga0466959_0401799 Ga0466959_0401799_306_803 145
70 3300045976 Ga0466967_0213264 Ga0466967_0213264_623_1120 145
71 3300005435 Ga0070714_100141685 Ga0070714_1001416852 146
72 3300005937 Ga0081455_10010331 Ga0081455_100103315 146
73 3300031852 Ga0307410_11133093 Ga0307410_111330932 146
74 3300031995 Ga0307409_100239054 Ga0307409_1002390543 146
75 3300032126 Ga0307415_100707410 Ga0307415_1007074102 146
76 3300006847 Ga0075431_100251724 Ga0075431_1002517243 147
77 3300013307 Ga0157372_10000044 Ga0157372_1000004493 147
78 3300031731 Ga0307405_10146058 Ga0307405_101460582 147
79 3300031824 Ga0307413_10623271 Ga0307413_106232712 147
80 3300031852 Ga0307410_10102890 Ga0307410_101028903 147
81 3300031903 Ga0307407_10262193 Ga0307407_102621932 147
82 3300031995 Ga0307409_100045072 Ga0307409_1000450724 147
83 3300032126 Ga0307415_100051927 Ga0307415_1000519272 147
84 3300032126 Ga0307415_102047336 Ga0307415_1020473361 147
85 3300047321 Ga0495676_0390601 Ga0495676_0390601_298_801 147
86 3300005437 Ga0070710_10085349 Ga0070710_100853492 148
87 3300025898 Ga0207692_10113928 Ga0207692_101139282 148
88 3300044694 Ga0466963_0593965 Ga0466963_0593965_190_675 148
89 3300046794 Ga0495589_0587703 Ga0495589_0587703_47_493 148
90 3300037466 Ga0395898_0137269 Ga0395898_0137269_1779_2282 149
91 3300006844 Ga0075428_100031225 Ga0075428_1000312251 150
92 3300006846 Ga0075430_100012632 Ga0075430_1000126328 150
93 3300006847 Ga0075431_100156012 Ga0075431_1001560122 150
94 3300006880 Ga0075429_100007437 Ga0075429_1000074379 150
95 3300049584 Ga0501068_0061878 Ga0501068_0061878_336_824 150
96 3300009147 Ga0114129_10259684 Ga0114129_102596842 151
97 3300041407 Ga0439447_150276 Ga0439447_150276_53_508 151
98 3300042156 Ga0439446_0000936 Ga0439446_0000936_2446_2901 151
99 3300049583 Ga0501067_0516524 Ga0501067_0516524_144_638 151
100 3300050507 nmdc:mga05p37_288519_c1 nmdc:mga05p37_288519_c1_646_1134 151
101 3300002459 JGI24751J29686_10014242 JGI24751J29686_100142421 152
102 3300005331 Ga0070670_100019042 Ga0070670_1000190428 152
103 3300005341 Ga0070691_10529219 Ga0070691_105292191 152
104 3300005577 Ga0068857_100048398 Ga0068857_1000483982 152
105 3300005840 Ga0068870_10013058 Ga0068870_100130582 152
106 3300006358 Ga0068871_100111604 Ga0068871_1001116042 152
107 3300006844 Ga0075428_100037399 Ga0075428_1000373992 152
108 3300006847 Ga0075431_100664114 Ga0075431_1006641142 152
109 3300009147 Ga0114129_10029537 Ga0114129_1002953710 152
110 3300009147 Ga0114129_10132970 Ga0114129_101329703 152
111 3300011119 Ga0105246_10299589 Ga0105246_102995892 152
112 3300025908 Ga0207643_10038160 Ga0207643_100381605 152
113 3300025925 Ga0207650_10001896 Ga0207650_1000189612 152
114 3300026075 Ga0207708_10843214 Ga0207708_108432142 152
115 3300026089 Ga0207648_10720867 Ga0207648_107208672 152
116 3300037418 Ga0395900_1154486 Ga0395900_1154486_166_660 152
117 3300049591 Ga0501075_0190484 Ga0501075_0190484_13_501 152
118 3300050507 nmdc:mga05p37_19939_c1 nmdc:mga05p37_19939_c1_4554_5087 152
119 3300050510 nmdc:mga06r32_513974_c1 nmdc:mga06r32_513974_c1_332_826 152
120 3300050510 nmdc:mga06r32_8661_c1 nmdc:mga06r32_8661_c1_8501_9013 152
121 3300050511 nmdc:mga08y16_183889_c1 nmdc:mga08y16_183889_c1_522_1016 152
122 3300003373 JGI25407J50210_10071649 JGI25407J50210_100716492 153
123 3300005338 Ga0068868_100388001 Ga0068868_1003880011 153
124 3300005347 Ga0070668_101517915 Ga0070668_1015179151 153
125 3300005459 Ga0068867_100245453 Ga0068867_1002454532 153
126 3300005466 Ga0070685_10417112 Ga0070685_104171122 153
127 3300005981 Ga0081538_10037456 Ga0081538_100374564 153
128 3300006237 Ga0097621_100676068 Ga0097621_1006760683 153
129 3300009098 Ga0105245_10213229 Ga0105245_102132292 153
130 3300013308 Ga0157375_10055648 Ga0157375_100556487 153
131 3300014325 Ga0163163_10959857 Ga0163163_109598572 153
132 3300025927 Ga0207687_10688647 Ga0207687_106886471 153
133 3300025934 Ga0207686_10263006 Ga0207686_102630061 153
134 3300025937 Ga0207669_11361251 Ga0207669_113612511 153
135 3300025938 Ga0207704_10814641 Ga0207704_108146411 153
136 3300026116 Ga0207674_10056049 Ga0207674_100560493 153
137 3300037471 Ga0395905_0769759 Ga0395905_0769759_207_674 153
138 3300038443 Ga0395901_0760556 Ga0395901_0760556_300_803 153
139 3300042014 Ga0439457_108745 Ga0439457_108745_167_631 153
140 3300049590 Ga0501074_0571226 Ga0501074_0571226_258_788 153
141 3300049592 Ga0501076_0571377 Ga0501076_0571377_242_772 153
142 3300050507 nmdc:mga05p37_755588_c1 nmdc:mga05p37_755588_c1_370_864 153
143 iso_pu_bacteria 2870782633 2870789165 153
144 3300005329 Ga0070683_100026791 Ga0070683_1000267919 154
145 3300005331 Ga0070670_100029292 Ga0070670_1000292928 154
146 3300005335 Ga0070666_10978875 Ga0070666_109788751 154
147 3300005337 Ga0070682_100150433 Ga0070682_1001504333 154
148 3300005338 Ga0068868_100139016 Ga0068868_1001390163 154
149 3300005340 Ga0070689_100043594 Ga0070689_1000435947 154
150 3300005354 Ga0070675_100089648 Ga0070675_1000896483 154
151 3300005355 Ga0070671_100017320 Ga0070671_1000173201 154
152 3300005356 Ga0070674_100145522 Ga0070674_1001455222 154
153 3300005364 Ga0070673_100258781 Ga0070673_1002587812 154
154 3300005365 Ga0070688_100010786 Ga0070688_1000107868 154
155 3300005366 Ga0070659_100180622 Ga0070659_1001806221 154
156 3300005367 Ga0070667_100860646 Ga0070667_1008606461 154
157 3300005441 Ga0070700_100474011 Ga0070700_1004740112 154
158 3300005455 Ga0070663_100279542 Ga0070663_1002795423 154
159 3300005459 Ga0068867_100217531 Ga0068867_1002175313 154
160 3300005466 Ga0070685_10001824 Ga0070685_1000182410 154
161 3300005535 Ga0070684_100098866 Ga0070684_1000988662 154
162 3300005543 Ga0070672_100156526 Ga0070672_1001565262 154
163 3300005544 Ga0070686_100177881 Ga0070686_1001778811 154
164 3300005545 Ga0070695_100686036 Ga0070695_1006860362 154
165 3300005548 Ga0070665_100010077 Ga0070665_10001007712 154
166 3300005549 Ga0070704_100061756 Ga0070704_1000617562 154
167 3300005564 Ga0070664_100398876 Ga0070664_1003988762 154
168 3300005617 Ga0068859_100187945 Ga0068859_1001879452 154
169 3300005618 Ga0068864_100031233 Ga0068864_1000312333 154
170 3300005718 Ga0068866_10687073 Ga0068866_106870731 154
171 3300005719 Ga0068861_100129398 Ga0068861_1001293982 154
172 3300005840 Ga0068870_10071825 Ga0068870_100718254 154
173 3300005842 Ga0068858_100457092 Ga0068858_1004570922 154
174 3300006237 Ga0097621_100275461 Ga0097621_1002754612 154
175 3300006846 Ga0075430_100020823 Ga0075430_1000208232 154
176 3300006881 Ga0068865_100383659 Ga0068865_1003836591 154
177 3300006931 Ga0097620_100187940 Ga0097620_1001879402 154
178 3300009098 Ga0105245_10062343 Ga0105245_100623434 154
179 3300009098 Ga0105245_10880896 Ga0105245_108808962 154
180 3300009148 Ga0105243_10050894 Ga0105243_100508943 154
181 3300009176 Ga0105242_10046650 Ga0105242_100466507 154
182 3300009177 Ga0105248_10384003 Ga0105248_103840033 154
183 3300011119 Ga0105246_10008465 Ga0105246_100084659 154
184 3300011119 Ga0105246_10239241 Ga0105246_102392412 154
185 3300013296 Ga0157374_10200014 Ga0157374_102000141 154
186 3300013297 Ga0157378_10073432 Ga0157378_100734324 154
187 3300013306 Ga0163162_10478743 Ga0163162_104787433 154
188 3300013307 Ga0157372_10654395 Ga0157372_106543952 154
189 3300014326 Ga0157380_10048637 Ga0157380_100486374 154
190 3300014745 Ga0157377_10002176 Ga0157377_1000217610 154
191 3300014969 Ga0157376_10656357 Ga0157376_106563571 154
192 3300025901 Ga0207688_10001062 Ga0207688_100010627 154
193 3300025908 Ga0207643_10343757 Ga0207643_103437571 154
194 3300025923 Ga0207681_10430321 Ga0207681_104303211 154
195 3300025927 Ga0207687_10105522 Ga0207687_101055222 154
196 3300025938 Ga0207704_11249173 Ga0207704_112491731 154
197 3300025940 Ga0207691_10044054 Ga0207691_100440547 154
198 3300025941 Ga0207711_10550662 Ga0207711_105506622 154
199 3300025960 Ga0207651_10074966 Ga0207651_100749661 154
200 3300026023 Ga0207677_10697802 Ga0207677_106978021 154
201 3300026075 Ga0207708_10553482 Ga0207708_105534821 154
202 3300026089 Ga0207648_10010765 Ga0207648_1001076512 154
203 3300026095 Ga0207676_10085256 Ga0207676_100852564 154
204 3300026118 Ga0207675_100093033 Ga0207675_1000930334 154
205 3300026118 Ga0207675_101005988 Ga0207675_1010059881 154
206 3300026121 Ga0207683_10018999 Ga0207683_100189991 154
207 3300028379 Ga0268266_10699066 Ga0268266_106990662 154
208 3300035207 Ga0373942_0352692 Ga0373942_0352692_16_480 154
209 3300037853 Ga0436364_0911004 Ga0436364_0911004_421_894 154
210 3300041463 Ga0451804_0061489 Ga0451804_0061489_69_533 154
211 3300044735 Ga0466968_0199385 Ga0466968_0199385_305_805 154
212 3300048912 Ga0496109_0023202 Ga0496109_0023202_390_884 154
213 3300048913 Ga0496110_0888893 Ga0496110_0888893_95_559 154
214 3300048914 Ga0496111_0529795 Ga0496111_0529795_110_604 154
215 3300049574 Ga0501038_0029451 Ga0501038_0029451_4103_4573 154
216 3300049585 Ga0501069_0053634 Ga0501069_0053634_1587_2057 154
217 3300049593 Ga0501077_0391911 Ga0501077_0391911_145_615 154
218 3300005337 Ga0070682_100585332 Ga0070682_1005853322 155
219 3300005345 Ga0070692_10290043 Ga0070692_102900432 155
220 3300005615 Ga0070702_100201556 Ga0070702_1002015562 155
221 3300005985 Ga0081539_10004479 Ga0081539_1000447912 155
222 3300006038 Ga0075365_10291808 Ga0075365_102918082 155
223 3300009094 Ga0111539_10142030 Ga0111539_101420306 155
224 3300009098 Ga0105245_10097378 Ga0105245_100973781 155
225 3300014326 Ga0157380_10098071 Ga0157380_100980712 155
226 3300014326 Ga0157380_10344463 Ga0157380_103444633 155
227 3300025927 Ga0207687_10792171 Ga0207687_107921712 155
228 3300037853 Ga0436364_0143458 Ga0436364_0143458_384_872 155
229 3300045051 Ga0451576_0029001 Ga0451576_0029001_4192_4662 155
230 3300049576 Ga0501040_1039554 Ga0501040_1039554_96_569 155
231 3300050512 nmdc:mga0n895_285588_c1 nmdc:mga0n895_285588_c1_703_1173 155
232 3300031731 Ga0307405_10020279 Ga0307405_100202794 156
233 3300044694 Ga0466963_0034613 Ga0466963_0034613_1932_2408 156
234 3300045976 Ga0466967_0361282 Ga0466967_0361282_185_661 156
235 3300048915 Ga0496112_0698845 Ga0496112_0698845_271_744 156
236 3300048916 Ga0496113_0590657 Ga0496113_0590657_266_739 156
237 3300005327 Ga0070658_10341023 Ga0070658_103410232 157
238 3300005439 Ga0070711_100543271 Ga0070711_1005432712 157
239 3300005445 Ga0070708_100000004 Ga0070708_10000000444 157
240 3300005467 Ga0070706_100095094 Ga0070706_1000950943 157
241 3300005468 Ga0070707_100112202 Ga0070707_1001122024 157
242 3300005564 Ga0070664_100213661 Ga0070664_1002136611 157
243 3300005719 Ga0068861_100754414 Ga0068861_1007544142 157
244 3300006844 Ga0075428_100030501 Ga0075428_1000305013 157
245 3300006847 Ga0075431_101246906 Ga0075431_1012469062 157
246 3300006852 Ga0075433_10105815 Ga0075433_101058156 157
247 3300006871 Ga0075434_100021747 Ga0075434_1000217477 157
248 3300006880 Ga0075429_100074312 Ga0075429_1000743127 157
249 3300009147 Ga0114129_10000558 Ga0114129_1000055822 157
250 3300009147 Ga0114129_10008295 Ga0114129_100082959 157
251 3300009551 Ga0105238_10812284 Ga0105238_108122841 157
252 3300025910 Ga0207684_10080635 Ga0207684_100806353 157
253 3300025922 Ga0207646_10731728 Ga0207646_107317282 157
254 3300026118 Ga0207675_100774065 Ga0207675_1007740652 157
255 3300045976 Ga0466967_1450103 Ga0466967_1450103_138_611 157
256 3300046477 Ga0495664_0283595 Ga0495664_0283595_500_988 157
257 3300046535 Ga0495586_0034843 Ga0495586_0034843_1255_1743 157
258 3300050507 nmdc:mga05p37_1526_c2 nmdc:mga05p37_1526_c2_128_622 157
259 3300050508 nmdc:mga09592_69089_c1 nmdc:mga09592_69089_c1_2420_2908 157
260 3300050510 nmdc:mga06r32_1159967_c1 nmdc:mga06r32_1159967_c1_55_543 157
261 3300050512 nmdc:mga0n895_107760_c1 nmdc:mga0n895_107760_c1_1547_2035 157
262 3300005937 Ga0081455_10033792 Ga0081455_100337924 158
263 3300006844 Ga0075428_100011261 Ga0075428_1000112616 158
264 3300006846 Ga0075430_100065973 Ga0075430_1000659733 158
265 3300031852 Ga0307410_10093012 Ga0307410_100930122 158
266 3300031901 Ga0307406_10035066 Ga0307406_100350663 158
267 3300031995 Ga0307409_100519116 Ga0307409_1005191162 158
268 3300031995 Ga0307409_101676653 Ga0307409_1016766531 158
269 3300032002 Ga0307416_100308578 Ga0307416_1003085783 158
270 3300032005 Ga0307411_11406160 Ga0307411_114061601 158
271 3300032126 Ga0307415_100139539 Ga0307415_1001395392 158
272 3300032126 Ga0307415_100257601 Ga0307415_1002576012 158
273 3300032126 Ga0307415_100260585 Ga0307415_1002605853 158
274 3300042016 Ga0439463_020750 Ga0439463_020750_50_532 158
275 3300042530 Ga0450916_003373 Ga0450916_003373_61_543 158
276 3300048907 Ga0496104_0111596 Ga0496104_0111596_259_735 158
277 3300048911 Ga0496108_1019163 Ga0496108_1019163_176_652 158
278 3300048915 Ga0496112_0055459 Ga0496112_0055459_2885_3361 158
279 3300049583 Ga0501067_0243415 Ga0501067_0243415_208_684 158
280 3300050509 nmdc:mga0qj67_79852_c1 nmdc:mga0qj67_79852_c1_1013_1489 158
281 3300050510 nmdc:mga06r32_1033851_c1 nmdc:mga06r32_1033851_c1_194_673 158
282 3300005539 Ga0068853_100451004 Ga0068853_1004510042 159
283 3300005577 Ga0068857_100875854 Ga0068857_1008758542 159
284 3300005937 Ga0081455_10435948 Ga0081455_104359482 159
285 3300006038 Ga0075365_10094395 Ga0075365_100943953 159
286 3300006051 Ga0075364_10104373 Ga0075364_101043732 159
287 3300010375 Ga0105239_10006994 Ga0105239_100069945 159
288 3300013104 Ga0157370_10201730 Ga0157370_102017303 159
289 3300013297 Ga0157378_10232654 Ga0157378_102326542 159
290 3300013307 Ga0157372_10743521 Ga0157372_107435212 159
291 3300026041 Ga0207639_10266393 Ga0207639_102663932 159
292 3300031911 Ga0307412_11330258 Ga0307412_113302582 159
293 3300048913 Ga0496110_0333080 Ga0496110_0333080_540_1019 159
294 3300048915 Ga0496112_0626369 Ga0496112_0626369_462_941 159
295 3300048927 Ga0496124_0118037 Ga0496124_0118037_149_628 159
296 3300048928 Ga0496125_0402036 Ga0496125_0402036_113_592 159
297 iso_pu_bacteria 2899359706 2899367525 159
298 3300005436 Ga0070713_100345077 Ga0070713_1003450773 160
299 3300005467 Ga0070706_100030463 Ga0070706_1000304636 160
300 3300005937 Ga0081455_10801988 Ga0081455_108019881 160
301 3300005981 Ga0081538_10000080 Ga0081538_1000008060 160
302 3300005983 Ga0081540_1089780 Ga0081540_10897802 160
303 3300005985 Ga0081539_10004373 Ga0081539_1000437312 160
304 3300005985 Ga0081539_10004534 Ga0081539_1000453411 160
305 3300006028 Ga0070717_10026595 Ga0070717_100265953 160
306 3300006028 Ga0070717_10416523 Ga0070717_104165232 160
307 3300021384 Ga0213876_10429575 Ga0213876_104295751 160
308 3300025910 Ga0207684_10025581 Ga0207684_100255812 160
309 3300025928 Ga0207700_10291486 Ga0207700_102914863 160
310 3300031731 Ga0307405_10591707 Ga0307405_105917072 160
311 3300031824 Ga0307413_10298435 Ga0307413_102984352 160
312 3300031852 Ga0307410_10077373 Ga0307410_100773733 160
313 3300031911 Ga0307412_10022635 Ga0307412_100226353 160
314 3300031911 Ga0307412_10161211 Ga0307412_101612112 160
315 3300031911 Ga0307412_11554237 Ga0307412_115542371 160
316 3300031995 Ga0307409_100031389 Ga0307409_1000313892 160
317 3300032005 Ga0307411_10986276 Ga0307411_109862762 160
318 3300032126 Ga0307415_100545366 Ga0307415_1005453662 160
319 3300037312 Ga0395899_0056100 Ga0395899_0056100_1592_2092 160
320 3300037418 Ga0395900_0130454 Ga0395900_0130454_351_851 160
321 3300037466 Ga0395898_0063831 Ga0395898_0063831_1319_1819 160
322 3300037471 Ga0395905_0062434 Ga0395905_0062434_1168_1668 160
323 3300038443 Ga0395901_0527102 Ga0395901_0527102_500_1000 160
324 3300039437 Ga0436365_0572677 Ga0436365_0572677_815_1300 160
325 3300042005 Ga0439448_0043240 Ga0439448_0043240_727_1242 160
326 3300042439 Ga0439464_0017288 Ga0439464_0017288_1018_1506 160
327 3300042993 Ga0439440_0225506 Ga0439440_0225506_45_533 160
328 3300044765 Ga0466970_0052317 Ga0466970_0052317_946_1428 160
329 3300048907 Ga0496104_0418076 Ga0496104_0418076_518_1018 160
330 3300049568 Ga0501031_0006569 Ga0501031_0006569_6752_7240 160
331 3300049569 Ga0501032_0175907 Ga0501032_0175907_806_1294 160
332 3300049569 Ga0501032_0662884 Ga0501032_0662884_33_533 160
333 3300049570 Ga0501033_0045546 Ga0501033_0045546_1656_2144 160
334 3300049572 Ga0501036_0005119 Ga0501036_0005119_9679_10167 160
335 3300049574 Ga0501038_0018052 Ga0501038_0018052_3102_3590 160
336 3300049575 Ga0501039_0012794 Ga0501039_0012794_2846_3334 160
337 3300049576 Ga0501040_0001208 Ga0501040_0001208_13181_13669 160
338 3300049576 Ga0501040_0323348 Ga0501040_0323348_202_702 160
339 3300049577 Ga0501041_0000325 Ga0501041_0000325_12136_12624 160
340 3300049577 Ga0501041_0379992 Ga0501041_0379992_86_598 160
341 3300049578 Ga0501042_0380820 Ga0501042_0380820_386_886 160
342 3300049579 Ga0501043_0021978 Ga0501043_0021978_3297_3785 160
343 3300049580 Ga0501046_0000797 Ga0501046_0000797_27158_27646 160
344 3300049581 Ga0501047_0034089 Ga0501047_0034089_4412_4900 160
345 3300049582 Ga0501048_0000036 Ga0501048_0000036_4338_4826 160
346 3300049584 Ga0501068_0006916 Ga0501068_0006916_305_793 160
347 3300049586 Ga0501070_0474160 Ga0501070_0474160_326_814 160
348 3300049587 Ga0501071_0015621 Ga0501071_0015621_3469_3957 160
349 3300049588 Ga0501072_0003418 Ga0501072_0003418_488_976 160
350 3300049590 Ga0501074_0000150 Ga0501074_0000150_5728_6216 160
351 3300049591 Ga0501075_0001381 Ga0501075_0001381_99_587 160
352 3300049592 Ga0501076_0022415 Ga0501076_0022415_211_699 160
353 3300049592 Ga0501076_0033773 Ga0501076_0033773_2611_3111 160
354 3300049593 Ga0501077_0025569 Ga0501077_0025569_1040_1528 160
355 3300049741 Ga0501079_0000484 Ga0501079_0000484_11600_12088 160
356 3300049741 Ga0501079_0029292 Ga0501079_0029292_170_670 160
357 3300049743 Ga0501081_0001297 Ga0501081_0001297_11366_11854 160
358 3300049744 Ga0501083_0023285 Ga0501083_0023285_3048_3536 160
359 3300049822 Ga0501035_0095957 Ga0501035_0095957_657_1145 160
360 3300049824 Ga0501045_0013896 Ga0501045_0013896_1252_1740 160
361 3300054114 Ga0501084_0000305 Ga0501084_0000305_19223_19711 160
362 3300054114 Ga0501084_0590748 Ga0501084_0590748_19_519 160
363 3300060353 Ga0501082_0000727 Ga0501082_0000727_17547_18035 160
364 3300060353 Ga0501082_0019758 Ga0501082_0019758_342_842 160
365 3300060353 Ga0501082_0226125 Ga0501082_0226125_381_893 160
366 3300061734 Ga0530510_0002334 Ga0530510_0002334_4093_4581 160
367 3300061734 Ga0530510_0087182 Ga0530510_0087182_799_1311 160
368 3300003323 rootH1_10190481 rootH1_101904812 161
369 3300003373 JGI25407J50210_10001249 JGI25407J50210_100012497 161
370 3300003373 JGI25407J50210_10013235 JGI25407J50210_100132352 161
371 3300003373 JGI25407J50210_10044455 JGI25407J50210_100444552 161
372 3300005329 Ga0070683_100002180 Ga0070683_1000021803 161
373 3300005441 Ga0070700_100000019 Ga0070700_100000019129 161
374 3300005535 Ga0070684_100022953 Ga0070684_1000229533 161
375 3300005543 Ga0070672_100189705 Ga0070672_1001897053 161
376 3300005546 Ga0070696_101063089 Ga0070696_1010630891 161
377 3300005548 Ga0070665_100664306 Ga0070665_1006643062 161
378 3300005563 Ga0068855_100099227 Ga0068855_1000992273 161
379 3300005937 Ga0081455_10002336 Ga0081455_1000233617 161
380 3300005937 Ga0081455_10164872 Ga0081455_101648722 161
381 3300005937 Ga0081455_10306136 Ga0081455_103061362 161
382 3300005937 Ga0081455_10746875 Ga0081455_107468751 161
383 3300005981 Ga0081538_10001298 Ga0081538_1000129830 161
384 3300005981 Ga0081538_10004845 Ga0081538_100048456 161
385 3300005985 Ga0081539_10021672 Ga0081539_100216725 161
386 3300006844 Ga0075428_100000001 Ga0075428_100000001346 161
387 3300006844 Ga0075428_100188821 Ga0075428_1001888213 161
388 3300006846 Ga0075430_100011247 Ga0075430_1000112475 161
389 3300006847 Ga0075431_100002312 Ga0075431_1000023123 161
390 3300006847 Ga0075431_100002400 Ga0075431_10000240012 161
391 3300006847 Ga0075431_101064587 Ga0075431_1010645872 161
392 3300006847 Ga0075431_101138462 Ga0075431_1011384621 161
393 3300006871 Ga0075434_100106982 Ga0075434_1001069823 161
394 3300006880 Ga0075429_100001668 Ga0075429_1000016689 161
395 3300009094 Ga0111539_10629365 Ga0111539_106293651 161
396 3300009098 Ga0105245_10145432 Ga0105245_101454322 161
397 3300009101 Ga0105247_10586989 Ga0105247_105869892 161
398 3300009147 Ga0114129_10411171 Ga0114129_104111713 161
399 3300009148 Ga0105243_11518320 Ga0105243_115183202 161
400 3300009176 Ga0105242_10383298 Ga0105242_103832982 161
401 3300009176 Ga0105242_10737790 Ga0105242_107377903 161
402 3300009545 Ga0105237_10126329 Ga0105237_101263293 161
403 3300013100 Ga0157373_10117165 Ga0157373_101171654 161
404 3300013105 Ga0157369_10044282 Ga0157369_100442825 161
405 3300013307 Ga0157372_10560345 Ga0157372_105603453 161
406 3300020078 Ga0206352_11045972 Ga0206352_110459722 161
407 3300021384 Ga0213876_10001139 Ga0213876_1000113911 161
408 3300025913 Ga0207695_10017361 Ga0207695_100173613 161
409 3300025914 Ga0207671_10061600 Ga0207671_100616005 161
410 3300025927 Ga0207687_10114233 Ga0207687_101142332 161
411 3300025934 Ga0207686_10174443 Ga0207686_101744433 161
412 3300025935 Ga0207709_11151089 Ga0207709_111510891 161
413 3300025937 Ga0207669_10545664 Ga0207669_105456642 161
414 3300025944 Ga0207661_10088693 Ga0207661_100886931 161
415 3300025949 Ga0207667_10059198 Ga0207667_100591985 161
416 3300026075 Ga0207708_10000038 Ga0207708_10000038127 161
417 3300028379 Ga0268266_10178244 Ga0268266_101782442 161
418 3300031852 Ga0307410_11486261 Ga0307410_114862612 161
419 3300031852 Ga0307410_11916135 Ga0307410_119161351 161
420 3300031901 Ga0307406_10670829 Ga0307406_106708292 161
421 3300031901 Ga0307406_10749251 Ga0307406_107492512 161
422 3300031903 Ga0307407_10553151 Ga0307407_105531511 161
423 3300031995 Ga0307409_100241814 Ga0307409_1002418143 161
424 3300031995 Ga0307409_101190019 Ga0307409_1011900192 161
425 3300032002 Ga0307416_100213536 Ga0307416_1002135362 161
426 3300032002 Ga0307416_100498224 Ga0307416_1004982242 161
427 3300032005 Ga0307411_10406606 Ga0307411_104066062 161
428 3300032126 Ga0307415_100385068 Ga0307415_1003850681 161
429 3300032126 Ga0307415_101054377 Ga0307415_1010543771 161
430 3300033179 Ga0307507_10006095 Ga0307507_1000609510 161
431 3300033180 Ga0307510_10106425 Ga0307510_101064252 161
432 3300035117 Ga0373953_0051218 Ga0373953_0051218_170_655 161
433 3300035172 Ga0373955_0045691 Ga0373955_0045691_940_1425 161
434 3300035410 Ga0373924_0043545 Ga0373924_0043545_542_1027 161
435 3300035724 Ga0373933_0083969 Ga0373933_0083969_270_755 161
436 3300036401 Ga0373937_0056651 Ga0373937_0056651_376_861 161
437 3300037418 Ga0395900_0212058 Ga0395900_0212058_215_709 161
438 3300037466 Ga0395898_0859038 Ga0395898_0859038_337_831 161
439 3300038443 Ga0395901_0857553 Ga0395901_0857553_208_693 161
440 3300039437 Ga0436365_1125982 Ga0436365_1125982_3365_3853 161
441 3300039437 Ga0436365_1558885 Ga0436365_1558885_371_856 161
442 3300039453 Ga0436362_0551951 Ga0436362_0551951_438_926 161
443 3300041405 Ga0439438_021921 Ga0439438_021921_622_1107 161
444 3300042006 Ga0439432_045521 Ga0439432_045521_176_661 161
445 3300042435 Ga0439434_0014120 Ga0439434_0014120_57_542 161
446 3300044658 Ga0466972_0000769 Ga0466972_0000769_9068_9556 161
447 3300044683 Ga0466965_0013377 Ga0466965_0013377_3151_3639 161
448 3300044684 Ga0466966_0090811 Ga0466966_0090811_87_575 161
449 3300044735 Ga0466968_0004226 Ga0466968_0004226_806_1294 161
450 3300044901 Ga0466960_0008951 Ga0466960_0008951_3216_3704 161
451 3300045976 Ga0466967_0251925 Ga0466967_0251925_145_630 161
452 3300046454 Ga0495592_0010454 Ga0495592_0010454_3638_4123 161
453 3300046462 Ga0495651_0015955 Ga0495651_0015955_3443_3928 161
454 3300046463 Ga0495653_0014736 Ga0495653_0014736_151_636 161
455 3300046477 Ga0495664_0071104 Ga0495664_0071104_1523_2008 161
456 3300046511 Ga0495608_0002082 Ga0495608_0002082_1815_2300 161
457 3300046516 Ga0495628_0489342 Ga0495628_0489342_385_870 161
458 3300046529 Ga0495652_0010929 Ga0495652_0010929_3321_3806 161
459 3300046533 Ga0495640_0021401 Ga0495640_0021401_1911_2396 161
460 3300046536 Ga0495587_0062017 Ga0495587_0062017_1377_1862 161
461 3300046559 Ga0495667_0001758 Ga0495667_0001758_9461_9946 161
462 3300046663 Ga0495635_0000652 Ga0495635_0000652_16523_17008 161
463 3300046675 Ga0495657_0029227 Ga0495657_0029227_470_955 161
464 3300046679 Ga0495623_0296496 Ga0495623_0296496_345_830 161
465 3300046680 Ga0495646_0040290 Ga0495646_0040290_296_781 161
466 3300046809 Ga0495600_0002592 Ga0495600_0002592_4732_5217 161
467 3300047317 Ga0495604_0048073 Ga0495604_0048073_2571_3056 161
468 3300047318 Ga0495636_0170135 Ga0495636_0170135_301_792 161
469 3300047319 Ga0495674_0031369 Ga0495674_0031369_1001_1486 161
470 3300047322 Ga0495680_0007779 Ga0495680_0007779_4831_5316 161
471 3300048088 Ga0495602_0029482 Ga0495602_0029482_104_589 161
472 3300048904 Ga0496101_0203559 Ga0496101_0203559_412_900 161
473 3300048905 Ga0496102_0046025 Ga0496102_0046025_2057_2545 161
474 3300048905 Ga0496102_0580131 Ga0496102_0580131_80_568 161
475 3300048907 Ga0496104_0456123 Ga0496104_0456123_635_1120 161
476 3300048912 Ga0496109_0015252 Ga0496109_0015252_3895_4383 161
477 3300048912 Ga0496109_0300273 Ga0496109_0300273_918_1403 161
478 3300048912 Ga0496109_0956571 Ga0496109_0956571_94_582 161
479 3300048914 Ga0496111_0421973 Ga0496111_0421973_422_910 161
480 3300048914 Ga0496111_1105673 Ga0496111_1105673_26_514 161
481 3300048916 Ga0496113_1194662 Ga0496113_1194662_26_514 161
482 3300048917 Ga0496114_0044843 Ga0496114_0044843_2839_3327 161
483 3300049583 Ga0501067_0316772 Ga0501067_0316772_327_827 161
484 3300049589 Ga0501073_0597059 Ga0501073_0597059_239_724 161
485 3300050490 nmdc:mga03n38_412430_c1 nmdc:mga03n38_412430_c1_167_658 161
486 3300050491 nmdc:mga00v17_209835_c1 nmdc:mga00v17_209835_c1_522_1013 161
487 3300050492 nmdc:mga0yw44_308747_c1 nmdc:mga0yw44_308747_c1_544_1035 161
488 3300050507 nmdc:mga05p37_906041_c1 nmdc:mga05p37_906041_c1_427_912 161
489 3300050508 nmdc:mga09592_10687_c1 nmdc:mga09592_10687_c1_2283_2777 161
490 3300050509 nmdc:mga0qj67_682_c1 nmdc:mga0qj67_682_c1_9741_10235 161
491 3300050510 nmdc:mga06r32_1013178_c1 nmdc:mga06r32_1013178_c1_195_683 161
492 3300053085 Ga0495619_0030537 Ga0495619_0030537_111_596 161
493 3300003373 JGI25407J50210_10001786 JGI25407J50210_100017862 162
494 3300003373 JGI25407J50210_10012016 JGI25407J50210_100120162 162
495 3300005329 Ga0070683_100573030 Ga0070683_1005730302 162
496 3300005340 Ga0070689_101052385 Ga0070689_1010523852 162
497 3300005457 Ga0070662_100333781 Ga0070662_1003337812 162
498 3300005459 Ga0068867_101403189 Ga0068867_1014031891 162
499 3300005467 Ga0070706_100002099 Ga0070706_10000209912 162
500 3300005544 Ga0070686_100194418 Ga0070686_1001944183 162
501 3300005578 Ga0068854_100680788 Ga0068854_1006807882 162
502 3300005719 Ga0068861_100173532 Ga0068861_1001735322 162
503 3300005840 Ga0068870_10314353 Ga0068870_103143532 162
504 3300005843 Ga0068860_100941495 Ga0068860_1009414952 162
505 3300005981 Ga0081538_10033686 Ga0081538_100336863 162
506 3300005981 Ga0081538_10069277 Ga0081538_100692773 162
507 3300006048 Ga0075363_100004072 Ga0075363_1000040728 162
508 3300006847 Ga0075431_100051929 Ga0075431_1000519297 162
509 3300006880 Ga0075429_100002220 Ga0075429_10000222016 162
510 3300009098 Ga0105245_10353315 Ga0105245_103533152 162
511 3300009101 Ga0105247_10812925 Ga0105247_108129252 162
512 3300009148 Ga0105243_10458124 Ga0105243_104581243 162
513 3300009176 Ga0105242_10645926 Ga0105242_106459262 162
514 3300009545 Ga0105237_11415897 Ga0105237_114158972 162
515 3300009551 Ga0105238_11096088 Ga0105238_110960882 162
516 3300009553 Ga0105249_10255158 Ga0105249_102551583 162
517 3300013307 Ga0157372_11225526 Ga0157372_112255262 162
518 3300014325 Ga0163163_11734607 Ga0163163_117346072 162
519 3300014969 Ga0157376_10338043 Ga0157376_103380432 162
520 3300017792 Ga0163161_10237211 Ga0163161_102372112 162
521 3300025908 Ga0207643_10273428 Ga0207643_102734282 162
522 3300025910 Ga0207684_10002784 Ga0207684_1000278412 162
523 3300025917 Ga0207660_10327152 Ga0207660_103271523 162
524 3300025922 Ga0207646_10093355 Ga0207646_100933555 162
525 3300025934 Ga0207686_10554642 Ga0207686_105546422 162
526 3300025935 Ga0207709_10202272 Ga0207709_102022723 162
527 3300025942 Ga0207689_10063901 Ga0207689_100639014 162
528 3300025944 Ga0207661_10942868 Ga0207661_109428682 162
529 3300025949 Ga0207667_11327642 Ga0207667_113276422 162
530 3300025960 Ga0207651_11003958 Ga0207651_110039582 162
531 3300025972 Ga0207668_10587553 Ga0207668_105875532 162
532 3300025986 Ga0207658_10886884 Ga0207658_108868841 162
533 3300026118 Ga0207675_100095937 Ga0207675_1000959372 162
534 3300026121 Ga0207683_10027452 Ga0207683_100274523 162
535 3300026121 Ga0207683_10081091 Ga0207683_100810912 162
536 3300026121 Ga0207683_11324708 Ga0207683_113247082 162
537 3300028381 Ga0268264_10460718 Ga0268264_104607182 162
538 3300028794 Ga0307515_10085249 Ga0307515_100852494 162
539 3300031548 Ga0307408_100308202 Ga0307408_1003082023 162
540 3300031731 Ga0307405_10489545 Ga0307405_104895452 162
541 3300031852 Ga0307410_10171128 Ga0307410_101711282 162
542 3300031852 Ga0307410_11635313 Ga0307410_116353131 162
543 3300031901 Ga0307406_10110519 Ga0307406_101105192 162
544 3300031911 Ga0307412_10187220 Ga0307412_101872202 162
545 3300031995 Ga0307409_100040222 Ga0307409_1000402224 162
546 3300031995 Ga0307409_100108160 Ga0307409_1001081603 162
547 3300031995 Ga0307409_100598443 Ga0307409_1005984431 162
548 3300032002 Ga0307416_100073605 Ga0307416_1000736052 162
549 3300032002 Ga0307416_100130404 Ga0307416_1001304043 162
550 3300032126 Ga0307415_100005505 Ga0307415_1000055058 162
551 3300032126 Ga0307415_100094098 Ga0307415_1000940983 162
552 3300037312 Ga0395899_0101868 Ga0395899_0101868_806_1303 162
553 3300037312 Ga0395899_0448408 Ga0395899_0448408_98_595 162
554 3300037418 Ga0395900_0159169 Ga0395900_0159169_1210_1707 162
555 3300037418 Ga0395900_0855945 Ga0395900_0855945_48_545 162
556 3300037466 Ga0395898_0149856 Ga0395898_0149856_283_780 162
557 3300037471 Ga0395905_0465040 Ga0395905_0465040_461_958 162
558 3300038443 Ga0395901_0012719 Ga0395901_0012719_7898_8395 162
559 3300038443 Ga0395901_0176181 Ga0395901_0176181_292_789 162
560 3300038443 Ga0395901_0600834 Ga0395901_0600834_295_792 162
561 3300038996 Ga0242420_088805 Ga0242420_088805_123_623 162
562 3300045976 Ga0466967_0814679 Ga0466967_0814679_254_757 162
563 3300048904 Ga0496101_0007633 Ga0496101_0007633_2348_2836 162
564 3300048905 Ga0496102_0001033 Ga0496102_0001033_23490_23978 162
565 3300048910 Ga0496107_0024165 Ga0496107_0024165_1872_2360 162
566 3300048912 Ga0496109_0468462 Ga0496109_0468462_484_972 162
567 3300048916 Ga0496113_0230116 Ga0496113_0230116_343_843 162
568 3300048929 Ga0496126_0512794 Ga0496126_0512794_230_718 162
569 3300049568 Ga0501031_0292848 Ga0501031_0292848_375_863 162
570 3300049572 Ga0501036_0269524 Ga0501036_0269524_41_529 162
571 3300049573 Ga0501037_0133862 Ga0501037_0133862_1207_1695 162
572 3300049574 Ga0501038_0070139 Ga0501038_0070139_1310_1798 162
573 3300049575 Ga0501039_0099563 Ga0501039_0099563_221_709 162
574 3300049576 Ga0501040_0095196 Ga0501040_0095196_198_686 162
575 3300049577 Ga0501041_0026009 Ga0501041_0026009_30_518 162
576 3300049578 Ga0501042_0018833 Ga0501042_0018833_2183_2671 162
577 3300049580 Ga0501046_0128032 Ga0501046_0128032_471_959 162
578 3300049582 Ga0501048_0010777 Ga0501048_0010777_2603_3091 162
579 3300049584 Ga0501068_0068378 Ga0501068_0068378_135_623 162
580 3300049587 Ga0501071_0013741 Ga0501071_0013741_3687_4175 162
581 3300049588 Ga0501072_0008710 Ga0501072_0008710_158_646 162
582 3300049590 Ga0501074_0020627 Ga0501074_0020627_1397_1885 162
583 3300049592 Ga0501076_0001172 Ga0501076_0001172_2657_3145 162
584 3300049593 Ga0501077_0001661 Ga0501077_0001661_1534_2022 162
585 3300049741 Ga0501079_0002866 Ga0501079_0002866_9813_10301 162
586 3300049742 Ga0501080_0014998 Ga0501080_0014998_368_856 162
587 3300049743 Ga0501081_0010006 Ga0501081_0010006_2380_2868 162
588 3300049744 Ga0501083_0538079 Ga0501083_0538079_97_585 162
589 3300049822 Ga0501035_0187618 Ga0501035_0187618_1240_1728 162
590 3300049824 Ga0501045_0001086 Ga0501045_0001086_2727_3215 162
591 3300050509 nmdc:mga0qj67_215072_c1 nmdc:mga0qj67_215072_c1_943_1440 162
592 3300050510 nmdc:mga06r32_270066_c1 nmdc:mga06r32_270066_c1_1048_1539 162
593 3300050510 nmdc:mga06r32_529362_c1 nmdc:mga06r32_529362_c1_74_571 162
594 3300059421 Ga0590071_009882 Ga0590071_009882_1310_1804 162
595 3300059423 Ga0590074_003839 Ga0590074_003839_1612_2106 162
596 3300059424 Ga0590075_001480 Ga0590075_001480_1491_1985 162
597 3300059426 Ga0590077_033627 Ga0590077_033627_244_738 162
598 3300060353 Ga0501082_0018363 Ga0501082_0018363_2541_3029 162
599 3300061734 Ga0530510_0057210 Ga0530510_0057210_209_697 162
600 3300005289 Ga0065704_10356959 Ga0065704_103569592 163
601 3300005295 Ga0065707_10027577 Ga0065707_100275772 163
602 3300005340 Ga0070689_100874888 Ga0070689_1008748881 163
603 3300005434 Ga0070709_10002774 Ga0070709_100027746 163
604 3300005438 Ga0070701_10235272 Ga0070701_102352721 163
605 3300005439 Ga0070711_100032240 Ga0070711_1000322403 163
606 3300005444 Ga0070694_100213950 Ga0070694_1002139502 163
607 3300005445 Ga0070708_100000013 Ga0070708_10000001360 163
608 3300005445 Ga0070708_100143446 Ga0070708_1001434464 163
609 3300005457 Ga0070662_100497901 Ga0070662_1004979012 163
610 3300005467 Ga0070706_100230776 Ga0070706_1002307763 163
611 3300005467 Ga0070706_101324354 Ga0070706_1013243541 163
612 3300005471 Ga0070698_100001121 Ga0070698_10000112116 163
613 3300005536 Ga0070697_100726378 Ga0070697_1007263781 163
614 3300005545 Ga0070695_100332414 Ga0070695_1003324142 163
615 3300005617 Ga0068859_100090293 Ga0068859_1000902933 163
616 3300005844 Ga0068862_100537714 Ga0068862_1005377142 163
617 3300005981 Ga0081538_10047783 Ga0081538_100477832 163
618 3300005981 Ga0081538_10093919 Ga0081538_100939193 163
619 3300006844 Ga0075428_100689963 Ga0075428_1006899632 163
620 3300006844 Ga0075428_101143079 Ga0075428_1011430792 163
621 3300006846 Ga0075430_100180353 Ga0075430_1001803532 163
622 3300006847 Ga0075431_100321009 Ga0075431_1003210094 163
623 3300006880 Ga0075429_100389805 Ga0075429_1003898052 163
624 3300006931 Ga0097620_100090295 Ga0097620_1000902953 163
625 3300009174 Ga0105241_10604290 Ga0105241_106042902 163
626 3300013308 Ga0157375_12047958 Ga0157375_120479581 163
627 3300015262 Ga0182007_10180910 Ga0182007_101809102 163
628 3300025910 Ga0207684_10229690 Ga0207684_102296903 163
629 3300025916 Ga0207663_10023106 Ga0207663_100231063 163
630 3300025921 Ga0207652_10203122 Ga0207652_102031223 163
631 3300025922 Ga0207646_10190259 Ga0207646_101902593 163
632 3300025927 Ga0207687_10300688 Ga0207687_103006883 163
633 3300025940 Ga0207691_11541098 Ga0207691_115410981 163
634 3300025944 Ga0207661_10116773 Ga0207661_101167733 163
635 3300031507 Ga0307509_10205105 Ga0307509_102051054 163
636 3300031616 Ga0307508_10000420 Ga0307508_1000042010 163
637 3300037312 Ga0395899_0092453 Ga0395899_0092453_288_791 163
638 3300037312 Ga0395899_0853607 Ga0395899_0853607_44_544 163
639 3300037418 Ga0395900_0035185 Ga0395900_0035185_3431_3934 163
640 3300037418 Ga0395900_0094308 Ga0395900_0094308_1177_1680 163
641 3300037466 Ga0395898_0062093 Ga0395898_0062093_566_1069 163
642 3300037466 Ga0395898_0573287 Ga0395898_0573287_199_699 163
643 3300037471 Ga0395905_0008903 Ga0395905_0008903_9297_9800 163
644 3300037471 Ga0395905_0090769 Ga0395905_0090769_2336_2839 163
645 3300038443 Ga0395901_0024059 Ga0395901_0024059_1343_1843 163
646 3300038443 Ga0395901_0029263 Ga0395901_0029263_3990_4493 163
647 3300038443 Ga0395901_0052447 Ga0395901_0052447_3500_4018 163
648 3300038443 Ga0395901_0141289 Ga0395901_0141289_801_1304 163
649 3300038443 Ga0395901_0285204 Ga0395901_0285204_449_949 163
650 3300041410 Ga0439461_0032900 Ga0439461_0032900_47_541 163
651 3300041997 Ga0439431_0125074 Ga0439431_0125074_166_660 163
652 3300041999 Ga0439433_0003967 Ga0439433_0003967_2316_2810 163
653 3300042005 Ga0439448_0200857 Ga0439448_0200857_166_657 163
654 3300042007 Ga0439449_0058991 Ga0439449_0058991_510_1004 163
655 3300042435 Ga0439434_0034967 Ga0439434_0034967_392_886 163
656 3300045976 Ga0466967_0172412 Ga0466967_0172412_39_545 163
657 3300045976 Ga0466967_0427373 Ga0466967_0427373_552_1052 163
658 3300049572 Ga0501036_0565577 Ga0501036_0565577_408_911 163
659 3300049587 Ga0501071_0302647 Ga0501071_0302647_404_907 163
660 3300049592 Ga0501076_0691081 Ga0501076_0691081_137_640 163
661 3300050510 nmdc:mga06r32_121285_c1 nmdc:mga06r32_121285_c1_1126_1617 163
662 3300054114 Ga0501084_0364084 Ga0501084_0364084_92_595 163
663 3300054114 Ga0501084_0817489 Ga0501084_0817489_239_754 163
664 3300060353 Ga0501082_0123879 Ga0501082_0123879_905_1408 163
665 3300002077 JGI24744J21845_10012886 JGI24744J21845_100128863 164
666 3300002239 JGI24034J26672_10046755 JGI24034J26672_100467552 164
667 3300002244 JGI24742J22300_10016937 JGI24742J22300_100169372 164
668 3300003322 rootL2_10169080 rootL2_101690802 164
669 3300003373 JGI25407J50210_10030346 JGI25407J50210_100303462 164
670 3300005327 Ga0070658_10044365 Ga0070658_100443653 164
671 3300005336 Ga0070680_100101887 Ga0070680_1001018872 164
672 3300005337 Ga0070682_100006239 Ga0070682_1000062392 164
673 3300005338 Ga0068868_100028178 Ga0068868_1000281781 164
674 3300005339 Ga0070660_100025013 Ga0070660_1000250134 164
675 3300005339 Ga0070660_100079968 Ga0070660_1000799682 164
676 3300005339 Ga0070660_100354203 Ga0070660_1003542032 164
677 3300005341 Ga0070691_10064422 Ga0070691_100644224 164
678 3300005344 Ga0070661_100312407 Ga0070661_1003124073 164
679 3300005345 Ga0070692_10056496 Ga0070692_100564962 164
680 3300005345 Ga0070692_10112563 Ga0070692_101125633 164
681 3300005354 Ga0070675_100085864 Ga0070675_1000858644 164
682 3300005355 Ga0070671_100716910 Ga0070671_1007169101 164
683 3300005356 Ga0070674_100068560 Ga0070674_1000685602 164
684 3300005356 Ga0070674_100851827 Ga0070674_1008518272 164
685 3300005356 Ga0070674_100895523 Ga0070674_1008955232 164
686 3300005364 Ga0070673_101471320 Ga0070673_1014713201 164
687 3300005365 Ga0070688_100003853 Ga0070688_1000038537 164
688 3300005365 Ga0070688_100266427 Ga0070688_1002664272 164
689 3300005366 Ga0070659_100100568 Ga0070659_1001005682 164
690 3300005366 Ga0070659_100512288 Ga0070659_1005122882 164
691 3300005367 Ga0070667_100150411 Ga0070667_1001504113 164
692 3300005406 Ga0070703_10182562 Ga0070703_101825622 164
693 3300005434 Ga0070709_10021991 Ga0070709_100219915 164
694 3300005434 Ga0070709_10155272 Ga0070709_101552723 164
695 3300005435 Ga0070714_100313380 Ga0070714_1003133802 164
696 3300005436 Ga0070713_100000644 Ga0070713_1000006449 164
697 3300005437 Ga0070710_10047971 Ga0070710_100479712 164
698 3300005438 Ga0070701_10000911 Ga0070701_100009115 164
699 3300005439 Ga0070711_100003577 Ga0070711_1000035779 164
700 3300005440 Ga0070705_100165464 Ga0070705_1001654642 164
701 3300005440 Ga0070705_100220684 Ga0070705_1002206842 164
702 3300005441 Ga0070700_100001973 Ga0070700_1000019734 164
703 3300005441 Ga0070700_100763868 Ga0070700_1007638682 164
704 3300005444 Ga0070694_100364091 Ga0070694_1003640912 164
705 3300005445 Ga0070708_100168796 Ga0070708_1001687965 164
706 3300005445 Ga0070708_100210428 Ga0070708_1002104282 164
707 3300005445 Ga0070708_100590516 Ga0070708_1005905162 164
708 3300005455 Ga0070663_100001959 Ga0070663_1000019598 164
709 3300005456 Ga0070678_100000298 Ga0070678_10000029830 164
710 3300005456 Ga0070678_101002710 Ga0070678_1010027102 164
711 3300005457 Ga0070662_100234216 Ga0070662_1002342162 164
712 3300005458 Ga0070681_10105938 Ga0070681_101059384 164
713 3300005458 Ga0070681_10198140 Ga0070681_101981402 164
714 3300005459 Ga0068867_100002281 Ga0068867_10000228116 164
715 3300005466 Ga0070685_10045060 Ga0070685_100450603 164
716 3300005467 Ga0070706_100423566 Ga0070706_1004235662 164
717 3300005467 Ga0070706_100632087 Ga0070706_1006320872 164
718 3300005468 Ga0070707_100145063 Ga0070707_1001450632 164
719 3300005471 Ga0070698_100017945 Ga0070698_1000179457 164
720 3300005471 Ga0070698_100148954 Ga0070698_1001489542 164
721 3300005518 Ga0070699_100308970 Ga0070699_1003089702 164
722 3300005518 Ga0070699_100681427 Ga0070699_1006814272 164
723 3300005530 Ga0070679_100626217 Ga0070679_1006262172 164
724 3300005536 Ga0070697_100094795 Ga0070697_1000947954 164
725 3300005536 Ga0070697_101141678 Ga0070697_1011416781 164
726 3300005539 Ga0068853_100085008 Ga0068853_1000850083 164
727 3300005539 Ga0068853_100737097 Ga0068853_1007370972 164
728 3300005543 Ga0070672_100425849 Ga0070672_1004258492 164
729 3300005543 Ga0070672_101629960 Ga0070672_1016299602 164
730 3300005544 Ga0070686_100007440 Ga0070686_1000074404 164
731 3300005545 Ga0070695_100161779 Ga0070695_1001617792 164
732 3300005546 Ga0070696_100033756 Ga0070696_1000337562 164
733 3300005546 Ga0070696_100838396 Ga0070696_1008383962 164
734 3300005546 Ga0070696_101652092 Ga0070696_1016520921 164
735 3300005547 Ga0070693_100023513 Ga0070693_1000235134 164
736 3300005547 Ga0070693_100566900 Ga0070693_1005669001 164
737 3300005549 Ga0070704_100159925 Ga0070704_1001599253 164
738 3300005563 Ga0068855_100360924 Ga0068855_1003609242 164
739 3300005563 Ga0068855_100370838 Ga0068855_1003708382 164
740 3300005564 Ga0070664_100859025 Ga0070664_1008590252 164
741 3300005578 Ga0068854_101147992 Ga0068854_1011479922 164
742 3300005614 Ga0068856_100064387 Ga0068856_1000643874 164
743 3300005614 Ga0068856_100132897 Ga0068856_1001328972 164
744 3300005615 Ga0070702_100023431 Ga0070702_1000234313 164
745 3300005616 Ga0068852_100002120 Ga0068852_10000212010 164
746 3300005618 Ga0068864_100449674 Ga0068864_1004496742 164
747 3300005718 Ga0068866_10014980 Ga0068866_100149804 164
748 3300005843 Ga0068860_100585852 Ga0068860_1005858522 164
749 3300005981 Ga0081538_10012727 Ga0081538_100127276 164
750 3300006028 Ga0070717_10043111 Ga0070717_100431114 164
751 3300006058 Ga0075432_10074702 Ga0075432_100747022 164
752 3300006163 Ga0070715_10030275 Ga0070715_100302752 164
753 3300006175 Ga0070712_100010895 Ga0070712_1000108957 164
754 3300006175 Ga0070712_100019749 Ga0070712_1000197494 164
755 3300006237 Ga0097621_100035448 Ga0097621_1000354482 164
756 3300006358 Ga0068871_101562352 Ga0068871_1015623521 164
757 3300006844 Ga0075428_100001400 Ga0075428_10000140017 164
758 3300006844 Ga0075428_100018653 Ga0075428_1000186535 164
759 3300006846 Ga0075430_100013658 Ga0075430_1000136583 164
760 3300006847 Ga0075431_100001828 Ga0075431_1000018286 164
761 3300006871 Ga0075434_100423453 Ga0075434_1004234532 164
762 3300006871 Ga0075434_101015932 Ga0075434_1010159321 164
763 3300006880 Ga0075429_100016078 Ga0075429_1000160782 164
764 3300006880 Ga0075429_100815983 Ga0075429_1008159831 164
765 3300006881 Ga0068865_100031672 Ga0068865_1000316724 164
766 3300009094 Ga0111539_11149348 Ga0111539_111493482 164
767 3300009098 Ga0105245_10013977 Ga0105245_100139776 164
768 3300009098 Ga0105245_10016782 Ga0105245_100167824 164
769 3300009098 Ga0105245_10019026 Ga0105245_100190263 164
770 3300009101 Ga0105247_10135707 Ga0105247_101357072 164
771 3300009147 Ga0114129_10004745 Ga0114129_1000474518 164
772 3300009147 Ga0114129_10444623 Ga0114129_104446235 164
773 3300009148 Ga0105243_10002101 Ga0105243_1000210111 164
774 3300009148 Ga0105243_10047430 Ga0105243_100474302 164
775 3300009174 Ga0105241_10019097 Ga0105241_100190977 164
776 3300009176 Ga0105242_10003124 Ga0105242_100031245 164
777 3300009176 Ga0105242_10514869 Ga0105242_105148692 164
778 3300009177 Ga0105248_10021005 Ga0105248_100210054 164
779 3300009551 Ga0105238_10020762 Ga0105238_100207624 164
780 3300009551 Ga0105238_10347713 Ga0105238_103477132 164
781 3300009553 Ga0105249_10002268 Ga0105249_1000226817 164
782 3300009553 Ga0105249_10175295 Ga0105249_101752954 164
783 3300010375 Ga0105239_10061108 Ga0105239_100611084 164
784 3300010375 Ga0105239_10077288 Ga0105239_100772883 164
785 3300010375 Ga0105239_11083337 Ga0105239_110833372 164
786 3300011119 Ga0105246_10287054 Ga0105246_102870542 164
787 3300013100 Ga0157373_10512682 Ga0157373_105126822 164
788 3300013105 Ga0157369_10432933 Ga0157369_104329333 164
789 3300013296 Ga0157374_10001932 Ga0157374_1000193211 164
790 3300013297 Ga0157378_10002234 Ga0157378_100022343 164
791 3300013306 Ga0163162_10021305 Ga0163162_100213056 164
792 3300013306 Ga0163162_10173270 Ga0163162_101732705 164
793 3300013307 Ga0157372_10038513 Ga0157372_100385135 164
794 3300013308 Ga0157375_10081823 Ga0157375_100818234 164
795 3300014326 Ga0157380_10017866 Ga0157380_100178662 164
796 3300014745 Ga0157377_10001693 Ga0157377_100016934 164
797 3300014969 Ga0157376_10005356 Ga0157376_1000535610 164
798 3300021384 Ga0213876_10061765 Ga0213876_100617653 164
799 3300025898 Ga0207692_10142735 Ga0207692_101427353 164
800 3300025899 Ga0207642_10054953 Ga0207642_100549533 164
801 3300025901 Ga0207688_10140322 Ga0207688_101403222 164
802 3300025903 Ga0207680_10023379 Ga0207680_100233793 164
803 3300025905 Ga0207685_10049871 Ga0207685_100498712 164
804 3300025906 Ga0207699_10030727 Ga0207699_100307272 164
805 3300025906 Ga0207699_10046025 Ga0207699_100460252 164
806 3300025909 Ga0207705_10041106 Ga0207705_100411064 164
807 3300025910 Ga0207684_10551004 Ga0207684_105510042 164
808 3300025911 Ga0207654_10107294 Ga0207654_101072943 164
809 3300025912 Ga0207707_10232707 Ga0207707_102327073 164
810 3300025912 Ga0207707_10577817 Ga0207707_105778172 164
811 3300025915 Ga0207693_10007175 Ga0207693_1000717512 164
812 3300025915 Ga0207693_10027303 Ga0207693_100273034 164
813 3300025915 Ga0207693_11135111 Ga0207693_111351111 164
814 3300025916 Ga0207663_10033549 Ga0207663_100335493 164
815 3300025917 Ga0207660_10213841 Ga0207660_102138412 164
816 3300025918 Ga0207662_10074295 Ga0207662_100742953 164
817 3300025919 Ga0207657_10004070 Ga0207657_1000407011 164
818 3300025919 Ga0207657_10042720 Ga0207657_100427204 164
819 3300025920 Ga0207649_10192131 Ga0207649_101921312 164
820 3300025923 Ga0207681_10662037 Ga0207681_106620372 164
821 3300025924 Ga0207694_10439139 Ga0207694_104391392 164
822 3300025927 Ga0207687_10019617 Ga0207687_100196173 164
823 3300025927 Ga0207687_10139571 Ga0207687_101395712 164
824 3300025928 Ga0207700_10004542 Ga0207700_100045424 164
825 3300025929 Ga0207664_10336965 Ga0207664_103369652 164
826 3300025929 Ga0207664_11222528 Ga0207664_112225281 164
827 3300025932 Ga0207690_10103134 Ga0207690_101031342 164
828 3300025932 Ga0207690_10153400 Ga0207690_101534002 164
829 3300025933 Ga0207706_10065047 Ga0207706_100650474 164
830 3300025933 Ga0207706_10252095 Ga0207706_102520952 164
831 3300025934 Ga0207686_10014856 Ga0207686_100148565 164
832 3300025934 Ga0207686_10130155 Ga0207686_101301552 164
833 3300025934 Ga0207686_10359231 Ga0207686_103592312 164
834 3300025935 Ga0207709_10053457 Ga0207709_100534573 164
835 3300025935 Ga0207709_10078175 Ga0207709_100781753 164
836 3300025937 Ga0207669_10192844 Ga0207669_101928441 164
837 3300025937 Ga0207669_10483661 Ga0207669_104836612 164
838 3300025937 Ga0207669_10663068 Ga0207669_106630681 164
839 3300025937 Ga0207669_11056327 Ga0207669_110563272 164
840 3300025938 Ga0207704_10068214 Ga0207704_100682142 164
841 3300025938 Ga0207704_10089184 Ga0207704_100891844 164
842 3300025940 Ga0207691_10081295 Ga0207691_100812952 164
843 3300025941 Ga0207711_10027079 Ga0207711_100270797 164
844 3300025949 Ga0207667_10342945 Ga0207667_103429452 164
845 3300025960 Ga0207651_10225155 Ga0207651_102251552 164
846 3300025960 Ga0207651_10257702 Ga0207651_102577022 164
847 3300025961 Ga0207712_10047091 Ga0207712_100470913 164
848 3300025961 Ga0207712_10124430 Ga0207712_101244303 164
849 3300025961 Ga0207712_10337687 Ga0207712_103376871 164
850 3300025972 Ga0207668_10284371 Ga0207668_102843712 164
851 3300025986 Ga0207658_10165417 Ga0207658_101654174 164
852 3300026023 Ga0207677_10096602 Ga0207677_100966023 164
853 3300026041 Ga0207639_10382465 Ga0207639_103824653 164
854 3300026041 Ga0207639_11831952 Ga0207639_118319521 164
855 3300026067 Ga0207678_10007751 Ga0207678_1000775112 164
856 3300026075 Ga0207708_10000352 Ga0207708_1000035240 164
857 3300026075 Ga0207708_10120002 Ga0207708_101200021 164
858 3300026078 Ga0207702_10077337 Ga0207702_100773373 164
859 3300026078 Ga0207702_10179997 Ga0207702_101799972 164
860 3300026078 Ga0207702_10344670 Ga0207702_103446702 164
861 3300026089 Ga0207648_10033696 Ga0207648_100336962 164
862 3300026089 Ga0207648_10628997 Ga0207648_106289971 164
863 3300026095 Ga0207676_10839413 Ga0207676_108394132 164
864 3300026118 Ga0207675_100015239 Ga0207675_1000152392 164
865 3300026121 Ga0207683_10000598 Ga0207683_1000059825 164
866 3300026142 Ga0207698_11522714 Ga0207698_115227141 164
867 3300027682 Ga0209971_1115614 Ga0209971_11156141 164
868 3300027907 Ga0207428_10003848 Ga0207428_1000384816 164
869 3300028381 Ga0268264_10536801 Ga0268264_105368012 164
870 3300031824 Ga0307413_10930033 Ga0307413_109300332 164
871 3300031901 Ga0307406_10059659 Ga0307406_100596593 164
872 3300031901 Ga0307406_10405464 Ga0307406_104054642 164
873 3300031903 Ga0307407_10178165 Ga0307407_101781653 164
874 3300031911 Ga0307412_10062126 Ga0307412_100621264 164
875 3300031995 Ga0307409_100093471 Ga0307409_1000934713 164
876 3300031995 Ga0307409_100191056 Ga0307409_1001910563 164
877 3300032002 Ga0307416_100029255 Ga0307416_1000292553 164
878 3300032002 Ga0307416_100143683 Ga0307416_1001436833 164
879 3300032002 Ga0307416_100550000 Ga0307416_1005500002 164
880 3300032005 Ga0307411_10849615 Ga0307411_108496152 164
881 3300032126 Ga0307415_100166071 Ga0307415_1001660712 164
882 3300035171 Ga0373946_0041328 Ga0373946_0041328_939_1433 164
883 3300035695 Ga0373927_0038793 Ga0373927_0038793_1720_2220 164
884 3300035695 Ga0373927_0693319 Ga0373927_0693319_35_535 164
885 3300037068 Ga0373925_0195437 Ga0373925_0195437_155_649 164
886 3300037312 Ga0395899_0059451 Ga0395899_0059451_1291_1788 164
887 3300037418 Ga0395900_0016596 Ga0395900_0016596_4279_4776 164
888 3300037418 Ga0395900_0039392 Ga0395900_0039392_2789_3328 164
889 3300037418 Ga0395900_0478768 Ga0395900_0478768_450_953 164
890 3300037466 Ga0395898_0029101 Ga0395898_0029101_1340_1879 164
891 3300037466 Ga0395898_0201796 Ga0395898_0201796_1173_1670 164
892 3300037471 Ga0395905_0038521 Ga0395905_0038521_2735_3232 164
893 3300037471 Ga0395905_0072180 Ga0395905_0072180_1495_2034 164
894 3300037471 Ga0395905_1201340 Ga0395905_1201340_82_621 164
895 3300038443 Ga0395901_0024817 Ga0395901_0024817_1758_2297 164
896 3300038443 Ga0395901_0169160 Ga0395901_0169160_826_1323 164
897 3300038443 Ga0395901_0182201 Ga0395901_0182201_485_988 164
898 3300038443 Ga0395901_0263037 Ga0395901_0263037_1184_1681 164
899 3300039437 Ga0436365_0714445 Ga0436365_0714445_6600_7103 164
900 3300039450 Ga0436363_1330717 Ga0436363_1330717_367_870 164
901 3300039453 Ga0436362_0098660 Ga0436362_0098660_492_995 164
902 3300044656 Ga0466969_0174477 Ga0466969_0174477_406_906 164
903 3300045049 Ga0466959_0030167 Ga0466959_0030167_1335_1835 164
904 3300045836 Ga0466958_0113222 Ga0466958_0113222_1053_1559 164
905 3300045976 Ga0466967_0121170 Ga0466967_0121170_1838_2338 164
906 3300045976 Ga0466967_0399820 Ga0466967_0399820_511_1011 164
907 3300046472 Ga0495580_0074948 Ga0495580_0074948_794_1288 164
908 3300046473 Ga0495582_0711659 Ga0495582_0711659_38_559 164
909 3300046475 Ga0495639_0028748 Ga0495639_0028748_1172_1666 164
910 3300046491 Ga0495584_0045009 Ga0495584_0045009_542_1036 164
911 3300046523 Ga0495644_0096346 Ga0495644_0096346_72_566 164
912 3300046523 Ga0495644_0136571 Ga0495644_0136571_393_887 164
913 3300046525 Ga0495663_0286773 Ga0495663_0286773_28_522 164
914 3300046528 Ga0495642_0089651 Ga0495642_0089651_683_1177 164
915 3300046528 Ga0495642_0211741 Ga0495642_0211741_177_671 164
916 3300046531 Ga0495665_0077748 Ga0495665_0077748_333_827 164
917 3300046531 Ga0495665_0550079 Ga0495665_0550079_18_512 164
918 3300046535 Ga0495586_0030028 Ga0495586_0030028_630_1130 164
919 3300046538 Ga0495609_0023638 Ga0495609_0023638_327_821 164
920 3300046616 Ga0495668_0044275 Ga0495668_0044275_1486_1980 164
921 3300046665 Ga0495661_0447651 Ga0495661_0447651_79_573 164
922 3300046683 Ga0495658_0310073 Ga0495658_0310073_40_534 164
923 3300046691 Ga0495670_0185005 Ga0495670_0185005_379_873 164
924 3300046794 Ga0495589_0037555 Ga0495589_0037555_1360_1854 164
925 3300047315 Ga0495581_0001162 Ga0495581_0001162_11575_12069 164
926 3300047315 Ga0495581_0009944 Ga0495581_0009944_4570_5064 164
927 3300047319 Ga0495674_0353634 Ga0495674_0353634_431_931 164
928 3300047321 Ga0495676_0041890 Ga0495676_0041890_208_702 164
929 3300047321 Ga0495676_0074415 Ga0495676_0074415_302_796 164
930 3300047323 Ga0495683_0152228 Ga0495683_0152228_259_753 164
931 3300047447 Ga0495685_103414 Ga0495685_103414_158_652 164
932 3300048903 Ga0496100_0007236 Ga0496100_0007236_4623_5117 164
933 3300048903 Ga0496100_0154411 Ga0496100_0154411_1004_1540 164
934 3300048905 Ga0496102_0032594 Ga0496102_0032594_2914_3408 164
935 3300048906 Ga0496103_0002529 Ga0496103_0002529_10108_10602 164
936 3300048906 Ga0496103_0018803 Ga0496103_0018803_1940_2476 164
937 3300048908 Ga0496105_0038149 Ga0496105_0038149_1837_2358 164
938 3300048908 Ga0496105_0194167 Ga0496105_0194167_35_571 164
939 3300048909 Ga0496106_0000412 Ga0496106_0000412_22271_22807 164
940 3300048909 Ga0496106_0000909 Ga0496106_0000909_8361_8882 164
941 3300048909 Ga0496106_0480971 Ga0496106_0480971_29_535 164
942 3300048910 Ga0496107_0004852 Ga0496107_0004852_6974_7495 164
943 3300048911 Ga0496108_0119825 Ga0496108_0119825_683_1204 164
944 3300048912 Ga0496109_0093771 Ga0496109_0093771_1179_1700 164
945 3300048914 Ga0496111_0336399 Ga0496111_0336399_474_980 164
946 3300048915 Ga0496112_0019479 Ga0496112_0019479_1290_1811 164
947 3300048915 Ga0496112_0039644 Ga0496112_0039644_3746_4243 164
948 3300048915 Ga0496112_0161569 Ga0496112_0161569_156_662 164
949 3300048917 Ga0496114_0087925 Ga0496114_0087925_1251_1772 164
950 3300048918 Ga0496115_0032095 Ga0496115_0032095_1449_1970 164
951 3300049568 Ga0501031_0001473 Ga0501031_0001473_10603_11097 164
952 3300049568 Ga0501031_0403576 Ga0501031_0403576_256_756 164
953 3300049569 Ga0501032_0248400 Ga0501032_0248400_506_1006 164
954 3300049570 Ga0501033_0015102 Ga0501033_0015102_4403_4897 164
955 3300049572 Ga0501036_0424466 Ga0501036_0424466_138_638 164
956 3300049573 Ga0501037_0036644 Ga0501037_0036644_2432_2926 164
957 3300049574 Ga0501038_0275907 Ga0501038_0275907_303_797 164
958 3300049575 Ga0501039_0007983 Ga0501039_0007983_5573_6067 164
959 3300049575 Ga0501039_0369702 Ga0501039_0369702_142_642 164
960 3300049576 Ga0501040_0054526 Ga0501040_0054526_2140_2634 164
961 3300049576 Ga0501040_0320034 Ga0501040_0320034_149_649 164
962 3300049577 Ga0501041_0057263 Ga0501041_0057263_1235_1729 164
963 3300049577 Ga0501041_0306163 Ga0501041_0306163_373_873 164
964 3300049578 Ga0501042_0003275 Ga0501042_0003275_7402_7896 164
965 3300049579 Ga0501043_0374801 Ga0501043_0374801_441_941 164
966 3300049580 Ga0501046_0024599 Ga0501046_0024599_4256_4750 164
967 3300049582 Ga0501048_0007617 Ga0501048_0007617_1843_2337 164
968 3300049582 Ga0501048_0056682 Ga0501048_0056682_1369_1869 164
969 3300049584 Ga0501068_0000766 Ga0501068_0000766_10022_10516 164
970 3300049584 Ga0501068_0006144 Ga0501068_0006144_193_693 164
971 3300049587 Ga0501071_0007395 Ga0501071_0007395_888_1382 164
972 3300049587 Ga0501071_0051052 Ga0501071_0051052_1588_2088 164
973 3300049588 Ga0501072_0030449 Ga0501072_0030449_3521_4015 164
974 3300049588 Ga0501072_0313163 Ga0501072_0313163_285_785 164
975 3300049589 Ga0501073_0171185 Ga0501073_0171185_16_510 164
976 3300049589 Ga0501073_0359240 Ga0501073_0359240_384_884 164
977 3300049590 Ga0501074_0013240 Ga0501074_0013240_4418_4912 164
978 3300049590 Ga0501074_0021310 Ga0501074_0021310_491_991 164
979 3300049591 Ga0501075_0056996 Ga0501075_0056996_656_1150 164
980 3300049591 Ga0501075_0230449 Ga0501075_0230449_777_1277 164
981 3300049592 Ga0501076_0004230 Ga0501076_0004230_7165_7659 164
982 3300049592 Ga0501076_0267969 Ga0501076_0267969_485_985 164
983 3300049593 Ga0501077_0020161 Ga0501077_0020161_3350_3844 164
984 3300049741 Ga0501079_0033079 Ga0501079_0033079_210_704 164
985 3300049742 Ga0501080_0016052 Ga0501080_0016052_1168_1662 164
986 3300049742 Ga0501080_0185757 Ga0501080_0185757_1067_1567 164
987 3300049743 Ga0501081_0001718 Ga0501081_0001718_176_670 164
988 3300049743 Ga0501081_0186675 Ga0501081_0186675_892_1392 164
989 3300049744 Ga0501083_0045121 Ga0501083_0045121_124_624 164
990 3300049822 Ga0501035_0172327 Ga0501035_0172327_516_1010 164
991 3300049824 Ga0501045_0002214 Ga0501045_0002214_333_827 164
992 3300049824 Ga0501045_0178403 Ga0501045_0178403_94_594 164
993 3300049824 Ga0501045_1167912 Ga0501045_1167912_26_520 164
994 3300050507 nmdc:mga05p37_126487_c1 nmdc:mga05p37_126487_c1_251_754 164
995 3300050507 nmdc:mga05p37_5072_c1 nmdc:mga05p37_5072_c1_3316_3834 164
996 3300050508 nmdc:mga09592_12562_c1 nmdc:mga09592_12562_c1_3498_4001 164
997 3300050509 nmdc:mga0qj67_8890_c1 nmdc:mga0qj67_8890_c1_2301_2804 164
998 3300050510 nmdc:mga06r32_101792_c1 nmdc:mga06r32_101792_c1_531_1034 164
999 3300050510 nmdc:mga06r32_17560_c1 nmdc:mga06r32_17560_c1_3266_3769 164
1000 3300050511 nmdc:mga08y16_71787_c1 nmdc:mga08y16_71787_c1_2341_2844 164
1001 3300050513 nmdc:mga0rr50_345043_c1 nmdc:mga0rr50_345043_c1_433_969 164
1002 3300054114 Ga0501084_0226242 Ga0501084_0226242_144_638 164
1003 3300054114 Ga0501084_0438989 Ga0501084_0438989_492_992 164
1004 3300060353 Ga0501082_0043028 Ga0501082_0043028_1162_1656 164
1005 3300060353 Ga0501082_0257680 Ga0501082_0257680_766_1266 164
1006 3300061734 Ga0530510_0379047 Ga0530510_0379047_96_596 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

40

174

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9483 9 163
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9435 9 162
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9414 9 164
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9393 9 162
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9391 10 164
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9384 9 160 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9283 9 161 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9038 9 161 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8877 10 160 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8871 10 162 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V9FGY1-F1-model_v4 ATPase 0.987 7 139
AF-A0A1H5FJA9-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9805 7 164
AF-A0A537FJU4-F1-model_v4 ATPase 0.9795 10 164
AF-A0A4Q5NTU3-F1-model_v4 ATPase 0.9782 12 164
AF-A0A0N9I7Y6-F1-model_v4 ATPase 0.9781 10 163

Feature Viewer

pLDDT pTM Quality
94.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map