F487962

General Info

Members Datasets Scaffolds Average Seq Length
1004 387 1004 285

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10015755|Ga0157370_100157552
Length 322
Sequence MPSFPKPRIPDAIVPPPLRKPAKPGTSGAPKGQAPSDLKTAPPERPSHGDKLLDRGKEAPIDALGWVDQRMAASGFLTGMLYRKVPKGTNWFYTLGSATLFAFVVQAVTGVFLAMYYTPSATQAYASIAHINNDVPLGQFVHGMHKWGSSVMVILIFLHMGRTFFFGAYKYPRELNWVIGVVLLILTMTMAFTGYLLPFDQRSFWASIVGININGTGPVVGPYLSDFLRAGPEFGATTLSRFYAIHMLLVPGAIIALIGAHMYLVVKLGTTAPPWVKAERPKGASPLAQLDAGVNGNGNGRVNGHRTNGTPVSDEGGNGASA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 9.06
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003604 3300001977 Bacteria 2439
2 JGI24740J21852_10000904 3300001979 Bacteria 13157
3 JGI24737J22298_10027549 3300001990 Bacteria 1791
4 JGI24748J21848_1000389 3300002074 Bacteria 4966
5 JGI24738J21930_10025607 3300002075 Bacteria 1212
6 JGI24034J26672_10000150 3300002239 Bacteria 9967
7 JGI24742J22300_10019606 3300002244 Bacteria 1149
8 JGI25407J50210_10002380 3300003373 Bacteria 4423
9 JGI25407J50210_10025274 3300003373 Bacteria 1540
10 JGI25407J50210_10037219 3300003373 Bacteria 1250
11 Ga0007409J51694_1018359 3300003575 Bacteria 1364
12 Ga0058862_10146983 3300004803 Bacteria 1105
13 Ga0070658_10016326 3300005327 Bacteria 5942
14 Ga0070676_10133369 3300005328 Bacteria 1573
15 Ga0070683_100000367 3300005329 Bacteria 31252
16 Ga0070683_100001266 3300005329 Bacteria 19233
17 Ga0070683_100008892 3300005329 Bacteria 8556
18 Ga0070683_100022950 3300005329 Bacteria 5579
19 Ga0070683_100026568 3300005329 Bacteria 5215
20 Ga0070683_100060529 3300005329 Bacteria 3519
21 Ga0070683_100271684 3300005329 Bacteria 1612
22 Ga0070690_100140722 3300005330 Bacteria 1638
23 Ga0070677_10000018 3300005333 Bacteria 51146
24 Ga0068869_100366521 3300005334 Bacteria 1178
25 Ga0070666_10013143 3300005335 Bacteria 5246
26 Ga0070666_10044022 3300005335 Bacteria 2990
27 Ga0070680_100008814 3300005336 Bacteria 7738
28 Ga0070680_100025271 3300005336 Bacteria 4746
29 Ga0070682_100000016 3300005337 Bacteria 239799
30 Ga0070682_100000029 3300005337 Bacteria 183516
31 Ga0070682_100061925 3300005337 Bacteria 2369
32 Ga0070682_100275275 3300005337 Bacteria 1224
33 Ga0070682_100384602 3300005337 Bacteria 1056
34 Ga0068868_100005977 3300005338 Bacteria 8589
35 Ga0068868_100050401 3300005338 Bacteria 3269
36 Ga0068868_100444473 3300005338 Bacteria 1127
37 Ga0070660_100006612 3300005339 Bacteria 8044
38 Ga0070660_100077368 3300005339 Bacteria 2607
39 Ga0070691_10000009 3300005341 Bacteria 58678
40 Ga0070691_10008056 3300005341 Bacteria 4821
41 Ga0070691_10146659 3300005341 Bacteria 1207
42 Ga0070687_100011944 3300005343 Bacteria 3817
43 Ga0070661_100000026 3300005344 Bacteria 118733
44 Ga0070661_100006067 3300005344 Bacteria 8316
45 Ga0070661_100023036 3300005344 Bacteria 4461
46 Ga0070692_10028477 3300005345 Bacteria 2776
47 Ga0070692_10049869 3300005345 Bacteria 2173
48 Ga0070692_10259767 3300005345 Bacteria 1043
49 Ga0070668_100002556 3300005347 Bacteria 13378
50 Ga0070668_100188703 3300005347 Bacteria 1687
51 Ga0070668_100271780 3300005347 Bacteria 1413
52 Ga0070669_100024526 3300005353 Bacteria 4324
53 Ga0070669_100252060 3300005353 Bacteria 1406
54 Ga0070675_100000015 3300005354 Bacteria 201080
55 Ga0070674_100000003 3300005356 Bacteria 258221
56 Ga0070674_100000028 3300005356 Bacteria 69584
57 Ga0070674_100349061 3300005356 Bacteria 1194
58 Ga0070688_100210574 3300005365 Bacteria 1365
59 Ga0070659_100000002 3300005366 Bacteria 369239
60 Ga0070659_100001108 3300005366 Bacteria 19650
61 Ga0070659_100001759 3300005366 Bacteria 15569
62 Ga0070659_100088392 3300005366 Bacteria 2481
63 Ga0070659_100144127 3300005366 Bacteria 1940
64 Ga0070667_100012784 3300005367 Bacteria 6937
65 Ga0070667_100097367 3300005367 Bacteria 2538
66 Ga0070667_100105361 3300005367 Bacteria 2440
67 Ga0070714_100000457 3300005435 Bacteria 29655
68 Ga0070714_100336604 3300005435 Bacteria 1414
69 Ga0070713_100000014 3300005436 Bacteria 124804
70 Ga0070713_100010729 3300005436 Bacteria 6635
71 Ga0070713_100022899 3300005436 Bacteria 4836
72 Ga0070710_10000007 3300005437 Bacteria 215320
73 Ga0070710_10032819 3300005437 Bacteria 2815
74 Ga0070710_10323023 3300005437 Bacteria 1014
75 Ga0070711_100018181 3300005439 Bacteria 4484
76 Ga0070711_100169259 3300005439 Bacteria 1664
77 Ga0070711_100169536 3300005439 Bacteria 1663
78 Ga0070705_100014228 3300005440 Bacteria 4089
79 Ga0070700_100000713 3300005441 Bacteria 16380
80 Ga0070663_100005232 3300005455 Bacteria 7686
81 Ga0070663_100032151 3300005455 Bacteria 3614
82 Ga0070663_100069580 3300005455 Bacteria 2557
83 Ga0070678_100011408 3300005456 Bacteria 5481
84 Ga0070678_100158391 3300005456 Bacteria 1832
85 Ga0070678_100289686 3300005456 Bacteria 1387
86 Ga0070678_100390347 3300005456 Bacteria 1206
87 Ga0070678_100683115 3300005456 Bacteria 923
88 Ga0070662_100000008 3300005457 Bacteria 168754
89 Ga0070662_100308842 3300005457 Bacteria 1287
90 Ga0070662_100473915 3300005457 Bacteria 1041
91 Ga0070681_10007190 3300005458 Bacteria 10848
92 Ga0070681_10016470 3300005458 Bacteria 7380
93 Ga0070681_10120339 3300005458 Bacteria 2561
94 Ga0070681_10384651 3300005458 Bacteria 1314
95 Ga0068867_100001503 3300005459 Bacteria 16143
96 Ga0068867_100075180 3300005459 Bacteria 2533
97 Ga0068867_100132290 3300005459 Bacteria 1940
98 Ga0068867_100472532 3300005459 Bacteria 1072
99 Ga0070685_10018903 3300005466 Bacteria 3712
100 Ga0070698_100119204 3300005471 Bacteria 2600
101 Ga0070699_100372117 3300005518 Bacteria 1289
102 Ga0070679_100000507 3300005530 Bacteria 33181
103 Ga0070679_100000674 3300005530 Bacteria 29110
104 Ga0070679_100003327 3300005530 Bacteria 14715
105 Ga0070679_100117690 3300005530 Bacteria 2642
106 Ga0070684_100022491 3300005535 Bacteria 5259
107 Ga0070684_100043637 3300005535 Bacteria 3873
108 Ga0070684_100051215 3300005535 Bacteria 3586
109 Ga0070684_100081725 3300005535 Bacteria 2859
110 Ga0070684_100092618 3300005535 Bacteria 2689
111 Ga0070684_100278799 3300005535 Bacteria 1531
112 Ga0070684_100283635 3300005535 Bacteria 1517
113 Ga0070684_100302559 3300005535 Bacteria 1468
114 Ga0070684_100440901 3300005535 Bacteria 1203
115 Ga0068853_100001814 3300005539 Bacteria 15699
116 Ga0068853_100083492 3300005539 Bacteria 2799
117 Ga0068853_100816413 3300005539 Bacteria 893
118 Ga0070672_100000129 3300005543 Bacteria 39624
119 Ga0070672_100021385 3300005543 Bacteria 4732
120 Ga0070686_100015412 3300005544 Bacteria 4428
121 Ga0070693_100000093 3300005547 Bacteria 38785
122 Ga0070665_100000120 3300005548 Bacteria 148340
123 Ga0070665_100001016 3300005548 Bacteria 35289
124 Ga0070665_100056914 3300005548 Bacteria 3921
125 Ga0070665_100058921 3300005548 Bacteria 3849
126 Ga0070665_100280015 3300005548 Bacteria 1669
127 Ga0068855_100175616 3300005563 Bacteria 2424
128 Ga0068855_100297589 3300005563 Bacteria 1788
129 Ga0070664_100257493 3300005564 Bacteria 1570
130 Ga0070664_100390594 3300005564 Bacteria 1271
131 Ga0070664_100440217 3300005564 Bacteria 1196
132 Ga0070664_100559857 3300005564 Bacteria 1058
133 Ga0068857_100042206 3300005577 Bacteria 4045
134 Ga0068857_100589759 3300005577 Bacteria 1050
135 Ga0068854_100000373 3300005578 Bacteria 28615
136 Ga0068854_100097394 3300005578 Bacteria 2199
137 Ga0068856_100000186 3300005614 Bacteria 64970
138 Ga0068856_100024148 3300005614 Bacteria 5915
139 Ga0068856_100035899 3300005614 Bacteria 4859
140 Ga0068856_100052759 3300005614 Bacteria 4011
141 Ga0068856_100432252 3300005614 Bacteria 1337
142 Ga0070702_100154317 3300005615 Bacteria 1477
143 Ga0068852_100000013 3300005616 Bacteria 139537
144 Ga0068852_100053917 3300005616 Bacteria 3464
145 Ga0068864_100000044 3300005618 Bacteria 157919
146 Ga0068864_100063941 3300005618 Bacteria 3190
147 Ga0068864_100176006 3300005618 Bacteria 1953
148 Ga0068864_100537068 3300005618 Bacteria 1129
149 Ga0068866_10000002 3300005718 Bacteria 394090
150 Ga0068866_10000045 3300005718 Bacteria 48372
151 Ga0068866_10009088 3300005718 Bacteria 4212
152 Ga0068866_10043953 3300005718 Bacteria 2232
153 Ga0068866_10167533 3300005718 Bacteria 1287
154 Ga0068861_100078748 3300005719 Bacteria 2575
155 Ga0068861_100213824 3300005719 Bacteria 1626
156 Ga0068851_10002068 3300005834 Bacteria 8847
157 Ga0068870_10048106 3300005840 Bacteria 2244
158 Ga0068870_10183207 3300005840 Bacteria 1258
159 Ga0068863_100000080 3300005841 Bacteria 106670
160 Ga0068863_100187922 3300005841 Bacteria 1985
161 Ga0068863_100362307 3300005841 Bacteria 1413
162 Ga0068863_100946688 3300005841 Bacteria 863
163 Ga0068858_100000035 3300005842 Bacteria 140466
164 Ga0068858_100000042 3300005842 Bacteria 132482
165 Ga0068858_100379343 3300005842 Bacteria 1357
166 Ga0068860_100057058 3300005843 Bacteria 3711
167 Ga0068860_100090940 3300005843 Bacteria 2907
168 Ga0068862_100005926 3300005844 Bacteria 10177
169 Ga0081455_10024603 3300005937 Bacteria 5571
170 Ga0081455_10033111 3300005937 Bacteria 4647
171 Ga0081455_10099992 3300005937 Bacteria 2331
172 Ga0081538_10000013 3300005981 Bacteria 151925
173 Ga0081538_10000169 3300005981 Bacteria 69684
174 Ga0081538_10000199 3300005981 Bacteria 66370
175 Ga0081538_10000601 3300005981 Bacteria 39857
176 Ga0081538_10001407 3300005981 Bacteria 24723
177 Ga0081538_10013039 3300005981 Bacteria 6614
178 Ga0081538_10046700 3300005981 Bacteria 2666
179 Ga0081538_10048018 3300005981 Bacteria 2610
180 Ga0081538_10078192 3300005981 Bacteria 1777
181 Ga0081538_10085412 3300005981 Bacteria 1658
182 Ga0081538_10131203 3300005981 Bacteria 1177
183 Ga0081540_1000115 3300005983 Bacteria 84188
184 Ga0081539_10000674 3300005985 Bacteria 68446
185 Ga0081539_10059310 3300005985 Bacteria 2107
186 Ga0081539_10172459 3300005985 Bacteria 1021
187 Ga0070717_10000005 3300006028 Bacteria 357819
188 Ga0070717_10178733 3300006028 Bacteria 1848
189 Ga0075365_10000307 3300006038 Bacteria 17163
190 Ga0075365_10003397 3300006038 Bacteria 8187
191 Ga0075364_10182165 3300006051 Bacteria 1422
192 Ga0075364_10190668 3300006051 Bacteria 1388
193 Ga0070715_10000015 3300006163 Bacteria 152816
194 Ga0070712_100000054 3300006175 Bacteria 57683
195 Ga0070712_100058401 3300006175 Bacteria 2714
196 Ga0075367_10303698 3300006178 Bacteria 1005
197 Ga0075428_100147238 3300006844 Bacteria 2559
198 Ga0075430_100054701 3300006846 Bacteria 3358
199 Ga0075430_100082115 3300006846 Bacteria 2700
200 Ga0075431_100002644 3300006847 Bacteria 17334
201 Ga0075431_100009078 3300006847 Bacteria 9968
202 Ga0075431_100039934 3300006847 Bacteria 4834
203 Ga0075431_100403643 3300006847 Bacteria 1367
204 Ga0075433_10000058 3300006852 Bacteria 48106
205 Ga0075433_10003079 3300006852 Bacteria 12818
206 Ga0075433_10109169 3300006852 Bacteria 2454
207 Ga0075434_100061090 3300006871 Bacteria 3748
208 Ga0075429_100181918 3300006880 Bacteria 1842
209 Ga0068865_100000001 3300006881 Bacteria 288199
210 Ga0068865_100031548 3300006881 Bacteria 3534
211 Ga0068865_100195622 3300006881 Bacteria 1567
212 Ga0075436_100160059 3300006914 Bacteria 1587
213 Ga0097620_100405859 3300006931 Bacteria 1459
214 Ga0075435_100005734 3300007076 Bacteria 8712
215 Ga0075435_100331112 3300007076 Bacteria 1304
216 Ga0105251_10166835 3300009011 Bacteria 992
217 Ga0105240_10009018 3300009093 Bacteria 14167
218 Ga0105240_10146315 3300009093 Bacteria 2819
219 Ga0105240_10441809 3300009093 Bacteria 1457
220 Ga0111539_10005245 3300009094 Bacteria 16790
221 Ga0111539_10040353 3300009094 Bacteria 5620
222 Ga0111539_10128332 3300009094 Bacteria 2970
223 Ga0111539_10160791 3300009094 Bacteria 2627
224 Ga0111539_10427115 3300009094 Bacteria 1543
225 Ga0105245_10000045 3300009098 Bacteria 134057
226 Ga0105245_10000053 3300009098 Bacteria 125678
227 Ga0105245_10000488 3300009098 Bacteria 36321
228 Ga0105245_10014040 3300009098 Bacteria 6975
229 Ga0105245_10161330 3300009098 Bacteria 2128
230 Ga0105245_10500345 3300009098 Bacteria 1231
231 Ga0105245_10511028 3300009098 Bacteria 1219
232 Ga0105247_10000169 3300009101 Bacteria 64387
233 Ga0114129_10007212 3300009147 Bacteria 15822
234 Ga0114129_10142177 3300009147 Bacteria 3288
235 Ga0114129_10149373 3300009147 Bacteria 3198
236 Ga0114129_10204505 3300009147 Bacteria 2672
237 Ga0114129_10311966 3300009147 Bacteria 2093
238 Ga0114129_10382147 3300009147 Bacteria 1859
239 Ga0114129_10411479 3300009147 Bacteria 1781
240 Ga0105243_10012944 3300009148 Bacteria 6304
241 Ga0105243_10222494 3300009148 Bacteria 1669
242 Ga0105243_10339527 3300009148 Bacteria 1375
243 Ga0105242_10000017 3300009176 Bacteria 122190
244 Ga0105242_10001870 3300009176 Bacteria 16542
245 Ga0105248_10000089 3300009177 Bacteria 102101
246 Ga0105248_10114960 3300009177 Bacteria 3035
247 Ga0105248_10214980 3300009177 Bacteria 2166
248 Ga0105238_10001238 3300009551 Bacteria 25694
249 Ga0105238_10132032 3300009551 Bacteria 2475
250 Ga0105238_10171748 3300009551 Bacteria 2144
251 Ga0105249_10000095 3300009553 Bacteria 121300
252 Ga0105249_10008240 3300009553 Bacteria 9076
253 Ga0105249_10070027 3300009553 Bacteria 3238
254 Ga0105249_10136760 3300009553 Bacteria 2346
255 Ga0105249_10264829 3300009553 Bacteria 1709
256 Ga0105249_10530015 3300009553 Bacteria 1226
257 Ga0105249_10538746 3300009553 Bacteria 1217
258 Ga0105239_10015484 3300010375 Bacteria 8448
259 Ga0105239_10428620 3300010375 Bacteria 1499
260 Ga0105239_10507760 3300010375 Bacteria 1371
261 Ga0105246_10052077 3300011119 Bacteria 2812
262 Ga0105246_10063586 3300011119 Bacteria 2574
263 Ga0105246_10156655 3300011119 Bacteria 1730
264 Ga0157316_1003173 3300012510 Bacteria 1168
265 Ga0157373_10146683 3300013100 Bacteria 1660
266 Ga0157371_10001481 3300013102 Bacteria 24297
267 Ga0157370_10004749 3300013104 Bacteria 15468
268 Ga0157370_10011051 3300013104 Bacteria 9468
269 Ga0157370_10015755 3300013104 Bacteria 7672
270 Ga0157370_10061195 3300013104 Bacteria 3573
271 Ga0157370_10128496 3300013104 Bacteria 2365
272 Ga0157370_10154130 3300013104 Bacteria 2138
273 Ga0157370_10272017 3300013104 Bacteria 1565
274 Ga0157369_10000037 3300013105 Bacteria 190395
275 Ga0157369_10028494 3300013105 Bacteria 6182
276 Ga0157374_10012519 3300013296 Bacteria 7384
277 Ga0157374_10454970 3300013296 Bacteria 1282
278 Ga0157378_10312796 3300013297 Bacteria 1524
279 Ga0157378_10341331 3300013297 Bacteria 1461
280 Ga0163162_10077973 3300013306 Bacteria 3378
281 Ga0157372_10000064 3300013307 Bacteria 114648
282 Ga0157372_10040278 3300013307 Bacteria 5159
283 Ga0157372_10131545 3300013307 Bacteria 2879
284 Ga0157372_10259674 3300013307 Bacteria 2017
285 Ga0157372_10499025 3300013307 Bacteria 1419
286 Ga0157375_10000076 3300013308 Bacteria 101715
287 Ga0157375_10018991 3300013308 Bacteria 6240
288 Ga0157375_10033964 3300013308 Bacteria 4854
289 Ga0163163_10020100 3300014325 Bacteria 6285
290 Ga0163163_10310414 3300014325 Bacteria 1630
291 Ga0157380_10000118 3300014326 Bacteria 43745
292 Ga0157380_10000163 3300014326 Bacteria 38484
293 Ga0157380_10022346 3300014326 Bacteria 4760
294 Ga0157380_10050458 3300014326 Bacteria 3287
295 Ga0157380_10282895 3300014326 Bacteria 1519
296 Ga0157377_10047054 3300014745 Bacteria 2415
297 Ga0157377_10159242 3300014745 Bacteria 1402
298 Ga0157379_10027803 3300014968 Bacteria 5034
299 Ga0157379_10338625 3300014968 Bacteria 1375
300 Ga0157379_10442128 3300014968 Bacteria 1199
301 Ga0157376_10016164 3300014969 Bacteria 5659
302 Ga0157376_10086348 3300014969 Bacteria 2705
303 Ga0163161_10000274 3300017792 Bacteria 45112
304 Ga0163161_10221738 3300017792 Bacteria 1464
305 Ga0197907_10398481 3300020069 Bacteria 2164
306 Ga0206356_11146824 3300020070 Bacteria 3962
307 Ga0206351_10113243 3300020077 Bacteria 2026
308 Ga0206351_10664240 3300020077 Bacteria 1003
309 Ga0206352_10890070 3300020078 Bacteria 2427
310 Ga0224712_10011362 3300022467 Bacteria 2761
311 Ga0224712_10076498 3300022467 Bacteria 1371
312 Ga0207656_10000144 3300025321 Bacteria 26784
313 Ga0207682_10000047 3300025893 Bacteria 51208
314 Ga0207692_10000001 3300025898 Bacteria 558345
315 Ga0207692_10002495 3300025898 Bacteria 7069
316 Ga0207642_10000001 3300025899 Bacteria 714030
317 Ga0207642_10000003 3300025899 Bacteria 650651
318 Ga0207642_10000050 3300025899 Bacteria 34402
319 Ga0207642_10015538 3300025899 Bacteria 2840
320 Ga0207710_10000103 3300025900 Bacteria 109033
321 Ga0207710_10084919 3300025900 Bacteria 1474
322 Ga0207688_10002646 3300025901 Bacteria 9691
323 Ga0207688_10013921 3300025901 Bacteria 4373
324 Ga0207688_10015440 3300025901 Bacteria 4142
325 Ga0207688_10031598 3300025901 Bacteria 2924
326 Ga0207688_10212405 3300025901 Bacteria 1163
327 Ga0207680_10007643 3300025903 Bacteria 5279
328 Ga0207680_10066138 3300025903 Bacteria 2222
329 Ga0207647_10081100 3300025904 Bacteria 1945
330 Ga0207647_10152391 3300025904 Bacteria 1351
331 Ga0207647_10190680 3300025904 Bacteria 1188
332 Ga0207685_10000001 3300025905 Bacteria 604473
333 Ga0207699_10134262 3300025906 Bacteria 1618
334 Ga0207643_10073739 3300025908 Bacteria 1968
335 Ga0207643_10082184 3300025908 Bacteria 1867
336 Ga0207705_10015960 3300025909 Bacteria 5392
337 Ga0207705_10020753 3300025909 Bacteria 4688
338 Ga0207705_10053833 3300025909 Bacteria 2900
339 Ga0207707_10062940 3300025912 Bacteria 3229
340 Ga0207707_10089776 3300025912 Bacteria 2686
341 Ga0207695_10398791 3300025913 Bacteria 1260
342 Ga0207693_10000001 3300025915 Bacteria 469535
343 Ga0207693_10002610 3300025915 Bacteria 15668
344 Ga0207693_10006332 3300025915 Bacteria 9813
345 Ga0207693_10032690 3300025915 Bacteria 4105
346 Ga0207663_10004253 3300025916 Bacteria 7103
347 Ga0207663_10073167 3300025916 Bacteria 2217
348 Ga0207663_10087472 3300025916 Bacteria 2058
349 Ga0207663_10232257 3300025916 Bacteria 1348
350 Ga0207660_10008920 3300025917 Bacteria 6488
351 Ga0207660_10011227 3300025917 Bacteria 5826
352 Ga0207660_10027681 3300025917 Bacteria 3871
353 Ga0207660_10134515 3300025917 Bacteria 1885
354 Ga0207662_10012004 3300025918 Bacteria 4818
355 Ga0207662_10019100 3300025918 Bacteria 3896
356 Ga0207657_10000902 3300025919 Bacteria 31364
357 Ga0207657_10018050 3300025919 Bacteria 6749
358 Ga0207657_10020984 3300025919 Bacteria 6161
359 Ga0207657_10068331 3300025919 Bacteria 3018
360 Ga0207657_10163770 3300025919 Bacteria 1805
361 Ga0207649_10000025 3300025920 Bacteria 177532
362 Ga0207649_10007634 3300025920 Bacteria 5881
363 Ga0207652_10000177 3300025921 Bacteria 67555
364 Ga0207652_10004034 3300025921 Bacteria 11985
365 Ga0207652_10007489 3300025921 Bacteria 8794
366 Ga0207652_10043446 3300025921 Bacteria 3826
367 Ga0207646_10357878 3300025922 Bacteria 1319
368 Ga0207681_10006628 3300025923 Bacteria 7110
369 Ga0207681_10224829 3300025923 Bacteria 1454
370 Ga0207694_10000067 3300025924 Bacteria 128108
371 Ga0207659_10000032 3300025926 Bacteria 119492
372 Ga0207687_10000021 3300025927 Bacteria 226396
373 Ga0207687_10000023 3300025927 Bacteria 217098
374 Ga0207687_10000241 3300025927 Bacteria 37298
375 Ga0207687_10110630 3300025927 Bacteria 2038
376 Ga0207687_10115669 3300025927 Bacteria 1998
377 Ga0207687_10235269 3300025927 Bacteria 1449
378 Ga0207687_10312529 3300025927 Bacteria 1269
379 Ga0207700_10000001 3300025928 Bacteria 1122509
380 Ga0207700_10000009 3300025928 Bacteria 314953
381 Ga0207700_10013851 3300025928 Bacteria 5265
382 Ga0207700_10078468 3300025928 Bacteria 2569
383 Ga0207664_10000008 3300025929 Bacteria 309301
384 Ga0207664_10068604 3300025929 Bacteria 2849
385 Ga0207664_10128030 3300025929 Bacteria 2134
386 Ga0207664_10303082 3300025929 Bacteria 1406
387 Ga0207690_10000024 3300025932 Bacteria 194416
388 Ga0207690_10001315 3300025932 Bacteria 15617
389 Ga0207690_10023389 3300025932 Bacteria 3855
390 Ga0207690_10024415 3300025932 Bacteria 3787
391 Ga0207690_10063905 3300025932 Bacteria 2511
392 Ga0207706_10000016 3300025933 Bacteria 170697
393 Ga0207706_10060988 3300025933 Bacteria 3321
394 Ga0207706_10155286 3300025933 Bacteria 2013
395 Ga0207686_10000016 3300025934 Bacteria 198779
396 Ga0207686_10000029 3300025934 Bacteria 160239
397 Ga0207686_10000189 3300025934 Bacteria 47718
398 Ga0207686_10069967 3300025934 Bacteria 2253
399 Ga0207709_10061777 3300025935 Bacteria 2342
400 Ga0207709_10072392 3300025935 Bacteria 2192
401 Ga0207709_10106828 3300025935 Bacteria 1863
402 Ga0207670_10099045 3300025936 Bacteria 2079
403 Ga0207669_10000014 3300025937 Bacteria 129145
404 Ga0207669_10000024 3300025937 Bacteria 96123
405 Ga0207704_10000004 3300025938 Bacteria 239295
406 Ga0207704_10004866 3300025938 Bacteria 6171
407 Ga0207691_10000062 3300025940 Bacteria 85448
408 Ga0207691_10025351 3300025940 Bacteria 5569
409 Ga0207711_10000083 3300025941 Bacteria 102109
410 Ga0207711_10070744 3300025941 Bacteria 3026
411 Ga0207711_10376413 3300025941 Bacteria 1317
412 Ga0207711_10383602 3300025941 Bacteria 1304
413 Ga0207689_10171221 3300025942 Bacteria 1790
414 Ga0207661_10000064 3300025944 Bacteria 75730
415 Ga0207661_10000086 3300025944 Bacteria 64501
416 Ga0207661_10003963 3300025944 Bacteria 10341
417 Ga0207661_10005229 3300025944 Bacteria 9125
418 Ga0207661_10009524 3300025944 Bacteria 6973
419 Ga0207661_10009721 3300025944 Bacteria 6905
420 Ga0207661_10065981 3300025944 Bacteria 2939
421 Ga0207661_10075426 3300025944 Bacteria 2767
422 Ga0207661_10077349 3300025944 Bacteria 2736
423 Ga0207661_10087907 3300025944 Bacteria 2582
424 Ga0207661_10130399 3300025944 Bacteria 2152
425 Ga0207661_10259646 3300025944 Bacteria 1547
426 Ga0207679_10264081 3300025945 Bacteria 1469
427 Ga0207667_10017232 3300025949 Bacteria 8139
428 Ga0207667_10221789 3300025949 Bacteria 1937
429 Ga0207667_10442350 3300025949 Bacteria 1321
430 Ga0207651_10589591 3300025960 Bacteria 971
431 Ga0207712_10000003 3300025961 Bacteria 615314
432 Ga0207712_10011344 3300025961 Bacteria 5676
433 Ga0207712_10054885 3300025961 Bacteria 2800
434 Ga0207712_10505545 3300025961 Bacteria 1034
435 Ga0207668_10007542 3300025972 Bacteria 6476
436 Ga0207668_10059269 3300025972 Bacteria 2681
437 Ga0207668_10274238 3300025972 Bacteria 1380
438 Ga0207640_10002466 3300025981 Bacteria 9906
439 Ga0207640_10047658 3300025981 Bacteria 2766
440 Ga0207658_10010778 3300025986 Bacteria 6218
441 Ga0207677_10000429 3300026023 Bacteria 28292
442 Ga0207677_10029377 3300026023 Bacteria 3493
443 Ga0207703_10000060 3300026035 Bacteria 134334
444 Ga0207703_10000067 3300026035 Bacteria 125623
445 Ga0207639_10018969 3300026041 Bacteria 4897
446 Ga0207639_10069307 3300026041 Bacteria 2751
447 Ga0207639_10377875 3300026041 Bacteria 1272
448 Ga0207678_10005519 3300026067 Bacteria 11299
449 Ga0207678_10012641 3300026067 Bacteria 7416
450 Ga0207678_10038380 3300026067 Bacteria 4161
451 Ga0207678_10082856 3300026067 Bacteria 2744
452 Ga0207678_10165577 3300026067 Bacteria 1888
453 Ga0207708_10000496 3300026075 Bacteria 30252
454 Ga0207708_10001660 3300026075 Bacteria 16551
455 Ga0207708_10149994 3300026075 Bacteria 1834
456 Ga0207708_10161260 3300026075 Bacteria 1771
457 Ga0207708_10207192 3300026075 Bacteria 1566
458 Ga0207708_10311270 3300026075 Bacteria 1283
459 Ga0207702_10000134 3300026078 Bacteria 88324
460 Ga0207702_10010610 3300026078 Bacteria 7699
461 Ga0207702_10030434 3300026078 Bacteria 4499
462 Ga0207702_10060363 3300026078 Bacteria 3233
463 Ga0207641_10000304 3300026088 Bacteria 61194
464 Ga0207641_10141998 3300026088 Bacteria 2168
465 Ga0207648_10000230 3300026089 Bacteria 59713
466 Ga0207648_10093083 3300026089 Bacteria 2636
467 Ga0207648_10098758 3300026089 Bacteria 2556
468 Ga0207648_10334360 3300026089 Bacteria 1363
469 Ga0207676_10000043 3300026095 Bacteria 161948
470 Ga0207676_10121577 3300026095 Bacteria 2203
471 Ga0207674_10053480 3300026116 Bacteria 4116
472 Ga0207674_10115203 3300026116 Bacteria 2659
473 Ga0207674_10185644 3300026116 Bacteria 2030
474 Ga0207674_10419567 3300026116 Bacteria 1293
475 Ga0207675_100031944 3300026118 Bacteria 4905
476 Ga0207675_100202406 3300026118 Bacteria 1907
477 Ga0207683_10010883 3300026121 Bacteria 7760
478 Ga0207683_10019153 3300026121 Bacteria 5843
479 Ga0207683_10266293 3300026121 Bacteria 1565
480 Ga0207698_10000002 3300026142 Bacteria 404991
481 Ga0207698_10029483 3300026142 Bacteria 3931
482 Ga0207698_10089841 3300026142 Bacteria 2510
483 Ga0207428_10248715 3300027907 Bacteria 1326
484 Ga0268266_10000023 3300028379 Bacteria 501899
485 Ga0268266_10000748 3300028379 Bacteria 43458
486 Ga0268266_10000985 3300028379 Bacteria 35931
487 Ga0268266_10069579 3300028379 Bacteria 3050
488 Ga0268266_10299200 3300028379 Bacteria 1500
489 Ga0268266_10398598 3300028379 Bacteria 1301
490 Ga0268266_10419207 3300028379 Bacteria 1268
491 Ga0268265_10008034 3300028380 Bacteria 7124
492 Ga0268265_10391754 3300028380 Bacteria 1281
493 Ga0268264_10032479 3300028381 Bacteria 4283
494 Ga0268264_10526437 3300028381 Bacteria 1156
495 Ga0265337_1000013 3300028556 Bacteria 82926
496 Ga0265326_10000004 3300028558 Bacteria 283947
497 Ga0265326_10000012 3300028558 Bacteria 175352
498 Ga0265319_1000044 3300028563 Bacteria 103641
499 Ga0265319_1000406 3300028563 Bacteria 31126
500 Ga0265334_10000019 3300028573 Bacteria 143921
501 Ga0265322_10000003 3300028654 Bacteria 468671
502 Ga0265336_10011220 3300028666 Bacteria 3053
503 Ga0265338_10000297 3300028800 Bacteria 89764
504 Ga0265338_10017019 3300028800 Bacteria 7862
505 Ga0265324_10000226 3300029957 Bacteria 42741
506 Ga0265324_10000730 3300029957 Bacteria 21931
507 Ga0265328_10004572 3300031239 Bacteria 6002
508 Ga0265320_10000001 3300031240 Bacteria 847191
509 Ga0265325_10012241 3300031241 Bacteria 4909
510 Ga0265340_10069051 3300031247 Bacteria 1677
511 Ga0265331_10005677 3300031250 Bacteria 7494
512 Ga0265331_10038269 3300031250 Bacteria 2345
513 Ga0265327_10000003 3300031251 Bacteria 852750
514 Ga0265327_10002548 3300031251 Bacteria 18951
515 Ga0265316_10022290 3300031344 Bacteria 5344
516 Ga0307408_100279395 3300031548 Bacteria 1390
517 Ga0265314_10000044 3300031711 Bacteria 207337
518 Ga0265314_10072978 3300031711 Bacteria 2290
519 Ga0307413_10020410 3300031824 Bacteria 3523
520 Ga0307410_10002178 3300031852 Bacteria 9316
521 Ga0307410_10034475 3300031852 Bacteria 3279
522 Ga0307406_10004963 3300031901 Bacteria 7248
523 Ga0307406_10143729 3300031901 Bacteria 1692
524 Ga0307407_10240007 3300031903 Bacteria 1236
525 Ga0307412_10033408 3300031911 Bacteria 3270
526 Ga0307409_100005794 3300031995 Bacteria 7166
527 Ga0307409_100056297 3300031995 Bacteria 3040
528 Ga0307409_100120159 3300031995 Bacteria 2223
529 Ga0307409_100137845 3300031995 Bacteria 2097
530 Ga0307416_100007630 3300032002 Bacteria 6902
531 Ga0307416_100047424 3300032002 Bacteria 3400
532 Ga0307416_100094954 3300032002 Bacteria 2573
533 Ga0307416_100107772 3300032002 Bacteria 2446
534 Ga0307416_100134707 3300032002 Bacteria 2232
535 Ga0307416_100402370 3300032002 Bacteria 1407
536 Ga0307414_10157054 3300032004 Bacteria 1802
537 Ga0307414_10294986 3300032004 Bacteria 1369
538 Ga0307411_10057982 3300032005 Bacteria 2561
539 Ga0307411_10187687 3300032005 Bacteria 1575
540 Ga0307415_100002806 3300032126 Bacteria 8719
541 Ga0307415_100015192 3300032126 Bacteria 4551
542 Ga0307415_100051745 3300032126 Bacteria 2789
543 Ga0307415_100065881 3300032126 Bacteria 2526
544 Ga0307415_100196771 3300032126 Bacteria 1595
545 Ga0307415_100276856 3300032126 Bacteria 1378
546 Ga0307415_100423055 3300032126 Bacteria 1144
547 Ga0373944_0037779 3300035089 Bacteria 1481
548 Ga0373945_0011334 3300035116 Bacteria 2949
549 Ga0373943_0000713 3300035170 Bacteria 14523
550 Ga0373955_0168607 3300035172 Bacteria 1295
551 Ga0373955_0206574 3300035172 Bacteria 1170
552 Ga0316574_0133860 3300035398 Bacteria 1596
553 Ga0373927_0029793 3300035695 Bacteria 3559
554 Ga0373933_0256038 3300035724 Bacteria 1128
555 Ga0373947_0015561 3300035725 Bacteria 4369
556 Ga0373937_0025996 3300036401 Bacteria 5288
557 Ga0395899_0323964 3300037312 Bacteria 1037
558 Ga0395900_0032686 3300037418 Bacteria 5350
559 Ga0395900_0037958 3300037418 Bacteria 4966
560 Ga0395898_0002611 3300037466 Bacteria 21002
561 Ga0395898_0023747 3300037466 Bacteria 6191
562 Ga0395898_0043792 3300037466 Bacteria 4409
563 Ga0395905_0076005 3300037471 Bacteria 3147
564 Ga0395905_0095615 3300037471 Bacteria 2788
565 Ga0395905_0372601 3300037471 Bacteria 1321
566 Ga0436364_1123401 3300037853 Bacteria 2098
567 Ga0395901_0043084 3300038443 Bacteria 4682
568 Ga0395901_0077287 3300038443 Bacteria 3474
569 Ga0395901_0081560 3300038443 Bacteria 3378
570 Ga0395901_0098579 3300038443 Bacteria 3064
571 Ga0436365_0190537 3300039437 Bacteria 23352
572 Ga0436365_0654279 3300039437 Bacteria 8389
573 Ga0436365_1156467 3300039437 Bacteria 1047
574 Ga0436365_1162518 3300039437 Bacteria 3456
575 Ga0436365_1168945 3300039437 Bacteria 1889
576 Ga0436363_0013651 3300039450 Bacteria 1174
577 Ga0436363_1008360 3300039450 Bacteria 1001
578 Ga0436362_0315400 3300039453 Bacteria 1374
579 Ga0436362_1121834 3300039453 Bacteria 955
580 Ga0451807_2554897 3300041486 Bacteria 1833
581 Ga0451833_0200162 3300041491 Bacteria 1569
582 Ga0451837_1322243 3300041494 Bacteria 864
583 Ga0439448_0058057 3300042005 Bacteria 1276
584 Ga0439459_0005651 3300042438 Bacteria 2063
585 Ga0466966_0041895 3300044684 Bacteria 2941
586 Ga0466966_0104943 3300044684 Bacteria 1745
587 Ga0466966_0254846 3300044684 Bacteria 1057
588 Ga0466961_0003399 3300044693 Bacteria 9933
589 Ga0466961_0055385 3300044693 Bacteria 2528
590 Ga0466963_0000021 3300044694 Bacteria 53432
591 Ga0466963_0010863 3300044694 Bacteria 5529
592 Ga0466963_0014928 3300044694 Bacteria 4800
593 Ga0466963_0024348 3300044694 Bacteria 3853
594 Ga0466963_0025075 3300044694 Bacteria 3800
595 Ga0466963_0028742 3300044694 Bacteria 3573
596 Ga0466963_0029483 3300044694 Bacteria 3533
597 Ga0466963_0050194 3300044694 Bacteria 2762
598 Ga0466963_0091375 3300044694 Bacteria 2073
599 Ga0466963_0181053 3300044694 Bacteria 1471
600 Ga0466964_0083209 3300044706 Bacteria 1378
601 Ga0466964_0114447 3300044706 Bacteria 1207
602 Ga0466971_0001196 3300044719 Bacteria 10777
603 Ga0466968_0025031 3300044735 Bacteria 2442
604 Ga0466957_0003657 3300044842 Bacteria 8484
605 Ga0466957_0004158 3300044842 Bacteria 8014
606 Ga0466957_0006194 3300044842 Bacteria 6752
607 Ga0466957_0016840 3300044842 Bacteria 4276
608 Ga0466957_0047290 3300044842 Bacteria 2614
609 Ga0466957_0201859 3300044842 Bacteria 1306
610 Ga0466960_0131798 3300044901 Bacteria 1320
611 Ga0466959_0001348 3300045049 Bacteria 14972
612 Ga0466959_0051085 3300045049 Bacteria 3034
613 Ga0466959_0076116 3300045049 Bacteria 2424
614 Ga0466959_0093998 3300045049 Bacteria 2151
615 Ga0466959_0125456 3300045049 Bacteria 1822
616 Ga0466959_0155532 3300045049 Bacteria 1610
617 Ga0466959_0191043 3300045049 Bacteria 1429
618 Ga0466959_0234163 3300045049 Bacteria 1270
619 Ga0466958_0047886 3300045836 Bacteria 2582
620 Ga0466967_0000004 3300045976 Bacteria 155664
621 Ga0466967_0001339 3300045976 Bacteria 14128
622 Ga0466967_0001971 3300045976 Bacteria 12441
623 Ga0466967_0013734 3300045976 Bacteria 6274
624 Ga0466967_0017023 3300045976 Bacteria 5753
625 Ga0466967_0023108 3300045976 Bacteria 5090
626 Ga0466967_0026684 3300045976 Bacteria 4789
627 Ga0466967_0049030 3300045976 Bacteria 3691
628 Ga0466967_0049082 3300045976 Bacteria 3690
629 Ga0466967_0104298 3300045976 Bacteria 2595
630 Ga0466967_0592747 3300045976 Bacteria 1093
631 Ga0495592_0000214 3300046454 Bacteria 49513
632 Ga0495592_0121061 3300046454 Bacteria 1841
633 Ga0495592_0320030 3300046454 Bacteria 1003
634 Ga0495603_0000554 3300046455 Bacteria 20910
635 Ga0495603_0015844 3300046455 Bacteria 4556
636 Ga0495629_0000014 3300046459 Bacteria 201801
637 Ga0495629_0009501 3300046459 Bacteria 7109
638 Ga0495641_0000001 3300046461 Bacteria 485224
639 Ga0495651_0283721 3300046462 Bacteria 1117
640 Ga0495653_0000183 3300046463 Bacteria 51182
641 Ga0495653_0046662 3300046463 Bacteria 3354
642 Ga0495653_0081107 3300046463 Bacteria 2398
643 Ga0495582_0000012 3300046473 Bacteria 112893
644 Ga0495662_0000048 3300046476 Bacteria 41426
645 Ga0495662_0003775 3300046476 Bacteria 7638
646 Ga0495664_0000051 3300046477 Bacteria 59070
647 Ga0495594_0000004 3300046499 Bacteria 195881
648 Ga0495596_0041300 3300046500 Bacteria 1819
649 Ga0495606_0000045 3300046507 Bacteria 212105
650 Ga0495608_0000001 3300046511 Bacteria 411278
651 Ga0495608_0001397 3300046511 Bacteria 17174
652 Ga0495608_0005626 3300046511 Bacteria 8951
653 Ga0495608_0008932 3300046511 Bacteria 7007
654 Ga0495608_0053206 3300046511 Bacteria 2679
655 Ga0495618_0000087 3300046514 Bacteria 66305
656 Ga0495618_0148667 3300046514 Bacteria 1497
657 Ga0495620_0000119 3300046515 Bacteria 63487
658 Ga0495628_0000070 3300046516 Bacteria 80592
659 Ga0495628_0002369 3300046516 Bacteria 17011
660 Ga0495628_0015291 3300046516 Bacteria 6411
661 Ga0495628_0073196 3300046516 Bacteria 2670
662 Ga0495628_0116833 3300046516 Bacteria 2049
663 Ga0495630_0000007 3300046517 Bacteria 376915
664 Ga0495630_0000312 3300046517 Bacteria 38816
665 Ga0495630_0048552 3300046517 Bacteria 3177
666 Ga0495630_0105735 3300046517 Bacteria 2131
667 Ga0495644_0000296 3300046523 Bacteria 23051
668 Ga0495652_0000066 3300046529 Bacteria 109895
669 Ga0495652_0002702 3300046529 Bacteria 18014
670 Ga0495652_0200363 3300046529 Bacteria 1515
671 Ga0495640_0008753 3300046533 Bacteria 7928
672 Ga0495640_0018734 3300046533 Bacteria 5124
673 Ga0495640_0053417 3300046533 Bacteria 2770
674 Ga0495640_0205518 3300046533 Bacteria 1247
675 Ga0495586_0000338 3300046535 Bacteria 29347
676 Ga0495587_0000446 3300046536 Bacteria 28865
677 Ga0495587_0066124 3300046536 Bacteria 2109
678 Ga0495587_0077002 3300046536 Bacteria 1937
679 Ga0495598_0000768 3300046537 Bacteria 6117
680 Ga0495621_0023623 3300046539 Bacteria 2046
681 Ga0495645_0029053 3300046543 Bacteria 4018
682 Ga0495645_0029487 3300046543 Bacteria 3991
683 Ga0495645_0362505 3300046543 Bacteria 931
684 Ga0495622_0000016 3300046557 Bacteria 177089
685 Ga0495667_0000015 3300046559 Bacteria 200377
686 Ga0495667_0009604 3300046559 Bacteria 6559
687 Ga0495667_0167718 3300046559 Bacteria 1411
688 Ga0495656_0000226 3300046615 Bacteria 19944
689 Ga0495656_0033783 3300046615 Bacteria 2090
690 Ga0495634_0000187 3300046642 Bacteria 57203
691 Ga0495634_0000755 3300046642 Bacteria 31302
692 Ga0495634_0026143 3300046642 Bacteria 4076
693 Ga0495634_0028471 3300046642 Bacteria 3877
694 Ga0495634_0034002 3300046642 Bacteria 3499
695 Ga0495634_0186448 3300046642 Bacteria 1296
696 Ga0495625_0000020 3300046660 Bacteria 290440
697 Ga0495635_0000036 3300046663 Bacteria 95138
698 Ga0495635_0048772 3300046663 Bacteria 2919
699 Ga0495635_0057868 3300046663 Bacteria 2667
700 Ga0495635_0150255 3300046663 Bacteria 1585
701 Ga0495588_0000217 3300046674 Bacteria 54461
702 Ga0495657_0000002 3300046675 Bacteria 411958
703 Ga0495657_0014465 3300046675 Bacteria 5793
704 Ga0495657_0021818 3300046675 Bacteria 4594
705 Ga0495599_0007160 3300046678 Bacteria 6754
706 Ga0495646_0050297 3300046680 Bacteria 2527
707 Ga0495647_0000013 3300046681 Bacteria 88029
708 Ga0495647_0002426 3300046681 Bacteria 5868
709 Ga0495658_0000024 3300046683 Bacteria 81300
710 Ga0495658_0030522 3300046683 Bacteria 2927
711 Ga0495669_0000251 3300046684 Bacteria 31256
712 Ga0495613_0000040 3300046689 Bacteria 131633
713 Ga0495613_0000159 3300046689 Bacteria 65969
714 Ga0495613_0118969 3300046689 Bacteria 1898
715 Ga0495613_0295406 3300046689 Bacteria 1122
716 Ga0495624_0000013 3300046690 Bacteria 115278
717 Ga0495624_0001178 3300046690 Bacteria 20710
718 Ga0495624_0041563 3300046690 Bacteria 2940
719 Ga0495624_0066395 3300046690 Bacteria 2252
720 Ga0495670_0003761 3300046691 Bacteria 7462
721 Ga0495649_0001084 3300046694 Bacteria 21240
722 Ga0495589_0092184 3300046794 Bacteria 1471
723 Ga0495600_0002351 3300046809 Bacteria 10794
724 Ga0495600_0026502 3300046809 Bacteria 3741
725 Ga0495600_0219863 3300046809 Bacteria 1215
726 Ga0495581_0167208 3300047315 Bacteria 1286
727 Ga0495604_0000802 3300047317 Bacteria 26433
728 Ga0495604_0001037 3300047317 Bacteria 23128
729 Ga0495604_0003372 3300047317 Bacteria 12743
730 Ga0495604_0028259 3300047317 Bacteria 4461
731 Ga0495604_0063409 3300047317 Bacteria 2819
732 Ga0495674_0000025 3300047319 Bacteria 141103
733 Ga0495674_0137093 3300047319 Bacteria 2058
734 Ga0495672_0001687 3300047320 Bacteria 21390
735 Ga0495672_0133030 3300047320 Bacteria 1306
736 Ga0495676_0000091 3300047321 Bacteria 66575
737 Ga0495676_0000252 3300047321 Bacteria 43212
738 Ga0495676_0007581 3300047321 Bacteria 9947
739 Ga0495676_0093228 3300047321 Bacteria 2246
740 Ga0495676_0132289 3300047321 Bacteria 1799
741 Ga0495676_0189322 3300047321 Bacteria 1436
742 Ga0495680_0000286 3300047322 Bacteria 56839
743 Ga0495680_0000741 3300047322 Bacteria 36581
744 Ga0495680_0043784 3300047322 Bacteria 3542
745 Ga0495680_0050805 3300047322 Bacteria 3240
746 Ga0495680_0110271 3300047322 Bacteria 2040
747 Ga0495675_0000019 3300047444 Bacteria 113641
748 Ga0495679_010847 3300047446 Bacteria 3554
749 Ga0495686_0031778 3300047472 Bacteria 3420
750 Ga0495593_0188526 3300047673 Bacteria 1038
751 Ga0495602_0000010 3300048088 Bacteria 212121
752 Ga0495602_0001188 3300048088 Bacteria 25566
753 Ga0495602_0052140 3300048088 Bacteria 3636
754 Ga0495602_0191644 3300048088 Bacteria 1567
755 Ga0495614_0068210 3300048089 Bacteria 1531
756 Ga0496100_0000003 3300048903 Bacteria 360802
757 Ga0496100_0000008 3300048903 Bacteria 231974
758 Ga0496100_0014322 3300048903 Bacteria 4602
759 Ga0496100_0062957 3300048903 Bacteria 2450
760 Ga0496100_0142244 3300048903 Bacteria 1702
761 Ga0496101_0000003 3300048904 Bacteria 406565
762 Ga0496101_0000016 3300048904 Bacteria 240753
763 Ga0496101_0001927 3300048904 Bacteria 12559
764 Ga0496101_0140244 3300048904 Bacteria 1842
765 Ga0496101_0162034 3300048904 Bacteria 1716
766 Ga0496101_0340737 3300048904 Bacteria 1177
767 Ga0496102_0000054 3300048905 Bacteria 175565
768 Ga0496102_0004675 3300048905 Bacteria 11583
769 Ga0496102_0049833 3300048905 Bacteria 3811
770 Ga0496102_0211415 3300048905 Bacteria 1829
771 Ga0496102_0457739 3300048905 Bacteria 1197
772 Ga0496103_0000016 3300048906 Bacteria 266127
773 Ga0496103_0000178 3300048906 Bacteria 64984
774 Ga0496103_0043658 3300048906 Bacteria 2760
775 Ga0496104_0000003 3300048907 Bacteria 669219
776 Ga0496104_0000030 3300048907 Bacteria 201919
777 Ga0496104_0000063 3300048907 Bacteria 116618
778 Ga0496104_0126525 3300048907 Bacteria 2454
779 Ga0496104_0140661 3300048907 Bacteria 2318
780 Ga0496104_0172149 3300048907 Bacteria 2076
781 Ga0496104_0350445 3300048907 Bacteria 1389
782 Ga0496105_0000031 3300048908 Bacteria 137220
783 Ga0496105_0000041 3300048908 Bacteria 116618
784 Ga0496105_0125436 3300048908 Bacteria 2116
785 Ga0496105_0184314 3300048908 Bacteria 1708
786 Ga0496106_0000048 3300048909 Bacteria 98233
787 Ga0496106_0000052 3300048909 Bacteria 94849
788 Ga0496106_0000086 3300048909 Bacteria 73933
789 Ga0496106_0003356 3300048909 Bacteria 11937
790 Ga0496106_0025678 3300048909 Bacteria 4386
791 Ga0496106_0058661 3300048909 Bacteria 2914
792 Ga0496106_0094150 3300048909 Bacteria 2316
793 Ga0496107_0000008 3300048910 Bacteria 251874
794 Ga0496107_0000009 3300048910 Bacteria 231682
795 Ga0496107_0195485 3300048910 Bacteria 1503
796 Ga0496108_0000002 3300048911 Bacteria 700890
797 Ga0496108_0000024 3300048911 Bacteria 183389
798 Ga0496108_0000153 3300048911 Bacteria 66080
799 Ga0496108_0049252 3300048911 Bacteria 3524
800 Ga0496108_0051614 3300048911 Bacteria 3445
801 Ga0496108_0088992 3300048911 Bacteria 2624
802 Ga0496108_0157061 3300048911 Bacteria 1964
803 Ga0496109_0000001 3300048912 Bacteria 700852
804 Ga0496109_0000033 3300048912 Bacteria 160496
805 Ga0496109_0000146 3300048912 Bacteria 69777
806 Ga0496109_0000300 3300048912 Bacteria 46637
807 Ga0496109_0010926 3300048912 Bacteria 7778
808 Ga0496109_0070473 3300048912 Bacteria 3208
809 Ga0496109_0108128 3300048912 Bacteria 2584
810 Ga0496109_0143526 3300048912 Bacteria 2233
811 Ga0496109_0259079 3300048912 Bacteria 1638
812 Ga0496109_0326582 3300048912 Bacteria 1448
813 Ga0496109_0362265 3300048912 Bacteria 1370
814 Ga0496109_0392349 3300048912 Bacteria 1311
815 Ga0496109_0511769 3300048912 Bacteria 1133
816 Ga0496110_0000008 3300048913 Bacteria 113408
817 Ga0496110_0000023 3300048913 Bacteria 75802
818 Ga0496110_0000230 3300048913 Bacteria 36192
819 Ga0496110_0003088 3300048913 Bacteria 12630
820 Ga0496110_0037066 3300048913 Bacteria 4237
821 Ga0496110_0047861 3300048913 Bacteria 3746
822 Ga0496110_0071809 3300048913 Bacteria 3070
823 Ga0496110_0138177 3300048913 Bacteria 2203
824 Ga0496110_0169062 3300048913 Bacteria 1983
825 Ga0496110_0185505 3300048913 Bacteria 1889
826 Ga0496111_0000004 3300048914 Bacteria 116115
827 Ga0496111_0000016 3300048914 Bacteria 77108
828 Ga0496111_0000181 3300048914 Bacteria 28684
829 Ga0496111_0061425 3300048914 Bacteria 2724
830 Ga0496111_0137594 3300048914 Bacteria 1810
831 Ga0496112_0000002 3300048915 Bacteria 782039
832 Ga0496112_0001445 3300048915 Bacteria 18234
833 Ga0496112_0192679 3300048915 Bacteria 1999
834 Ga0496113_0000003 3300048916 Bacteria 123519
835 Ga0496113_0006959 3300048916 Bacteria 7228
836 Ga0496113_0111989 3300048916 Bacteria 2125
837 Ga0496113_0305065 3300048916 Bacteria 1275
838 Ga0496114_0000010 3300048917 Bacteria 363396
839 Ga0496114_0026192 3300048917 Bacteria 4773
840 Ga0496115_0000074 3300048918 Bacteria 90267
841 Ga0496115_0000212 3300048918 Bacteria 53976
842 Ga0496115_0001537 3300048918 Bacteria 16551
843 Ga0496115_0029926 3300048918 Bacteria 4281
844 Ga0496115_0147686 3300048918 Bacteria 1941
845 Ga0496115_0298124 3300048918 Bacteria 1321
846 Ga0496116_0000014 3300048919 Bacteria 569049
847 Ga0496117_0001369 3300048920 Bacteria 35534
848 Ga0496118_0000389 3300048921 Bacteria 74298
849 Ga0496118_0019280 3300048921 Bacteria 6103
850 Ga0496119_0000937 3300048922 Bacteria 37582
851 Ga0496119_0004788 3300048922 Bacteria 13285
852 Ga0496119_0072208 3300048922 Bacteria 2017
853 Ga0496120_0004305 3300048923 Bacteria 12065
854 Ga0496121_0071566 3300048924 Bacteria 2788
855 Ga0496124_0044254 3300048927 Bacteria 3821
856 Ga0496124_0071588 3300048927 Bacteria 2873
857 Ga0496124_0191086 3300048927 Bacteria 1567
858 Ga0501031_0000172 3300049568 Bacteria 36896
859 Ga0501031_0163505 3300049568 Bacteria 1455
860 Ga0501032_0000902 3300049569 Bacteria 24083
861 Ga0501033_0000211 3300049570 Bacteria 55768
862 Ga0501034_0003939 3300049571 Bacteria 16683
863 Ga0501036_0000841 3300049572 Bacteria 22831
864 Ga0501036_0067898 3300049572 Bacteria 3017
865 Ga0501036_0264390 3300049572 Bacteria 1441
866 Ga0501037_0000120 3300049573 Bacteria 73352
867 Ga0501038_0000139 3300049574 Bacteria 62162
868 Ga0501039_0006697 3300049575 Bacteria 8762
869 Ga0501039_0032649 3300049575 Bacteria 4014
870 Ga0501039_0067117 3300049575 Bacteria 2786
871 Ga0501040_0065586 3300049576 Bacteria 2501
872 Ga0501040_0079999 3300049576 Bacteria 2263
873 Ga0501040_0095431 3300049576 Bacteria 2070
874 Ga0501040_0199644 3300049576 Bacteria 1420
875 Ga0501040_0250144 3300049576 Bacteria 1264
876 Ga0501040_0261644 3300049576 Bacteria 1235
877 Ga0501041_0092304 3300049577 Bacteria 1870
878 Ga0501041_0105319 3300049577 Bacteria 1748
879 Ga0501042_0075317 3300049578 Bacteria 2415
880 Ga0501042_0109156 3300049578 Bacteria 1992
881 Ga0501043_0000203 3300049579 Bacteria 54330
882 Ga0501046_0000194 3300049580 Bacteria 62330
883 Ga0501047_0000287 3300049581 Bacteria 58087
884 Ga0501047_0319929 3300049581 Bacteria 1391
885 Ga0501047_0445751 3300049581 Bacteria 1124
886 Ga0501048_0000004 3300049582 Bacteria 100672
887 Ga0501067_0001412 3300049583 Bacteria 13020
888 Ga0501068_0003838 3300049584 Bacteria 8153
889 Ga0501068_0159455 3300049584 Bacteria 1422
890 Ga0501069_0006081 3300049585 Bacteria 6300
891 Ga0501069_0054695 3300049585 Bacteria 2222
892 Ga0501070_0000049 3300049586 Bacteria 104564
893 Ga0501070_0000079 3300049586 Bacteria 82054
894 Ga0501070_0022040 3300049586 Bacteria 5336
895 Ga0501070_0156923 3300049586 Bacteria 1876
896 Ga0501070_0167579 3300049586 Bacteria 1810
897 Ga0501070_0297713 3300049586 Bacteria 1315
898 Ga0501070_0388116 3300049586 Bacteria 1130
899 Ga0501071_0025386 3300049587 Bacteria 4151
900 Ga0501072_0010167 3300049588 Bacteria 7166
901 Ga0501072_0047989 3300049588 Bacteria 3363
902 Ga0501074_0005099 3300049590 Bacteria 9433
903 Ga0501074_0013310 3300049590 Bacteria 5982
904 Ga0501074_0066081 3300049590 Bacteria 2602
905 Ga0501074_0071035 3300049590 Bacteria 2502
906 Ga0501074_0092709 3300049590 Bacteria 2163
907 Ga0501075_0000598 3300049591 Bacteria 22031
908 Ga0501075_0058435 3300049591 Bacteria 2905
909 Ga0501075_0135260 3300049591 Bacteria 1878
910 Ga0501075_0170598 3300049591 Bacteria 1660
911 Ga0501075_0362475 3300049591 Bacteria 1105
912 Ga0501076_0003024 3300049592 Bacteria 11684
913 Ga0501076_0098986 3300049592 Bacteria 2349
914 Ga0501077_0013588 3300049593 Bacteria 5104
915 Ga0501077_0202885 3300049593 Bacteria 1260
916 Ga0501079_0000318 3300049741 Bacteria 30235
917 Ga0501079_0005061 3300049741 Bacteria 9786
918 Ga0501079_0033296 3300049741 Bacteria 3964
919 Ga0501079_0126989 3300049741 Bacteria 1984
920 Ga0501079_0249703 3300049741 Bacteria 1387
921 Ga0501079_0615565 3300049741 Bacteria 855
922 Ga0501080_0004716 3300049742 Bacteria 12163
923 Ga0501080_0039515 3300049742 Bacteria 4403
924 Ga0501080_0226721 3300049742 Bacteria 1708
925 Ga0501080_0540419 3300049742 Bacteria 1039
926 Ga0501081_0222113 3300049743 Bacteria 1374
927 Ga0501081_0471883 3300049743 Bacteria 933
928 Ga0501083_0008391 3300049744 Bacteria 7305
929 Ga0501083_0019756 3300049744 Bacteria 4688
930 Ga0501083_0205086 3300049744 Bacteria 1286
931 Ga0501083_0274270 3300049744 Bacteria 1097
932 Ga0501035_0000059 3300049822 Bacteria 134506
933 Ga0501044_0001354 3300049823 Bacteria 28756
934 Ga0501044_0065596 3300049823 Bacteria 3702
935 Ga0501045_0029237 3300049824 Bacteria 3982
936 Ga0501045_0162884 3300049824 Bacteria 1661
937 nmdc:mga00v17_152267_c1 3300050491 Bacteria 1486
938 nmdc:mga0yw44_152049_c1 3300050492 Bacteria 1510
939 nmdc:mga0yw44_196092_c1 3300050492 Bacteria 1333
940 nmdc:mga0yw44_231_c1 3300050492 Bacteria 19110
941 nmdc:mga0yw44_276040_c1 3300050492 Bacteria 1123
942 nmdc:mga0yw44_89934_c1 3300050492 Bacteria 1938
943 nmdc:mga05p37_1079737_c1 3300050507 Bacteria 843
944 nmdc:mga05p37_179704_c1 3300050507 Bacteria 2575
945 nmdc:mga05p37_2220_c1 3300050507 Bacteria 19240
946 nmdc:mga05p37_347856_c1 3300050507 Bacteria 1746
947 nmdc:mga05p37_90274_c1 3300050507 Bacteria 3776
948 nmdc:mga05p37_95327_c1 3300050507 Bacteria 3666
949 nmdc:mga09592_1226_c2 3300050508 Bacteria 19678
950 nmdc:mga09592_127940_c1 3300050508 Bacteria 2184
951 nmdc:mga09592_173788_c1 3300050508 Bacteria 1863
952 nmdc:mga0qj67_32858_c1 3300050509 Bacteria 4047
953 nmdc:mga06r32_429255_c1 3300050510 Bacteria 1302
954 nmdc:mga06r32_70499_c1 3300050510 Bacteria 3380
955 nmdc:mga08y16_27710_c1 3300050511 Bacteria 5969
956 nmdc:mga08y16_419449_c1 3300050511 Bacteria 1368
957 nmdc:mga08y16_620079_c1 3300050511 Bacteria 1089
958 nmdc:mga0n895_255599_c1 3300050512 Bacteria 1778
959 nmdc:mga0rr50_248220_c1 3300050513 Bacteria 1477
960 nmdc:mga0rr50_68950_c1 3300050513 Bacteria 2690
961 nmdc:mga0rr50_77688_c1 3300050513 Bacteria 2552
962 nmdc:mga08x19_71518_c1 3300050514 Bacteria 2262
963 nmdc:mga0a205_320751_c1 3300050515 Bacteria 1420
964 nmdc:mga0a205_4209_c1 3300050515 Bacteria 12901
965 nmdc:mga0a205_47748_c1 3300050515 Bacteria 4131
966 nmdc:mga0a205_58885_c1 3300050515 Bacteria 3710
967 nmdc:mga0a205_9_c2 3300050515 Bacteria 69167
968 Ga0495601_0000012 3300053077 Bacteria 227853
969 Ga0495601_0000344 3300053077 Bacteria 24491
970 Ga0495601_0008897 3300053077 Bacteria 5925
971 Ga0495601_0012016 3300053077 Bacteria 5188
972 Ga0495601_0053210 3300053077 Bacteria 2558
973 Ga0495601_0063512 3300053077 Bacteria 2347
974 Ga0495612_0000100 3300053078 Bacteria 37132
975 Ga0495612_0000403 3300053078 Bacteria 17309
976 Ga0495655_0000003 3300053083 Bacteria 303053
977 Ga0495595_0000001 3300053084 Bacteria 495226
978 Ga0495595_0000251 3300053084 Bacteria 21266
979 Ga0495619_0000015 3300053085 Bacteria 252787
980 Ga0495619_0000020 3300053085 Bacteria 201556
981 Ga0495619_0000046 3300053085 Bacteria 104451
982 Ga0495619_0000626 3300053085 Bacteria 23392
983 Ga0495619_0049830 3300053085 Bacteria 2763
984 Ga0495619_0053161 3300053085 Bacteria 2678
985 Ga0495619_0126366 3300053085 Bacteria 1755
986 Ga0500566_0001971 3300053094 Bacteria 12098
987 Ga0500641_0009337 3300053096 Bacteria 3527
988 Ga0500554_020941 3300053102 Bacteria 1805
989 Ga0500614_000039 3300053123 Bacteria 28194
990 Ga0500628_000002 3300053129 Bacteria 357687
991 Ga0501084_0135654 3300054114 Bacteria 2072
992 Ga0501084_0138999 3300054114 Bacteria 2045
993 Ga0501084_0217970 3300054114 Bacteria 1610
994 Ga0587070_006567 3300059491 Bacteria 1575
995 Ga0587077_009254 3300059493 Bacteria 1491
996 Ga0587085_010233 3300059506 Bacteria 1241
997 Ga0587111_0027391 3300060346 Bacteria 1142
998 Ga0501082_0004892 3300060353 Bacteria 11685
999 Ga0501082_0119820 3300060353 Bacteria 2281
1000 Ga0466962_0000706 3300061719 Bacteria 14858
1001 Ga0466962_0026097 3300061719 Bacteria 2806
1002 Ga0466962_0133586 3300061719 Bacteria 1200
1003 Ga0530510_0003575 3300061734 Bacteria 10704
1004 Ga0530510_0008860 3300061734 Bacteria 7041

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1168945 Ga0436365_1168945_1138_1845 226
2 3300045049 Ga0466959_0125456 Ga0466959_0125456_625_1320 226
3 3300005981 Ga0081538_10085412 Ga0081538_100854122 233
4 3300006028 Ga0070717_10178733 Ga0070717_101787332 236
5 3300025929 Ga0207664_10128030 Ga0207664_101280302 236
6 3300031247 Ga0265340_10069051 Ga0265340_100690512 236
7 3300035116 Ga0373945_0011334 Ga0373945_0011334_2080_2877 236
8 3300035172 Ga0373955_0206574 Ga0373955_0206574_351_1142 236
9 3300046454 Ga0495592_0320030 Ga0495592_0320030_13_804 236
10 3300046462 Ga0495651_0283721 Ga0495651_0283721_181_972 236
11 3300046511 Ga0495608_0008932 Ga0495608_0008932_4532_5323 236
12 3300046533 Ga0495640_0205518 Ga0495640_0205518_355_1146 236
13 3300046536 Ga0495587_0066124 Ga0495587_0066124_344_1135 236
14 3300046543 Ga0495645_0362505 Ga0495645_0362505_91_882 236
15 3300046559 Ga0495667_0009604 Ga0495667_0009604_5532_6323 236
16 3300046642 Ga0495634_0028471 Ga0495634_0028471_2140_3027 236
17 3300046690 Ga0495624_0041563 Ga0495624_0041563_1985_2776 236
18 3300047317 Ga0495604_0028259 Ga0495604_0028259_534_1325 236
19 3300048088 Ga0495602_0052140 Ga0495602_0052140_2675_3466 236
20 3300053077 Ga0495601_0063512 Ga0495601_0063512_474_1265 236
21 3300003373 JGI25407J50210_10002380 JGI25407J50210_100023804 237
22 3300005327 Ga0070658_10016326 Ga0070658_100163267 237
23 3300005329 Ga0070683_100008892 Ga0070683_1000088923 237
24 3300005336 Ga0070680_100008814 Ga0070680_1000088143 237
25 3300005339 Ga0070660_100006612 Ga0070660_1000066125 237
26 3300005458 Ga0070681_10016470 Ga0070681_100164703 237
27 3300005471 Ga0070698_100119204 Ga0070698_1001192043 237
28 3300005530 Ga0070679_100117690 Ga0070679_1001176903 237
29 3300005535 Ga0070684_100051215 Ga0070684_1000512155 237
30 3300005563 Ga0068855_100175616 Ga0068855_1001756162 237
31 3300005981 Ga0081538_10000013 Ga0081538_10000013104 237
32 3300009093 Ga0105240_10146315 Ga0105240_101463154 237
33 3300013104 Ga0157370_10004749 Ga0157370_100047499 237
34 3300020070 Ga0206356_11146824 Ga0206356_111468242 237
35 3300025909 Ga0207705_10015960 Ga0207705_100159602 237
36 3300025917 Ga0207660_10027681 Ga0207660_100276812 237
37 3300025919 Ga0207657_10000902 Ga0207657_1000090228 237
38 3300025921 Ga0207652_10043446 Ga0207652_100434465 237
39 3300025944 Ga0207661_10087907 Ga0207661_100879073 237
40 3300025949 Ga0207667_10017232 Ga0207667_100172322 237
41 3300048912 Ga0496109_0326582 Ga0496109_0326582_237_1148 237
42 3300044694 Ga0466963_0181053 Ga0466963_0181053_290_1081 238
43 3300048912 Ga0496109_0392349 Ga0496109_0392349_48_908 238
44 3300048922 Ga0496119_0004788 Ga0496119_0004788_12441_13274 238
45 3300049586 Ga0501070_0000049 Ga0501070_0000049_11135_11926 238
46 3300049744 Ga0501083_0205086 Ga0501083_0205086_416_1204 238
47 3300050492 nmdc:mga0yw44_89934_c1 nmdc:mga0yw44_89934_c1_550_1377 238
48 3300005338 Ga0068868_100444473 Ga0068868_1004444732 239
49 3300005535 Ga0070684_100022491 Ga0070684_1000224912 239
50 3300005535 Ga0070684_100302559 Ga0070684_1003025592 239
51 3300005563 Ga0068855_100297589 Ga0068855_1002975892 239
52 3300013104 Ga0157370_10128496 Ga0157370_101284962 239
53 3300025909 Ga0207705_10053833 Ga0207705_100538331 239
54 3300025941 Ga0207711_10376413 Ga0207711_103764132 239
55 3300025944 Ga0207661_10075426 Ga0207661_100754263 239
56 3300025944 Ga0207661_10259646 Ga0207661_102596462 239
57 3300025949 Ga0207667_10221789 Ga0207667_102217892 239
58 3300035398 Ga0316574_0133860 Ga0316574_0133860_391_1239 239
59 3300037853 Ga0436364_1123401 Ga0436364_1123401_350_1138 239
60 3300044694 Ga0466963_0014928 Ga0466963_0014928_537_1325 239
61 3300044842 Ga0466957_0003657 Ga0466957_0003657_2687_3475 239
62 3300045976 Ga0466967_0001971 Ga0466967_0001971_7416_8204 239
63 3300045976 Ga0466967_0013734 Ga0466967_0013734_1666_2454 239
64 3300045976 Ga0466967_0023108 Ga0466967_0023108_1906_2694 239
65 3300048903 Ga0496100_0062957 Ga0496100_0062957_1224_2015 239
66 3300048904 Ga0496101_0340737 Ga0496101_0340737_89_880 239
67 3300048907 Ga0496104_0126525 Ga0496104_0126525_1237_2028 239
68 3300048911 Ga0496108_0049252 Ga0496108_0049252_1533_2324 239
69 3300048911 Ga0496108_0088992 Ga0496108_0088992_1168_1959 239
70 3300048912 Ga0496109_0259079 Ga0496109_0259079_651_1442 239
71 3300048913 Ga0496110_0071809 Ga0496110_0071809_2211_3002 239
72 3300048913 Ga0496110_0185505 Ga0496110_0185505_669_1460 239
73 3300048918 Ga0496115_0298124 Ga0496115_0298124_151_939 239
74 3300049583 Ga0501067_0001412 Ga0501067_0001412_6745_7533 239
75 3300049585 Ga0501069_0006081 Ga0501069_0006081_1559_2347 239
76 3300049586 Ga0501070_0167579 Ga0501070_0167579_949_1737 239
77 3300061734 Ga0530510_0008860 Ga0530510_0008860_1000_1788 239
78 3300005435 Ga0070714_100336604 Ga0070714_1003366042 240
79 3300005436 Ga0070713_100022899 Ga0070713_1000228996 240
80 3300005985 Ga0081539_10059310 Ga0081539_100593102 240
81 3300020077 Ga0206351_10113243 Ga0206351_101132432 240
82 3300025928 Ga0207700_10000001 Ga0207700_100000011041 240
83 3300035089 Ga0373944_0037779 Ga0373944_0037779_322_1116 240
84 3300035170 Ga0373943_0000713 Ga0373943_0000713_12466_13260 240
85 3300035695 Ga0373927_0029793 Ga0373927_0029793_476_1270 240
86 3300035725 Ga0373947_0015561 Ga0373947_0015561_3160_3954 240
87 3300045976 Ga0466967_0049082 Ga0466967_0049082_1271_2059 240
88 3300046511 Ga0495608_0053206 Ga0495608_0053206_333_1124 240
89 3300046533 Ga0495640_0008753 Ga0495640_0008753_3914_4705 240
90 3300046559 Ga0495667_0167718 Ga0495667_0167718_297_1088 240
91 3300046642 Ga0495634_0034002 Ga0495634_0034002_941_1732 240
92 3300046689 Ga0495613_0295406 Ga0495613_0295406_212_1006 240
93 3300047319 Ga0495674_0137093 Ga0495674_0137093_456_1247 240
94 3300047321 Ga0495676_0132289 Ga0495676_0132289_410_1204 240
95 3300047322 Ga0495680_0050805 Ga0495680_0050805_1176_1967 240
96 3300047673 Ga0495593_0188526 Ga0495593_0188526_62_856 240
97 3300048088 Ga0495602_0191644 Ga0495602_0191644_752_1543 240
98 3300049586 Ga0501070_0388116 Ga0501070_0388116_21_809 240
99 3300049590 Ga0501074_0013310 Ga0501074_0013310_1961_2749 240
100 3300049590 Ga0501074_0066081 Ga0501074_0066081_1398_2192 240
101 3300053085 Ga0495619_0049830 Ga0495619_0049830_189_980 240
102 3300005535 Ga0070684_100440901 Ga0070684_1004409012 241
103 3300005981 Ga0081538_10001407 Ga0081538_1000140710 241
104 3300009147 Ga0114129_10007212 Ga0114129_1000721213 241
105 3300025922 Ga0207646_10357878 Ga0207646_103578782 241
106 3300039437 Ga0436365_1156467 Ga0436365_1156467_44_838 241
107 3300039450 Ga0436363_0013651 Ga0436363_0013651_379_1164 241
108 3300050507 nmdc:mga05p37_2220_c1 nmdc:mga05p37_2220_c1_12030_12821 241
109 3300005518 Ga0070699_100372117 Ga0070699_1003721172 242
110 3300020069 Ga0197907_10398481 Ga0197907_103984813 242
111 3300020078 Ga0206352_10890070 Ga0206352_108900702 242
112 3300037418 Ga0395900_0032686 Ga0395900_0032686_3862_4656 242
113 3300037466 Ga0395898_0043792 Ga0395898_0043792_1304_2098 242
114 3300037471 Ga0395905_0076005 Ga0395905_0076005_2311_3105 242
115 3300038443 Ga0395901_0081560 Ga0395901_0081560_47_841 242
116 3300045976 Ga0466967_0026684 Ga0466967_0026684_1770_2564 242
117 3300047320 Ga0495672_0133030 Ga0495672_0133030_309_1106 242
118 3300049568 Ga0501031_0163505 Ga0501031_0163505_138_974 242
119 3300005436 Ga0070713_100010729 Ga0070713_1000107294 243
120 3300006028 Ga0070717_10000005 Ga0070717_1000000515 243
121 3300006880 Ga0075429_100181918 Ga0075429_1001819182 243
122 3300009093 Ga0105240_10009018 Ga0105240_1000901812 243
123 3300009094 Ga0111539_10040353 Ga0111539_100403531 243
124 3300025928 Ga0207700_10013851 Ga0207700_100138513 243
125 3300045976 Ga0466967_0049030 Ga0466967_0049030_172_975 243
126 3300046477 Ga0495664_0000051 Ga0495664_0000051_51324_52103 243
127 3300046529 Ga0495652_0200363 Ga0495652_0200363_434_1327 243
128 3300049586 Ga0501070_0297713 Ga0501070_0297713_56_868 243
129 3300050492 nmdc:mga0yw44_152049_c1 nmdc:mga0yw44_152049_c1_235_1047 243
130 3300050508 nmdc:mga09592_127940_c1 nmdc:mga09592_127940_c1_768_1595 243
131 3300050511 nmdc:mga08y16_620079_c1 nmdc:mga08y16_620079_c1_86_874 243
132 3300050513 nmdc:mga0rr50_68950_c1 nmdc:mga0rr50_68950_c1_1454_2242 243
133 3300050514 nmdc:mga08x19_71518_c1 nmdc:mga08x19_71518_c1_1292_2080 243
134 3300053077 Ga0495601_0012016 Ga0495601_0012016_2290_3069 243
135 3300009147 Ga0114129_10204505 Ga0114129_102045054 244
136 3300009553 Ga0105249_10136760 Ga0105249_101367602 244
137 3300014326 Ga0157380_10282895 Ga0157380_102828952 244
138 3300025944 Ga0207661_10009524 Ga0207661_100095247 244
139 3300026075 Ga0207708_10161260 Ga0207708_101612602 244
140 3300028558 Ga0265326_10000004 Ga0265326_10000004196 244
141 3300028563 Ga0265319_1000406 Ga0265319_100040613 244
142 3300028573 Ga0265334_10000019 Ga0265334_10000019157 244
143 3300028800 Ga0265338_10017019 Ga0265338_100170198 244
144 3300029957 Ga0265324_10000730 Ga0265324_1000073013 244
145 3300039453 Ga0436362_1121834 Ga0436362_1121834_81_893 244
146 3300044684 Ga0466966_0254846 Ga0466966_0254846_184_996 244
147 3300045049 Ga0466959_0191043 Ga0466959_0191043_182_994 244
148 3300046794 Ga0495589_0092184 Ga0495589_0092184_257_1036 244
149 3300048907 Ga0496104_0172149 Ga0496104_0172149_723_1523 244
150 3300048913 Ga0496110_0169062 Ga0496110_0169062_320_1120 244
151 3300048918 Ga0496115_0147686 Ga0496115_0147686_635_1435 244
152 3300050507 nmdc:mga05p37_90274_c1 nmdc:mga05p37_90274_c1_1539_2363 244
153 3300050508 nmdc:mga09592_173788_c1 nmdc:mga09592_173788_c1_11_835 244
154 3300050511 nmdc:mga08y16_419449_c1 nmdc:mga08y16_419449_c1_409_1233 244
155 3300005981 Ga0081538_10078192 Ga0081538_100781922 245
156 3300005985 Ga0081539_10172459 Ga0081539_101724592 245
157 3300013296 Ga0157374_10454970 Ga0157374_104549702 245
158 3300025908 Ga0207643_10082184 Ga0207643_100821842 245
159 3300032002 Ga0307416_100134707 Ga0307416_1001347072 245
160 3300032126 Ga0307415_100065881 Ga0307415_1000658814 245
161 3300039437 Ga0436365_0654279 Ga0436365_0654279_7131_7943 245
162 3300045049 Ga0466959_0076116 Ga0466959_0076116_145_933 245
163 3300046516 Ga0495628_0073196 Ga0495628_0073196_196_1074 245
164 3300048913 Ga0496110_0000023 Ga0496110_0000023_18376_19155 245
165 3300048914 Ga0496111_0000181 Ga0496111_0000181_5655_6434 245
166 3300049577 Ga0501041_0092304 Ga0501041_0092304_85_909 245
167 3300049578 Ga0501042_0109156 Ga0501042_0109156_571_1395 245
168 3300049588 Ga0501072_0047989 Ga0501072_0047989_580_1404 245
169 3300049591 Ga0501075_0058435 Ga0501075_0058435_1842_2666 245
170 3300049592 Ga0501076_0003024 Ga0501076_0003024_4944_5768 245
171 3300049742 Ga0501080_0540419 Ga0501080_0540419_37_852 245
172 3300054114 Ga0501084_0217970 Ga0501084_0217970_103_927 245
173 3300001990 JGI24737J22298_10027549 JGI24737J22298_100275492 246
174 3300002074 JGI24748J21848_1000389 JGI24748J21848_10003892 246
175 3300002075 JGI24738J21930_10025607 JGI24738J21930_100256072 246
176 3300002239 JGI24034J26672_10000150 JGI24034J26672_1000015014 246
177 3300002244 JGI24742J22300_10019606 JGI24742J22300_100196061 246
178 3300005328 Ga0070676_10133369 Ga0070676_101333692 246
179 3300005337 Ga0070682_100061925 Ga0070682_1000619252 246
180 3300005366 Ga0070659_100144127 Ga0070659_1001441273 246
181 3300005435 Ga0070714_100000457 Ga0070714_10000045735 246
182 3300005437 Ga0070710_10323023 Ga0070710_103230232 246
183 3300005457 Ga0070662_100473915 Ga0070662_1004739152 246
184 3300005459 Ga0068867_100132290 Ga0068867_1001322901 246
185 3300005539 Ga0068853_100816413 Ga0068853_1008164131 246
186 3300005578 Ga0068854_100097394 Ga0068854_1000973943 246
187 3300005718 Ga0068866_10043953 Ga0068866_100439533 246
188 3300005841 Ga0068863_100946688 Ga0068863_1009466881 246
189 3300005842 Ga0068858_100379343 Ga0068858_1003793432 246
190 3300006931 Ga0097620_100405859 Ga0097620_1004058591 246
191 3300009553 Ga0105249_10070027 Ga0105249_100700274 246
192 3300013306 Ga0163162_10077973 Ga0163162_100779734 246
193 3300014745 Ga0157377_10159242 Ga0157377_101592422 246
194 3300025900 Ga0207710_10084919 Ga0207710_100849192 246
195 3300025901 Ga0207688_10015440 Ga0207688_100154405 246
196 3300025916 Ga0207663_10073167 Ga0207663_100731672 246
197 3300025927 Ga0207687_10110630 Ga0207687_101106302 246
198 3300025929 Ga0207664_10000008 Ga0207664_1000000835 246
199 3300025929 Ga0207664_10068604 Ga0207664_100686042 246
200 3300025934 Ga0207686_10069967 Ga0207686_100699672 246
201 3300025961 Ga0207712_10505545 Ga0207712_105055452 246
202 3300028380 Ga0268265_10391754 Ga0268265_103917542 246
203 3300028381 Ga0268264_10526437 Ga0268264_105264372 246
204 3300038443 Ga0395901_0043084 Ga0395901_0043084_1983_2843 246
205 3300046463 Ga0495653_0046662 Ga0495653_0046662_1387_2277 246
206 3300046500 Ga0495596_0041300 Ga0495596_0041300_193_1017 246
207 3300046517 Ga0495630_0000312 Ga0495630_0000312_15419_16309 246
208 3300046529 Ga0495652_0000066 Ga0495652_0000066_3384_4304 246
209 3300046543 Ga0495645_0029487 Ga0495645_0029487_1446_2354 246
210 3300046642 Ga0495634_0000187 Ga0495634_0000187_37157_38047 246
211 3300046663 Ga0495635_0048772 Ga0495635_0048772_1079_1969 246
212 3300046663 Ga0495635_0057868 Ga0495635_0057868_306_1196 246
213 3300046675 Ga0495657_0021818 Ga0495657_0021818_1894_2784 246
214 3300046809 Ga0495600_0219863 Ga0495600_0219863_153_1061 246
215 3300047322 Ga0495680_0110271 Ga0495680_0110271_690_1580 246
216 3300048912 Ga0496109_0511769 Ga0496109_0511769_181_972 246
217 3300049581 Ga0501047_0445751 Ga0501047_0445751_30_827 246
218 3300053077 Ga0495601_0053210 Ga0495601_0053210_120_1010 246
219 3300053085 Ga0495619_0000626 Ga0495619_0000626_5552_6442 246
220 3300003373 JGI25407J50210_10037219 JGI25407J50210_100372191 247
221 3300005345 Ga0070692_10049869 Ga0070692_100498692 247
222 3300005365 Ga0070688_100210574 Ga0070688_1002105741 247
223 3300005366 Ga0070659_100088392 Ga0070659_1000883923 247
224 3300005439 Ga0070711_100169536 Ga0070711_1001695362 247
225 3300005456 Ga0070678_100683115 Ga0070678_1006831151 247
226 3300005459 Ga0068867_100472532 Ga0068867_1004725321 247
227 3300005614 Ga0068856_100432252 Ga0068856_1004322522 247
228 3300005618 Ga0068864_100176006 Ga0068864_1001760062 247
229 3300005719 Ga0068861_100213824 Ga0068861_1002138242 247
230 3300005840 Ga0068870_10183207 Ga0068870_101832072 247
231 3300005981 Ga0081538_10013039 Ga0081538_100130393 247
232 3300005981 Ga0081538_10048018 Ga0081538_100480183 247
233 3300006178 Ga0075367_10303698 Ga0075367_103036982 247
234 3300006852 Ga0075433_10003079 Ga0075433_1000307910 247
235 3300009098 Ga0105245_10161330 Ga0105245_101613302 247
236 3300009553 Ga0105249_10264829 Ga0105249_102648292 247
237 3300011119 Ga0105246_10156655 Ga0105246_101566552 247
238 3300013307 Ga0157372_10499025 Ga0157372_104990252 247
239 3300014325 Ga0163163_10310414 Ga0163163_103104142 247
240 3300025901 Ga0207688_10212405 Ga0207688_102124052 247
241 3300025908 Ga0207643_10073739 Ga0207643_100737393 247
242 3300025917 Ga0207660_10134515 Ga0207660_101345152 247
243 3300025918 Ga0207662_10019100 Ga0207662_100191004 247
244 3300025919 Ga0207657_10163770 Ga0207657_101637703 247
245 3300025933 Ga0207706_10060988 Ga0207706_100609882 247
246 3300025960 Ga0207651_10589591 Ga0207651_105895911 247
247 3300025961 Ga0207712_10054885 Ga0207712_100548854 247
248 3300026067 Ga0207678_10082856 Ga0207678_100828564 247
249 3300026075 Ga0207708_10207192 Ga0207708_102071921 247
250 3300026089 Ga0207648_10334360 Ga0207648_103343602 247
251 3300026118 Ga0207675_100202406 Ga0207675_1002024062 247
252 3300026121 Ga0207683_10266293 Ga0207683_102662932 247
253 3300031548 Ga0307408_100279395 Ga0307408_1002793951 247
254 3300031824 Ga0307413_10020410 Ga0307413_100204102 247
255 3300031852 Ga0307410_10002178 Ga0307410_100021785 247
256 3300031901 Ga0307406_10004963 Ga0307406_1000496310 247
257 3300031903 Ga0307407_10240007 Ga0307407_102400072 247
258 3300031911 Ga0307412_10033408 Ga0307412_100334083 247
259 3300031995 Ga0307409_100120159 Ga0307409_1001201592 247
260 3300031995 Ga0307409_100137845 Ga0307409_1001378452 247
261 3300032002 Ga0307416_100007630 Ga0307416_1000076302 247
262 3300032002 Ga0307416_100047424 Ga0307416_1000474242 247
263 3300032002 Ga0307416_100107772 Ga0307416_1001077723 247
264 3300032002 Ga0307416_100402370 Ga0307416_1004023702 247
265 3300032004 Ga0307414_10157054 Ga0307414_101570542 247
266 3300032005 Ga0307411_10057982 Ga0307411_100579822 247
267 3300032126 Ga0307415_100002806 Ga0307415_10000280610 247
268 3300032126 Ga0307415_100196771 Ga0307415_1001967712 247
269 3300032126 Ga0307415_100423055 Ga0307415_1004230552 247
270 3300041494 Ga0451837_1322243 Ga0451837_1322243_43_843 247
271 3300042438 Ga0439459_0005651 Ga0439459_0005651_274_1080 247
272 3300044694 Ga0466963_0024348 Ga0466963_0024348_1818_2615 247
273 3300044694 Ga0466963_0029483 Ga0466963_0029483_179_976 247
274 3300044706 Ga0466964_0083209 Ga0466964_0083209_19_870 247
275 3300045049 Ga0466959_0093998 Ga0466959_0093998_455_1255 247
276 3300045976 Ga0466967_0001339 Ga0466967_0001339_8250_9047 247
277 3300045976 Ga0466967_0104298 Ga0466967_0104298_1054_1848 247
278 3300045976 Ga0466967_0592747 Ga0466967_0592747_20_820 247
279 3300048914 Ga0496111_0137594 Ga0496111_0137594_341_1273 247
280 3300049572 Ga0501036_0067898 Ga0501036_0067898_1136_1939 247
281 3300049575 Ga0501039_0032649 Ga0501039_0032649_1473_2276 247
282 3300049576 Ga0501040_0250144 Ga0501040_0250144_278_1081 247
283 3300049591 Ga0501075_0170598 Ga0501075_0170598_19_822 247
284 3300049741 Ga0501079_0615565 Ga0501079_0615565_29_823 247
285 3300050515 nmdc:mga0a205_4209_c1 nmdc:mga0a205_4209_c1_1853_2734 247
286 3300053102 Ga0500554_020941 Ga0500554_020941_805_1608 247
287 3300059491 Ga0587070_006567 Ga0587070_006567_641_1441 247
288 3300059493 Ga0587077_009254 Ga0587077_009254_361_1155 247
289 3300003575 Ga0007409J51694_1018359 Ga0007409J51694_10183592 248
290 3300004803 Ga0058862_10146983 Ga0058862_101469831 248
291 3300005345 Ga0070692_10259767 Ga0070692_102597671 248
292 3300005353 Ga0070669_100252060 Ga0070669_1002520602 248
293 3300005356 Ga0070674_100349061 Ga0070674_1003490611 248
294 3300005456 Ga0070678_100289686 Ga0070678_1002896862 248
295 3300005535 Ga0070684_100092618 Ga0070684_1000926183 248
296 3300005564 Ga0070664_100440217 Ga0070664_1004402172 248
297 3300005981 Ga0081538_10000169 Ga0081538_1000016972 248
298 3300005981 Ga0081538_10000199 Ga0081538_1000019935 248
299 3300005981 Ga0081538_10131203 Ga0081538_101312032 248
300 3300006844 Ga0075428_100147238 Ga0075428_1001472382 248
301 3300006846 Ga0075430_100082115 Ga0075430_1000821152 248
302 3300006847 Ga0075431_100039934 Ga0075431_1000399344 248
303 3300009098 Ga0105245_10511028 Ga0105245_105110282 248
304 3300009148 Ga0105243_10222494 Ga0105243_102224942 248
305 3300014326 Ga0157380_10022346 Ga0157380_100223463 248
306 3300025923 Ga0207681_10224829 Ga0207681_102248292 248
307 3300025944 Ga0207661_10077349 Ga0207661_100773492 248
308 3300026116 Ga0207674_10115203 Ga0207674_101152034 248
309 3300026118 Ga0207675_100031944 Ga0207675_1000319442 248
310 3300032004 Ga0307414_10294986 Ga0307414_102949862 248
311 3300042005 Ga0439448_0058057 Ga0439448_0058057_333_1130 248
312 3300044694 Ga0466963_0050194 Ga0466963_0050194_331_1134 248
313 3300044694 Ga0466963_0091375 Ga0466963_0091375_350_1153 248
314 3300044842 Ga0466957_0047290 Ga0466957_0047290_949_1752 248
315 3300044901 Ga0466960_0131798 Ga0466960_0131798_207_1019 248
316 3300045049 Ga0466959_0234163 Ga0466959_0234163_257_1060 248
317 3300046642 Ga0495634_0026143 Ga0495634_0026143_3114_4004 248
318 3300048904 Ga0496101_0001927 Ga0496101_0001927_11103_11903 248
319 3300048905 Ga0496102_0004675 Ga0496102_0004675_9888_10688 248
320 3300048909 Ga0496106_0003356 Ga0496106_0003356_1990_2790 248
321 3300048918 Ga0496115_0029926 Ga0496115_0029926_2531_3331 248
322 3300048927 Ga0496124_0044254 Ga0496124_0044254_2729_3532 248
323 3300049576 Ga0501040_0261644 Ga0501040_0261644_182_1009 248
324 3300049743 Ga0501081_0471883 Ga0501081_0471883_38_874 248
325 3300050509 nmdc:mga0qj67_32858_c1 nmdc:mga0qj67_32858_c1_1814_2641 248
326 3300060353 Ga0501082_0119820 Ga0501082_0119820_789_1625 248
327 3300061719 Ga0466962_0026097 Ga0466962_0026097_71_871 248
328 3300003373 JGI25407J50210_10025274 JGI25407J50210_100252742 249
329 3300005329 Ga0070683_100271684 Ga0070683_1002716842 249
330 3300005334 Ga0068869_100366521 Ga0068869_1003665212 249
331 3300005338 Ga0068868_100050401 Ga0068868_1000504014 249
332 3300005341 Ga0070691_10008056 Ga0070691_100080564 249
333 3300005353 Ga0070669_100024526 Ga0070669_1000245262 249
334 3300005366 Ga0070659_100000002 Ga0070659_100000002186 249
335 3300005437 Ga0070710_10000007 Ga0070710_1000000753 249
336 3300005437 Ga0070710_10032819 Ga0070710_100328193 249
337 3300005439 Ga0070711_100169259 Ga0070711_1001692592 249
338 3300005440 Ga0070705_100014228 Ga0070705_1000142282 249
339 3300005441 Ga0070700_100000713 Ga0070700_1000007134 249
340 3300005455 Ga0070663_100069580 Ga0070663_1000695802 249
341 3300005456 Ga0070678_100158391 Ga0070678_1001583912 249
342 3300005466 Ga0070685_10018903 Ga0070685_100189033 249
343 3300005535 Ga0070684_100081725 Ga0070684_1000817252 249
344 3300005564 Ga0070664_100257493 Ga0070664_1002574932 249
345 3300005564 Ga0070664_100559857 Ga0070664_1005598571 249
346 3300005577 Ga0068857_100589759 Ga0068857_1005897592 249
347 3300005618 Ga0068864_100063941 Ga0068864_1000639412 249
348 3300005718 Ga0068866_10167533 Ga0068866_101675332 249
349 3300005841 Ga0068863_100187922 Ga0068863_1001879223 249
350 3300005981 Ga0081538_10000601 Ga0081538_1000060128 249
351 3300005981 Ga0081538_10046700 Ga0081538_100467002 249
352 3300006175 Ga0070712_100000054 Ga0070712_10000005411 249
353 3300006175 Ga0070712_100058401 Ga0070712_1000584014 249
354 3300006847 Ga0075431_100403643 Ga0075431_1004036432 249
355 3300006852 Ga0075433_10109169 Ga0075433_101091692 249
356 3300006881 Ga0068865_100031548 Ga0068865_1000315484 249
357 3300006914 Ga0075436_100160059 Ga0075436_1001600592 249
358 3300009011 Ga0105251_10166835 Ga0105251_101668352 249
359 3300009094 Ga0111539_10128332 Ga0111539_101283323 249
360 3300009094 Ga0111539_10160791 Ga0111539_101607912 249
361 3300009098 Ga0105245_10014040 Ga0105245_1001404010 249
362 3300009147 Ga0114129_10382147 Ga0114129_103821472 249
363 3300009147 Ga0114129_10411479 Ga0114129_104114792 249
364 3300009177 Ga0105248_10114960 Ga0105248_101149602 249
365 3300009553 Ga0105249_10538746 Ga0105249_105387462 249
366 3300010375 Ga0105239_10015484 Ga0105239_100154848 249
367 3300011119 Ga0105246_10052077 Ga0105246_100520773 249
368 3300011119 Ga0105246_10063586 Ga0105246_100635862 249
369 3300012510 Ga0157316_1003173 Ga0157316_10031732 249
370 3300013296 Ga0157374_10012519 Ga0157374_100125197 249
371 3300013307 Ga0157372_10259674 Ga0157372_102596742 249
372 3300013308 Ga0157375_10018991 Ga0157375_100189916 249
373 3300014325 Ga0163163_10020100 Ga0163163_100201004 249
374 3300014326 Ga0157380_10050458 Ga0157380_100504584 249
375 3300014745 Ga0157377_10047054 Ga0157377_100470544 249
376 3300014969 Ga0157376_10016164 Ga0157376_100161648 249
377 3300014969 Ga0157376_10086348 Ga0157376_100863483 249
378 3300017792 Ga0163161_10221738 Ga0163161_102217382 249
379 3300022467 Ga0224712_10076498 Ga0224712_100764982 249
380 3300025898 Ga0207692_10000001 Ga0207692_10000001283 249
381 3300025898 Ga0207692_10002495 Ga0207692_100024951 249
382 3300025901 Ga0207688_10002646 Ga0207688_100026469 249
383 3300025901 Ga0207688_10031598 Ga0207688_100315982 249
384 3300025904 Ga0207647_10152391 Ga0207647_101523912 249
385 3300025906 Ga0207699_10134262 Ga0207699_101342622 249
386 3300025915 Ga0207693_10000001 Ga0207693_10000001114 249
387 3300025915 Ga0207693_10032690 Ga0207693_100326904 249
388 3300025916 Ga0207663_10087472 Ga0207663_100874723 249
389 3300025919 Ga0207657_10068331 Ga0207657_100683313 249
390 3300025923 Ga0207681_10006628 Ga0207681_100066287 249
391 3300025927 Ga0207687_10235269 Ga0207687_102352692 249
392 3300025929 Ga0207664_10303082 Ga0207664_103030822 249
393 3300025932 Ga0207690_10000024 Ga0207690_10000024123 249
394 3300025932 Ga0207690_10063905 Ga0207690_100639052 249
395 3300025942 Ga0207689_10171221 Ga0207689_101712212 249
396 3300025945 Ga0207679_10264081 Ga0207679_102640811 249
397 3300025949 Ga0207667_10442350 Ga0207667_104423502 249
398 3300025981 Ga0207640_10047658 Ga0207640_100476581 249
399 3300026041 Ga0207639_10377875 Ga0207639_103778752 249
400 3300026067 Ga0207678_10005519 Ga0207678_1000551910 249
401 3300026075 Ga0207708_10000496 Ga0207708_1000049610 249
402 3300026088 Ga0207641_10141998 Ga0207641_101419982 249
403 3300026089 Ga0207648_10098758 Ga0207648_100987582 249
404 3300026095 Ga0207676_10121577 Ga0207676_101215772 249
405 3300026116 Ga0207674_10419567 Ga0207674_104195671 249
406 3300026121 Ga0207683_10010883 Ga0207683_100108832 249
407 3300027907 Ga0207428_10248715 Ga0207428_102487152 249
408 3300028379 Ga0268266_10398598 Ga0268266_103985982 249
409 3300031251 Ga0265327_10002548 Ga0265327_1000254815 249
410 3300031711 Ga0265314_10072978 Ga0265314_100729782 249
411 3300031995 Ga0307409_100005794 Ga0307409_1000057942 249
412 3300032126 Ga0307415_100051745 Ga0307415_1000517454 249
413 3300044684 Ga0466966_0104943 Ga0466966_0104943_550_1353 249
414 3300046463 Ga0495653_0000183 Ga0495653_0000183_12608_13414 249
415 3300046516 Ga0495628_0116833 Ga0495628_0116833_990_1793 249
416 3300047320 Ga0495672_0001687 Ga0495672_0001687_6708_7514 249
417 3300048903 Ga0496100_0014322 Ga0496100_0014322_754_1593 249
418 3300048905 Ga0496102_0049833 Ga0496102_0049833_2958_3797 249
419 3300048906 Ga0496103_0000016 Ga0496103_0000016_110105_110917 249
420 3300048907 Ga0496104_0000030 Ga0496104_0000030_108352_109164 249
421 3300048907 Ga0496104_0140661 Ga0496104_0140661_1273_2112 249
422 3300048908 Ga0496105_0125436 Ga0496105_0125436_295_1134 249
423 3300048909 Ga0496106_0058661 Ga0496106_0058661_83_922 249
424 3300048911 Ga0496108_0000153 Ga0496108_0000153_30182_31078 249
425 3300048911 Ga0496108_0157061 Ga0496108_0157061_256_1095 249
426 3300048912 Ga0496109_0000300 Ga0496109_0000300_36749_37645 249
427 3300048912 Ga0496109_0108128 Ga0496109_0108128_989_1828 249
428 3300048912 Ga0496109_0143526 Ga0496109_0143526_910_1716 249
429 3300048913 Ga0496110_0000230 Ga0496110_0000230_34623_35435 249
430 3300048914 Ga0496111_0000016 Ga0496111_0000016_74585_75397 249
431 3300048915 Ga0496112_0001445 Ga0496112_0001445_16560_17366 249
432 3300048915 Ga0496112_0192679 Ga0496112_0192679_962_1801 249
433 3300048916 Ga0496113_0111989 Ga0496113_0111989_1256_2062 249
434 3300050507 nmdc:mga05p37_95327_c1 nmdc:mga05p37_95327_c1_1208_2044 249
435 3300050515 nmdc:mga0a205_320751_c1 nmdc:mga0a205_320751_c1_274_1113 249
436 3300053085 Ga0495619_0126366 Ga0495619_0126366_616_1428 249
437 3300059506 Ga0587085_010233 Ga0587085_010233_66_911 249
438 3300006871 Ga0075434_100061090 Ga0075434_1000610904 250
439 3300007076 Ga0075435_100005734 Ga0075435_10000573410 250
440 3300009098 Ga0105245_10500345 Ga0105245_105003452 250
441 3300009147 Ga0114129_10149373 Ga0114129_101493732 250
442 3300025915 Ga0207693_10006332 Ga0207693_100063328 250
443 3300025916 Ga0207663_10232257 Ga0207663_102322572 250
444 3300025927 Ga0207687_10115669 Ga0207687_101156692 250
445 3300031901 Ga0307406_10143729 Ga0307406_101437292 250
446 3300032005 Ga0307411_10187687 Ga0307411_101876872 250
447 3300039437 Ga0436365_0190537 Ga0436365_0190537_5566_6375 250
448 3300044693 Ga0466961_0055385 Ga0466961_0055385_499_1305 250
449 3300045049 Ga0466959_0051085 Ga0466959_0051085_1601_2407 250
450 3300046615 Ga0495656_0033783 Ga0495656_0033783_498_1286 250
451 3300048904 Ga0496101_0140244 Ga0496101_0140244_846_1685 250
452 3300048905 Ga0496102_0457739 Ga0496102_0457739_321_1106 250
453 3300048909 Ga0496106_0094150 Ga0496106_0094150_1374_2159 250
454 3300048912 Ga0496109_0010926 Ga0496109_0010926_5877_6686 250
455 3300049591 Ga0501075_0135260 Ga0501075_0135260_1058_1840 250
456 3300049741 Ga0501079_0126989 Ga0501079_0126989_1040_1822 250
457 3300050507 nmdc:mga05p37_1079737_c1 nmdc:mga05p37_1079737_c1_40_825 250
458 3300050512 nmdc:mga0n895_255599_c1 nmdc:mga0n895_255599_c1_225_1010 250
459 3300050513 nmdc:mga0rr50_77688_c1 nmdc:mga0rr50_77688_c1_959_1744 250
460 3300050515 nmdc:mga0a205_58885_c1 nmdc:mga0a205_58885_c1_2661_3446 250
461 3300054114 Ga0501084_0138999 Ga0501084_0138999_722_1504 250
462 3300005339 Ga0070660_100077368 Ga0070660_1000773683 251
463 3300005344 Ga0070661_100006067 Ga0070661_1000060676 251
464 3300005458 Ga0070681_10007190 Ga0070681_1000719014 251
465 3300005530 Ga0070679_100003327 Ga0070679_10000332718 251
466 3300005539 Ga0068853_100083492 Ga0068853_1000834922 251
467 3300005614 Ga0068856_100052759 Ga0068856_1000527592 251
468 3300006051 Ga0075364_10182165 Ga0075364_101821652 251
469 3300006051 Ga0075364_10190668 Ga0075364_101906682 251
470 3300013104 Ga0157370_10011051 Ga0157370_100110513 251
471 3300013105 Ga0157369_10028494 Ga0157369_100284945 251
472 3300013307 Ga0157372_10040278 Ga0157372_100402784 251
473 3300025904 Ga0207647_10190680 Ga0207647_101906801 251
474 3300025912 Ga0207707_10062940 Ga0207707_100629401 251
475 3300025913 Ga0207695_10398791 Ga0207695_103987912 251
476 3300025917 Ga0207660_10008920 Ga0207660_100089206 251
477 3300025919 Ga0207657_10020984 Ga0207657_100209842 251
478 3300025920 Ga0207649_10007634 Ga0207649_100076345 251
479 3300025921 Ga0207652_10004034 Ga0207652_100040344 251
480 3300025944 Ga0207661_10003963 Ga0207661_100039635 251
481 3300026041 Ga0207639_10069307 Ga0207639_100693072 251
482 3300026078 Ga0207702_10030434 Ga0207702_100304345 251
483 3300026116 Ga0207674_10185644 Ga0207674_101856442 251
484 3300026142 Ga0207698_10029483 Ga0207698_100294833 251
485 3300031852 Ga0307410_10034475 Ga0307410_100344753 251
486 3300031995 Ga0307409_100056297 Ga0307409_1000562973 251
487 3300032002 Ga0307416_100094954 Ga0307416_1000949544 251
488 3300044684 Ga0466966_0041895 Ga0466966_0041895_228_1025 251
489 3300044693 Ga0466961_0003399 Ga0466961_0003399_6721_7518 251
490 3300044694 Ga0466963_0010863 Ga0466963_0010863_268_1065 251
491 3300044706 Ga0466964_0114447 Ga0466964_0114447_186_989 251
492 3300044719 Ga0466971_0001196 Ga0466971_0001196_6467_7264 251
493 3300044842 Ga0466957_0004158 Ga0466957_0004158_6700_7497 251
494 3300044842 Ga0466957_0006194 Ga0466957_0006194_2238_3035 251
495 3300044842 Ga0466957_0201859 Ga0466957_0201859_262_1059 251
496 3300045049 Ga0466959_0001348 Ga0466959_0001348_7456_8253 251
497 3300045049 Ga0466959_0155532 Ga0466959_0155532_551_1348 251
498 3300045836 Ga0466958_0047886 Ga0466958_0047886_134_931 251
499 3300050508 nmdc:mga09592_1226_c2 nmdc:mga09592_1226_c2_8052_8864 251
500 3300061719 Ga0466962_0000706 Ga0466962_0000706_7601_8398 251
501 3300061719 Ga0466962_0133586 Ga0466962_0133586_135_932 251
502 3300032126 Ga0307415_100276856 Ga0307415_1002768562 252
503 3300039437 Ga0436365_1162518 Ga0436365_1162518_1364_2164 252
504 3300039450 Ga0436363_1008360 Ga0436363_1008360_175_972 252
505 3300039453 Ga0436362_0315400 Ga0436362_0315400_96_896 252
506 3300044694 Ga0466963_0025075 Ga0466963_0025075_2667_3467 252
507 3300044735 Ga0466968_0025031 Ga0466968_0025031_841_1650 252
508 3300009147 Ga0114129_10311966 Ga0114129_103119663 253
509 3300045976 Ga0466967_0017023 Ga0466967_0017023_2170_3090 253
510 3300049572 Ga0501036_0264390 Ga0501036_0264390_16_810 253
511 3300049577 Ga0501041_0105319 Ga0501041_0105319_623_1417 253
512 3300049584 Ga0501068_0159455 Ga0501068_0159455_380_1177 253
513 3300049588 Ga0501072_0010167 Ga0501072_0010167_6068_6862 253
514 3300049593 Ga0501077_0013588 Ga0501077_0013588_4059_4853 253
515 3300049741 Ga0501079_0005061 Ga0501079_0005061_5879_6673 253
516 3300049824 Ga0501045_0029237 Ga0501045_0029237_3091_3885 253
517 3300050507 nmdc:mga05p37_347856_c1 nmdc:mga05p37_347856_c1_34_828 253
518 3300050510 nmdc:mga06r32_429255_c1 nmdc:mga06r32_429255_c1_373_1167 253
519 3300061734 Ga0530510_0003575 Ga0530510_0003575_1784_2578 253
520 3300005834 Ga0068851_10002068 Ga0068851_1000206810 254
521 3300010375 Ga0105239_10428620 Ga0105239_104286202 254
522 3300013100 Ga0157373_10146683 Ga0157373_101466831 254
523 3300006038 Ga0075365_10000307 Ga0075365_100003074 255
524 3300048913 Ga0496110_0000008 Ga0496110_0000008_16836_17795 255
525 3300048914 Ga0496111_0000004 Ga0496111_0000004_89076_90035 255
526 3300050491 nmdc:mga00v17_152267_c1 nmdc:mga00v17_152267_c1_477_1277 255
527 3300050492 nmdc:mga0yw44_231_c1 nmdc:mga0yw44_231_c1_11433_12233 255
528 3300006038 Ga0075365_10003397 Ga0075365_100033973 256
529 3300006847 Ga0075431_100002644 Ga0075431_10000264416 256
530 3300007076 Ga0075435_100331112 Ga0075435_1003311122 256
531 3300009094 Ga0111539_10005245 Ga0111539_100052458 256
532 3300009147 Ga0114129_10142177 Ga0114129_101421774 256
533 3300025899 Ga0207642_10015538 Ga0207642_100155381 256
534 3300037312 Ga0395899_0323964 Ga0395899_0323964_56_859 256
535 3300037418 Ga0395900_0037958 Ga0395900_0037958_3142_3945 256
536 3300037466 Ga0395898_0002611 Ga0395898_0002611_3590_4393 256
537 3300037466 Ga0395898_0023747 Ga0395898_0023747_5218_6021 256
538 3300037471 Ga0395905_0095615 Ga0395905_0095615_896_1699 256
539 3300037471 Ga0395905_0372601 Ga0395905_0372601_94_897 256
540 3300038443 Ga0395901_0077287 Ga0395901_0077287_1101_1904 256
541 3300038443 Ga0395901_0098579 Ga0395901_0098579_1044_1847 256
542 3300050492 nmdc:mga0yw44_196092_c1 nmdc:mga0yw44_196092_c1_88_891 256
543 3300050507 nmdc:mga05p37_179704_c1 nmdc:mga05p37_179704_c1_1241_2044 256
544 3300050511 nmdc:mga08y16_27710_c1 nmdc:mga08y16_27710_c1_1847_2650 256
545 3300050513 nmdc:mga0rr50_248220_c1 nmdc:mga0rr50_248220_c1_243_1046 256
546 3300050515 nmdc:mga0a205_47748_c1 nmdc:mga0a205_47748_c1_1247_2050 256
547 3300005338 Ga0068868_100005977 Ga0068868_10000597712 257
548 3300020077 Ga0206351_10664240 Ga0206351_106642401 257
549 3300025904 Ga0207647_10081100 Ga0207647_100811002 257
550 3300026023 Ga0207677_10029377 Ga0207677_100293772 257
551 3300047317 Ga0495604_0000802 Ga0495604_0000802_7160_8038 257
552 3300009551 Ga0105238_10001238 Ga0105238_1000123812 259
553 3300010375 Ga0105239_10507760 Ga0105239_105077602 259
554 3300025924 Ga0207694_10000067 Ga0207694_1000006748 259
555 3300026075 Ga0207708_10311270 Ga0207708_103112702 259
556 3300046535 Ga0495586_0000338 Ga0495586_0000338_23734_24642 259
557 3300046642 Ga0495634_0186448 Ga0495634_0186448_44_934 259
558 3300046663 Ga0495635_0000036 Ga0495635_0000036_61678_62568 259
559 3300049593 Ga0501077_0202885 Ga0501077_0202885_93_944 259
560 3300005539 Ga0068853_100001814 Ga0068853_1000018144 260
561 3300005578 Ga0068854_100000373 Ga0068854_10000037312 260
562 3300005614 Ga0068856_100024148 Ga0068856_1000241488 260
563 3300025981 Ga0207640_10002466 Ga0207640_100024662 260
564 3300026041 Ga0207639_10018969 Ga0207639_100189694 260
565 3300026078 Ga0207702_10060363 Ga0207702_100603634 260
566 3300047321 Ga0495676_0000091 Ga0495676_0000091_63176_64084 260
567 3300047446 Ga0495679_010847 Ga0495679_010847_861_1769 260
568 3300049741 Ga0501079_0249703 Ga0501079_0249703_464_1315 260
569 3300009094 Ga0111539_10427115 Ga0111539_104271152 261
570 3300025927 Ga0207687_10312529 Ga0207687_103125292 261
571 3300046459 Ga0495629_0000014 Ga0495629_0000014_50652_51572 261
572 3300046523 Ga0495644_0000296 Ga0495644_0000296_19734_20624 261
573 3300049581 Ga0501047_0319929 Ga0501047_0319929_137_1093 261
574 3300005937 Ga0081455_10033111 Ga0081455_100331116 262
575 3300046455 Ga0495603_0015844 Ga0495603_0015844_206_1093 262
576 3300048912 Ga0496109_0362265 Ga0496109_0362265_109_1038 262
577 3300049743 Ga0501081_0222113 Ga0501081_0222113_132_992 262
578 3300005341 Ga0070691_10000009 Ga0070691_1000000936 263
579 3300005937 Ga0081455_10024603 Ga0081455_100246034 264
580 3300046516 Ga0495628_0000070 Ga0495628_0000070_11842_12750 264
581 3300046536 Ga0495587_0077002 Ga0495587_0077002_351_1262 264
582 3300047322 Ga0495680_0043784 Ga0495680_0043784_552_1445 264
583 3300048088 Ga0495602_0001188 Ga0495602_0001188_13471_14379 264
584 3300049576 Ga0501040_0065586 Ga0501040_0065586_907_1806 264
585 3300049590 Ga0501074_0092709 Ga0501074_0092709_1098_2003 264
586 3300049591 Ga0501075_0362475 Ga0501075_0362475_110_1009 264
587 3300049592 Ga0501076_0098986 Ga0501076_0098986_887_1798 264
588 3300049824 Ga0501045_0162884 Ga0501045_0162884_483_1382 264
589 3300054114 Ga0501084_0135654 Ga0501084_0135654_972_1871 264
590 3300005337 Ga0070682_100384602 Ga0070682_1003846021 265
591 3300005343 Ga0070687_100011944 Ga0070687_1000119442 265
592 3300005344 Ga0070661_100023036 Ga0070661_1000230363 265
593 3300005345 Ga0070692_10028477 Ga0070692_100284774 265
594 3300005347 Ga0070668_100271780 Ga0070668_1002717802 265
595 3300005366 Ga0070659_100001108 Ga0070659_10000110816 265
596 3300005455 Ga0070663_100032151 Ga0070663_1000321514 265
597 3300005457 Ga0070662_100308842 Ga0070662_1003088422 265
598 3300005459 Ga0068867_100075180 Ga0068867_1000751802 265
599 3300005535 Ga0070684_100043637 Ga0070684_1000436371 265
600 3300005543 Ga0070672_100021385 Ga0070672_1000213854 265
601 3300005544 Ga0070686_100015412 Ga0070686_1000154122 265
602 3300005564 Ga0070664_100390594 Ga0070664_1003905942 265
603 3300005577 Ga0068857_100042206 Ga0068857_1000422064 265
604 3300005615 Ga0070702_100154317 Ga0070702_1001543172 265
605 3300005616 Ga0068852_100053917 Ga0068852_1000539174 265
606 3300005618 Ga0068864_100537068 Ga0068864_1005370682 265
607 3300005719 Ga0068861_100078748 Ga0068861_1000787482 265
608 3300006881 Ga0068865_100195622 Ga0068865_1001956222 265
609 3300009148 Ga0105243_10012944 Ga0105243_100129444 265
610 3300009551 Ga0105238_10171748 Ga0105238_101717483 265
611 3300009553 Ga0105249_10530015 Ga0105249_105300152 265
612 3300013307 Ga0157372_10131545 Ga0157372_101315454 265
613 3300025901 Ga0207688_10013921 Ga0207688_100139212 265
614 3300025909 Ga0207705_10020753 Ga0207705_100207536 265
615 3300025918 Ga0207662_10012004 Ga0207662_100120042 265
616 3300025919 Ga0207657_10018050 Ga0207657_100180505 265
617 3300025932 Ga0207690_10023389 Ga0207690_100233892 265
618 3300025933 Ga0207706_10155286 Ga0207706_101552862 265
619 3300025935 Ga0207709_10072392 Ga0207709_100723922 265
620 3300025938 Ga0207704_10004866 Ga0207704_100048666 265
621 3300025940 Ga0207691_10025351 Ga0207691_100253514 265
622 3300025941 Ga0207711_10383602 Ga0207711_103836022 265
623 3300025944 Ga0207661_10130399 Ga0207661_101303992 265
624 3300025972 Ga0207668_10274238 Ga0207668_102742382 265
625 3300026067 Ga0207678_10038380 Ga0207678_100383805 265
626 3300026075 Ga0207708_10001660 Ga0207708_1000166014 265
627 3300026089 Ga0207648_10093083 Ga0207648_100930832 265
628 3300026116 Ga0207674_10053480 Ga0207674_100534804 265
629 3300026142 Ga0207698_10089841 Ga0207698_100898412 265
630 3300028379 Ga0268266_10069579 Ga0268266_100695794 265
631 3300048903 Ga0496100_0142244 Ga0496100_0142244_495_1412 265
632 3300048909 Ga0496106_0025678 Ga0496106_0025678_3267_4184 265
633 3300048912 Ga0496109_0070473 Ga0496109_0070473_526_1443 265
634 3300048913 Ga0496110_0138177 Ga0496110_0138177_1017_1934 265
635 3300048916 Ga0496113_0006959 Ga0496113_0006959_282_1199 265
636 3300050492 nmdc:mga0yw44_276040_c1 nmdc:mga0yw44_276040_c1_138_1055 265
637 3300005337 Ga0070682_100000016 Ga0070682_100000016150 266
638 3300005356 Ga0070674_100000028 Ga0070674_10000002854 266
639 3300005614 Ga0068856_100035899 Ga0068856_1000358995 266
640 3300005718 Ga0068866_10000045 Ga0068866_1000004510 266
641 3300005840 Ga0068870_10048106 Ga0068870_100481061 266
642 3300009148 Ga0105243_10339527 Ga0105243_103395272 266
643 3300013307 Ga0157372_10000064 Ga0157372_1000006467 266
644 3300025899 Ga0207642_10000050 Ga0207642_1000005025 266
645 3300025935 Ga0207709_10061777 Ga0207709_100617772 266
646 3300025936 Ga0207670_10099045 Ga0207670_100990452 266
647 3300025937 Ga0207669_10000014 Ga0207669_1000001452 266
648 3300026078 Ga0207702_10010610 Ga0207702_100106105 266
649 3300028379 Ga0268266_10419207 Ga0268266_104192072 266
650 3300048916 Ga0496113_0000003 Ga0496113_0000003_9291_10250 266
651 3300053085 Ga0495619_0000020 Ga0495619_0000020_105169_106125 266
652 3300005841 Ga0068863_100000080 Ga0068863_10000008061 267
653 3300006847 Ga0075431_100009078 Ga0075431_1000090789 267
654 3300009093 Ga0105240_10441809 Ga0105240_104418092 267
655 3300009551 Ga0105238_10132032 Ga0105238_101320322 267
656 3300026088 Ga0207641_10000304 Ga0207641_1000030445 267
657 3300041491 Ga0451833_0200162 Ga0451833_0200162_571_1488 267
658 3300048913 Ga0496110_0037066 Ga0496110_0037066_3294_4193 267
659 3300050510 nmdc:mga06r32_70499_c1 nmdc:mga06r32_70499_c1_1900_2799 267
660 3300005614 Ga0068856_100000186 Ga0068856_10000018617 268
661 3300005937 Ga0081455_10099992 Ga0081455_100999923 268
662 3300013105 Ga0157369_10000037 Ga0157369_1000003798 268
663 3300026078 Ga0207702_10000134 Ga0207702_1000013425 268
664 3300046454 Ga0495592_0121061 Ga0495592_0121061_514_1443 268
665 3300046455 Ga0495603_0000554 Ga0495603_0000554_17314_18207 268
666 3300048918 Ga0496115_0000074 Ga0496115_0000074_24329_25243 268
667 3300049742 Ga0501080_0226721 Ga0501080_0226721_616_1536 268
668 3300049744 Ga0501083_0274270 Ga0501083_0274270_157_1077 268
669 3300005329 Ga0070683_100001266 Ga0070683_1000012669 269
670 3300005347 Ga0070668_100002556 Ga0070668_1000025569 269
671 3300005367 Ga0070667_100012784 Ga0070667_1000127847 269
672 3300005548 Ga0070665_100056914 Ga0070665_1000569142 269
673 3300005843 Ga0068860_100057058 Ga0068860_1000570584 269
674 3300005844 Ga0068862_100005926 Ga0068862_1000059265 269
675 3300009553 Ga0105249_10008240 Ga0105249_100082409 269
676 3300014326 Ga0157380_10000118 Ga0157380_1000011811 269
677 3300014968 Ga0157379_10027803 Ga0157379_100278032 269
678 3300025944 Ga0207661_10000086 Ga0207661_1000008621 269
679 3300025961 Ga0207712_10011344 Ga0207712_100113448 269
680 3300025972 Ga0207668_10007542 Ga0207668_100075423 269
681 3300025986 Ga0207658_10010778 Ga0207658_100107787 269
682 3300026075 Ga0207708_10149994 Ga0207708_101499942 269
683 3300028380 Ga0268265_10008034 Ga0268265_100080347 269
684 3300028381 Ga0268264_10032479 Ga0268264_100324792 269
685 3300046476 Ga0495662_0000048 Ga0495662_0000048_32062_32940 269
686 3300046476 Ga0495662_0003775 Ga0495662_0003775_785_1696 269
687 3300046515 Ga0495620_0000119 Ga0495620_0000119_2600_3484 269
688 3300048907 Ga0496104_0000063 Ga0496104_0000063_75535_76443 269
689 3300048908 Ga0496105_0000041 Ga0496105_0000041_40176_41084 269
690 3300048911 Ga0496108_0000024 Ga0496108_0000024_128528_129496 269
691 3300048912 Ga0496109_0000033 Ga0496109_0000033_105635_106603 269
692 3300049591 Ga0501075_0000598 Ga0501075_0000598_8136_9014 269
693 3300053085 Ga0495619_0053161 Ga0495619_0053161_589_1467 269
694 3300001979 JGI24740J21852_10000904 JGI24740J21852_1000090413 270
695 3300005548 Ga0070665_100001016 Ga0070665_1000010165 270
696 3300005616 Ga0068852_100000013 Ga0068852_10000001349 270
697 3300005842 Ga0068858_100000042 Ga0068858_10000004251 270
698 3300005983 Ga0081540_1000115 Ga0081540_10001153 270
699 3300009176 Ga0105242_10001870 Ga0105242_1000187018 270
700 3300009177 Ga0105248_10000089 Ga0105248_1000008956 270
701 3300025321 Ga0207656_10000144 Ga0207656_100001444 270
702 3300025934 Ga0207686_10000189 Ga0207686_1000018947 270
703 3300025941 Ga0207711_10000083 Ga0207711_1000008356 270
704 3300026035 Ga0207703_10000060 Ga0207703_1000006081 270
705 3300026142 Ga0207698_10000002 Ga0207698_10000002314 270
706 3300028379 Ga0268266_10000985 Ga0268266_1000098537 270
707 3300028556 Ga0265337_1000013 Ga0265337_10000134 270
708 3300028558 Ga0265326_10000012 Ga0265326_10000012165 270
709 3300028654 Ga0265322_10000003 Ga0265322_10000003452 270
710 3300028666 Ga0265336_10011220 Ga0265336_100112203 270
711 3300029957 Ga0265324_10000226 Ga0265324_1000022628 270
712 3300031239 Ga0265328_10004572 Ga0265328_100045722 270
713 3300031240 Ga0265320_10000001 Ga0265320_10000001452 270
714 3300031250 Ga0265331_10005677 Ga0265331_100056775 270
715 3300031251 Ga0265327_10000003 Ga0265327_10000003452 270
716 3300031344 Ga0265316_10022290 Ga0265316_100222905 270
717 3300031711 Ga0265314_10000044 Ga0265314_1000004415 270
718 3300032126 Ga0307415_100015192 Ga0307415_1000151926 270
719 3300041486 Ga0451807_2554897 Ga0451807_2554897_702_1613 270
720 3300046459 Ga0495629_0009501 Ga0495629_0009501_4538_5467 270
721 3300046507 Ga0495606_0000045 Ga0495606_0000045_144406_145320 270
722 3300046514 Ga0495618_0148667 Ga0495618_0148667_278_1189 270
723 3300046517 Ga0495630_0048552 Ga0495630_0048552_1928_2839 270
724 3300046529 Ga0495652_0002702 Ga0495652_0002702_8436_9350 270
725 3300046536 Ga0495587_0000446 Ga0495587_0000446_7912_8832 270
726 3300046543 Ga0495645_0029053 Ga0495645_0029053_1094_2008 270
727 3300046559 Ga0495667_0000015 Ga0495667_0000015_160765_161676 270
728 3300047321 Ga0495676_0000252 Ga0495676_0000252_25544_26452 270
729 3300047321 Ga0495676_0007581 Ga0495676_0007581_916_1827 270
730 3300047321 Ga0495676_0093228 Ga0495676_0093228_1023_1937 270
731 3300047322 Ga0495680_0000741 Ga0495680_0000741_28484_29395 270
732 3300048903 Ga0496100_0000008 Ga0496100_0000008_53439_54347 270
733 3300048904 Ga0496101_0000016 Ga0496101_0000016_62221_63129 270
734 3300048909 Ga0496106_0000086 Ga0496106_0000086_19815_20723 270
735 3300048910 Ga0496107_0000009 Ga0496107_0000009_53153_54061 270
736 3300048917 Ga0496114_0000010 Ga0496114_0000010_206117_207031 270
737 3300048918 Ga0496115_0000212 Ga0496115_0000212_25841_26755 270
738 3300048918 Ga0496115_0001537 Ga0496115_0001537_3878_4795 270
739 3300048927 Ga0496124_0191086 Ga0496124_0191086_470_1384 270
740 3300049586 Ga0501070_0022040 Ga0501070_0022040_2431_3348 270
741 3300053085 Ga0495619_0000015 Ga0495619_0000015_5319_6203 270
742 3300053094 Ga0500566_0001971 Ga0500566_0001971_1022_1951 270
743 3300005329 Ga0070683_100022950 Ga0070683_1000229504 271
744 3300005329 Ga0070683_100026568 Ga0070683_1000265684 271
745 3300005329 Ga0070683_100060529 Ga0070683_1000605293 271
746 3300005333 Ga0070677_10000018 Ga0070677_1000001814 271
747 3300005335 Ga0070666_10044022 Ga0070666_100440222 271
748 3300005336 Ga0070680_100025271 Ga0070680_1000252717 271
749 3300005337 Ga0070682_100000029 Ga0070682_10000002996 271
750 3300005337 Ga0070682_100275275 Ga0070682_1002752752 271
751 3300005341 Ga0070691_10146659 Ga0070691_101466592 271
752 3300005356 Ga0070674_100000003 Ga0070674_100000003261 271
753 3300005367 Ga0070667_100105361 Ga0070667_1001053612 271
754 3300005455 Ga0070663_100005232 Ga0070663_1000052324 271
755 3300005456 Ga0070678_100390347 Ga0070678_1003903472 271
756 3300005457 Ga0070662_100000008 Ga0070662_100000008166 271
757 3300005458 Ga0070681_10120339 Ga0070681_101203394 271
758 3300005458 Ga0070681_10384651 Ga0070681_103846512 271
759 3300005459 Ga0068867_100001503 Ga0068867_10000150316 271
760 3300005530 Ga0070679_100000507 Ga0070679_1000005078 271
761 3300005530 Ga0070679_100000674 Ga0070679_10000067427 271
762 3300005547 Ga0070693_100000093 Ga0070693_10000009334 271
763 3300005548 Ga0070665_100000120 Ga0070665_10000012079 271
764 3300005548 Ga0070665_100058921 Ga0070665_1000589214 271
765 3300005548 Ga0070665_100280015 Ga0070665_1002800152 271
766 3300005618 Ga0068864_100000044 Ga0068864_10000004453 271
767 3300005718 Ga0068866_10000002 Ga0068866_10000002146 271
768 3300005718 Ga0068866_10009088 Ga0068866_100090883 271
769 3300005841 Ga0068863_100362307 Ga0068863_1003623072 271
770 3300005842 Ga0068858_100000035 Ga0068858_10000003577 271
771 3300005843 Ga0068860_100090940 Ga0068860_1000909402 271
772 3300005985 Ga0081539_10000674 Ga0081539_1000067458 271
773 3300006163 Ga0070715_10000015 Ga0070715_1000001526 271
774 3300006846 Ga0075430_100054701 Ga0075430_1000547013 271
775 3300006852 Ga0075433_10000058 Ga0075433_1000005846 271
776 3300009098 Ga0105245_10000053 Ga0105245_1000005331 271
777 3300009098 Ga0105245_10000488 Ga0105245_1000048829 271
778 3300009101 Ga0105247_10000169 Ga0105247_1000016942 271
779 3300009176 Ga0105242_10000017 Ga0105242_1000001731 271
780 3300009553 Ga0105249_10000095 Ga0105249_1000009570 271
781 3300013104 Ga0157370_10272017 Ga0157370_102720172 271
782 3300013297 Ga0157378_10341331 Ga0157378_103413312 271
783 3300013308 Ga0157375_10000076 Ga0157375_1000007654 271
784 3300013308 Ga0157375_10033964 Ga0157375_100339643 271
785 3300014968 Ga0157379_10442128 Ga0157379_104421281 271
786 3300017792 Ga0163161_10000274 Ga0163161_100002746 271
787 3300025893 Ga0207682_10000047 Ga0207682_1000004714 271
788 3300025899 Ga0207642_10000001 Ga0207642_10000001463 271
789 3300025899 Ga0207642_10000003 Ga0207642_10000003463 271
790 3300025900 Ga0207710_10000103 Ga0207710_1000010365 271
791 3300025903 Ga0207680_10066138 Ga0207680_100661382 271
792 3300025905 Ga0207685_10000001 Ga0207685_10000001398 271
793 3300025912 Ga0207707_10089776 Ga0207707_100897762 271
794 3300025916 Ga0207663_10004253 Ga0207663_100042537 271
795 3300025917 Ga0207660_10011227 Ga0207660_100112276 271
796 3300025921 Ga0207652_10000177 Ga0207652_1000017712 271
797 3300025921 Ga0207652_10007489 Ga0207652_100074896 271
798 3300025927 Ga0207687_10000021 Ga0207687_1000002169 271
799 3300025927 Ga0207687_10000241 Ga0207687_1000024129 271
800 3300025932 Ga0207690_10024415 Ga0207690_100244154 271
801 3300025933 Ga0207706_10000016 Ga0207706_100000169 271
802 3300025934 Ga0207686_10000016 Ga0207686_1000001630 271
803 3300025934 Ga0207686_10000029 Ga0207686_10000029125 271
804 3300025937 Ga0207669_10000024 Ga0207669_1000002443 271
805 3300025944 Ga0207661_10005229 Ga0207661_100052298 271
806 3300025944 Ga0207661_10009721 Ga0207661_100097217 271
807 3300025944 Ga0207661_10065981 Ga0207661_100659814 271
808 3300025961 Ga0207712_10000003 Ga0207712_10000003564 271
809 3300026023 Ga0207677_10000429 Ga0207677_1000042914 271
810 3300026035 Ga0207703_10000067 Ga0207703_10000067110 271
811 3300026067 Ga0207678_10012641 Ga0207678_100126413 271
812 3300026067 Ga0207678_10165577 Ga0207678_101655772 271
813 3300026089 Ga0207648_10000230 Ga0207648_1000023059 271
814 3300026095 Ga0207676_10000043 Ga0207676_1000004352 271
815 3300028379 Ga0268266_10000023 Ga0268266_10000023439 271
816 3300028379 Ga0268266_10000748 Ga0268266_1000074816 271
817 3300028379 Ga0268266_10299200 Ga0268266_102992002 271
818 3300028563 Ga0265319_1000044 Ga0265319_100004452 271
819 3300028800 Ga0265338_10000297 Ga0265338_1000029752 271
820 3300031241 Ga0265325_10012241 Ga0265325_100122417 271
821 3300031250 Ga0265331_10038269 Ga0265331_100382693 271
822 3300035172 Ga0373955_0168607 Ga0373955_0168607_95_982 271
823 3300035724 Ga0373933_0256038 Ga0373933_0256038_32_919 271
824 3300044694 Ga0466963_0000021 Ga0466963_0000021_4629_5516 271
825 3300046454 Ga0495592_0000214 Ga0495592_0000214_8489_9379 271
826 3300046461 Ga0495641_0000001 Ga0495641_0000001_48381_49289 271
827 3300046463 Ga0495653_0081107 Ga0495653_0081107_1002_1892 271
828 3300046473 Ga0495582_0000012 Ga0495582_0000012_79873_80763 271
829 3300046499 Ga0495594_0000004 Ga0495594_0000004_155623_156552 271
830 3300046511 Ga0495608_0001397 Ga0495608_0001397_3239_4129 271
831 3300046511 Ga0495608_0005626 Ga0495608_0005626_7128_8018 271
832 3300046514 Ga0495618_0000087 Ga0495618_0000087_56935_57825 271
833 3300046516 Ga0495628_0002369 Ga0495628_0002369_4261_5151 271
834 3300046516 Ga0495628_0015291 Ga0495628_0015291_560_1450 271
835 3300046517 Ga0495630_0105735 Ga0495630_0105735_636_1544 271
836 3300046533 Ga0495640_0018734 Ga0495640_0018734_2360_3250 271
837 3300046533 Ga0495640_0053417 Ga0495640_0053417_654_1583 271
838 3300046537 Ga0495598_0000768 Ga0495598_0000768_3636_4526 271
839 3300046539 Ga0495621_0023623 Ga0495621_0023623_818_1705 271
840 3300046557 Ga0495622_0000016 Ga0495622_0000016_127752_128681 271
841 3300046615 Ga0495656_0000226 Ga0495656_0000226_18339_19229 271
842 3300046642 Ga0495634_0000755 Ga0495634_0000755_13453_14346 271
843 3300046660 Ga0495625_0000020 Ga0495625_0000020_159587_160510 271
844 3300046675 Ga0495657_0014465 Ga0495657_0014465_4736_5623 271
845 3300046678 Ga0495599_0007160 Ga0495599_0007160_3303_4211 271
846 3300046680 Ga0495646_0050297 Ga0495646_0050297_696_1616 271
847 3300046681 Ga0495647_0000013 Ga0495647_0000013_35479_36387 271
848 3300046683 Ga0495658_0000024 Ga0495658_0000024_32142_33032 271
849 3300046684 Ga0495669_0000251 Ga0495669_0000251_5091_5999 271
850 3300046689 Ga0495613_0000159 Ga0495613_0000159_40676_41566 271
851 3300046690 Ga0495624_0000013 Ga0495624_0000013_41524_42426 271
852 3300046690 Ga0495624_0066395 Ga0495624_0066395_923_1813 271
853 3300046691 Ga0495670_0003761 Ga0495670_0003761_5417_6307 271
854 3300046694 Ga0495649_0001084 Ga0495649_0001084_2499_3407 271
855 3300046809 Ga0495600_0002351 Ga0495600_0002351_1378_2268 271
856 3300047315 Ga0495581_0167208 Ga0495581_0167208_62_952 271
857 3300047319 Ga0495674_0000025 Ga0495674_0000025_93168_94097 271
858 3300047321 Ga0495676_0189322 Ga0495676_0189322_87_977 271
859 3300047322 Ga0495680_0000286 Ga0495680_0000286_27581_28489 271
860 3300047472 Ga0495686_0031778 Ga0495686_0031778_1087_2016 271
861 3300048903 Ga0496100_0000003 Ga0496100_0000003_301197_302105 271
862 3300048904 Ga0496101_0000003 Ga0496101_0000003_301197_302105 271
863 3300048904 Ga0496101_0162034 Ga0496101_0162034_440_1402 271
864 3300048905 Ga0496102_0000054 Ga0496102_0000054_118659_119591 271
865 3300048906 Ga0496103_0000178 Ga0496103_0000178_8017_8949 271
866 3300048907 Ga0496104_0000003 Ga0496104_0000003_76828_77736 271
867 3300048908 Ga0496105_0000031 Ga0496105_0000031_59485_60393 271
868 3300048908 Ga0496105_0184314 Ga0496105_0184314_275_1162 271
869 3300048909 Ga0496106_0000048 Ga0496106_0000048_58701_59609 271
870 3300048909 Ga0496106_0000052 Ga0496106_0000052_37932_38840 271
871 3300048910 Ga0496107_0000008 Ga0496107_0000008_192257_193165 271
872 3300048910 Ga0496107_0195485 Ga0496107_0195485_102_1010 271
873 3300048911 Ga0496108_0000002 Ga0496108_0000002_164911_165819 271
874 3300048912 Ga0496109_0000001 Ga0496109_0000001_164873_165781 271
875 3300048913 Ga0496110_0003088 Ga0496110_0003088_8572_9480 271
876 3300048914 Ga0496111_0061425 Ga0496111_0061425_54_1007 271
877 3300048915 Ga0496112_0000002 Ga0496112_0000002_723578_724468 271
878 3300048917 Ga0496114_0026192 Ga0496114_0026192_285_1199 271
879 3300048927 Ga0496124_0071588 Ga0496124_0071588_796_1758 271
880 3300049568 Ga0501031_0000172 Ga0501031_0000172_24165_25124 271
881 3300049569 Ga0501032_0000902 Ga0501032_0000902_19029_19988 271
882 3300049570 Ga0501033_0000211 Ga0501033_0000211_43019_43978 271
883 3300049571 Ga0501034_0003939 Ga0501034_0003939_3934_4893 271
884 3300049572 Ga0501036_0000841 Ga0501036_0000841_11788_12747 271
885 3300049573 Ga0501037_0000120 Ga0501037_0000120_22956_23915 271
886 3300049574 Ga0501038_0000139 Ga0501038_0000139_49455_50414 271
887 3300049575 Ga0501039_0006697 Ga0501039_0006697_5043_6002 271
888 3300049576 Ga0501040_0079999 Ga0501040_0079999_954_1913 271
889 3300049576 Ga0501040_0199644 Ga0501040_0199644_146_1033 271
890 3300049578 Ga0501042_0075317 Ga0501042_0075317_223_1113 271
891 3300049579 Ga0501043_0000203 Ga0501043_0000203_49582_50541 271
892 3300049580 Ga0501046_0000194 Ga0501046_0000194_49454_50413 271
893 3300049581 Ga0501047_0000287 Ga0501047_0000287_45338_46297 271
894 3300049582 Ga0501048_0000004 Ga0501048_0000004_50225_51184 271
895 3300049584 Ga0501068_0003838 Ga0501068_0003838_1812_2771 271
896 3300049585 Ga0501069_0054695 Ga0501069_0054695_1088_2047 271
897 3300049586 Ga0501070_0000079 Ga0501070_0000079_948_1907 271
898 3300049586 Ga0501070_0156923 Ga0501070_0156923_85_1041 271
899 3300049587 Ga0501071_0025386 Ga0501071_0025386_2296_3255 271
900 3300049590 Ga0501074_0005099 Ga0501074_0005099_2871_3830 271
901 3300049590 Ga0501074_0071035 Ga0501074_0071035_92_1048 271
902 3300049741 Ga0501079_0000318 Ga0501079_0000318_17520_18479 271
903 3300049741 Ga0501079_0033296 Ga0501079_0033296_746_1702 271
904 3300049742 Ga0501080_0004716 Ga0501080_0004716_3371_4330 271
905 3300049742 Ga0501080_0039515 Ga0501080_0039515_1923_2879 271
906 3300049744 Ga0501083_0008391 Ga0501083_0008391_3163_4122 271
907 3300049822 Ga0501035_0000059 Ga0501035_0000059_11791_12750 271
908 3300049823 Ga0501044_0001354 Ga0501044_0001354_10213_11172 271
909 3300049823 Ga0501044_0065596 Ga0501044_0065596_1098_2054 271
910 3300050515 nmdc:mga0a205_9_c2 nmdc:mga0a205_9_c2_3984_4877 271
911 3300053077 Ga0495601_0000344 Ga0495601_0000344_4723_5631 271
912 3300053078 Ga0495612_0000403 Ga0495612_0000403_12543_13496 271
913 3300053083 Ga0495655_0000003 Ga0495655_0000003_127063_127995 271
914 3300053084 Ga0495595_0000251 Ga0495595_0000251_16873_17763 271
915 3300053096 Ga0500641_0009337 Ga0500641_0009337_1572_2492 271
916 3300053123 Ga0500614_000039 Ga0500614_000039_10796_11704 271
917 3300053129 Ga0500628_000002 Ga0500628_000002_127063_127995 271
918 3300060346 Ga0587111_0027391 Ga0587111_0027391_221_1111 271
919 3300060353 Ga0501082_0004892 Ga0501082_0004892_8737_9696 271
920 3300005456 Ga0070678_100011408 Ga0070678_1000114083 272
921 3300005543 Ga0070672_100000129 Ga0070672_10000012911 272
922 3300006881 Ga0068865_100000001 Ga0068865_100000001231 272
923 3300009177 Ga0105248_10214980 Ga0105248_102149802 272
924 3300013104 Ga0157370_10154130 Ga0157370_101541303 272
925 3300013297 Ga0157378_10312796 Ga0157378_103127962 272
926 3300014326 Ga0157380_10000163 Ga0157380_1000016314 272
927 3300014968 Ga0157379_10338625 Ga0157379_103386252 272
928 3300025935 Ga0207709_10106828 Ga0207709_101068282 272
929 3300025938 Ga0207704_10000004 Ga0207704_1000000418 272
930 3300025940 Ga0207691_10000062 Ga0207691_1000006233 272
931 3300025941 Ga0207711_10070744 Ga0207711_100707442 272
932 3300026121 Ga0207683_10019153 Ga0207683_100191534 272
933 3300044694 Ga0466963_0028742 Ga0466963_0028742_2282_3181 272
934 3300046517 Ga0495630_0000007 Ga0495630_0000007_338049_338993 272
935 3300046663 Ga0495635_0150255 Ga0495635_0150255_324_1220 272
936 3300046674 Ga0495588_0000217 Ga0495588_0000217_51863_52816 272
937 3300046681 Ga0495647_0002426 Ga0495647_0002426_4667_5611 272
938 3300046689 Ga0495613_0118969 Ga0495613_0118969_365_1261 272
939 3300046690 Ga0495624_0001178 Ga0495624_0001178_159_1103 272
940 3300048089 Ga0495614_0068210 Ga0495614_0068210_32_928 272
941 3300048905 Ga0496102_0211415 Ga0496102_0211415_663_1625 272
942 3300048906 Ga0496103_0043658 Ga0496103_0043658_69_1031 272
943 3300048919 Ga0496116_0000014 Ga0496116_0000014_410217_411179 272
944 3300048920 Ga0496117_0001369 Ga0496117_0001369_23633_24595 272
945 3300048921 Ga0496118_0000389 Ga0496118_0000389_23800_24762 272
946 3300048921 Ga0496118_0019280 Ga0496118_0019280_5119_6081 272
947 3300048922 Ga0496119_0000937 Ga0496119_0000937_2653_3615 272
948 3300048922 Ga0496119_0072208 Ga0496119_0072208_78_1037 272
949 3300048923 Ga0496120_0004305 Ga0496120_0004305_11071_12033 272
950 3300048924 Ga0496121_0071566 Ga0496121_0071566_540_1502 272
951 3300049744 Ga0501083_0019756 Ga0501083_0019756_18_980 272
952 3300001977 JGI24746J21847_1003604 JGI24746J21847_10036042 273
953 3300005329 Ga0070683_100000367 Ga0070683_10000036717 273
954 3300005330 Ga0070690_100140722 Ga0070690_1001407222 273
955 3300005335 Ga0070666_10013143 Ga0070666_100131433 273
956 3300005344 Ga0070661_100000026 Ga0070661_100000026113 273
957 3300005347 Ga0070668_100188703 Ga0070668_1001887032 273
958 3300005354 Ga0070675_100000015 Ga0070675_10000001548 273
959 3300005366 Ga0070659_100001759 Ga0070659_1000017592 273
960 3300005367 Ga0070667_100097367 Ga0070667_1000973673 273
961 3300005436 Ga0070713_100000014 Ga0070713_10000001449 273
962 3300005439 Ga0070711_100018181 Ga0070711_1000181812 273
963 3300005535 Ga0070684_100278799 Ga0070684_1002787991 273
964 3300005535 Ga0070684_100283635 Ga0070684_1002836352 273
965 3300009098 Ga0105245_10000045 Ga0105245_1000004581 273
966 3300013102 Ga0157371_10001481 Ga0157371_100014819 273
967 3300013104 Ga0157370_10015755 Ga0157370_100157552 273
968 3300013104 Ga0157370_10061195 Ga0157370_100611953 273
969 3300022467 Ga0224712_10011362 Ga0224712_100113622 273
970 3300025903 Ga0207680_10007643 Ga0207680_100076435 273
971 3300025915 Ga0207693_10002610 Ga0207693_1000261018 273
972 3300025920 Ga0207649_10000025 Ga0207649_10000025124 273
973 3300025926 Ga0207659_10000032 Ga0207659_1000003227 273
974 3300025927 Ga0207687_10000023 Ga0207687_1000002381 273
975 3300025928 Ga0207700_10000009 Ga0207700_1000000978 273
976 3300025928 Ga0207700_10078468 Ga0207700_100784682 273
977 3300025932 Ga0207690_10001315 Ga0207690_100013152 273
978 3300025944 Ga0207661_10000064 Ga0207661_1000006417 273
979 3300025972 Ga0207668_10059269 Ga0207668_100592693 273
980 3300036401 Ga0373937_0025996 Ga0373937_0025996_804_1703 273
981 3300044842 Ga0466957_0016840 Ga0466957_0016840_1434_2396 273
982 3300045976 Ga0466967_0000004 Ga0466967_0000004_96599_97558 273
983 3300046511 Ga0495608_0000001 Ga0495608_0000001_88860_89825 273
984 3300046675 Ga0495657_0000002 Ga0495657_0000002_89540_90505 273
985 3300046683 Ga0495658_0030522 Ga0495658_0030522_447_1412 273
986 3300046689 Ga0495613_0000040 Ga0495613_0000040_112043_112990 273
987 3300046809 Ga0495600_0026502 Ga0495600_0026502_1519_2466 273
988 3300047317 Ga0495604_0001037 Ga0495604_0001037_13529_14476 273
989 3300047317 Ga0495604_0003372 Ga0495604_0003372_9835_10782 273
990 3300047317 Ga0495604_0063409 Ga0495604_0063409_727_1626 273
991 3300047444 Ga0495675_0000019 Ga0495675_0000019_23137_24102 273
992 3300048088 Ga0495602_0000010 Ga0495602_0000010_47065_48012 273
993 3300048907 Ga0496104_0350445 Ga0496104_0350445_218_1147 273
994 3300048911 Ga0496108_0051614 Ga0496108_0051614_110_1066 273
995 3300048912 Ga0496109_0000146 Ga0496109_0000146_58359_59315 273
996 3300048913 Ga0496110_0047861 Ga0496110_0047861_2049_2948 273
997 3300048916 Ga0496113_0305065 Ga0496113_0305065_43_942 273
998 3300049575 Ga0501039_0067117 Ga0501039_0067117_1146_2042 273
999 3300049576 Ga0501040_0095431 Ga0501040_0095431_1018_1914 273
1000 3300053077 Ga0495601_0000012 Ga0495601_0000012_44835_45782 273
1001 3300053077 Ga0495601_0008897 Ga0495601_0008897_4903_5799 273
1002 3300053078 Ga0495612_0000100 Ga0495612_0000100_25305_26201 273
1003 3300053084 Ga0495595_0000001 Ga0495595_0000001_321454_322419 273
1004 3300053085 Ga0495619_0000046 Ga0495619_0000046_63709_64674 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00033

Cytochrome_B

Cytochrome b/b6/petB

80

269

0.96

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

150

292

0.94

PF14358

DUF4405

Domain of unknown function (DUF4405)

94

163

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rje-assembly1.cif.gz_T complex iii2 from candida albicans, inz-5 bound 0.9046 56 235
7jrg-assembly1.cif.gz_C plant mitochondrial complex iii2 from vigna radiata 0.8763 60 250
2d2c-assembly1.cif.gz_A crystal structure of cytochrome b6f complex with dbmib from m. laminosus 0.8705 52 243
5gup-assembly1.cif.gz_7 cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.8682 55 249
3cwb-assembly1.cif.gz_C chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d 0.8642 55 249
ID Description Score Start End Superfamily
2d2cA00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8705 52 243 1.20.810.10
af_Q37311_1_385_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8671 56 249 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8642 55 249 1.20.810.10
1vf5A00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8582 47 243 1.20.810.10
af_P03879_1_263_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8456 43 235 1.20.810.10
ID Description Score Start End GO Terms
AF-A0A0B0I5F4-F1-model_v4 deleted 0.9504 69 243
AF-A0A8B0SW37-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9473 60 170 GO:0005743
GO:0009055
GO:0016491
GO:0022904
GO:0046872
AF-A0A399ZUQ1-F1-model_v4 Cytochrome b/b6 N-terminal region profile domain-containing protein 0.9457 63 235 GO:0009055
GO:0016020
GO:0016491
GO:0022904
AF-A0A521IEW8-F1-model_v4 Cytochrome b/b6 N-terminal region profile domain-containing protein 0.9415 63 235 GO:0009055
GO:0016020
GO:0016491
GO:0022904
AF-A0A533T573-F1-model_v4 Cytochrome B 0.9401 61 243 GO:0009055
GO:0016020
GO:0016491
GO:0022904
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.71 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map