F487962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1004 | 387 | 1004 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10015755|Ga0157370_100157552 |
| Length | 322 |
| Sequence | MPSFPKPRIPDAIVPPPLRKPAKPGTSGAPKGQAPSDLKTAPPERPSHGDKLLDRGKEAPIDALGWVDQRMAASGFLTGMLYRKVPKGTNWFYTLGSATLFAFVVQAVTGVFLAMYYTPSATQAYASIAHINNDVPLGQFVHGMHKWGSSVMVILIFLHMGRTFFFGAYKYPRELNWVIGVVLLILTMTMAFTGYLLPFDQRSFWASIVGININGTGPVVGPYLSDFLRAGPEFGATTLSRFYAIHMLLVPGAIIALIGAHMYLVVKLGTTAPPWVKAERPKGASPLAQLDAGVNGNGNGRVNGHRTNGTPVSDEGGNGASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 378 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 387 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 1.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 9.06 |
| Rhizosphere | 87.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003604 | 3300001977 | Bacteria | 2439 |
| 2 | JGI24740J21852_10000904 | 3300001979 | Bacteria | 13157 |
| 3 | JGI24737J22298_10027549 | 3300001990 | Bacteria | 1791 |
| 4 | JGI24748J21848_1000389 | 3300002074 | Bacteria | 4966 |
| 5 | JGI24738J21930_10025607 | 3300002075 | Bacteria | 1212 |
| 6 | JGI24034J26672_10000150 | 3300002239 | Bacteria | 9967 |
| 7 | JGI24742J22300_10019606 | 3300002244 | Bacteria | 1149 |
| 8 | JGI25407J50210_10002380 | 3300003373 | Bacteria | 4423 |
| 9 | JGI25407J50210_10025274 | 3300003373 | Bacteria | 1540 |
| 10 | JGI25407J50210_10037219 | 3300003373 | Bacteria | 1250 |
| 11 | Ga0007409J51694_1018359 | 3300003575 | Bacteria | 1364 |
| 12 | Ga0058862_10146983 | 3300004803 | Bacteria | 1105 |
| 13 | Ga0070658_10016326 | 3300005327 | Bacteria | 5942 |
| 14 | Ga0070676_10133369 | 3300005328 | Bacteria | 1573 |
| 15 | Ga0070683_100000367 | 3300005329 | Bacteria | 31252 |
| 16 | Ga0070683_100001266 | 3300005329 | Bacteria | 19233 |
| 17 | Ga0070683_100008892 | 3300005329 | Bacteria | 8556 |
| 18 | Ga0070683_100022950 | 3300005329 | Bacteria | 5579 |
| 19 | Ga0070683_100026568 | 3300005329 | Bacteria | 5215 |
| 20 | Ga0070683_100060529 | 3300005329 | Bacteria | 3519 |
| 21 | Ga0070683_100271684 | 3300005329 | Bacteria | 1612 |
| 22 | Ga0070690_100140722 | 3300005330 | Bacteria | 1638 |
| 23 | Ga0070677_10000018 | 3300005333 | Bacteria | 51146 |
| 24 | Ga0068869_100366521 | 3300005334 | Bacteria | 1178 |
| 25 | Ga0070666_10013143 | 3300005335 | Bacteria | 5246 |
| 26 | Ga0070666_10044022 | 3300005335 | Bacteria | 2990 |
| 27 | Ga0070680_100008814 | 3300005336 | Bacteria | 7738 |
| 28 | Ga0070680_100025271 | 3300005336 | Bacteria | 4746 |
| 29 | Ga0070682_100000016 | 3300005337 | Bacteria | 239799 |
| 30 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 31 | Ga0070682_100061925 | 3300005337 | Bacteria | 2369 |
| 32 | Ga0070682_100275275 | 3300005337 | Bacteria | 1224 |
| 33 | Ga0070682_100384602 | 3300005337 | Bacteria | 1056 |
| 34 | Ga0068868_100005977 | 3300005338 | Bacteria | 8589 |
| 35 | Ga0068868_100050401 | 3300005338 | Bacteria | 3269 |
| 36 | Ga0068868_100444473 | 3300005338 | Bacteria | 1127 |
| 37 | Ga0070660_100006612 | 3300005339 | Bacteria | 8044 |
| 38 | Ga0070660_100077368 | 3300005339 | Bacteria | 2607 |
| 39 | Ga0070691_10000009 | 3300005341 | Bacteria | 58678 |
| 40 | Ga0070691_10008056 | 3300005341 | Bacteria | 4821 |
| 41 | Ga0070691_10146659 | 3300005341 | Bacteria | 1207 |
| 42 | Ga0070687_100011944 | 3300005343 | Bacteria | 3817 |
| 43 | Ga0070661_100000026 | 3300005344 | Bacteria | 118733 |
| 44 | Ga0070661_100006067 | 3300005344 | Bacteria | 8316 |
| 45 | Ga0070661_100023036 | 3300005344 | Bacteria | 4461 |
| 46 | Ga0070692_10028477 | 3300005345 | Bacteria | 2776 |
| 47 | Ga0070692_10049869 | 3300005345 | Bacteria | 2173 |
| 48 | Ga0070692_10259767 | 3300005345 | Bacteria | 1043 |
| 49 | Ga0070668_100002556 | 3300005347 | Bacteria | 13378 |
| 50 | Ga0070668_100188703 | 3300005347 | Bacteria | 1687 |
| 51 | Ga0070668_100271780 | 3300005347 | Bacteria | 1413 |
| 52 | Ga0070669_100024526 | 3300005353 | Bacteria | 4324 |
| 53 | Ga0070669_100252060 | 3300005353 | Bacteria | 1406 |
| 54 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 55 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 56 | Ga0070674_100000028 | 3300005356 | Bacteria | 69584 |
| 57 | Ga0070674_100349061 | 3300005356 | Bacteria | 1194 |
| 58 | Ga0070688_100210574 | 3300005365 | Bacteria | 1365 |
| 59 | Ga0070659_100000002 | 3300005366 | Bacteria | 369239 |
| 60 | Ga0070659_100001108 | 3300005366 | Bacteria | 19650 |
| 61 | Ga0070659_100001759 | 3300005366 | Bacteria | 15569 |
| 62 | Ga0070659_100088392 | 3300005366 | Bacteria | 2481 |
| 63 | Ga0070659_100144127 | 3300005366 | Bacteria | 1940 |
| 64 | Ga0070667_100012784 | 3300005367 | Bacteria | 6937 |
| 65 | Ga0070667_100097367 | 3300005367 | Bacteria | 2538 |
| 66 | Ga0070667_100105361 | 3300005367 | Bacteria | 2440 |
| 67 | Ga0070714_100000457 | 3300005435 | Bacteria | 29655 |
| 68 | Ga0070714_100336604 | 3300005435 | Bacteria | 1414 |
| 69 | Ga0070713_100000014 | 3300005436 | Bacteria | 124804 |
| 70 | Ga0070713_100010729 | 3300005436 | Bacteria | 6635 |
| 71 | Ga0070713_100022899 | 3300005436 | Bacteria | 4836 |
| 72 | Ga0070710_10000007 | 3300005437 | Bacteria | 215320 |
| 73 | Ga0070710_10032819 | 3300005437 | Bacteria | 2815 |
| 74 | Ga0070710_10323023 | 3300005437 | Bacteria | 1014 |
| 75 | Ga0070711_100018181 | 3300005439 | Bacteria | 4484 |
| 76 | Ga0070711_100169259 | 3300005439 | Bacteria | 1664 |
| 77 | Ga0070711_100169536 | 3300005439 | Bacteria | 1663 |
| 78 | Ga0070705_100014228 | 3300005440 | Bacteria | 4089 |
| 79 | Ga0070700_100000713 | 3300005441 | Bacteria | 16380 |
| 80 | Ga0070663_100005232 | 3300005455 | Bacteria | 7686 |
| 81 | Ga0070663_100032151 | 3300005455 | Bacteria | 3614 |
| 82 | Ga0070663_100069580 | 3300005455 | Bacteria | 2557 |
| 83 | Ga0070678_100011408 | 3300005456 | Bacteria | 5481 |
| 84 | Ga0070678_100158391 | 3300005456 | Bacteria | 1832 |
| 85 | Ga0070678_100289686 | 3300005456 | Bacteria | 1387 |
| 86 | Ga0070678_100390347 | 3300005456 | Bacteria | 1206 |
| 87 | Ga0070678_100683115 | 3300005456 | Bacteria | 923 |
| 88 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 89 | Ga0070662_100308842 | 3300005457 | Bacteria | 1287 |
| 90 | Ga0070662_100473915 | 3300005457 | Bacteria | 1041 |
| 91 | Ga0070681_10007190 | 3300005458 | Bacteria | 10848 |
| 92 | Ga0070681_10016470 | 3300005458 | Bacteria | 7380 |
| 93 | Ga0070681_10120339 | 3300005458 | Bacteria | 2561 |
| 94 | Ga0070681_10384651 | 3300005458 | Bacteria | 1314 |
| 95 | Ga0068867_100001503 | 3300005459 | Bacteria | 16143 |
| 96 | Ga0068867_100075180 | 3300005459 | Bacteria | 2533 |
| 97 | Ga0068867_100132290 | 3300005459 | Bacteria | 1940 |
| 98 | Ga0068867_100472532 | 3300005459 | Bacteria | 1072 |
| 99 | Ga0070685_10018903 | 3300005466 | Bacteria | 3712 |
| 100 | Ga0070698_100119204 | 3300005471 | Bacteria | 2600 |
| 101 | Ga0070699_100372117 | 3300005518 | Bacteria | 1289 |
| 102 | Ga0070679_100000507 | 3300005530 | Bacteria | 33181 |
| 103 | Ga0070679_100000674 | 3300005530 | Bacteria | 29110 |
| 104 | Ga0070679_100003327 | 3300005530 | Bacteria | 14715 |
| 105 | Ga0070679_100117690 | 3300005530 | Bacteria | 2642 |
| 106 | Ga0070684_100022491 | 3300005535 | Bacteria | 5259 |
| 107 | Ga0070684_100043637 | 3300005535 | Bacteria | 3873 |
| 108 | Ga0070684_100051215 | 3300005535 | Bacteria | 3586 |
| 109 | Ga0070684_100081725 | 3300005535 | Bacteria | 2859 |
| 110 | Ga0070684_100092618 | 3300005535 | Bacteria | 2689 |
| 111 | Ga0070684_100278799 | 3300005535 | Bacteria | 1531 |
| 112 | Ga0070684_100283635 | 3300005535 | Bacteria | 1517 |
| 113 | Ga0070684_100302559 | 3300005535 | Bacteria | 1468 |
| 114 | Ga0070684_100440901 | 3300005535 | Bacteria | 1203 |
| 115 | Ga0068853_100001814 | 3300005539 | Bacteria | 15699 |
| 116 | Ga0068853_100083492 | 3300005539 | Bacteria | 2799 |
| 117 | Ga0068853_100816413 | 3300005539 | Bacteria | 893 |
| 118 | Ga0070672_100000129 | 3300005543 | Bacteria | 39624 |
| 119 | Ga0070672_100021385 | 3300005543 | Bacteria | 4732 |
| 120 | Ga0070686_100015412 | 3300005544 | Bacteria | 4428 |
| 121 | Ga0070693_100000093 | 3300005547 | Bacteria | 38785 |
| 122 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 123 | Ga0070665_100001016 | 3300005548 | Bacteria | 35289 |
| 124 | Ga0070665_100056914 | 3300005548 | Bacteria | 3921 |
| 125 | Ga0070665_100058921 | 3300005548 | Bacteria | 3849 |
| 126 | Ga0070665_100280015 | 3300005548 | Bacteria | 1669 |
| 127 | Ga0068855_100175616 | 3300005563 | Bacteria | 2424 |
| 128 | Ga0068855_100297589 | 3300005563 | Bacteria | 1788 |
| 129 | Ga0070664_100257493 | 3300005564 | Bacteria | 1570 |
| 130 | Ga0070664_100390594 | 3300005564 | Bacteria | 1271 |
| 131 | Ga0070664_100440217 | 3300005564 | Bacteria | 1196 |
| 132 | Ga0070664_100559857 | 3300005564 | Bacteria | 1058 |
| 133 | Ga0068857_100042206 | 3300005577 | Bacteria | 4045 |
| 134 | Ga0068857_100589759 | 3300005577 | Bacteria | 1050 |
| 135 | Ga0068854_100000373 | 3300005578 | Bacteria | 28615 |
| 136 | Ga0068854_100097394 | 3300005578 | Bacteria | 2199 |
| 137 | Ga0068856_100000186 | 3300005614 | Bacteria | 64970 |
| 138 | Ga0068856_100024148 | 3300005614 | Bacteria | 5915 |
| 139 | Ga0068856_100035899 | 3300005614 | Bacteria | 4859 |
| 140 | Ga0068856_100052759 | 3300005614 | Bacteria | 4011 |
| 141 | Ga0068856_100432252 | 3300005614 | Bacteria | 1337 |
| 142 | Ga0070702_100154317 | 3300005615 | Bacteria | 1477 |
| 143 | Ga0068852_100000013 | 3300005616 | Bacteria | 139537 |
| 144 | Ga0068852_100053917 | 3300005616 | Bacteria | 3464 |
| 145 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 146 | Ga0068864_100063941 | 3300005618 | Bacteria | 3190 |
| 147 | Ga0068864_100176006 | 3300005618 | Bacteria | 1953 |
| 148 | Ga0068864_100537068 | 3300005618 | Bacteria | 1129 |
| 149 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 150 | Ga0068866_10000045 | 3300005718 | Bacteria | 48372 |
| 151 | Ga0068866_10009088 | 3300005718 | Bacteria | 4212 |
| 152 | Ga0068866_10043953 | 3300005718 | Bacteria | 2232 |
| 153 | Ga0068866_10167533 | 3300005718 | Bacteria | 1287 |
| 154 | Ga0068861_100078748 | 3300005719 | Bacteria | 2575 |
| 155 | Ga0068861_100213824 | 3300005719 | Bacteria | 1626 |
| 156 | Ga0068851_10002068 | 3300005834 | Bacteria | 8847 |
| 157 | Ga0068870_10048106 | 3300005840 | Bacteria | 2244 |
| 158 | Ga0068870_10183207 | 3300005840 | Bacteria | 1258 |
| 159 | Ga0068863_100000080 | 3300005841 | Bacteria | 106670 |
| 160 | Ga0068863_100187922 | 3300005841 | Bacteria | 1985 |
| 161 | Ga0068863_100362307 | 3300005841 | Bacteria | 1413 |
| 162 | Ga0068863_100946688 | 3300005841 | Bacteria | 863 |
| 163 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 164 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 165 | Ga0068858_100379343 | 3300005842 | Bacteria | 1357 |
| 166 | Ga0068860_100057058 | 3300005843 | Bacteria | 3711 |
| 167 | Ga0068860_100090940 | 3300005843 | Bacteria | 2907 |
| 168 | Ga0068862_100005926 | 3300005844 | Bacteria | 10177 |
| 169 | Ga0081455_10024603 | 3300005937 | Bacteria | 5571 |
| 170 | Ga0081455_10033111 | 3300005937 | Bacteria | 4647 |
| 171 | Ga0081455_10099992 | 3300005937 | Bacteria | 2331 |
| 172 | Ga0081538_10000013 | 3300005981 | Bacteria | 151925 |
| 173 | Ga0081538_10000169 | 3300005981 | Bacteria | 69684 |
| 174 | Ga0081538_10000199 | 3300005981 | Bacteria | 66370 |
| 175 | Ga0081538_10000601 | 3300005981 | Bacteria | 39857 |
| 176 | Ga0081538_10001407 | 3300005981 | Bacteria | 24723 |
| 177 | Ga0081538_10013039 | 3300005981 | Bacteria | 6614 |
| 178 | Ga0081538_10046700 | 3300005981 | Bacteria | 2666 |
| 179 | Ga0081538_10048018 | 3300005981 | Bacteria | 2610 |
| 180 | Ga0081538_10078192 | 3300005981 | Bacteria | 1777 |
| 181 | Ga0081538_10085412 | 3300005981 | Bacteria | 1658 |
| 182 | Ga0081538_10131203 | 3300005981 | Bacteria | 1177 |
| 183 | Ga0081540_1000115 | 3300005983 | Bacteria | 84188 |
| 184 | Ga0081539_10000674 | 3300005985 | Bacteria | 68446 |
| 185 | Ga0081539_10059310 | 3300005985 | Bacteria | 2107 |
| 186 | Ga0081539_10172459 | 3300005985 | Bacteria | 1021 |
| 187 | Ga0070717_10000005 | 3300006028 | Bacteria | 357819 |
| 188 | Ga0070717_10178733 | 3300006028 | Bacteria | 1848 |
| 189 | Ga0075365_10000307 | 3300006038 | Bacteria | 17163 |
| 190 | Ga0075365_10003397 | 3300006038 | Bacteria | 8187 |
| 191 | Ga0075364_10182165 | 3300006051 | Bacteria | 1422 |
| 192 | Ga0075364_10190668 | 3300006051 | Bacteria | 1388 |
| 193 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 194 | Ga0070712_100000054 | 3300006175 | Bacteria | 57683 |
| 195 | Ga0070712_100058401 | 3300006175 | Bacteria | 2714 |
| 196 | Ga0075367_10303698 | 3300006178 | Bacteria | 1005 |
| 197 | Ga0075428_100147238 | 3300006844 | Bacteria | 2559 |
| 198 | Ga0075430_100054701 | 3300006846 | Bacteria | 3358 |
| 199 | Ga0075430_100082115 | 3300006846 | Bacteria | 2700 |
| 200 | Ga0075431_100002644 | 3300006847 | Bacteria | 17334 |
| 201 | Ga0075431_100009078 | 3300006847 | Bacteria | 9968 |
| 202 | Ga0075431_100039934 | 3300006847 | Bacteria | 4834 |
| 203 | Ga0075431_100403643 | 3300006847 | Bacteria | 1367 |
| 204 | Ga0075433_10000058 | 3300006852 | Bacteria | 48106 |
| 205 | Ga0075433_10003079 | 3300006852 | Bacteria | 12818 |
| 206 | Ga0075433_10109169 | 3300006852 | Bacteria | 2454 |
| 207 | Ga0075434_100061090 | 3300006871 | Bacteria | 3748 |
| 208 | Ga0075429_100181918 | 3300006880 | Bacteria | 1842 |
| 209 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 210 | Ga0068865_100031548 | 3300006881 | Bacteria | 3534 |
| 211 | Ga0068865_100195622 | 3300006881 | Bacteria | 1567 |
| 212 | Ga0075436_100160059 | 3300006914 | Bacteria | 1587 |
| 213 | Ga0097620_100405859 | 3300006931 | Bacteria | 1459 |
| 214 | Ga0075435_100005734 | 3300007076 | Bacteria | 8712 |
| 215 | Ga0075435_100331112 | 3300007076 | Bacteria | 1304 |
| 216 | Ga0105251_10166835 | 3300009011 | Bacteria | 992 |
| 217 | Ga0105240_10009018 | 3300009093 | Bacteria | 14167 |
| 218 | Ga0105240_10146315 | 3300009093 | Bacteria | 2819 |
| 219 | Ga0105240_10441809 | 3300009093 | Bacteria | 1457 |
| 220 | Ga0111539_10005245 | 3300009094 | Bacteria | 16790 |
| 221 | Ga0111539_10040353 | 3300009094 | Bacteria | 5620 |
| 222 | Ga0111539_10128332 | 3300009094 | Bacteria | 2970 |
| 223 | Ga0111539_10160791 | 3300009094 | Bacteria | 2627 |
| 224 | Ga0111539_10427115 | 3300009094 | Bacteria | 1543 |
| 225 | Ga0105245_10000045 | 3300009098 | Bacteria | 134057 |
| 226 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 227 | Ga0105245_10000488 | 3300009098 | Bacteria | 36321 |
| 228 | Ga0105245_10014040 | 3300009098 | Bacteria | 6975 |
| 229 | Ga0105245_10161330 | 3300009098 | Bacteria | 2128 |
| 230 | Ga0105245_10500345 | 3300009098 | Bacteria | 1231 |
| 231 | Ga0105245_10511028 | 3300009098 | Bacteria | 1219 |
| 232 | Ga0105247_10000169 | 3300009101 | Bacteria | 64387 |
| 233 | Ga0114129_10007212 | 3300009147 | Bacteria | 15822 |
| 234 | Ga0114129_10142177 | 3300009147 | Bacteria | 3288 |
| 235 | Ga0114129_10149373 | 3300009147 | Bacteria | 3198 |
| 236 | Ga0114129_10204505 | 3300009147 | Bacteria | 2672 |
| 237 | Ga0114129_10311966 | 3300009147 | Bacteria | 2093 |
| 238 | Ga0114129_10382147 | 3300009147 | Bacteria | 1859 |
| 239 | Ga0114129_10411479 | 3300009147 | Bacteria | 1781 |
| 240 | Ga0105243_10012944 | 3300009148 | Bacteria | 6304 |
| 241 | Ga0105243_10222494 | 3300009148 | Bacteria | 1669 |
| 242 | Ga0105243_10339527 | 3300009148 | Bacteria | 1375 |
| 243 | Ga0105242_10000017 | 3300009176 | Bacteria | 122190 |
| 244 | Ga0105242_10001870 | 3300009176 | Bacteria | 16542 |
| 245 | Ga0105248_10000089 | 3300009177 | Bacteria | 102101 |
| 246 | Ga0105248_10114960 | 3300009177 | Bacteria | 3035 |
| 247 | Ga0105248_10214980 | 3300009177 | Bacteria | 2166 |
| 248 | Ga0105238_10001238 | 3300009551 | Bacteria | 25694 |
| 249 | Ga0105238_10132032 | 3300009551 | Bacteria | 2475 |
| 250 | Ga0105238_10171748 | 3300009551 | Bacteria | 2144 |
| 251 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 252 | Ga0105249_10008240 | 3300009553 | Bacteria | 9076 |
| 253 | Ga0105249_10070027 | 3300009553 | Bacteria | 3238 |
| 254 | Ga0105249_10136760 | 3300009553 | Bacteria | 2346 |
| 255 | Ga0105249_10264829 | 3300009553 | Bacteria | 1709 |
| 256 | Ga0105249_10530015 | 3300009553 | Bacteria | 1226 |
| 257 | Ga0105249_10538746 | 3300009553 | Bacteria | 1217 |
| 258 | Ga0105239_10015484 | 3300010375 | Bacteria | 8448 |
| 259 | Ga0105239_10428620 | 3300010375 | Bacteria | 1499 |
| 260 | Ga0105239_10507760 | 3300010375 | Bacteria | 1371 |
| 261 | Ga0105246_10052077 | 3300011119 | Bacteria | 2812 |
| 262 | Ga0105246_10063586 | 3300011119 | Bacteria | 2574 |
| 263 | Ga0105246_10156655 | 3300011119 | Bacteria | 1730 |
| 264 | Ga0157316_1003173 | 3300012510 | Bacteria | 1168 |
| 265 | Ga0157373_10146683 | 3300013100 | Bacteria | 1660 |
| 266 | Ga0157371_10001481 | 3300013102 | Bacteria | 24297 |
| 267 | Ga0157370_10004749 | 3300013104 | Bacteria | 15468 |
| 268 | Ga0157370_10011051 | 3300013104 | Bacteria | 9468 |
| 269 | Ga0157370_10015755 | 3300013104 | Bacteria | 7672 |
| 270 | Ga0157370_10061195 | 3300013104 | Bacteria | 3573 |
| 271 | Ga0157370_10128496 | 3300013104 | Bacteria | 2365 |
| 272 | Ga0157370_10154130 | 3300013104 | Bacteria | 2138 |
| 273 | Ga0157370_10272017 | 3300013104 | Bacteria | 1565 |
| 274 | Ga0157369_10000037 | 3300013105 | Bacteria | 190395 |
| 275 | Ga0157369_10028494 | 3300013105 | Bacteria | 6182 |
| 276 | Ga0157374_10012519 | 3300013296 | Bacteria | 7384 |
| 277 | Ga0157374_10454970 | 3300013296 | Bacteria | 1282 |
| 278 | Ga0157378_10312796 | 3300013297 | Bacteria | 1524 |
| 279 | Ga0157378_10341331 | 3300013297 | Bacteria | 1461 |
| 280 | Ga0163162_10077973 | 3300013306 | Bacteria | 3378 |
| 281 | Ga0157372_10000064 | 3300013307 | Bacteria | 114648 |
| 282 | Ga0157372_10040278 | 3300013307 | Bacteria | 5159 |
| 283 | Ga0157372_10131545 | 3300013307 | Bacteria | 2879 |
| 284 | Ga0157372_10259674 | 3300013307 | Bacteria | 2017 |
| 285 | Ga0157372_10499025 | 3300013307 | Bacteria | 1419 |
| 286 | Ga0157375_10000076 | 3300013308 | Bacteria | 101715 |
| 287 | Ga0157375_10018991 | 3300013308 | Bacteria | 6240 |
| 288 | Ga0157375_10033964 | 3300013308 | Bacteria | 4854 |
| 289 | Ga0163163_10020100 | 3300014325 | Bacteria | 6285 |
| 290 | Ga0163163_10310414 | 3300014325 | Bacteria | 1630 |
| 291 | Ga0157380_10000118 | 3300014326 | Bacteria | 43745 |
| 292 | Ga0157380_10000163 | 3300014326 | Bacteria | 38484 |
| 293 | Ga0157380_10022346 | 3300014326 | Bacteria | 4760 |
| 294 | Ga0157380_10050458 | 3300014326 | Bacteria | 3287 |
| 295 | Ga0157380_10282895 | 3300014326 | Bacteria | 1519 |
| 296 | Ga0157377_10047054 | 3300014745 | Bacteria | 2415 |
| 297 | Ga0157377_10159242 | 3300014745 | Bacteria | 1402 |
| 298 | Ga0157379_10027803 | 3300014968 | Bacteria | 5034 |
| 299 | Ga0157379_10338625 | 3300014968 | Bacteria | 1375 |
| 300 | Ga0157379_10442128 | 3300014968 | Bacteria | 1199 |
| 301 | Ga0157376_10016164 | 3300014969 | Bacteria | 5659 |
| 302 | Ga0157376_10086348 | 3300014969 | Bacteria | 2705 |
| 303 | Ga0163161_10000274 | 3300017792 | Bacteria | 45112 |
| 304 | Ga0163161_10221738 | 3300017792 | Bacteria | 1464 |
| 305 | Ga0197907_10398481 | 3300020069 | Bacteria | 2164 |
| 306 | Ga0206356_11146824 | 3300020070 | Bacteria | 3962 |
| 307 | Ga0206351_10113243 | 3300020077 | Bacteria | 2026 |
| 308 | Ga0206351_10664240 | 3300020077 | Bacteria | 1003 |
| 309 | Ga0206352_10890070 | 3300020078 | Bacteria | 2427 |
| 310 | Ga0224712_10011362 | 3300022467 | Bacteria | 2761 |
| 311 | Ga0224712_10076498 | 3300022467 | Bacteria | 1371 |
| 312 | Ga0207656_10000144 | 3300025321 | Bacteria | 26784 |
| 313 | Ga0207682_10000047 | 3300025893 | Bacteria | 51208 |
| 314 | Ga0207692_10000001 | 3300025898 | Bacteria | 558345 |
| 315 | Ga0207692_10002495 | 3300025898 | Bacteria | 7069 |
| 316 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 317 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 318 | Ga0207642_10000050 | 3300025899 | Bacteria | 34402 |
| 319 | Ga0207642_10015538 | 3300025899 | Bacteria | 2840 |
| 320 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 321 | Ga0207710_10084919 | 3300025900 | Bacteria | 1474 |
| 322 | Ga0207688_10002646 | 3300025901 | Bacteria | 9691 |
| 323 | Ga0207688_10013921 | 3300025901 | Bacteria | 4373 |
| 324 | Ga0207688_10015440 | 3300025901 | Bacteria | 4142 |
| 325 | Ga0207688_10031598 | 3300025901 | Bacteria | 2924 |
| 326 | Ga0207688_10212405 | 3300025901 | Bacteria | 1163 |
| 327 | Ga0207680_10007643 | 3300025903 | Bacteria | 5279 |
| 328 | Ga0207680_10066138 | 3300025903 | Bacteria | 2222 |
| 329 | Ga0207647_10081100 | 3300025904 | Bacteria | 1945 |
| 330 | Ga0207647_10152391 | 3300025904 | Bacteria | 1351 |
| 331 | Ga0207647_10190680 | 3300025904 | Bacteria | 1188 |
| 332 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 333 | Ga0207699_10134262 | 3300025906 | Bacteria | 1618 |
| 334 | Ga0207643_10073739 | 3300025908 | Bacteria | 1968 |
| 335 | Ga0207643_10082184 | 3300025908 | Bacteria | 1867 |
| 336 | Ga0207705_10015960 | 3300025909 | Bacteria | 5392 |
| 337 | Ga0207705_10020753 | 3300025909 | Bacteria | 4688 |
| 338 | Ga0207705_10053833 | 3300025909 | Bacteria | 2900 |
| 339 | Ga0207707_10062940 | 3300025912 | Bacteria | 3229 |
| 340 | Ga0207707_10089776 | 3300025912 | Bacteria | 2686 |
| 341 | Ga0207695_10398791 | 3300025913 | Bacteria | 1260 |
| 342 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 343 | Ga0207693_10002610 | 3300025915 | Bacteria | 15668 |
| 344 | Ga0207693_10006332 | 3300025915 | Bacteria | 9813 |
| 345 | Ga0207693_10032690 | 3300025915 | Bacteria | 4105 |
| 346 | Ga0207663_10004253 | 3300025916 | Bacteria | 7103 |
| 347 | Ga0207663_10073167 | 3300025916 | Bacteria | 2217 |
| 348 | Ga0207663_10087472 | 3300025916 | Bacteria | 2058 |
| 349 | Ga0207663_10232257 | 3300025916 | Bacteria | 1348 |
| 350 | Ga0207660_10008920 | 3300025917 | Bacteria | 6488 |
| 351 | Ga0207660_10011227 | 3300025917 | Bacteria | 5826 |
| 352 | Ga0207660_10027681 | 3300025917 | Bacteria | 3871 |
| 353 | Ga0207660_10134515 | 3300025917 | Bacteria | 1885 |
| 354 | Ga0207662_10012004 | 3300025918 | Bacteria | 4818 |
| 355 | Ga0207662_10019100 | 3300025918 | Bacteria | 3896 |
| 356 | Ga0207657_10000902 | 3300025919 | Bacteria | 31364 |
| 357 | Ga0207657_10018050 | 3300025919 | Bacteria | 6749 |
| 358 | Ga0207657_10020984 | 3300025919 | Bacteria | 6161 |
| 359 | Ga0207657_10068331 | 3300025919 | Bacteria | 3018 |
| 360 | Ga0207657_10163770 | 3300025919 | Bacteria | 1805 |
| 361 | Ga0207649_10000025 | 3300025920 | Bacteria | 177532 |
| 362 | Ga0207649_10007634 | 3300025920 | Bacteria | 5881 |
| 363 | Ga0207652_10000177 | 3300025921 | Bacteria | 67555 |
| 364 | Ga0207652_10004034 | 3300025921 | Bacteria | 11985 |
| 365 | Ga0207652_10007489 | 3300025921 | Bacteria | 8794 |
| 366 | Ga0207652_10043446 | 3300025921 | Bacteria | 3826 |
| 367 | Ga0207646_10357878 | 3300025922 | Bacteria | 1319 |
| 368 | Ga0207681_10006628 | 3300025923 | Bacteria | 7110 |
| 369 | Ga0207681_10224829 | 3300025923 | Bacteria | 1454 |
| 370 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 371 | Ga0207659_10000032 | 3300025926 | Bacteria | 119492 |
| 372 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 373 | Ga0207687_10000023 | 3300025927 | Bacteria | 217098 |
| 374 | Ga0207687_10000241 | 3300025927 | Bacteria | 37298 |
| 375 | Ga0207687_10110630 | 3300025927 | Bacteria | 2038 |
| 376 | Ga0207687_10115669 | 3300025927 | Bacteria | 1998 |
| 377 | Ga0207687_10235269 | 3300025927 | Bacteria | 1449 |
| 378 | Ga0207687_10312529 | 3300025927 | Bacteria | 1269 |
| 379 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 380 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 381 | Ga0207700_10013851 | 3300025928 | Bacteria | 5265 |
| 382 | Ga0207700_10078468 | 3300025928 | Bacteria | 2569 |
| 383 | Ga0207664_10000008 | 3300025929 | Bacteria | 309301 |
| 384 | Ga0207664_10068604 | 3300025929 | Bacteria | 2849 |
| 385 | Ga0207664_10128030 | 3300025929 | Bacteria | 2134 |
| 386 | Ga0207664_10303082 | 3300025929 | Bacteria | 1406 |
| 387 | Ga0207690_10000024 | 3300025932 | Bacteria | 194416 |
| 388 | Ga0207690_10001315 | 3300025932 | Bacteria | 15617 |
| 389 | Ga0207690_10023389 | 3300025932 | Bacteria | 3855 |
| 390 | Ga0207690_10024415 | 3300025932 | Bacteria | 3787 |
| 391 | Ga0207690_10063905 | 3300025932 | Bacteria | 2511 |
| 392 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 393 | Ga0207706_10060988 | 3300025933 | Bacteria | 3321 |
| 394 | Ga0207706_10155286 | 3300025933 | Bacteria | 2013 |
| 395 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 396 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 397 | Ga0207686_10000189 | 3300025934 | Bacteria | 47718 |
| 398 | Ga0207686_10069967 | 3300025934 | Bacteria | 2253 |
| 399 | Ga0207709_10061777 | 3300025935 | Bacteria | 2342 |
| 400 | Ga0207709_10072392 | 3300025935 | Bacteria | 2192 |
| 401 | Ga0207709_10106828 | 3300025935 | Bacteria | 1863 |
| 402 | Ga0207670_10099045 | 3300025936 | Bacteria | 2079 |
| 403 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 404 | Ga0207669_10000024 | 3300025937 | Bacteria | 96123 |
| 405 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 406 | Ga0207704_10004866 | 3300025938 | Bacteria | 6171 |
| 407 | Ga0207691_10000062 | 3300025940 | Bacteria | 85448 |
| 408 | Ga0207691_10025351 | 3300025940 | Bacteria | 5569 |
| 409 | Ga0207711_10000083 | 3300025941 | Bacteria | 102109 |
| 410 | Ga0207711_10070744 | 3300025941 | Bacteria | 3026 |
| 411 | Ga0207711_10376413 | 3300025941 | Bacteria | 1317 |
| 412 | Ga0207711_10383602 | 3300025941 | Bacteria | 1304 |
| 413 | Ga0207689_10171221 | 3300025942 | Bacteria | 1790 |
| 414 | Ga0207661_10000064 | 3300025944 | Bacteria | 75730 |
| 415 | Ga0207661_10000086 | 3300025944 | Bacteria | 64501 |
| 416 | Ga0207661_10003963 | 3300025944 | Bacteria | 10341 |
| 417 | Ga0207661_10005229 | 3300025944 | Bacteria | 9125 |
| 418 | Ga0207661_10009524 | 3300025944 | Bacteria | 6973 |
| 419 | Ga0207661_10009721 | 3300025944 | Bacteria | 6905 |
| 420 | Ga0207661_10065981 | 3300025944 | Bacteria | 2939 |
| 421 | Ga0207661_10075426 | 3300025944 | Bacteria | 2767 |
| 422 | Ga0207661_10077349 | 3300025944 | Bacteria | 2736 |
| 423 | Ga0207661_10087907 | 3300025944 | Bacteria | 2582 |
| 424 | Ga0207661_10130399 | 3300025944 | Bacteria | 2152 |
| 425 | Ga0207661_10259646 | 3300025944 | Bacteria | 1547 |
| 426 | Ga0207679_10264081 | 3300025945 | Bacteria | 1469 |
| 427 | Ga0207667_10017232 | 3300025949 | Bacteria | 8139 |
| 428 | Ga0207667_10221789 | 3300025949 | Bacteria | 1937 |
| 429 | Ga0207667_10442350 | 3300025949 | Bacteria | 1321 |
| 430 | Ga0207651_10589591 | 3300025960 | Bacteria | 971 |
| 431 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 432 | Ga0207712_10011344 | 3300025961 | Bacteria | 5676 |
| 433 | Ga0207712_10054885 | 3300025961 | Bacteria | 2800 |
| 434 | Ga0207712_10505545 | 3300025961 | Bacteria | 1034 |
| 435 | Ga0207668_10007542 | 3300025972 | Bacteria | 6476 |
| 436 | Ga0207668_10059269 | 3300025972 | Bacteria | 2681 |
| 437 | Ga0207668_10274238 | 3300025972 | Bacteria | 1380 |
| 438 | Ga0207640_10002466 | 3300025981 | Bacteria | 9906 |
| 439 | Ga0207640_10047658 | 3300025981 | Bacteria | 2766 |
| 440 | Ga0207658_10010778 | 3300025986 | Bacteria | 6218 |
| 441 | Ga0207677_10000429 | 3300026023 | Bacteria | 28292 |
| 442 | Ga0207677_10029377 | 3300026023 | Bacteria | 3493 |
| 443 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 444 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 445 | Ga0207639_10018969 | 3300026041 | Bacteria | 4897 |
| 446 | Ga0207639_10069307 | 3300026041 | Bacteria | 2751 |
| 447 | Ga0207639_10377875 | 3300026041 | Bacteria | 1272 |
| 448 | Ga0207678_10005519 | 3300026067 | Bacteria | 11299 |
| 449 | Ga0207678_10012641 | 3300026067 | Bacteria | 7416 |
| 450 | Ga0207678_10038380 | 3300026067 | Bacteria | 4161 |
| 451 | Ga0207678_10082856 | 3300026067 | Bacteria | 2744 |
| 452 | Ga0207678_10165577 | 3300026067 | Bacteria | 1888 |
| 453 | Ga0207708_10000496 | 3300026075 | Bacteria | 30252 |
| 454 | Ga0207708_10001660 | 3300026075 | Bacteria | 16551 |
| 455 | Ga0207708_10149994 | 3300026075 | Bacteria | 1834 |
| 456 | Ga0207708_10161260 | 3300026075 | Bacteria | 1771 |
| 457 | Ga0207708_10207192 | 3300026075 | Bacteria | 1566 |
| 458 | Ga0207708_10311270 | 3300026075 | Bacteria | 1283 |
| 459 | Ga0207702_10000134 | 3300026078 | Bacteria | 88324 |
| 460 | Ga0207702_10010610 | 3300026078 | Bacteria | 7699 |
| 461 | Ga0207702_10030434 | 3300026078 | Bacteria | 4499 |
| 462 | Ga0207702_10060363 | 3300026078 | Bacteria | 3233 |
| 463 | Ga0207641_10000304 | 3300026088 | Bacteria | 61194 |
| 464 | Ga0207641_10141998 | 3300026088 | Bacteria | 2168 |
| 465 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 466 | Ga0207648_10093083 | 3300026089 | Bacteria | 2636 |
| 467 | Ga0207648_10098758 | 3300026089 | Bacteria | 2556 |
| 468 | Ga0207648_10334360 | 3300026089 | Bacteria | 1363 |
| 469 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 470 | Ga0207676_10121577 | 3300026095 | Bacteria | 2203 |
| 471 | Ga0207674_10053480 | 3300026116 | Bacteria | 4116 |
| 472 | Ga0207674_10115203 | 3300026116 | Bacteria | 2659 |
| 473 | Ga0207674_10185644 | 3300026116 | Bacteria | 2030 |
| 474 | Ga0207674_10419567 | 3300026116 | Bacteria | 1293 |
| 475 | Ga0207675_100031944 | 3300026118 | Bacteria | 4905 |
| 476 | Ga0207675_100202406 | 3300026118 | Bacteria | 1907 |
| 477 | Ga0207683_10010883 | 3300026121 | Bacteria | 7760 |
| 478 | Ga0207683_10019153 | 3300026121 | Bacteria | 5843 |
| 479 | Ga0207683_10266293 | 3300026121 | Bacteria | 1565 |
| 480 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 481 | Ga0207698_10029483 | 3300026142 | Bacteria | 3931 |
| 482 | Ga0207698_10089841 | 3300026142 | Bacteria | 2510 |
| 483 | Ga0207428_10248715 | 3300027907 | Bacteria | 1326 |
| 484 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 485 | Ga0268266_10000748 | 3300028379 | Bacteria | 43458 |
| 486 | Ga0268266_10000985 | 3300028379 | Bacteria | 35931 |
| 487 | Ga0268266_10069579 | 3300028379 | Bacteria | 3050 |
| 488 | Ga0268266_10299200 | 3300028379 | Bacteria | 1500 |
| 489 | Ga0268266_10398598 | 3300028379 | Bacteria | 1301 |
| 490 | Ga0268266_10419207 | 3300028379 | Bacteria | 1268 |
| 491 | Ga0268265_10008034 | 3300028380 | Bacteria | 7124 |
| 492 | Ga0268265_10391754 | 3300028380 | Bacteria | 1281 |
| 493 | Ga0268264_10032479 | 3300028381 | Bacteria | 4283 |
| 494 | Ga0268264_10526437 | 3300028381 | Bacteria | 1156 |
| 495 | Ga0265337_1000013 | 3300028556 | Bacteria | 82926 |
| 496 | Ga0265326_10000004 | 3300028558 | Bacteria | 283947 |
| 497 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 498 | Ga0265319_1000044 | 3300028563 | Bacteria | 103641 |
| 499 | Ga0265319_1000406 | 3300028563 | Bacteria | 31126 |
| 500 | Ga0265334_10000019 | 3300028573 | Bacteria | 143921 |
| 501 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 502 | Ga0265336_10011220 | 3300028666 | Bacteria | 3053 |
| 503 | Ga0265338_10000297 | 3300028800 | Bacteria | 89764 |
| 504 | Ga0265338_10017019 | 3300028800 | Bacteria | 7862 |
| 505 | Ga0265324_10000226 | 3300029957 | Bacteria | 42741 |
| 506 | Ga0265324_10000730 | 3300029957 | Bacteria | 21931 |
| 507 | Ga0265328_10004572 | 3300031239 | Bacteria | 6002 |
| 508 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 509 | Ga0265325_10012241 | 3300031241 | Bacteria | 4909 |
| 510 | Ga0265340_10069051 | 3300031247 | Bacteria | 1677 |
| 511 | Ga0265331_10005677 | 3300031250 | Bacteria | 7494 |
| 512 | Ga0265331_10038269 | 3300031250 | Bacteria | 2345 |
| 513 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 514 | Ga0265327_10002548 | 3300031251 | Bacteria | 18951 |
| 515 | Ga0265316_10022290 | 3300031344 | Bacteria | 5344 |
| 516 | Ga0307408_100279395 | 3300031548 | Bacteria | 1390 |
| 517 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 518 | Ga0265314_10072978 | 3300031711 | Bacteria | 2290 |
| 519 | Ga0307413_10020410 | 3300031824 | Bacteria | 3523 |
| 520 | Ga0307410_10002178 | 3300031852 | Bacteria | 9316 |
| 521 | Ga0307410_10034475 | 3300031852 | Bacteria | 3279 |
| 522 | Ga0307406_10004963 | 3300031901 | Bacteria | 7248 |
| 523 | Ga0307406_10143729 | 3300031901 | Bacteria | 1692 |
| 524 | Ga0307407_10240007 | 3300031903 | Bacteria | 1236 |
| 525 | Ga0307412_10033408 | 3300031911 | Bacteria | 3270 |
| 526 | Ga0307409_100005794 | 3300031995 | Bacteria | 7166 |
| 527 | Ga0307409_100056297 | 3300031995 | Bacteria | 3040 |
| 528 | Ga0307409_100120159 | 3300031995 | Bacteria | 2223 |
| 529 | Ga0307409_100137845 | 3300031995 | Bacteria | 2097 |
| 530 | Ga0307416_100007630 | 3300032002 | Bacteria | 6902 |
| 531 | Ga0307416_100047424 | 3300032002 | Bacteria | 3400 |
| 532 | Ga0307416_100094954 | 3300032002 | Bacteria | 2573 |
| 533 | Ga0307416_100107772 | 3300032002 | Bacteria | 2446 |
| 534 | Ga0307416_100134707 | 3300032002 | Bacteria | 2232 |
| 535 | Ga0307416_100402370 | 3300032002 | Bacteria | 1407 |
| 536 | Ga0307414_10157054 | 3300032004 | Bacteria | 1802 |
| 537 | Ga0307414_10294986 | 3300032004 | Bacteria | 1369 |
| 538 | Ga0307411_10057982 | 3300032005 | Bacteria | 2561 |
| 539 | Ga0307411_10187687 | 3300032005 | Bacteria | 1575 |
| 540 | Ga0307415_100002806 | 3300032126 | Bacteria | 8719 |
| 541 | Ga0307415_100015192 | 3300032126 | Bacteria | 4551 |
| 542 | Ga0307415_100051745 | 3300032126 | Bacteria | 2789 |
| 543 | Ga0307415_100065881 | 3300032126 | Bacteria | 2526 |
| 544 | Ga0307415_100196771 | 3300032126 | Bacteria | 1595 |
| 545 | Ga0307415_100276856 | 3300032126 | Bacteria | 1378 |
| 546 | Ga0307415_100423055 | 3300032126 | Bacteria | 1144 |
| 547 | Ga0373944_0037779 | 3300035089 | Bacteria | 1481 |
| 548 | Ga0373945_0011334 | 3300035116 | Bacteria | 2949 |
| 549 | Ga0373943_0000713 | 3300035170 | Bacteria | 14523 |
| 550 | Ga0373955_0168607 | 3300035172 | Bacteria | 1295 |
| 551 | Ga0373955_0206574 | 3300035172 | Bacteria | 1170 |
| 552 | Ga0316574_0133860 | 3300035398 | Bacteria | 1596 |
| 553 | Ga0373927_0029793 | 3300035695 | Bacteria | 3559 |
| 554 | Ga0373933_0256038 | 3300035724 | Bacteria | 1128 |
| 555 | Ga0373947_0015561 | 3300035725 | Bacteria | 4369 |
| 556 | Ga0373937_0025996 | 3300036401 | Bacteria | 5288 |
| 557 | Ga0395899_0323964 | 3300037312 | Bacteria | 1037 |
| 558 | Ga0395900_0032686 | 3300037418 | Bacteria | 5350 |
| 559 | Ga0395900_0037958 | 3300037418 | Bacteria | 4966 |
| 560 | Ga0395898_0002611 | 3300037466 | Bacteria | 21002 |
| 561 | Ga0395898_0023747 | 3300037466 | Bacteria | 6191 |
| 562 | Ga0395898_0043792 | 3300037466 | Bacteria | 4409 |
| 563 | Ga0395905_0076005 | 3300037471 | Bacteria | 3147 |
| 564 | Ga0395905_0095615 | 3300037471 | Bacteria | 2788 |
| 565 | Ga0395905_0372601 | 3300037471 | Bacteria | 1321 |
| 566 | Ga0436364_1123401 | 3300037853 | Bacteria | 2098 |
| 567 | Ga0395901_0043084 | 3300038443 | Bacteria | 4682 |
| 568 | Ga0395901_0077287 | 3300038443 | Bacteria | 3474 |
| 569 | Ga0395901_0081560 | 3300038443 | Bacteria | 3378 |
| 570 | Ga0395901_0098579 | 3300038443 | Bacteria | 3064 |
| 571 | Ga0436365_0190537 | 3300039437 | Bacteria | 23352 |
| 572 | Ga0436365_0654279 | 3300039437 | Bacteria | 8389 |
| 573 | Ga0436365_1156467 | 3300039437 | Bacteria | 1047 |
| 574 | Ga0436365_1162518 | 3300039437 | Bacteria | 3456 |
| 575 | Ga0436365_1168945 | 3300039437 | Bacteria | 1889 |
| 576 | Ga0436363_0013651 | 3300039450 | Bacteria | 1174 |
| 577 | Ga0436363_1008360 | 3300039450 | Bacteria | 1001 |
| 578 | Ga0436362_0315400 | 3300039453 | Bacteria | 1374 |
| 579 | Ga0436362_1121834 | 3300039453 | Bacteria | 955 |
| 580 | Ga0451807_2554897 | 3300041486 | Bacteria | 1833 |
| 581 | Ga0451833_0200162 | 3300041491 | Bacteria | 1569 |
| 582 | Ga0451837_1322243 | 3300041494 | Bacteria | 864 |
| 583 | Ga0439448_0058057 | 3300042005 | Bacteria | 1276 |
| 584 | Ga0439459_0005651 | 3300042438 | Bacteria | 2063 |
| 585 | Ga0466966_0041895 | 3300044684 | Bacteria | 2941 |
| 586 | Ga0466966_0104943 | 3300044684 | Bacteria | 1745 |
| 587 | Ga0466966_0254846 | 3300044684 | Bacteria | 1057 |
| 588 | Ga0466961_0003399 | 3300044693 | Bacteria | 9933 |
| 589 | Ga0466961_0055385 | 3300044693 | Bacteria | 2528 |
| 590 | Ga0466963_0000021 | 3300044694 | Bacteria | 53432 |
| 591 | Ga0466963_0010863 | 3300044694 | Bacteria | 5529 |
| 592 | Ga0466963_0014928 | 3300044694 | Bacteria | 4800 |
| 593 | Ga0466963_0024348 | 3300044694 | Bacteria | 3853 |
| 594 | Ga0466963_0025075 | 3300044694 | Bacteria | 3800 |
| 595 | Ga0466963_0028742 | 3300044694 | Bacteria | 3573 |
| 596 | Ga0466963_0029483 | 3300044694 | Bacteria | 3533 |
| 597 | Ga0466963_0050194 | 3300044694 | Bacteria | 2762 |
| 598 | Ga0466963_0091375 | 3300044694 | Bacteria | 2073 |
| 599 | Ga0466963_0181053 | 3300044694 | Bacteria | 1471 |
| 600 | Ga0466964_0083209 | 3300044706 | Bacteria | 1378 |
| 601 | Ga0466964_0114447 | 3300044706 | Bacteria | 1207 |
| 602 | Ga0466971_0001196 | 3300044719 | Bacteria | 10777 |
| 603 | Ga0466968_0025031 | 3300044735 | Bacteria | 2442 |
| 604 | Ga0466957_0003657 | 3300044842 | Bacteria | 8484 |
| 605 | Ga0466957_0004158 | 3300044842 | Bacteria | 8014 |
| 606 | Ga0466957_0006194 | 3300044842 | Bacteria | 6752 |
| 607 | Ga0466957_0016840 | 3300044842 | Bacteria | 4276 |
| 608 | Ga0466957_0047290 | 3300044842 | Bacteria | 2614 |
| 609 | Ga0466957_0201859 | 3300044842 | Bacteria | 1306 |
| 610 | Ga0466960_0131798 | 3300044901 | Bacteria | 1320 |
| 611 | Ga0466959_0001348 | 3300045049 | Bacteria | 14972 |
| 612 | Ga0466959_0051085 | 3300045049 | Bacteria | 3034 |
| 613 | Ga0466959_0076116 | 3300045049 | Bacteria | 2424 |
| 614 | Ga0466959_0093998 | 3300045049 | Bacteria | 2151 |
| 615 | Ga0466959_0125456 | 3300045049 | Bacteria | 1822 |
| 616 | Ga0466959_0155532 | 3300045049 | Bacteria | 1610 |
| 617 | Ga0466959_0191043 | 3300045049 | Bacteria | 1429 |
| 618 | Ga0466959_0234163 | 3300045049 | Bacteria | 1270 |
| 619 | Ga0466958_0047886 | 3300045836 | Bacteria | 2582 |
| 620 | Ga0466967_0000004 | 3300045976 | Bacteria | 155664 |
| 621 | Ga0466967_0001339 | 3300045976 | Bacteria | 14128 |
| 622 | Ga0466967_0001971 | 3300045976 | Bacteria | 12441 |
| 623 | Ga0466967_0013734 | 3300045976 | Bacteria | 6274 |
| 624 | Ga0466967_0017023 | 3300045976 | Bacteria | 5753 |
| 625 | Ga0466967_0023108 | 3300045976 | Bacteria | 5090 |
| 626 | Ga0466967_0026684 | 3300045976 | Bacteria | 4789 |
| 627 | Ga0466967_0049030 | 3300045976 | Bacteria | 3691 |
| 628 | Ga0466967_0049082 | 3300045976 | Bacteria | 3690 |
| 629 | Ga0466967_0104298 | 3300045976 | Bacteria | 2595 |
| 630 | Ga0466967_0592747 | 3300045976 | Bacteria | 1093 |
| 631 | Ga0495592_0000214 | 3300046454 | Bacteria | 49513 |
| 632 | Ga0495592_0121061 | 3300046454 | Bacteria | 1841 |
| 633 | Ga0495592_0320030 | 3300046454 | Bacteria | 1003 |
| 634 | Ga0495603_0000554 | 3300046455 | Bacteria | 20910 |
| 635 | Ga0495603_0015844 | 3300046455 | Bacteria | 4556 |
| 636 | Ga0495629_0000014 | 3300046459 | Bacteria | 201801 |
| 637 | Ga0495629_0009501 | 3300046459 | Bacteria | 7109 |
| 638 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 639 | Ga0495651_0283721 | 3300046462 | Bacteria | 1117 |
| 640 | Ga0495653_0000183 | 3300046463 | Bacteria | 51182 |
| 641 | Ga0495653_0046662 | 3300046463 | Bacteria | 3354 |
| 642 | Ga0495653_0081107 | 3300046463 | Bacteria | 2398 |
| 643 | Ga0495582_0000012 | 3300046473 | Bacteria | 112893 |
| 644 | Ga0495662_0000048 | 3300046476 | Bacteria | 41426 |
| 645 | Ga0495662_0003775 | 3300046476 | Bacteria | 7638 |
| 646 | Ga0495664_0000051 | 3300046477 | Bacteria | 59070 |
| 647 | Ga0495594_0000004 | 3300046499 | Bacteria | 195881 |
| 648 | Ga0495596_0041300 | 3300046500 | Bacteria | 1819 |
| 649 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 650 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 651 | Ga0495608_0001397 | 3300046511 | Bacteria | 17174 |
| 652 | Ga0495608_0005626 | 3300046511 | Bacteria | 8951 |
| 653 | Ga0495608_0008932 | 3300046511 | Bacteria | 7007 |
| 654 | Ga0495608_0053206 | 3300046511 | Bacteria | 2679 |
| 655 | Ga0495618_0000087 | 3300046514 | Bacteria | 66305 |
| 656 | Ga0495618_0148667 | 3300046514 | Bacteria | 1497 |
| 657 | Ga0495620_0000119 | 3300046515 | Bacteria | 63487 |
| 658 | Ga0495628_0000070 | 3300046516 | Bacteria | 80592 |
| 659 | Ga0495628_0002369 | 3300046516 | Bacteria | 17011 |
| 660 | Ga0495628_0015291 | 3300046516 | Bacteria | 6411 |
| 661 | Ga0495628_0073196 | 3300046516 | Bacteria | 2670 |
| 662 | Ga0495628_0116833 | 3300046516 | Bacteria | 2049 |
| 663 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 664 | Ga0495630_0000312 | 3300046517 | Bacteria | 38816 |
| 665 | Ga0495630_0048552 | 3300046517 | Bacteria | 3177 |
| 666 | Ga0495630_0105735 | 3300046517 | Bacteria | 2131 |
| 667 | Ga0495644_0000296 | 3300046523 | Bacteria | 23051 |
| 668 | Ga0495652_0000066 | 3300046529 | Bacteria | 109895 |
| 669 | Ga0495652_0002702 | 3300046529 | Bacteria | 18014 |
| 670 | Ga0495652_0200363 | 3300046529 | Bacteria | 1515 |
| 671 | Ga0495640_0008753 | 3300046533 | Bacteria | 7928 |
| 672 | Ga0495640_0018734 | 3300046533 | Bacteria | 5124 |
| 673 | Ga0495640_0053417 | 3300046533 | Bacteria | 2770 |
| 674 | Ga0495640_0205518 | 3300046533 | Bacteria | 1247 |
| 675 | Ga0495586_0000338 | 3300046535 | Bacteria | 29347 |
| 676 | Ga0495587_0000446 | 3300046536 | Bacteria | 28865 |
| 677 | Ga0495587_0066124 | 3300046536 | Bacteria | 2109 |
| 678 | Ga0495587_0077002 | 3300046536 | Bacteria | 1937 |
| 679 | Ga0495598_0000768 | 3300046537 | Bacteria | 6117 |
| 680 | Ga0495621_0023623 | 3300046539 | Bacteria | 2046 |
| 681 | Ga0495645_0029053 | 3300046543 | Bacteria | 4018 |
| 682 | Ga0495645_0029487 | 3300046543 | Bacteria | 3991 |
| 683 | Ga0495645_0362505 | 3300046543 | Bacteria | 931 |
| 684 | Ga0495622_0000016 | 3300046557 | Bacteria | 177089 |
| 685 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 686 | Ga0495667_0009604 | 3300046559 | Bacteria | 6559 |
| 687 | Ga0495667_0167718 | 3300046559 | Bacteria | 1411 |
| 688 | Ga0495656_0000226 | 3300046615 | Bacteria | 19944 |
| 689 | Ga0495656_0033783 | 3300046615 | Bacteria | 2090 |
| 690 | Ga0495634_0000187 | 3300046642 | Bacteria | 57203 |
| 691 | Ga0495634_0000755 | 3300046642 | Bacteria | 31302 |
| 692 | Ga0495634_0026143 | 3300046642 | Bacteria | 4076 |
| 693 | Ga0495634_0028471 | 3300046642 | Bacteria | 3877 |
| 694 | Ga0495634_0034002 | 3300046642 | Bacteria | 3499 |
| 695 | Ga0495634_0186448 | 3300046642 | Bacteria | 1296 |
| 696 | Ga0495625_0000020 | 3300046660 | Bacteria | 290440 |
| 697 | Ga0495635_0000036 | 3300046663 | Bacteria | 95138 |
| 698 | Ga0495635_0048772 | 3300046663 | Bacteria | 2919 |
| 699 | Ga0495635_0057868 | 3300046663 | Bacteria | 2667 |
| 700 | Ga0495635_0150255 | 3300046663 | Bacteria | 1585 |
| 701 | Ga0495588_0000217 | 3300046674 | Bacteria | 54461 |
| 702 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 703 | Ga0495657_0014465 | 3300046675 | Bacteria | 5793 |
| 704 | Ga0495657_0021818 | 3300046675 | Bacteria | 4594 |
| 705 | Ga0495599_0007160 | 3300046678 | Bacteria | 6754 |
| 706 | Ga0495646_0050297 | 3300046680 | Bacteria | 2527 |
| 707 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 708 | Ga0495647_0002426 | 3300046681 | Bacteria | 5868 |
| 709 | Ga0495658_0000024 | 3300046683 | Bacteria | 81300 |
| 710 | Ga0495658_0030522 | 3300046683 | Bacteria | 2927 |
| 711 | Ga0495669_0000251 | 3300046684 | Bacteria | 31256 |
| 712 | Ga0495613_0000040 | 3300046689 | Bacteria | 131633 |
| 713 | Ga0495613_0000159 | 3300046689 | Bacteria | 65969 |
| 714 | Ga0495613_0118969 | 3300046689 | Bacteria | 1898 |
| 715 | Ga0495613_0295406 | 3300046689 | Bacteria | 1122 |
| 716 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 717 | Ga0495624_0001178 | 3300046690 | Bacteria | 20710 |
| 718 | Ga0495624_0041563 | 3300046690 | Bacteria | 2940 |
| 719 | Ga0495624_0066395 | 3300046690 | Bacteria | 2252 |
| 720 | Ga0495670_0003761 | 3300046691 | Bacteria | 7462 |
| 721 | Ga0495649_0001084 | 3300046694 | Bacteria | 21240 |
| 722 | Ga0495589_0092184 | 3300046794 | Bacteria | 1471 |
| 723 | Ga0495600_0002351 | 3300046809 | Bacteria | 10794 |
| 724 | Ga0495600_0026502 | 3300046809 | Bacteria | 3741 |
| 725 | Ga0495600_0219863 | 3300046809 | Bacteria | 1215 |
| 726 | Ga0495581_0167208 | 3300047315 | Bacteria | 1286 |
| 727 | Ga0495604_0000802 | 3300047317 | Bacteria | 26433 |
| 728 | Ga0495604_0001037 | 3300047317 | Bacteria | 23128 |
| 729 | Ga0495604_0003372 | 3300047317 | Bacteria | 12743 |
| 730 | Ga0495604_0028259 | 3300047317 | Bacteria | 4461 |
| 731 | Ga0495604_0063409 | 3300047317 | Bacteria | 2819 |
| 732 | Ga0495674_0000025 | 3300047319 | Bacteria | 141103 |
| 733 | Ga0495674_0137093 | 3300047319 | Bacteria | 2058 |
| 734 | Ga0495672_0001687 | 3300047320 | Bacteria | 21390 |
| 735 | Ga0495672_0133030 | 3300047320 | Bacteria | 1306 |
| 736 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 737 | Ga0495676_0000252 | 3300047321 | Bacteria | 43212 |
| 738 | Ga0495676_0007581 | 3300047321 | Bacteria | 9947 |
| 739 | Ga0495676_0093228 | 3300047321 | Bacteria | 2246 |
| 740 | Ga0495676_0132289 | 3300047321 | Bacteria | 1799 |
| 741 | Ga0495676_0189322 | 3300047321 | Bacteria | 1436 |
| 742 | Ga0495680_0000286 | 3300047322 | Bacteria | 56839 |
| 743 | Ga0495680_0000741 | 3300047322 | Bacteria | 36581 |
| 744 | Ga0495680_0043784 | 3300047322 | Bacteria | 3542 |
| 745 | Ga0495680_0050805 | 3300047322 | Bacteria | 3240 |
| 746 | Ga0495680_0110271 | 3300047322 | Bacteria | 2040 |
| 747 | Ga0495675_0000019 | 3300047444 | Bacteria | 113641 |
| 748 | Ga0495679_010847 | 3300047446 | Bacteria | 3554 |
| 749 | Ga0495686_0031778 | 3300047472 | Bacteria | 3420 |
| 750 | Ga0495593_0188526 | 3300047673 | Bacteria | 1038 |
| 751 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 752 | Ga0495602_0001188 | 3300048088 | Bacteria | 25566 |
| 753 | Ga0495602_0052140 | 3300048088 | Bacteria | 3636 |
| 754 | Ga0495602_0191644 | 3300048088 | Bacteria | 1567 |
| 755 | Ga0495614_0068210 | 3300048089 | Bacteria | 1531 |
| 756 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 757 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 758 | Ga0496100_0014322 | 3300048903 | Bacteria | 4602 |
| 759 | Ga0496100_0062957 | 3300048903 | Bacteria | 2450 |
| 760 | Ga0496100_0142244 | 3300048903 | Bacteria | 1702 |
| 761 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 762 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 763 | Ga0496101_0001927 | 3300048904 | Bacteria | 12559 |
| 764 | Ga0496101_0140244 | 3300048904 | Bacteria | 1842 |
| 765 | Ga0496101_0162034 | 3300048904 | Bacteria | 1716 |
| 766 | Ga0496101_0340737 | 3300048904 | Bacteria | 1177 |
| 767 | Ga0496102_0000054 | 3300048905 | Bacteria | 175565 |
| 768 | Ga0496102_0004675 | 3300048905 | Bacteria | 11583 |
| 769 | Ga0496102_0049833 | 3300048905 | Bacteria | 3811 |
| 770 | Ga0496102_0211415 | 3300048905 | Bacteria | 1829 |
| 771 | Ga0496102_0457739 | 3300048905 | Bacteria | 1197 |
| 772 | Ga0496103_0000016 | 3300048906 | Bacteria | 266127 |
| 773 | Ga0496103_0000178 | 3300048906 | Bacteria | 64984 |
| 774 | Ga0496103_0043658 | 3300048906 | Bacteria | 2760 |
| 775 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 776 | Ga0496104_0000030 | 3300048907 | Bacteria | 201919 |
| 777 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 778 | Ga0496104_0126525 | 3300048907 | Bacteria | 2454 |
| 779 | Ga0496104_0140661 | 3300048907 | Bacteria | 2318 |
| 780 | Ga0496104_0172149 | 3300048907 | Bacteria | 2076 |
| 781 | Ga0496104_0350445 | 3300048907 | Bacteria | 1389 |
| 782 | Ga0496105_0000031 | 3300048908 | Bacteria | 137220 |
| 783 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 784 | Ga0496105_0125436 | 3300048908 | Bacteria | 2116 |
| 785 | Ga0496105_0184314 | 3300048908 | Bacteria | 1708 |
| 786 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 787 | Ga0496106_0000052 | 3300048909 | Bacteria | 94849 |
| 788 | Ga0496106_0000086 | 3300048909 | Bacteria | 73933 |
| 789 | Ga0496106_0003356 | 3300048909 | Bacteria | 11937 |
| 790 | Ga0496106_0025678 | 3300048909 | Bacteria | 4386 |
| 791 | Ga0496106_0058661 | 3300048909 | Bacteria | 2914 |
| 792 | Ga0496106_0094150 | 3300048909 | Bacteria | 2316 |
| 793 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 794 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 795 | Ga0496107_0195485 | 3300048910 | Bacteria | 1503 |
| 796 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 797 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 798 | Ga0496108_0000153 | 3300048911 | Bacteria | 66080 |
| 799 | Ga0496108_0049252 | 3300048911 | Bacteria | 3524 |
| 800 | Ga0496108_0051614 | 3300048911 | Bacteria | 3445 |
| 801 | Ga0496108_0088992 | 3300048911 | Bacteria | 2624 |
| 802 | Ga0496108_0157061 | 3300048911 | Bacteria | 1964 |
| 803 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 804 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 805 | Ga0496109_0000146 | 3300048912 | Bacteria | 69777 |
| 806 | Ga0496109_0000300 | 3300048912 | Bacteria | 46637 |
| 807 | Ga0496109_0010926 | 3300048912 | Bacteria | 7778 |
| 808 | Ga0496109_0070473 | 3300048912 | Bacteria | 3208 |
| 809 | Ga0496109_0108128 | 3300048912 | Bacteria | 2584 |
| 810 | Ga0496109_0143526 | 3300048912 | Bacteria | 2233 |
| 811 | Ga0496109_0259079 | 3300048912 | Bacteria | 1638 |
| 812 | Ga0496109_0326582 | 3300048912 | Bacteria | 1448 |
| 813 | Ga0496109_0362265 | 3300048912 | Bacteria | 1370 |
| 814 | Ga0496109_0392349 | 3300048912 | Bacteria | 1311 |
| 815 | Ga0496109_0511769 | 3300048912 | Bacteria | 1133 |
| 816 | Ga0496110_0000008 | 3300048913 | Bacteria | 113408 |
| 817 | Ga0496110_0000023 | 3300048913 | Bacteria | 75802 |
| 818 | Ga0496110_0000230 | 3300048913 | Bacteria | 36192 |
| 819 | Ga0496110_0003088 | 3300048913 | Bacteria | 12630 |
| 820 | Ga0496110_0037066 | 3300048913 | Bacteria | 4237 |
| 821 | Ga0496110_0047861 | 3300048913 | Bacteria | 3746 |
| 822 | Ga0496110_0071809 | 3300048913 | Bacteria | 3070 |
| 823 | Ga0496110_0138177 | 3300048913 | Bacteria | 2203 |
| 824 | Ga0496110_0169062 | 3300048913 | Bacteria | 1983 |
| 825 | Ga0496110_0185505 | 3300048913 | Bacteria | 1889 |
| 826 | Ga0496111_0000004 | 3300048914 | Bacteria | 116115 |
| 827 | Ga0496111_0000016 | 3300048914 | Bacteria | 77108 |
| 828 | Ga0496111_0000181 | 3300048914 | Bacteria | 28684 |
| 829 | Ga0496111_0061425 | 3300048914 | Bacteria | 2724 |
| 830 | Ga0496111_0137594 | 3300048914 | Bacteria | 1810 |
| 831 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 832 | Ga0496112_0001445 | 3300048915 | Bacteria | 18234 |
| 833 | Ga0496112_0192679 | 3300048915 | Bacteria | 1999 |
| 834 | Ga0496113_0000003 | 3300048916 | Bacteria | 123519 |
| 835 | Ga0496113_0006959 | 3300048916 | Bacteria | 7228 |
| 836 | Ga0496113_0111989 | 3300048916 | Bacteria | 2125 |
| 837 | Ga0496113_0305065 | 3300048916 | Bacteria | 1275 |
| 838 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 839 | Ga0496114_0026192 | 3300048917 | Bacteria | 4773 |
| 840 | Ga0496115_0000074 | 3300048918 | Bacteria | 90267 |
| 841 | Ga0496115_0000212 | 3300048918 | Bacteria | 53976 |
| 842 | Ga0496115_0001537 | 3300048918 | Bacteria | 16551 |
| 843 | Ga0496115_0029926 | 3300048918 | Bacteria | 4281 |
| 844 | Ga0496115_0147686 | 3300048918 | Bacteria | 1941 |
| 845 | Ga0496115_0298124 | 3300048918 | Bacteria | 1321 |
| 846 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 847 | Ga0496117_0001369 | 3300048920 | Bacteria | 35534 |
| 848 | Ga0496118_0000389 | 3300048921 | Bacteria | 74298 |
| 849 | Ga0496118_0019280 | 3300048921 | Bacteria | 6103 |
| 850 | Ga0496119_0000937 | 3300048922 | Bacteria | 37582 |
| 851 | Ga0496119_0004788 | 3300048922 | Bacteria | 13285 |
| 852 | Ga0496119_0072208 | 3300048922 | Bacteria | 2017 |
| 853 | Ga0496120_0004305 | 3300048923 | Bacteria | 12065 |
| 854 | Ga0496121_0071566 | 3300048924 | Bacteria | 2788 |
| 855 | Ga0496124_0044254 | 3300048927 | Bacteria | 3821 |
| 856 | Ga0496124_0071588 | 3300048927 | Bacteria | 2873 |
| 857 | Ga0496124_0191086 | 3300048927 | Bacteria | 1567 |
| 858 | Ga0501031_0000172 | 3300049568 | Bacteria | 36896 |
| 859 | Ga0501031_0163505 | 3300049568 | Bacteria | 1455 |
| 860 | Ga0501032_0000902 | 3300049569 | Bacteria | 24083 |
| 861 | Ga0501033_0000211 | 3300049570 | Bacteria | 55768 |
| 862 | Ga0501034_0003939 | 3300049571 | Bacteria | 16683 |
| 863 | Ga0501036_0000841 | 3300049572 | Bacteria | 22831 |
| 864 | Ga0501036_0067898 | 3300049572 | Bacteria | 3017 |
| 865 | Ga0501036_0264390 | 3300049572 | Bacteria | 1441 |
| 866 | Ga0501037_0000120 | 3300049573 | Bacteria | 73352 |
| 867 | Ga0501038_0000139 | 3300049574 | Bacteria | 62162 |
| 868 | Ga0501039_0006697 | 3300049575 | Bacteria | 8762 |
| 869 | Ga0501039_0032649 | 3300049575 | Bacteria | 4014 |
| 870 | Ga0501039_0067117 | 3300049575 | Bacteria | 2786 |
| 871 | Ga0501040_0065586 | 3300049576 | Bacteria | 2501 |
| 872 | Ga0501040_0079999 | 3300049576 | Bacteria | 2263 |
| 873 | Ga0501040_0095431 | 3300049576 | Bacteria | 2070 |
| 874 | Ga0501040_0199644 | 3300049576 | Bacteria | 1420 |
| 875 | Ga0501040_0250144 | 3300049576 | Bacteria | 1264 |
| 876 | Ga0501040_0261644 | 3300049576 | Bacteria | 1235 |
| 877 | Ga0501041_0092304 | 3300049577 | Bacteria | 1870 |
| 878 | Ga0501041_0105319 | 3300049577 | Bacteria | 1748 |
| 879 | Ga0501042_0075317 | 3300049578 | Bacteria | 2415 |
| 880 | Ga0501042_0109156 | 3300049578 | Bacteria | 1992 |
| 881 | Ga0501043_0000203 | 3300049579 | Bacteria | 54330 |
| 882 | Ga0501046_0000194 | 3300049580 | Bacteria | 62330 |
| 883 | Ga0501047_0000287 | 3300049581 | Bacteria | 58087 |
| 884 | Ga0501047_0319929 | 3300049581 | Bacteria | 1391 |
| 885 | Ga0501047_0445751 | 3300049581 | Bacteria | 1124 |
| 886 | Ga0501048_0000004 | 3300049582 | Bacteria | 100672 |
| 887 | Ga0501067_0001412 | 3300049583 | Bacteria | 13020 |
| 888 | Ga0501068_0003838 | 3300049584 | Bacteria | 8153 |
| 889 | Ga0501068_0159455 | 3300049584 | Bacteria | 1422 |
| 890 | Ga0501069_0006081 | 3300049585 | Bacteria | 6300 |
| 891 | Ga0501069_0054695 | 3300049585 | Bacteria | 2222 |
| 892 | Ga0501070_0000049 | 3300049586 | Bacteria | 104564 |
| 893 | Ga0501070_0000079 | 3300049586 | Bacteria | 82054 |
| 894 | Ga0501070_0022040 | 3300049586 | Bacteria | 5336 |
| 895 | Ga0501070_0156923 | 3300049586 | Bacteria | 1876 |
| 896 | Ga0501070_0167579 | 3300049586 | Bacteria | 1810 |
| 897 | Ga0501070_0297713 | 3300049586 | Bacteria | 1315 |
| 898 | Ga0501070_0388116 | 3300049586 | Bacteria | 1130 |
| 899 | Ga0501071_0025386 | 3300049587 | Bacteria | 4151 |
| 900 | Ga0501072_0010167 | 3300049588 | Bacteria | 7166 |
| 901 | Ga0501072_0047989 | 3300049588 | Bacteria | 3363 |
| 902 | Ga0501074_0005099 | 3300049590 | Bacteria | 9433 |
| 903 | Ga0501074_0013310 | 3300049590 | Bacteria | 5982 |
| 904 | Ga0501074_0066081 | 3300049590 | Bacteria | 2602 |
| 905 | Ga0501074_0071035 | 3300049590 | Bacteria | 2502 |
| 906 | Ga0501074_0092709 | 3300049590 | Bacteria | 2163 |
| 907 | Ga0501075_0000598 | 3300049591 | Bacteria | 22031 |
| 908 | Ga0501075_0058435 | 3300049591 | Bacteria | 2905 |
| 909 | Ga0501075_0135260 | 3300049591 | Bacteria | 1878 |
| 910 | Ga0501075_0170598 | 3300049591 | Bacteria | 1660 |
| 911 | Ga0501075_0362475 | 3300049591 | Bacteria | 1105 |
| 912 | Ga0501076_0003024 | 3300049592 | Bacteria | 11684 |
| 913 | Ga0501076_0098986 | 3300049592 | Bacteria | 2349 |
| 914 | Ga0501077_0013588 | 3300049593 | Bacteria | 5104 |
| 915 | Ga0501077_0202885 | 3300049593 | Bacteria | 1260 |
| 916 | Ga0501079_0000318 | 3300049741 | Bacteria | 30235 |
| 917 | Ga0501079_0005061 | 3300049741 | Bacteria | 9786 |
| 918 | Ga0501079_0033296 | 3300049741 | Bacteria | 3964 |
| 919 | Ga0501079_0126989 | 3300049741 | Bacteria | 1984 |
| 920 | Ga0501079_0249703 | 3300049741 | Bacteria | 1387 |
| 921 | Ga0501079_0615565 | 3300049741 | Bacteria | 855 |
| 922 | Ga0501080_0004716 | 3300049742 | Bacteria | 12163 |
| 923 | Ga0501080_0039515 | 3300049742 | Bacteria | 4403 |
| 924 | Ga0501080_0226721 | 3300049742 | Bacteria | 1708 |
| 925 | Ga0501080_0540419 | 3300049742 | Bacteria | 1039 |
| 926 | Ga0501081_0222113 | 3300049743 | Bacteria | 1374 |
| 927 | Ga0501081_0471883 | 3300049743 | Bacteria | 933 |
| 928 | Ga0501083_0008391 | 3300049744 | Bacteria | 7305 |
| 929 | Ga0501083_0019756 | 3300049744 | Bacteria | 4688 |
| 930 | Ga0501083_0205086 | 3300049744 | Bacteria | 1286 |
| 931 | Ga0501083_0274270 | 3300049744 | Bacteria | 1097 |
| 932 | Ga0501035_0000059 | 3300049822 | Bacteria | 134506 |
| 933 | Ga0501044_0001354 | 3300049823 | Bacteria | 28756 |
| 934 | Ga0501044_0065596 | 3300049823 | Bacteria | 3702 |
| 935 | Ga0501045_0029237 | 3300049824 | Bacteria | 3982 |
| 936 | Ga0501045_0162884 | 3300049824 | Bacteria | 1661 |
| 937 | nmdc:mga00v17_152267_c1 | 3300050491 | Bacteria | 1486 |
| 938 | nmdc:mga0yw44_152049_c1 | 3300050492 | Bacteria | 1510 |
| 939 | nmdc:mga0yw44_196092_c1 | 3300050492 | Bacteria | 1333 |
| 940 | nmdc:mga0yw44_231_c1 | 3300050492 | Bacteria | 19110 |
| 941 | nmdc:mga0yw44_276040_c1 | 3300050492 | Bacteria | 1123 |
| 942 | nmdc:mga0yw44_89934_c1 | 3300050492 | Bacteria | 1938 |
| 943 | nmdc:mga05p37_1079737_c1 | 3300050507 | Bacteria | 843 |
| 944 | nmdc:mga05p37_179704_c1 | 3300050507 | Bacteria | 2575 |
| 945 | nmdc:mga05p37_2220_c1 | 3300050507 | Bacteria | 19240 |
| 946 | nmdc:mga05p37_347856_c1 | 3300050507 | Bacteria | 1746 |
| 947 | nmdc:mga05p37_90274_c1 | 3300050507 | Bacteria | 3776 |
| 948 | nmdc:mga05p37_95327_c1 | 3300050507 | Bacteria | 3666 |
| 949 | nmdc:mga09592_1226_c2 | 3300050508 | Bacteria | 19678 |
| 950 | nmdc:mga09592_127940_c1 | 3300050508 | Bacteria | 2184 |
| 951 | nmdc:mga09592_173788_c1 | 3300050508 | Bacteria | 1863 |
| 952 | nmdc:mga0qj67_32858_c1 | 3300050509 | Bacteria | 4047 |
| 953 | nmdc:mga06r32_429255_c1 | 3300050510 | Bacteria | 1302 |
| 954 | nmdc:mga06r32_70499_c1 | 3300050510 | Bacteria | 3380 |
| 955 | nmdc:mga08y16_27710_c1 | 3300050511 | Bacteria | 5969 |
| 956 | nmdc:mga08y16_419449_c1 | 3300050511 | Bacteria | 1368 |
| 957 | nmdc:mga08y16_620079_c1 | 3300050511 | Bacteria | 1089 |
| 958 | nmdc:mga0n895_255599_c1 | 3300050512 | Bacteria | 1778 |
| 959 | nmdc:mga0rr50_248220_c1 | 3300050513 | Bacteria | 1477 |
| 960 | nmdc:mga0rr50_68950_c1 | 3300050513 | Bacteria | 2690 |
| 961 | nmdc:mga0rr50_77688_c1 | 3300050513 | Bacteria | 2552 |
| 962 | nmdc:mga08x19_71518_c1 | 3300050514 | Bacteria | 2262 |
| 963 | nmdc:mga0a205_320751_c1 | 3300050515 | Bacteria | 1420 |
| 964 | nmdc:mga0a205_4209_c1 | 3300050515 | Bacteria | 12901 |
| 965 | nmdc:mga0a205_47748_c1 | 3300050515 | Bacteria | 4131 |
| 966 | nmdc:mga0a205_58885_c1 | 3300050515 | Bacteria | 3710 |
| 967 | nmdc:mga0a205_9_c2 | 3300050515 | Bacteria | 69167 |
| 968 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 969 | Ga0495601_0000344 | 3300053077 | Bacteria | 24491 |
| 970 | Ga0495601_0008897 | 3300053077 | Bacteria | 5925 |
| 971 | Ga0495601_0012016 | 3300053077 | Bacteria | 5188 |
| 972 | Ga0495601_0053210 | 3300053077 | Bacteria | 2558 |
| 973 | Ga0495601_0063512 | 3300053077 | Bacteria | 2347 |
| 974 | Ga0495612_0000100 | 3300053078 | Bacteria | 37132 |
| 975 | Ga0495612_0000403 | 3300053078 | Bacteria | 17309 |
| 976 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 977 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 978 | Ga0495595_0000251 | 3300053084 | Bacteria | 21266 |
| 979 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 980 | Ga0495619_0000020 | 3300053085 | Bacteria | 201556 |
| 981 | Ga0495619_0000046 | 3300053085 | Bacteria | 104451 |
| 982 | Ga0495619_0000626 | 3300053085 | Bacteria | 23392 |
| 983 | Ga0495619_0049830 | 3300053085 | Bacteria | 2763 |
| 984 | Ga0495619_0053161 | 3300053085 | Bacteria | 2678 |
| 985 | Ga0495619_0126366 | 3300053085 | Bacteria | 1755 |
| 986 | Ga0500566_0001971 | 3300053094 | Bacteria | 12098 |
| 987 | Ga0500641_0009337 | 3300053096 | Bacteria | 3527 |
| 988 | Ga0500554_020941 | 3300053102 | Bacteria | 1805 |
| 989 | Ga0500614_000039 | 3300053123 | Bacteria | 28194 |
| 990 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 991 | Ga0501084_0135654 | 3300054114 | Bacteria | 2072 |
| 992 | Ga0501084_0138999 | 3300054114 | Bacteria | 2045 |
| 993 | Ga0501084_0217970 | 3300054114 | Bacteria | 1610 |
| 994 | Ga0587070_006567 | 3300059491 | Bacteria | 1575 |
| 995 | Ga0587077_009254 | 3300059493 | Bacteria | 1491 |
| 996 | Ga0587085_010233 | 3300059506 | Bacteria | 1241 |
| 997 | Ga0587111_0027391 | 3300060346 | Bacteria | 1142 |
| 998 | Ga0501082_0004892 | 3300060353 | Bacteria | 11685 |
| 999 | Ga0501082_0119820 | 3300060353 | Bacteria | 2281 |
| 1000 | Ga0466962_0000706 | 3300061719 | Bacteria | 14858 |
| 1001 | Ga0466962_0026097 | 3300061719 | Bacteria | 2806 |
| 1002 | Ga0466962_0133586 | 3300061719 | Bacteria | 1200 |
| 1003 | Ga0530510_0003575 | 3300061734 | Bacteria | 10704 |
| 1004 | Ga0530510_0008860 | 3300061734 | Bacteria | 7041 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1168945 | Ga0436365_1168945_1138_1845 | 226 |
| 2 | 3300045049 | Ga0466959_0125456 | Ga0466959_0125456_625_1320 | 226 |
| 3 | 3300005981 | Ga0081538_10085412 | Ga0081538_100854122 | 233 |
| 4 | 3300006028 | Ga0070717_10178733 | Ga0070717_101787332 | 236 |
| 5 | 3300025929 | Ga0207664_10128030 | Ga0207664_101280302 | 236 |
| 6 | 3300031247 | Ga0265340_10069051 | Ga0265340_100690512 | 236 |
| 7 | 3300035116 | Ga0373945_0011334 | Ga0373945_0011334_2080_2877 | 236 |
| 8 | 3300035172 | Ga0373955_0206574 | Ga0373955_0206574_351_1142 | 236 |
| 9 | 3300046454 | Ga0495592_0320030 | Ga0495592_0320030_13_804 | 236 |
| 10 | 3300046462 | Ga0495651_0283721 | Ga0495651_0283721_181_972 | 236 |
| 11 | 3300046511 | Ga0495608_0008932 | Ga0495608_0008932_4532_5323 | 236 |
| 12 | 3300046533 | Ga0495640_0205518 | Ga0495640_0205518_355_1146 | 236 |
| 13 | 3300046536 | Ga0495587_0066124 | Ga0495587_0066124_344_1135 | 236 |
| 14 | 3300046543 | Ga0495645_0362505 | Ga0495645_0362505_91_882 | 236 |
| 15 | 3300046559 | Ga0495667_0009604 | Ga0495667_0009604_5532_6323 | 236 |
| 16 | 3300046642 | Ga0495634_0028471 | Ga0495634_0028471_2140_3027 | 236 |
| 17 | 3300046690 | Ga0495624_0041563 | Ga0495624_0041563_1985_2776 | 236 |
| 18 | 3300047317 | Ga0495604_0028259 | Ga0495604_0028259_534_1325 | 236 |
| 19 | 3300048088 | Ga0495602_0052140 | Ga0495602_0052140_2675_3466 | 236 |
| 20 | 3300053077 | Ga0495601_0063512 | Ga0495601_0063512_474_1265 | 236 |
| 21 | 3300003373 | JGI25407J50210_10002380 | JGI25407J50210_100023804 | 237 |
| 22 | 3300005327 | Ga0070658_10016326 | Ga0070658_100163267 | 237 |
| 23 | 3300005329 | Ga0070683_100008892 | Ga0070683_1000088923 | 237 |
| 24 | 3300005336 | Ga0070680_100008814 | Ga0070680_1000088143 | 237 |
| 25 | 3300005339 | Ga0070660_100006612 | Ga0070660_1000066125 | 237 |
| 26 | 3300005458 | Ga0070681_10016470 | Ga0070681_100164703 | 237 |
| 27 | 3300005471 | Ga0070698_100119204 | Ga0070698_1001192043 | 237 |
| 28 | 3300005530 | Ga0070679_100117690 | Ga0070679_1001176903 | 237 |
| 29 | 3300005535 | Ga0070684_100051215 | Ga0070684_1000512155 | 237 |
| 30 | 3300005563 | Ga0068855_100175616 | Ga0068855_1001756162 | 237 |
| 31 | 3300005981 | Ga0081538_10000013 | Ga0081538_10000013104 | 237 |
| 32 | 3300009093 | Ga0105240_10146315 | Ga0105240_101463154 | 237 |
| 33 | 3300013104 | Ga0157370_10004749 | Ga0157370_100047499 | 237 |
| 34 | 3300020070 | Ga0206356_11146824 | Ga0206356_111468242 | 237 |
| 35 | 3300025909 | Ga0207705_10015960 | Ga0207705_100159602 | 237 |
| 36 | 3300025917 | Ga0207660_10027681 | Ga0207660_100276812 | 237 |
| 37 | 3300025919 | Ga0207657_10000902 | Ga0207657_1000090228 | 237 |
| 38 | 3300025921 | Ga0207652_10043446 | Ga0207652_100434465 | 237 |
| 39 | 3300025944 | Ga0207661_10087907 | Ga0207661_100879073 | 237 |
| 40 | 3300025949 | Ga0207667_10017232 | Ga0207667_100172322 | 237 |
| 41 | 3300048912 | Ga0496109_0326582 | Ga0496109_0326582_237_1148 | 237 |
| 42 | 3300044694 | Ga0466963_0181053 | Ga0466963_0181053_290_1081 | 238 |
| 43 | 3300048912 | Ga0496109_0392349 | Ga0496109_0392349_48_908 | 238 |
| 44 | 3300048922 | Ga0496119_0004788 | Ga0496119_0004788_12441_13274 | 238 |
| 45 | 3300049586 | Ga0501070_0000049 | Ga0501070_0000049_11135_11926 | 238 |
| 46 | 3300049744 | Ga0501083_0205086 | Ga0501083_0205086_416_1204 | 238 |
| 47 | 3300050492 | nmdc:mga0yw44_89934_c1 | nmdc:mga0yw44_89934_c1_550_1377 | 238 |
| 48 | 3300005338 | Ga0068868_100444473 | Ga0068868_1004444732 | 239 |
| 49 | 3300005535 | Ga0070684_100022491 | Ga0070684_1000224912 | 239 |
| 50 | 3300005535 | Ga0070684_100302559 | Ga0070684_1003025592 | 239 |
| 51 | 3300005563 | Ga0068855_100297589 | Ga0068855_1002975892 | 239 |
| 52 | 3300013104 | Ga0157370_10128496 | Ga0157370_101284962 | 239 |
| 53 | 3300025909 | Ga0207705_10053833 | Ga0207705_100538331 | 239 |
| 54 | 3300025941 | Ga0207711_10376413 | Ga0207711_103764132 | 239 |
| 55 | 3300025944 | Ga0207661_10075426 | Ga0207661_100754263 | 239 |
| 56 | 3300025944 | Ga0207661_10259646 | Ga0207661_102596462 | 239 |
| 57 | 3300025949 | Ga0207667_10221789 | Ga0207667_102217892 | 239 |
| 58 | 3300035398 | Ga0316574_0133860 | Ga0316574_0133860_391_1239 | 239 |
| 59 | 3300037853 | Ga0436364_1123401 | Ga0436364_1123401_350_1138 | 239 |
| 60 | 3300044694 | Ga0466963_0014928 | Ga0466963_0014928_537_1325 | 239 |
| 61 | 3300044842 | Ga0466957_0003657 | Ga0466957_0003657_2687_3475 | 239 |
| 62 | 3300045976 | Ga0466967_0001971 | Ga0466967_0001971_7416_8204 | 239 |
| 63 | 3300045976 | Ga0466967_0013734 | Ga0466967_0013734_1666_2454 | 239 |
| 64 | 3300045976 | Ga0466967_0023108 | Ga0466967_0023108_1906_2694 | 239 |
| 65 | 3300048903 | Ga0496100_0062957 | Ga0496100_0062957_1224_2015 | 239 |
| 66 | 3300048904 | Ga0496101_0340737 | Ga0496101_0340737_89_880 | 239 |
| 67 | 3300048907 | Ga0496104_0126525 | Ga0496104_0126525_1237_2028 | 239 |
| 68 | 3300048911 | Ga0496108_0049252 | Ga0496108_0049252_1533_2324 | 239 |
| 69 | 3300048911 | Ga0496108_0088992 | Ga0496108_0088992_1168_1959 | 239 |
| 70 | 3300048912 | Ga0496109_0259079 | Ga0496109_0259079_651_1442 | 239 |
| 71 | 3300048913 | Ga0496110_0071809 | Ga0496110_0071809_2211_3002 | 239 |
| 72 | 3300048913 | Ga0496110_0185505 | Ga0496110_0185505_669_1460 | 239 |
| 73 | 3300048918 | Ga0496115_0298124 | Ga0496115_0298124_151_939 | 239 |
| 74 | 3300049583 | Ga0501067_0001412 | Ga0501067_0001412_6745_7533 | 239 |
| 75 | 3300049585 | Ga0501069_0006081 | Ga0501069_0006081_1559_2347 | 239 |
| 76 | 3300049586 | Ga0501070_0167579 | Ga0501070_0167579_949_1737 | 239 |
| 77 | 3300061734 | Ga0530510_0008860 | Ga0530510_0008860_1000_1788 | 239 |
| 78 | 3300005435 | Ga0070714_100336604 | Ga0070714_1003366042 | 240 |
| 79 | 3300005436 | Ga0070713_100022899 | Ga0070713_1000228996 | 240 |
| 80 | 3300005985 | Ga0081539_10059310 | Ga0081539_100593102 | 240 |
| 81 | 3300020077 | Ga0206351_10113243 | Ga0206351_101132432 | 240 |
| 82 | 3300025928 | Ga0207700_10000001 | Ga0207700_100000011041 | 240 |
| 83 | 3300035089 | Ga0373944_0037779 | Ga0373944_0037779_322_1116 | 240 |
| 84 | 3300035170 | Ga0373943_0000713 | Ga0373943_0000713_12466_13260 | 240 |
| 85 | 3300035695 | Ga0373927_0029793 | Ga0373927_0029793_476_1270 | 240 |
| 86 | 3300035725 | Ga0373947_0015561 | Ga0373947_0015561_3160_3954 | 240 |
| 87 | 3300045976 | Ga0466967_0049082 | Ga0466967_0049082_1271_2059 | 240 |
| 88 | 3300046511 | Ga0495608_0053206 | Ga0495608_0053206_333_1124 | 240 |
| 89 | 3300046533 | Ga0495640_0008753 | Ga0495640_0008753_3914_4705 | 240 |
| 90 | 3300046559 | Ga0495667_0167718 | Ga0495667_0167718_297_1088 | 240 |
| 91 | 3300046642 | Ga0495634_0034002 | Ga0495634_0034002_941_1732 | 240 |
| 92 | 3300046689 | Ga0495613_0295406 | Ga0495613_0295406_212_1006 | 240 |
| 93 | 3300047319 | Ga0495674_0137093 | Ga0495674_0137093_456_1247 | 240 |
| 94 | 3300047321 | Ga0495676_0132289 | Ga0495676_0132289_410_1204 | 240 |
| 95 | 3300047322 | Ga0495680_0050805 | Ga0495680_0050805_1176_1967 | 240 |
| 96 | 3300047673 | Ga0495593_0188526 | Ga0495593_0188526_62_856 | 240 |
| 97 | 3300048088 | Ga0495602_0191644 | Ga0495602_0191644_752_1543 | 240 |
| 98 | 3300049586 | Ga0501070_0388116 | Ga0501070_0388116_21_809 | 240 |
| 99 | 3300049590 | Ga0501074_0013310 | Ga0501074_0013310_1961_2749 | 240 |
| 100 | 3300049590 | Ga0501074_0066081 | Ga0501074_0066081_1398_2192 | 240 |
| 101 | 3300053085 | Ga0495619_0049830 | Ga0495619_0049830_189_980 | 240 |
| 102 | 3300005535 | Ga0070684_100440901 | Ga0070684_1004409012 | 241 |
| 103 | 3300005981 | Ga0081538_10001407 | Ga0081538_1000140710 | 241 |
| 104 | 3300009147 | Ga0114129_10007212 | Ga0114129_1000721213 | 241 |
| 105 | 3300025922 | Ga0207646_10357878 | Ga0207646_103578782 | 241 |
| 106 | 3300039437 | Ga0436365_1156467 | Ga0436365_1156467_44_838 | 241 |
| 107 | 3300039450 | Ga0436363_0013651 | Ga0436363_0013651_379_1164 | 241 |
| 108 | 3300050507 | nmdc:mga05p37_2220_c1 | nmdc:mga05p37_2220_c1_12030_12821 | 241 |
| 109 | 3300005518 | Ga0070699_100372117 | Ga0070699_1003721172 | 242 |
| 110 | 3300020069 | Ga0197907_10398481 | Ga0197907_103984813 | 242 |
| 111 | 3300020078 | Ga0206352_10890070 | Ga0206352_108900702 | 242 |
| 112 | 3300037418 | Ga0395900_0032686 | Ga0395900_0032686_3862_4656 | 242 |
| 113 | 3300037466 | Ga0395898_0043792 | Ga0395898_0043792_1304_2098 | 242 |
| 114 | 3300037471 | Ga0395905_0076005 | Ga0395905_0076005_2311_3105 | 242 |
| 115 | 3300038443 | Ga0395901_0081560 | Ga0395901_0081560_47_841 | 242 |
| 116 | 3300045976 | Ga0466967_0026684 | Ga0466967_0026684_1770_2564 | 242 |
| 117 | 3300047320 | Ga0495672_0133030 | Ga0495672_0133030_309_1106 | 242 |
| 118 | 3300049568 | Ga0501031_0163505 | Ga0501031_0163505_138_974 | 242 |
| 119 | 3300005436 | Ga0070713_100010729 | Ga0070713_1000107294 | 243 |
| 120 | 3300006028 | Ga0070717_10000005 | Ga0070717_1000000515 | 243 |
| 121 | 3300006880 | Ga0075429_100181918 | Ga0075429_1001819182 | 243 |
| 122 | 3300009093 | Ga0105240_10009018 | Ga0105240_1000901812 | 243 |
| 123 | 3300009094 | Ga0111539_10040353 | Ga0111539_100403531 | 243 |
| 124 | 3300025928 | Ga0207700_10013851 | Ga0207700_100138513 | 243 |
| 125 | 3300045976 | Ga0466967_0049030 | Ga0466967_0049030_172_975 | 243 |
| 126 | 3300046477 | Ga0495664_0000051 | Ga0495664_0000051_51324_52103 | 243 |
| 127 | 3300046529 | Ga0495652_0200363 | Ga0495652_0200363_434_1327 | 243 |
| 128 | 3300049586 | Ga0501070_0297713 | Ga0501070_0297713_56_868 | 243 |
| 129 | 3300050492 | nmdc:mga0yw44_152049_c1 | nmdc:mga0yw44_152049_c1_235_1047 | 243 |
| 130 | 3300050508 | nmdc:mga09592_127940_c1 | nmdc:mga09592_127940_c1_768_1595 | 243 |
| 131 | 3300050511 | nmdc:mga08y16_620079_c1 | nmdc:mga08y16_620079_c1_86_874 | 243 |
| 132 | 3300050513 | nmdc:mga0rr50_68950_c1 | nmdc:mga0rr50_68950_c1_1454_2242 | 243 |
| 133 | 3300050514 | nmdc:mga08x19_71518_c1 | nmdc:mga08x19_71518_c1_1292_2080 | 243 |
| 134 | 3300053077 | Ga0495601_0012016 | Ga0495601_0012016_2290_3069 | 243 |
| 135 | 3300009147 | Ga0114129_10204505 | Ga0114129_102045054 | 244 |
| 136 | 3300009553 | Ga0105249_10136760 | Ga0105249_101367602 | 244 |
| 137 | 3300014326 | Ga0157380_10282895 | Ga0157380_102828952 | 244 |
| 138 | 3300025944 | Ga0207661_10009524 | Ga0207661_100095247 | 244 |
| 139 | 3300026075 | Ga0207708_10161260 | Ga0207708_101612602 | 244 |
| 140 | 3300028558 | Ga0265326_10000004 | Ga0265326_10000004196 | 244 |
| 141 | 3300028563 | Ga0265319_1000406 | Ga0265319_100040613 | 244 |
| 142 | 3300028573 | Ga0265334_10000019 | Ga0265334_10000019157 | 244 |
| 143 | 3300028800 | Ga0265338_10017019 | Ga0265338_100170198 | 244 |
| 144 | 3300029957 | Ga0265324_10000730 | Ga0265324_1000073013 | 244 |
| 145 | 3300039453 | Ga0436362_1121834 | Ga0436362_1121834_81_893 | 244 |
| 146 | 3300044684 | Ga0466966_0254846 | Ga0466966_0254846_184_996 | 244 |
| 147 | 3300045049 | Ga0466959_0191043 | Ga0466959_0191043_182_994 | 244 |
| 148 | 3300046794 | Ga0495589_0092184 | Ga0495589_0092184_257_1036 | 244 |
| 149 | 3300048907 | Ga0496104_0172149 | Ga0496104_0172149_723_1523 | 244 |
| 150 | 3300048913 | Ga0496110_0169062 | Ga0496110_0169062_320_1120 | 244 |
| 151 | 3300048918 | Ga0496115_0147686 | Ga0496115_0147686_635_1435 | 244 |
| 152 | 3300050507 | nmdc:mga05p37_90274_c1 | nmdc:mga05p37_90274_c1_1539_2363 | 244 |
| 153 | 3300050508 | nmdc:mga09592_173788_c1 | nmdc:mga09592_173788_c1_11_835 | 244 |
| 154 | 3300050511 | nmdc:mga08y16_419449_c1 | nmdc:mga08y16_419449_c1_409_1233 | 244 |
| 155 | 3300005981 | Ga0081538_10078192 | Ga0081538_100781922 | 245 |
| 156 | 3300005985 | Ga0081539_10172459 | Ga0081539_101724592 | 245 |
| 157 | 3300013296 | Ga0157374_10454970 | Ga0157374_104549702 | 245 |
| 158 | 3300025908 | Ga0207643_10082184 | Ga0207643_100821842 | 245 |
| 159 | 3300032002 | Ga0307416_100134707 | Ga0307416_1001347072 | 245 |
| 160 | 3300032126 | Ga0307415_100065881 | Ga0307415_1000658814 | 245 |
| 161 | 3300039437 | Ga0436365_0654279 | Ga0436365_0654279_7131_7943 | 245 |
| 162 | 3300045049 | Ga0466959_0076116 | Ga0466959_0076116_145_933 | 245 |
| 163 | 3300046516 | Ga0495628_0073196 | Ga0495628_0073196_196_1074 | 245 |
| 164 | 3300048913 | Ga0496110_0000023 | Ga0496110_0000023_18376_19155 | 245 |
| 165 | 3300048914 | Ga0496111_0000181 | Ga0496111_0000181_5655_6434 | 245 |
| 166 | 3300049577 | Ga0501041_0092304 | Ga0501041_0092304_85_909 | 245 |
| 167 | 3300049578 | Ga0501042_0109156 | Ga0501042_0109156_571_1395 | 245 |
| 168 | 3300049588 | Ga0501072_0047989 | Ga0501072_0047989_580_1404 | 245 |
| 169 | 3300049591 | Ga0501075_0058435 | Ga0501075_0058435_1842_2666 | 245 |
| 170 | 3300049592 | Ga0501076_0003024 | Ga0501076_0003024_4944_5768 | 245 |
| 171 | 3300049742 | Ga0501080_0540419 | Ga0501080_0540419_37_852 | 245 |
| 172 | 3300054114 | Ga0501084_0217970 | Ga0501084_0217970_103_927 | 245 |
| 173 | 3300001990 | JGI24737J22298_10027549 | JGI24737J22298_100275492 | 246 |
| 174 | 3300002074 | JGI24748J21848_1000389 | JGI24748J21848_10003892 | 246 |
| 175 | 3300002075 | JGI24738J21930_10025607 | JGI24738J21930_100256072 | 246 |
| 176 | 3300002239 | JGI24034J26672_10000150 | JGI24034J26672_1000015014 | 246 |
| 177 | 3300002244 | JGI24742J22300_10019606 | JGI24742J22300_100196061 | 246 |
| 178 | 3300005328 | Ga0070676_10133369 | Ga0070676_101333692 | 246 |
| 179 | 3300005337 | Ga0070682_100061925 | Ga0070682_1000619252 | 246 |
| 180 | 3300005366 | Ga0070659_100144127 | Ga0070659_1001441273 | 246 |
| 181 | 3300005435 | Ga0070714_100000457 | Ga0070714_10000045735 | 246 |
| 182 | 3300005437 | Ga0070710_10323023 | Ga0070710_103230232 | 246 |
| 183 | 3300005457 | Ga0070662_100473915 | Ga0070662_1004739152 | 246 |
| 184 | 3300005459 | Ga0068867_100132290 | Ga0068867_1001322901 | 246 |
| 185 | 3300005539 | Ga0068853_100816413 | Ga0068853_1008164131 | 246 |
| 186 | 3300005578 | Ga0068854_100097394 | Ga0068854_1000973943 | 246 |
| 187 | 3300005718 | Ga0068866_10043953 | Ga0068866_100439533 | 246 |
| 188 | 3300005841 | Ga0068863_100946688 | Ga0068863_1009466881 | 246 |
| 189 | 3300005842 | Ga0068858_100379343 | Ga0068858_1003793432 | 246 |
| 190 | 3300006931 | Ga0097620_100405859 | Ga0097620_1004058591 | 246 |
| 191 | 3300009553 | Ga0105249_10070027 | Ga0105249_100700274 | 246 |
| 192 | 3300013306 | Ga0163162_10077973 | Ga0163162_100779734 | 246 |
| 193 | 3300014745 | Ga0157377_10159242 | Ga0157377_101592422 | 246 |
| 194 | 3300025900 | Ga0207710_10084919 | Ga0207710_100849192 | 246 |
| 195 | 3300025901 | Ga0207688_10015440 | Ga0207688_100154405 | 246 |
| 196 | 3300025916 | Ga0207663_10073167 | Ga0207663_100731672 | 246 |
| 197 | 3300025927 | Ga0207687_10110630 | Ga0207687_101106302 | 246 |
| 198 | 3300025929 | Ga0207664_10000008 | Ga0207664_1000000835 | 246 |
| 199 | 3300025929 | Ga0207664_10068604 | Ga0207664_100686042 | 246 |
| 200 | 3300025934 | Ga0207686_10069967 | Ga0207686_100699672 | 246 |
| 201 | 3300025961 | Ga0207712_10505545 | Ga0207712_105055452 | 246 |
| 202 | 3300028380 | Ga0268265_10391754 | Ga0268265_103917542 | 246 |
| 203 | 3300028381 | Ga0268264_10526437 | Ga0268264_105264372 | 246 |
| 204 | 3300038443 | Ga0395901_0043084 | Ga0395901_0043084_1983_2843 | 246 |
| 205 | 3300046463 | Ga0495653_0046662 | Ga0495653_0046662_1387_2277 | 246 |
| 206 | 3300046500 | Ga0495596_0041300 | Ga0495596_0041300_193_1017 | 246 |
| 207 | 3300046517 | Ga0495630_0000312 | Ga0495630_0000312_15419_16309 | 246 |
| 208 | 3300046529 | Ga0495652_0000066 | Ga0495652_0000066_3384_4304 | 246 |
| 209 | 3300046543 | Ga0495645_0029487 | Ga0495645_0029487_1446_2354 | 246 |
| 210 | 3300046642 | Ga0495634_0000187 | Ga0495634_0000187_37157_38047 | 246 |
| 211 | 3300046663 | Ga0495635_0048772 | Ga0495635_0048772_1079_1969 | 246 |
| 212 | 3300046663 | Ga0495635_0057868 | Ga0495635_0057868_306_1196 | 246 |
| 213 | 3300046675 | Ga0495657_0021818 | Ga0495657_0021818_1894_2784 | 246 |
| 214 | 3300046809 | Ga0495600_0219863 | Ga0495600_0219863_153_1061 | 246 |
| 215 | 3300047322 | Ga0495680_0110271 | Ga0495680_0110271_690_1580 | 246 |
| 216 | 3300048912 | Ga0496109_0511769 | Ga0496109_0511769_181_972 | 246 |
| 217 | 3300049581 | Ga0501047_0445751 | Ga0501047_0445751_30_827 | 246 |
| 218 | 3300053077 | Ga0495601_0053210 | Ga0495601_0053210_120_1010 | 246 |
| 219 | 3300053085 | Ga0495619_0000626 | Ga0495619_0000626_5552_6442 | 246 |
| 220 | 3300003373 | JGI25407J50210_10037219 | JGI25407J50210_100372191 | 247 |
| 221 | 3300005345 | Ga0070692_10049869 | Ga0070692_100498692 | 247 |
| 222 | 3300005365 | Ga0070688_100210574 | Ga0070688_1002105741 | 247 |
| 223 | 3300005366 | Ga0070659_100088392 | Ga0070659_1000883923 | 247 |
| 224 | 3300005439 | Ga0070711_100169536 | Ga0070711_1001695362 | 247 |
| 225 | 3300005456 | Ga0070678_100683115 | Ga0070678_1006831151 | 247 |
| 226 | 3300005459 | Ga0068867_100472532 | Ga0068867_1004725321 | 247 |
| 227 | 3300005614 | Ga0068856_100432252 | Ga0068856_1004322522 | 247 |
| 228 | 3300005618 | Ga0068864_100176006 | Ga0068864_1001760062 | 247 |
| 229 | 3300005719 | Ga0068861_100213824 | Ga0068861_1002138242 | 247 |
| 230 | 3300005840 | Ga0068870_10183207 | Ga0068870_101832072 | 247 |
| 231 | 3300005981 | Ga0081538_10013039 | Ga0081538_100130393 | 247 |
| 232 | 3300005981 | Ga0081538_10048018 | Ga0081538_100480183 | 247 |
| 233 | 3300006178 | Ga0075367_10303698 | Ga0075367_103036982 | 247 |
| 234 | 3300006852 | Ga0075433_10003079 | Ga0075433_1000307910 | 247 |
| 235 | 3300009098 | Ga0105245_10161330 | Ga0105245_101613302 | 247 |
| 236 | 3300009553 | Ga0105249_10264829 | Ga0105249_102648292 | 247 |
| 237 | 3300011119 | Ga0105246_10156655 | Ga0105246_101566552 | 247 |
| 238 | 3300013307 | Ga0157372_10499025 | Ga0157372_104990252 | 247 |
| 239 | 3300014325 | Ga0163163_10310414 | Ga0163163_103104142 | 247 |
| 240 | 3300025901 | Ga0207688_10212405 | Ga0207688_102124052 | 247 |
| 241 | 3300025908 | Ga0207643_10073739 | Ga0207643_100737393 | 247 |
| 242 | 3300025917 | Ga0207660_10134515 | Ga0207660_101345152 | 247 |
| 243 | 3300025918 | Ga0207662_10019100 | Ga0207662_100191004 | 247 |
| 244 | 3300025919 | Ga0207657_10163770 | Ga0207657_101637703 | 247 |
| 245 | 3300025933 | Ga0207706_10060988 | Ga0207706_100609882 | 247 |
| 246 | 3300025960 | Ga0207651_10589591 | Ga0207651_105895911 | 247 |
| 247 | 3300025961 | Ga0207712_10054885 | Ga0207712_100548854 | 247 |
| 248 | 3300026067 | Ga0207678_10082856 | Ga0207678_100828564 | 247 |
| 249 | 3300026075 | Ga0207708_10207192 | Ga0207708_102071921 | 247 |
| 250 | 3300026089 | Ga0207648_10334360 | Ga0207648_103343602 | 247 |
| 251 | 3300026118 | Ga0207675_100202406 | Ga0207675_1002024062 | 247 |
| 252 | 3300026121 | Ga0207683_10266293 | Ga0207683_102662932 | 247 |
| 253 | 3300031548 | Ga0307408_100279395 | Ga0307408_1002793951 | 247 |
| 254 | 3300031824 | Ga0307413_10020410 | Ga0307413_100204102 | 247 |
| 255 | 3300031852 | Ga0307410_10002178 | Ga0307410_100021785 | 247 |
| 256 | 3300031901 | Ga0307406_10004963 | Ga0307406_1000496310 | 247 |
| 257 | 3300031903 | Ga0307407_10240007 | Ga0307407_102400072 | 247 |
| 258 | 3300031911 | Ga0307412_10033408 | Ga0307412_100334083 | 247 |
| 259 | 3300031995 | Ga0307409_100120159 | Ga0307409_1001201592 | 247 |
| 260 | 3300031995 | Ga0307409_100137845 | Ga0307409_1001378452 | 247 |
| 261 | 3300032002 | Ga0307416_100007630 | Ga0307416_1000076302 | 247 |
| 262 | 3300032002 | Ga0307416_100047424 | Ga0307416_1000474242 | 247 |
| 263 | 3300032002 | Ga0307416_100107772 | Ga0307416_1001077723 | 247 |
| 264 | 3300032002 | Ga0307416_100402370 | Ga0307416_1004023702 | 247 |
| 265 | 3300032004 | Ga0307414_10157054 | Ga0307414_101570542 | 247 |
| 266 | 3300032005 | Ga0307411_10057982 | Ga0307411_100579822 | 247 |
| 267 | 3300032126 | Ga0307415_100002806 | Ga0307415_10000280610 | 247 |
| 268 | 3300032126 | Ga0307415_100196771 | Ga0307415_1001967712 | 247 |
| 269 | 3300032126 | Ga0307415_100423055 | Ga0307415_1004230552 | 247 |
| 270 | 3300041494 | Ga0451837_1322243 | Ga0451837_1322243_43_843 | 247 |
| 271 | 3300042438 | Ga0439459_0005651 | Ga0439459_0005651_274_1080 | 247 |
| 272 | 3300044694 | Ga0466963_0024348 | Ga0466963_0024348_1818_2615 | 247 |
| 273 | 3300044694 | Ga0466963_0029483 | Ga0466963_0029483_179_976 | 247 |
| 274 | 3300044706 | Ga0466964_0083209 | Ga0466964_0083209_19_870 | 247 |
| 275 | 3300045049 | Ga0466959_0093998 | Ga0466959_0093998_455_1255 | 247 |
| 276 | 3300045976 | Ga0466967_0001339 | Ga0466967_0001339_8250_9047 | 247 |
| 277 | 3300045976 | Ga0466967_0104298 | Ga0466967_0104298_1054_1848 | 247 |
| 278 | 3300045976 | Ga0466967_0592747 | Ga0466967_0592747_20_820 | 247 |
| 279 | 3300048914 | Ga0496111_0137594 | Ga0496111_0137594_341_1273 | 247 |
| 280 | 3300049572 | Ga0501036_0067898 | Ga0501036_0067898_1136_1939 | 247 |
| 281 | 3300049575 | Ga0501039_0032649 | Ga0501039_0032649_1473_2276 | 247 |
| 282 | 3300049576 | Ga0501040_0250144 | Ga0501040_0250144_278_1081 | 247 |
| 283 | 3300049591 | Ga0501075_0170598 | Ga0501075_0170598_19_822 | 247 |
| 284 | 3300049741 | Ga0501079_0615565 | Ga0501079_0615565_29_823 | 247 |
| 285 | 3300050515 | nmdc:mga0a205_4209_c1 | nmdc:mga0a205_4209_c1_1853_2734 | 247 |
| 286 | 3300053102 | Ga0500554_020941 | Ga0500554_020941_805_1608 | 247 |
| 287 | 3300059491 | Ga0587070_006567 | Ga0587070_006567_641_1441 | 247 |
| 288 | 3300059493 | Ga0587077_009254 | Ga0587077_009254_361_1155 | 247 |
| 289 | 3300003575 | Ga0007409J51694_1018359 | Ga0007409J51694_10183592 | 248 |
| 290 | 3300004803 | Ga0058862_10146983 | Ga0058862_101469831 | 248 |
| 291 | 3300005345 | Ga0070692_10259767 | Ga0070692_102597671 | 248 |
| 292 | 3300005353 | Ga0070669_100252060 | Ga0070669_1002520602 | 248 |
| 293 | 3300005356 | Ga0070674_100349061 | Ga0070674_1003490611 | 248 |
| 294 | 3300005456 | Ga0070678_100289686 | Ga0070678_1002896862 | 248 |
| 295 | 3300005535 | Ga0070684_100092618 | Ga0070684_1000926183 | 248 |
| 296 | 3300005564 | Ga0070664_100440217 | Ga0070664_1004402172 | 248 |
| 297 | 3300005981 | Ga0081538_10000169 | Ga0081538_1000016972 | 248 |
| 298 | 3300005981 | Ga0081538_10000199 | Ga0081538_1000019935 | 248 |
| 299 | 3300005981 | Ga0081538_10131203 | Ga0081538_101312032 | 248 |
| 300 | 3300006844 | Ga0075428_100147238 | Ga0075428_1001472382 | 248 |
| 301 | 3300006846 | Ga0075430_100082115 | Ga0075430_1000821152 | 248 |
| 302 | 3300006847 | Ga0075431_100039934 | Ga0075431_1000399344 | 248 |
| 303 | 3300009098 | Ga0105245_10511028 | Ga0105245_105110282 | 248 |
| 304 | 3300009148 | Ga0105243_10222494 | Ga0105243_102224942 | 248 |
| 305 | 3300014326 | Ga0157380_10022346 | Ga0157380_100223463 | 248 |
| 306 | 3300025923 | Ga0207681_10224829 | Ga0207681_102248292 | 248 |
| 307 | 3300025944 | Ga0207661_10077349 | Ga0207661_100773492 | 248 |
| 308 | 3300026116 | Ga0207674_10115203 | Ga0207674_101152034 | 248 |
| 309 | 3300026118 | Ga0207675_100031944 | Ga0207675_1000319442 | 248 |
| 310 | 3300032004 | Ga0307414_10294986 | Ga0307414_102949862 | 248 |
| 311 | 3300042005 | Ga0439448_0058057 | Ga0439448_0058057_333_1130 | 248 |
| 312 | 3300044694 | Ga0466963_0050194 | Ga0466963_0050194_331_1134 | 248 |
| 313 | 3300044694 | Ga0466963_0091375 | Ga0466963_0091375_350_1153 | 248 |
| 314 | 3300044842 | Ga0466957_0047290 | Ga0466957_0047290_949_1752 | 248 |
| 315 | 3300044901 | Ga0466960_0131798 | Ga0466960_0131798_207_1019 | 248 |
| 316 | 3300045049 | Ga0466959_0234163 | Ga0466959_0234163_257_1060 | 248 |
| 317 | 3300046642 | Ga0495634_0026143 | Ga0495634_0026143_3114_4004 | 248 |
| 318 | 3300048904 | Ga0496101_0001927 | Ga0496101_0001927_11103_11903 | 248 |
| 319 | 3300048905 | Ga0496102_0004675 | Ga0496102_0004675_9888_10688 | 248 |
| 320 | 3300048909 | Ga0496106_0003356 | Ga0496106_0003356_1990_2790 | 248 |
| 321 | 3300048918 | Ga0496115_0029926 | Ga0496115_0029926_2531_3331 | 248 |
| 322 | 3300048927 | Ga0496124_0044254 | Ga0496124_0044254_2729_3532 | 248 |
| 323 | 3300049576 | Ga0501040_0261644 | Ga0501040_0261644_182_1009 | 248 |
| 324 | 3300049743 | Ga0501081_0471883 | Ga0501081_0471883_38_874 | 248 |
| 325 | 3300050509 | nmdc:mga0qj67_32858_c1 | nmdc:mga0qj67_32858_c1_1814_2641 | 248 |
| 326 | 3300060353 | Ga0501082_0119820 | Ga0501082_0119820_789_1625 | 248 |
| 327 | 3300061719 | Ga0466962_0026097 | Ga0466962_0026097_71_871 | 248 |
| 328 | 3300003373 | JGI25407J50210_10025274 | JGI25407J50210_100252742 | 249 |
| 329 | 3300005329 | Ga0070683_100271684 | Ga0070683_1002716842 | 249 |
| 330 | 3300005334 | Ga0068869_100366521 | Ga0068869_1003665212 | 249 |
| 331 | 3300005338 | Ga0068868_100050401 | Ga0068868_1000504014 | 249 |
| 332 | 3300005341 | Ga0070691_10008056 | Ga0070691_100080564 | 249 |
| 333 | 3300005353 | Ga0070669_100024526 | Ga0070669_1000245262 | 249 |
| 334 | 3300005366 | Ga0070659_100000002 | Ga0070659_100000002186 | 249 |
| 335 | 3300005437 | Ga0070710_10000007 | Ga0070710_1000000753 | 249 |
| 336 | 3300005437 | Ga0070710_10032819 | Ga0070710_100328193 | 249 |
| 337 | 3300005439 | Ga0070711_100169259 | Ga0070711_1001692592 | 249 |
| 338 | 3300005440 | Ga0070705_100014228 | Ga0070705_1000142282 | 249 |
| 339 | 3300005441 | Ga0070700_100000713 | Ga0070700_1000007134 | 249 |
| 340 | 3300005455 | Ga0070663_100069580 | Ga0070663_1000695802 | 249 |
| 341 | 3300005456 | Ga0070678_100158391 | Ga0070678_1001583912 | 249 |
| 342 | 3300005466 | Ga0070685_10018903 | Ga0070685_100189033 | 249 |
| 343 | 3300005535 | Ga0070684_100081725 | Ga0070684_1000817252 | 249 |
| 344 | 3300005564 | Ga0070664_100257493 | Ga0070664_1002574932 | 249 |
| 345 | 3300005564 | Ga0070664_100559857 | Ga0070664_1005598571 | 249 |
| 346 | 3300005577 | Ga0068857_100589759 | Ga0068857_1005897592 | 249 |
| 347 | 3300005618 | Ga0068864_100063941 | Ga0068864_1000639412 | 249 |
| 348 | 3300005718 | Ga0068866_10167533 | Ga0068866_101675332 | 249 |
| 349 | 3300005841 | Ga0068863_100187922 | Ga0068863_1001879223 | 249 |
| 350 | 3300005981 | Ga0081538_10000601 | Ga0081538_1000060128 | 249 |
| 351 | 3300005981 | Ga0081538_10046700 | Ga0081538_100467002 | 249 |
| 352 | 3300006175 | Ga0070712_100000054 | Ga0070712_10000005411 | 249 |
| 353 | 3300006175 | Ga0070712_100058401 | Ga0070712_1000584014 | 249 |
| 354 | 3300006847 | Ga0075431_100403643 | Ga0075431_1004036432 | 249 |
| 355 | 3300006852 | Ga0075433_10109169 | Ga0075433_101091692 | 249 |
| 356 | 3300006881 | Ga0068865_100031548 | Ga0068865_1000315484 | 249 |
| 357 | 3300006914 | Ga0075436_100160059 | Ga0075436_1001600592 | 249 |
| 358 | 3300009011 | Ga0105251_10166835 | Ga0105251_101668352 | 249 |
| 359 | 3300009094 | Ga0111539_10128332 | Ga0111539_101283323 | 249 |
| 360 | 3300009094 | Ga0111539_10160791 | Ga0111539_101607912 | 249 |
| 361 | 3300009098 | Ga0105245_10014040 | Ga0105245_1001404010 | 249 |
| 362 | 3300009147 | Ga0114129_10382147 | Ga0114129_103821472 | 249 |
| 363 | 3300009147 | Ga0114129_10411479 | Ga0114129_104114792 | 249 |
| 364 | 3300009177 | Ga0105248_10114960 | Ga0105248_101149602 | 249 |
| 365 | 3300009553 | Ga0105249_10538746 | Ga0105249_105387462 | 249 |
| 366 | 3300010375 | Ga0105239_10015484 | Ga0105239_100154848 | 249 |
| 367 | 3300011119 | Ga0105246_10052077 | Ga0105246_100520773 | 249 |
| 368 | 3300011119 | Ga0105246_10063586 | Ga0105246_100635862 | 249 |
| 369 | 3300012510 | Ga0157316_1003173 | Ga0157316_10031732 | 249 |
| 370 | 3300013296 | Ga0157374_10012519 | Ga0157374_100125197 | 249 |
| 371 | 3300013307 | Ga0157372_10259674 | Ga0157372_102596742 | 249 |
| 372 | 3300013308 | Ga0157375_10018991 | Ga0157375_100189916 | 249 |
| 373 | 3300014325 | Ga0163163_10020100 | Ga0163163_100201004 | 249 |
| 374 | 3300014326 | Ga0157380_10050458 | Ga0157380_100504584 | 249 |
| 375 | 3300014745 | Ga0157377_10047054 | Ga0157377_100470544 | 249 |
| 376 | 3300014969 | Ga0157376_10016164 | Ga0157376_100161648 | 249 |
| 377 | 3300014969 | Ga0157376_10086348 | Ga0157376_100863483 | 249 |
| 378 | 3300017792 | Ga0163161_10221738 | Ga0163161_102217382 | 249 |
| 379 | 3300022467 | Ga0224712_10076498 | Ga0224712_100764982 | 249 |
| 380 | 3300025898 | Ga0207692_10000001 | Ga0207692_10000001283 | 249 |
| 381 | 3300025898 | Ga0207692_10002495 | Ga0207692_100024951 | 249 |
| 382 | 3300025901 | Ga0207688_10002646 | Ga0207688_100026469 | 249 |
| 383 | 3300025901 | Ga0207688_10031598 | Ga0207688_100315982 | 249 |
| 384 | 3300025904 | Ga0207647_10152391 | Ga0207647_101523912 | 249 |
| 385 | 3300025906 | Ga0207699_10134262 | Ga0207699_101342622 | 249 |
| 386 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001114 | 249 |
| 387 | 3300025915 | Ga0207693_10032690 | Ga0207693_100326904 | 249 |
| 388 | 3300025916 | Ga0207663_10087472 | Ga0207663_100874723 | 249 |
| 389 | 3300025919 | Ga0207657_10068331 | Ga0207657_100683313 | 249 |
| 390 | 3300025923 | Ga0207681_10006628 | Ga0207681_100066287 | 249 |
| 391 | 3300025927 | Ga0207687_10235269 | Ga0207687_102352692 | 249 |
| 392 | 3300025929 | Ga0207664_10303082 | Ga0207664_103030822 | 249 |
| 393 | 3300025932 | Ga0207690_10000024 | Ga0207690_10000024123 | 249 |
| 394 | 3300025932 | Ga0207690_10063905 | Ga0207690_100639052 | 249 |
| 395 | 3300025942 | Ga0207689_10171221 | Ga0207689_101712212 | 249 |
| 396 | 3300025945 | Ga0207679_10264081 | Ga0207679_102640811 | 249 |
| 397 | 3300025949 | Ga0207667_10442350 | Ga0207667_104423502 | 249 |
| 398 | 3300025981 | Ga0207640_10047658 | Ga0207640_100476581 | 249 |
| 399 | 3300026041 | Ga0207639_10377875 | Ga0207639_103778752 | 249 |
| 400 | 3300026067 | Ga0207678_10005519 | Ga0207678_1000551910 | 249 |
| 401 | 3300026075 | Ga0207708_10000496 | Ga0207708_1000049610 | 249 |
| 402 | 3300026088 | Ga0207641_10141998 | Ga0207641_101419982 | 249 |
| 403 | 3300026089 | Ga0207648_10098758 | Ga0207648_100987582 | 249 |
| 404 | 3300026095 | Ga0207676_10121577 | Ga0207676_101215772 | 249 |
| 405 | 3300026116 | Ga0207674_10419567 | Ga0207674_104195671 | 249 |
| 406 | 3300026121 | Ga0207683_10010883 | Ga0207683_100108832 | 249 |
| 407 | 3300027907 | Ga0207428_10248715 | Ga0207428_102487152 | 249 |
| 408 | 3300028379 | Ga0268266_10398598 | Ga0268266_103985982 | 249 |
| 409 | 3300031251 | Ga0265327_10002548 | Ga0265327_1000254815 | 249 |
| 410 | 3300031711 | Ga0265314_10072978 | Ga0265314_100729782 | 249 |
| 411 | 3300031995 | Ga0307409_100005794 | Ga0307409_1000057942 | 249 |
| 412 | 3300032126 | Ga0307415_100051745 | Ga0307415_1000517454 | 249 |
| 413 | 3300044684 | Ga0466966_0104943 | Ga0466966_0104943_550_1353 | 249 |
| 414 | 3300046463 | Ga0495653_0000183 | Ga0495653_0000183_12608_13414 | 249 |
| 415 | 3300046516 | Ga0495628_0116833 | Ga0495628_0116833_990_1793 | 249 |
| 416 | 3300047320 | Ga0495672_0001687 | Ga0495672_0001687_6708_7514 | 249 |
| 417 | 3300048903 | Ga0496100_0014322 | Ga0496100_0014322_754_1593 | 249 |
| 418 | 3300048905 | Ga0496102_0049833 | Ga0496102_0049833_2958_3797 | 249 |
| 419 | 3300048906 | Ga0496103_0000016 | Ga0496103_0000016_110105_110917 | 249 |
| 420 | 3300048907 | Ga0496104_0000030 | Ga0496104_0000030_108352_109164 | 249 |
| 421 | 3300048907 | Ga0496104_0140661 | Ga0496104_0140661_1273_2112 | 249 |
| 422 | 3300048908 | Ga0496105_0125436 | Ga0496105_0125436_295_1134 | 249 |
| 423 | 3300048909 | Ga0496106_0058661 | Ga0496106_0058661_83_922 | 249 |
| 424 | 3300048911 | Ga0496108_0000153 | Ga0496108_0000153_30182_31078 | 249 |
| 425 | 3300048911 | Ga0496108_0157061 | Ga0496108_0157061_256_1095 | 249 |
| 426 | 3300048912 | Ga0496109_0000300 | Ga0496109_0000300_36749_37645 | 249 |
| 427 | 3300048912 | Ga0496109_0108128 | Ga0496109_0108128_989_1828 | 249 |
| 428 | 3300048912 | Ga0496109_0143526 | Ga0496109_0143526_910_1716 | 249 |
| 429 | 3300048913 | Ga0496110_0000230 | Ga0496110_0000230_34623_35435 | 249 |
| 430 | 3300048914 | Ga0496111_0000016 | Ga0496111_0000016_74585_75397 | 249 |
| 431 | 3300048915 | Ga0496112_0001445 | Ga0496112_0001445_16560_17366 | 249 |
| 432 | 3300048915 | Ga0496112_0192679 | Ga0496112_0192679_962_1801 | 249 |
| 433 | 3300048916 | Ga0496113_0111989 | Ga0496113_0111989_1256_2062 | 249 |
| 434 | 3300050507 | nmdc:mga05p37_95327_c1 | nmdc:mga05p37_95327_c1_1208_2044 | 249 |
| 435 | 3300050515 | nmdc:mga0a205_320751_c1 | nmdc:mga0a205_320751_c1_274_1113 | 249 |
| 436 | 3300053085 | Ga0495619_0126366 | Ga0495619_0126366_616_1428 | 249 |
| 437 | 3300059506 | Ga0587085_010233 | Ga0587085_010233_66_911 | 249 |
| 438 | 3300006871 | Ga0075434_100061090 | Ga0075434_1000610904 | 250 |
| 439 | 3300007076 | Ga0075435_100005734 | Ga0075435_10000573410 | 250 |
| 440 | 3300009098 | Ga0105245_10500345 | Ga0105245_105003452 | 250 |
| 441 | 3300009147 | Ga0114129_10149373 | Ga0114129_101493732 | 250 |
| 442 | 3300025915 | Ga0207693_10006332 | Ga0207693_100063328 | 250 |
| 443 | 3300025916 | Ga0207663_10232257 | Ga0207663_102322572 | 250 |
| 444 | 3300025927 | Ga0207687_10115669 | Ga0207687_101156692 | 250 |
| 445 | 3300031901 | Ga0307406_10143729 | Ga0307406_101437292 | 250 |
| 446 | 3300032005 | Ga0307411_10187687 | Ga0307411_101876872 | 250 |
| 447 | 3300039437 | Ga0436365_0190537 | Ga0436365_0190537_5566_6375 | 250 |
| 448 | 3300044693 | Ga0466961_0055385 | Ga0466961_0055385_499_1305 | 250 |
| 449 | 3300045049 | Ga0466959_0051085 | Ga0466959_0051085_1601_2407 | 250 |
| 450 | 3300046615 | Ga0495656_0033783 | Ga0495656_0033783_498_1286 | 250 |
| 451 | 3300048904 | Ga0496101_0140244 | Ga0496101_0140244_846_1685 | 250 |
| 452 | 3300048905 | Ga0496102_0457739 | Ga0496102_0457739_321_1106 | 250 |
| 453 | 3300048909 | Ga0496106_0094150 | Ga0496106_0094150_1374_2159 | 250 |
| 454 | 3300048912 | Ga0496109_0010926 | Ga0496109_0010926_5877_6686 | 250 |
| 455 | 3300049591 | Ga0501075_0135260 | Ga0501075_0135260_1058_1840 | 250 |
| 456 | 3300049741 | Ga0501079_0126989 | Ga0501079_0126989_1040_1822 | 250 |
| 457 | 3300050507 | nmdc:mga05p37_1079737_c1 | nmdc:mga05p37_1079737_c1_40_825 | 250 |
| 458 | 3300050512 | nmdc:mga0n895_255599_c1 | nmdc:mga0n895_255599_c1_225_1010 | 250 |
| 459 | 3300050513 | nmdc:mga0rr50_77688_c1 | nmdc:mga0rr50_77688_c1_959_1744 | 250 |
| 460 | 3300050515 | nmdc:mga0a205_58885_c1 | nmdc:mga0a205_58885_c1_2661_3446 | 250 |
| 461 | 3300054114 | Ga0501084_0138999 | Ga0501084_0138999_722_1504 | 250 |
| 462 | 3300005339 | Ga0070660_100077368 | Ga0070660_1000773683 | 251 |
| 463 | 3300005344 | Ga0070661_100006067 | Ga0070661_1000060676 | 251 |
| 464 | 3300005458 | Ga0070681_10007190 | Ga0070681_1000719014 | 251 |
| 465 | 3300005530 | Ga0070679_100003327 | Ga0070679_10000332718 | 251 |
| 466 | 3300005539 | Ga0068853_100083492 | Ga0068853_1000834922 | 251 |
| 467 | 3300005614 | Ga0068856_100052759 | Ga0068856_1000527592 | 251 |
| 468 | 3300006051 | Ga0075364_10182165 | Ga0075364_101821652 | 251 |
| 469 | 3300006051 | Ga0075364_10190668 | Ga0075364_101906682 | 251 |
| 470 | 3300013104 | Ga0157370_10011051 | Ga0157370_100110513 | 251 |
| 471 | 3300013105 | Ga0157369_10028494 | Ga0157369_100284945 | 251 |
| 472 | 3300013307 | Ga0157372_10040278 | Ga0157372_100402784 | 251 |
| 473 | 3300025904 | Ga0207647_10190680 | Ga0207647_101906801 | 251 |
| 474 | 3300025912 | Ga0207707_10062940 | Ga0207707_100629401 | 251 |
| 475 | 3300025913 | Ga0207695_10398791 | Ga0207695_103987912 | 251 |
| 476 | 3300025917 | Ga0207660_10008920 | Ga0207660_100089206 | 251 |
| 477 | 3300025919 | Ga0207657_10020984 | Ga0207657_100209842 | 251 |
| 478 | 3300025920 | Ga0207649_10007634 | Ga0207649_100076345 | 251 |
| 479 | 3300025921 | Ga0207652_10004034 | Ga0207652_100040344 | 251 |
| 480 | 3300025944 | Ga0207661_10003963 | Ga0207661_100039635 | 251 |
| 481 | 3300026041 | Ga0207639_10069307 | Ga0207639_100693072 | 251 |
| 482 | 3300026078 | Ga0207702_10030434 | Ga0207702_100304345 | 251 |
| 483 | 3300026116 | Ga0207674_10185644 | Ga0207674_101856442 | 251 |
| 484 | 3300026142 | Ga0207698_10029483 | Ga0207698_100294833 | 251 |
| 485 | 3300031852 | Ga0307410_10034475 | Ga0307410_100344753 | 251 |
| 486 | 3300031995 | Ga0307409_100056297 | Ga0307409_1000562973 | 251 |
| 487 | 3300032002 | Ga0307416_100094954 | Ga0307416_1000949544 | 251 |
| 488 | 3300044684 | Ga0466966_0041895 | Ga0466966_0041895_228_1025 | 251 |
| 489 | 3300044693 | Ga0466961_0003399 | Ga0466961_0003399_6721_7518 | 251 |
| 490 | 3300044694 | Ga0466963_0010863 | Ga0466963_0010863_268_1065 | 251 |
| 491 | 3300044706 | Ga0466964_0114447 | Ga0466964_0114447_186_989 | 251 |
| 492 | 3300044719 | Ga0466971_0001196 | Ga0466971_0001196_6467_7264 | 251 |
| 493 | 3300044842 | Ga0466957_0004158 | Ga0466957_0004158_6700_7497 | 251 |
| 494 | 3300044842 | Ga0466957_0006194 | Ga0466957_0006194_2238_3035 | 251 |
| 495 | 3300044842 | Ga0466957_0201859 | Ga0466957_0201859_262_1059 | 251 |
| 496 | 3300045049 | Ga0466959_0001348 | Ga0466959_0001348_7456_8253 | 251 |
| 497 | 3300045049 | Ga0466959_0155532 | Ga0466959_0155532_551_1348 | 251 |
| 498 | 3300045836 | Ga0466958_0047886 | Ga0466958_0047886_134_931 | 251 |
| 499 | 3300050508 | nmdc:mga09592_1226_c2 | nmdc:mga09592_1226_c2_8052_8864 | 251 |
| 500 | 3300061719 | Ga0466962_0000706 | Ga0466962_0000706_7601_8398 | 251 |
| 501 | 3300061719 | Ga0466962_0133586 | Ga0466962_0133586_135_932 | 251 |
| 502 | 3300032126 | Ga0307415_100276856 | Ga0307415_1002768562 | 252 |
| 503 | 3300039437 | Ga0436365_1162518 | Ga0436365_1162518_1364_2164 | 252 |
| 504 | 3300039450 | Ga0436363_1008360 | Ga0436363_1008360_175_972 | 252 |
| 505 | 3300039453 | Ga0436362_0315400 | Ga0436362_0315400_96_896 | 252 |
| 506 | 3300044694 | Ga0466963_0025075 | Ga0466963_0025075_2667_3467 | 252 |
| 507 | 3300044735 | Ga0466968_0025031 | Ga0466968_0025031_841_1650 | 252 |
| 508 | 3300009147 | Ga0114129_10311966 | Ga0114129_103119663 | 253 |
| 509 | 3300045976 | Ga0466967_0017023 | Ga0466967_0017023_2170_3090 | 253 |
| 510 | 3300049572 | Ga0501036_0264390 | Ga0501036_0264390_16_810 | 253 |
| 511 | 3300049577 | Ga0501041_0105319 | Ga0501041_0105319_623_1417 | 253 |
| 512 | 3300049584 | Ga0501068_0159455 | Ga0501068_0159455_380_1177 | 253 |
| 513 | 3300049588 | Ga0501072_0010167 | Ga0501072_0010167_6068_6862 | 253 |
| 514 | 3300049593 | Ga0501077_0013588 | Ga0501077_0013588_4059_4853 | 253 |
| 515 | 3300049741 | Ga0501079_0005061 | Ga0501079_0005061_5879_6673 | 253 |
| 516 | 3300049824 | Ga0501045_0029237 | Ga0501045_0029237_3091_3885 | 253 |
| 517 | 3300050507 | nmdc:mga05p37_347856_c1 | nmdc:mga05p37_347856_c1_34_828 | 253 |
| 518 | 3300050510 | nmdc:mga06r32_429255_c1 | nmdc:mga06r32_429255_c1_373_1167 | 253 |
| 519 | 3300061734 | Ga0530510_0003575 | Ga0530510_0003575_1784_2578 | 253 |
| 520 | 3300005834 | Ga0068851_10002068 | Ga0068851_1000206810 | 254 |
| 521 | 3300010375 | Ga0105239_10428620 | Ga0105239_104286202 | 254 |
| 522 | 3300013100 | Ga0157373_10146683 | Ga0157373_101466831 | 254 |
| 523 | 3300006038 | Ga0075365_10000307 | Ga0075365_100003074 | 255 |
| 524 | 3300048913 | Ga0496110_0000008 | Ga0496110_0000008_16836_17795 | 255 |
| 525 | 3300048914 | Ga0496111_0000004 | Ga0496111_0000004_89076_90035 | 255 |
| 526 | 3300050491 | nmdc:mga00v17_152267_c1 | nmdc:mga00v17_152267_c1_477_1277 | 255 |
| 527 | 3300050492 | nmdc:mga0yw44_231_c1 | nmdc:mga0yw44_231_c1_11433_12233 | 255 |
| 528 | 3300006038 | Ga0075365_10003397 | Ga0075365_100033973 | 256 |
| 529 | 3300006847 | Ga0075431_100002644 | Ga0075431_10000264416 | 256 |
| 530 | 3300007076 | Ga0075435_100331112 | Ga0075435_1003311122 | 256 |
| 531 | 3300009094 | Ga0111539_10005245 | Ga0111539_100052458 | 256 |
| 532 | 3300009147 | Ga0114129_10142177 | Ga0114129_101421774 | 256 |
| 533 | 3300025899 | Ga0207642_10015538 | Ga0207642_100155381 | 256 |
| 534 | 3300037312 | Ga0395899_0323964 | Ga0395899_0323964_56_859 | 256 |
| 535 | 3300037418 | Ga0395900_0037958 | Ga0395900_0037958_3142_3945 | 256 |
| 536 | 3300037466 | Ga0395898_0002611 | Ga0395898_0002611_3590_4393 | 256 |
| 537 | 3300037466 | Ga0395898_0023747 | Ga0395898_0023747_5218_6021 | 256 |
| 538 | 3300037471 | Ga0395905_0095615 | Ga0395905_0095615_896_1699 | 256 |
| 539 | 3300037471 | Ga0395905_0372601 | Ga0395905_0372601_94_897 | 256 |
| 540 | 3300038443 | Ga0395901_0077287 | Ga0395901_0077287_1101_1904 | 256 |
| 541 | 3300038443 | Ga0395901_0098579 | Ga0395901_0098579_1044_1847 | 256 |
| 542 | 3300050492 | nmdc:mga0yw44_196092_c1 | nmdc:mga0yw44_196092_c1_88_891 | 256 |
| 543 | 3300050507 | nmdc:mga05p37_179704_c1 | nmdc:mga05p37_179704_c1_1241_2044 | 256 |
| 544 | 3300050511 | nmdc:mga08y16_27710_c1 | nmdc:mga08y16_27710_c1_1847_2650 | 256 |
| 545 | 3300050513 | nmdc:mga0rr50_248220_c1 | nmdc:mga0rr50_248220_c1_243_1046 | 256 |
| 546 | 3300050515 | nmdc:mga0a205_47748_c1 | nmdc:mga0a205_47748_c1_1247_2050 | 256 |
| 547 | 3300005338 | Ga0068868_100005977 | Ga0068868_10000597712 | 257 |
| 548 | 3300020077 | Ga0206351_10664240 | Ga0206351_106642401 | 257 |
| 549 | 3300025904 | Ga0207647_10081100 | Ga0207647_100811002 | 257 |
| 550 | 3300026023 | Ga0207677_10029377 | Ga0207677_100293772 | 257 |
| 551 | 3300047317 | Ga0495604_0000802 | Ga0495604_0000802_7160_8038 | 257 |
| 552 | 3300009551 | Ga0105238_10001238 | Ga0105238_1000123812 | 259 |
| 553 | 3300010375 | Ga0105239_10507760 | Ga0105239_105077602 | 259 |
| 554 | 3300025924 | Ga0207694_10000067 | Ga0207694_1000006748 | 259 |
| 555 | 3300026075 | Ga0207708_10311270 | Ga0207708_103112702 | 259 |
| 556 | 3300046535 | Ga0495586_0000338 | Ga0495586_0000338_23734_24642 | 259 |
| 557 | 3300046642 | Ga0495634_0186448 | Ga0495634_0186448_44_934 | 259 |
| 558 | 3300046663 | Ga0495635_0000036 | Ga0495635_0000036_61678_62568 | 259 |
| 559 | 3300049593 | Ga0501077_0202885 | Ga0501077_0202885_93_944 | 259 |
| 560 | 3300005539 | Ga0068853_100001814 | Ga0068853_1000018144 | 260 |
| 561 | 3300005578 | Ga0068854_100000373 | Ga0068854_10000037312 | 260 |
| 562 | 3300005614 | Ga0068856_100024148 | Ga0068856_1000241488 | 260 |
| 563 | 3300025981 | Ga0207640_10002466 | Ga0207640_100024662 | 260 |
| 564 | 3300026041 | Ga0207639_10018969 | Ga0207639_100189694 | 260 |
| 565 | 3300026078 | Ga0207702_10060363 | Ga0207702_100603634 | 260 |
| 566 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_63176_64084 | 260 |
| 567 | 3300047446 | Ga0495679_010847 | Ga0495679_010847_861_1769 | 260 |
| 568 | 3300049741 | Ga0501079_0249703 | Ga0501079_0249703_464_1315 | 260 |
| 569 | 3300009094 | Ga0111539_10427115 | Ga0111539_104271152 | 261 |
| 570 | 3300025927 | Ga0207687_10312529 | Ga0207687_103125292 | 261 |
| 571 | 3300046459 | Ga0495629_0000014 | Ga0495629_0000014_50652_51572 | 261 |
| 572 | 3300046523 | Ga0495644_0000296 | Ga0495644_0000296_19734_20624 | 261 |
| 573 | 3300049581 | Ga0501047_0319929 | Ga0501047_0319929_137_1093 | 261 |
| 574 | 3300005937 | Ga0081455_10033111 | Ga0081455_100331116 | 262 |
| 575 | 3300046455 | Ga0495603_0015844 | Ga0495603_0015844_206_1093 | 262 |
| 576 | 3300048912 | Ga0496109_0362265 | Ga0496109_0362265_109_1038 | 262 |
| 577 | 3300049743 | Ga0501081_0222113 | Ga0501081_0222113_132_992 | 262 |
| 578 | 3300005341 | Ga0070691_10000009 | Ga0070691_1000000936 | 263 |
| 579 | 3300005937 | Ga0081455_10024603 | Ga0081455_100246034 | 264 |
| 580 | 3300046516 | Ga0495628_0000070 | Ga0495628_0000070_11842_12750 | 264 |
| 581 | 3300046536 | Ga0495587_0077002 | Ga0495587_0077002_351_1262 | 264 |
| 582 | 3300047322 | Ga0495680_0043784 | Ga0495680_0043784_552_1445 | 264 |
| 583 | 3300048088 | Ga0495602_0001188 | Ga0495602_0001188_13471_14379 | 264 |
| 584 | 3300049576 | Ga0501040_0065586 | Ga0501040_0065586_907_1806 | 264 |
| 585 | 3300049590 | Ga0501074_0092709 | Ga0501074_0092709_1098_2003 | 264 |
| 586 | 3300049591 | Ga0501075_0362475 | Ga0501075_0362475_110_1009 | 264 |
| 587 | 3300049592 | Ga0501076_0098986 | Ga0501076_0098986_887_1798 | 264 |
| 588 | 3300049824 | Ga0501045_0162884 | Ga0501045_0162884_483_1382 | 264 |
| 589 | 3300054114 | Ga0501084_0135654 | Ga0501084_0135654_972_1871 | 264 |
| 590 | 3300005337 | Ga0070682_100384602 | Ga0070682_1003846021 | 265 |
| 591 | 3300005343 | Ga0070687_100011944 | Ga0070687_1000119442 | 265 |
| 592 | 3300005344 | Ga0070661_100023036 | Ga0070661_1000230363 | 265 |
| 593 | 3300005345 | Ga0070692_10028477 | Ga0070692_100284774 | 265 |
| 594 | 3300005347 | Ga0070668_100271780 | Ga0070668_1002717802 | 265 |
| 595 | 3300005366 | Ga0070659_100001108 | Ga0070659_10000110816 | 265 |
| 596 | 3300005455 | Ga0070663_100032151 | Ga0070663_1000321514 | 265 |
| 597 | 3300005457 | Ga0070662_100308842 | Ga0070662_1003088422 | 265 |
| 598 | 3300005459 | Ga0068867_100075180 | Ga0068867_1000751802 | 265 |
| 599 | 3300005535 | Ga0070684_100043637 | Ga0070684_1000436371 | 265 |
| 600 | 3300005543 | Ga0070672_100021385 | Ga0070672_1000213854 | 265 |
| 601 | 3300005544 | Ga0070686_100015412 | Ga0070686_1000154122 | 265 |
| 602 | 3300005564 | Ga0070664_100390594 | Ga0070664_1003905942 | 265 |
| 603 | 3300005577 | Ga0068857_100042206 | Ga0068857_1000422064 | 265 |
| 604 | 3300005615 | Ga0070702_100154317 | Ga0070702_1001543172 | 265 |
| 605 | 3300005616 | Ga0068852_100053917 | Ga0068852_1000539174 | 265 |
| 606 | 3300005618 | Ga0068864_100537068 | Ga0068864_1005370682 | 265 |
| 607 | 3300005719 | Ga0068861_100078748 | Ga0068861_1000787482 | 265 |
| 608 | 3300006881 | Ga0068865_100195622 | Ga0068865_1001956222 | 265 |
| 609 | 3300009148 | Ga0105243_10012944 | Ga0105243_100129444 | 265 |
| 610 | 3300009551 | Ga0105238_10171748 | Ga0105238_101717483 | 265 |
| 611 | 3300009553 | Ga0105249_10530015 | Ga0105249_105300152 | 265 |
| 612 | 3300013307 | Ga0157372_10131545 | Ga0157372_101315454 | 265 |
| 613 | 3300025901 | Ga0207688_10013921 | Ga0207688_100139212 | 265 |
| 614 | 3300025909 | Ga0207705_10020753 | Ga0207705_100207536 | 265 |
| 615 | 3300025918 | Ga0207662_10012004 | Ga0207662_100120042 | 265 |
| 616 | 3300025919 | Ga0207657_10018050 | Ga0207657_100180505 | 265 |
| 617 | 3300025932 | Ga0207690_10023389 | Ga0207690_100233892 | 265 |
| 618 | 3300025933 | Ga0207706_10155286 | Ga0207706_101552862 | 265 |
| 619 | 3300025935 | Ga0207709_10072392 | Ga0207709_100723922 | 265 |
| 620 | 3300025938 | Ga0207704_10004866 | Ga0207704_100048666 | 265 |
| 621 | 3300025940 | Ga0207691_10025351 | Ga0207691_100253514 | 265 |
| 622 | 3300025941 | Ga0207711_10383602 | Ga0207711_103836022 | 265 |
| 623 | 3300025944 | Ga0207661_10130399 | Ga0207661_101303992 | 265 |
| 624 | 3300025972 | Ga0207668_10274238 | Ga0207668_102742382 | 265 |
| 625 | 3300026067 | Ga0207678_10038380 | Ga0207678_100383805 | 265 |
| 626 | 3300026075 | Ga0207708_10001660 | Ga0207708_1000166014 | 265 |
| 627 | 3300026089 | Ga0207648_10093083 | Ga0207648_100930832 | 265 |
| 628 | 3300026116 | Ga0207674_10053480 | Ga0207674_100534804 | 265 |
| 629 | 3300026142 | Ga0207698_10089841 | Ga0207698_100898412 | 265 |
| 630 | 3300028379 | Ga0268266_10069579 | Ga0268266_100695794 | 265 |
| 631 | 3300048903 | Ga0496100_0142244 | Ga0496100_0142244_495_1412 | 265 |
| 632 | 3300048909 | Ga0496106_0025678 | Ga0496106_0025678_3267_4184 | 265 |
| 633 | 3300048912 | Ga0496109_0070473 | Ga0496109_0070473_526_1443 | 265 |
| 634 | 3300048913 | Ga0496110_0138177 | Ga0496110_0138177_1017_1934 | 265 |
| 635 | 3300048916 | Ga0496113_0006959 | Ga0496113_0006959_282_1199 | 265 |
| 636 | 3300050492 | nmdc:mga0yw44_276040_c1 | nmdc:mga0yw44_276040_c1_138_1055 | 265 |
| 637 | 3300005337 | Ga0070682_100000016 | Ga0070682_100000016150 | 266 |
| 638 | 3300005356 | Ga0070674_100000028 | Ga0070674_10000002854 | 266 |
| 639 | 3300005614 | Ga0068856_100035899 | Ga0068856_1000358995 | 266 |
| 640 | 3300005718 | Ga0068866_10000045 | Ga0068866_1000004510 | 266 |
| 641 | 3300005840 | Ga0068870_10048106 | Ga0068870_100481061 | 266 |
| 642 | 3300009148 | Ga0105243_10339527 | Ga0105243_103395272 | 266 |
| 643 | 3300013307 | Ga0157372_10000064 | Ga0157372_1000006467 | 266 |
| 644 | 3300025899 | Ga0207642_10000050 | Ga0207642_1000005025 | 266 |
| 645 | 3300025935 | Ga0207709_10061777 | Ga0207709_100617772 | 266 |
| 646 | 3300025936 | Ga0207670_10099045 | Ga0207670_100990452 | 266 |
| 647 | 3300025937 | Ga0207669_10000014 | Ga0207669_1000001452 | 266 |
| 648 | 3300026078 | Ga0207702_10010610 | Ga0207702_100106105 | 266 |
| 649 | 3300028379 | Ga0268266_10419207 | Ga0268266_104192072 | 266 |
| 650 | 3300048916 | Ga0496113_0000003 | Ga0496113_0000003_9291_10250 | 266 |
| 651 | 3300053085 | Ga0495619_0000020 | Ga0495619_0000020_105169_106125 | 266 |
| 652 | 3300005841 | Ga0068863_100000080 | Ga0068863_10000008061 | 267 |
| 653 | 3300006847 | Ga0075431_100009078 | Ga0075431_1000090789 | 267 |
| 654 | 3300009093 | Ga0105240_10441809 | Ga0105240_104418092 | 267 |
| 655 | 3300009551 | Ga0105238_10132032 | Ga0105238_101320322 | 267 |
| 656 | 3300026088 | Ga0207641_10000304 | Ga0207641_1000030445 | 267 |
| 657 | 3300041491 | Ga0451833_0200162 | Ga0451833_0200162_571_1488 | 267 |
| 658 | 3300048913 | Ga0496110_0037066 | Ga0496110_0037066_3294_4193 | 267 |
| 659 | 3300050510 | nmdc:mga06r32_70499_c1 | nmdc:mga06r32_70499_c1_1900_2799 | 267 |
| 660 | 3300005614 | Ga0068856_100000186 | Ga0068856_10000018617 | 268 |
| 661 | 3300005937 | Ga0081455_10099992 | Ga0081455_100999923 | 268 |
| 662 | 3300013105 | Ga0157369_10000037 | Ga0157369_1000003798 | 268 |
| 663 | 3300026078 | Ga0207702_10000134 | Ga0207702_1000013425 | 268 |
| 664 | 3300046454 | Ga0495592_0121061 | Ga0495592_0121061_514_1443 | 268 |
| 665 | 3300046455 | Ga0495603_0000554 | Ga0495603_0000554_17314_18207 | 268 |
| 666 | 3300048918 | Ga0496115_0000074 | Ga0496115_0000074_24329_25243 | 268 |
| 667 | 3300049742 | Ga0501080_0226721 | Ga0501080_0226721_616_1536 | 268 |
| 668 | 3300049744 | Ga0501083_0274270 | Ga0501083_0274270_157_1077 | 268 |
| 669 | 3300005329 | Ga0070683_100001266 | Ga0070683_1000012669 | 269 |
| 670 | 3300005347 | Ga0070668_100002556 | Ga0070668_1000025569 | 269 |
| 671 | 3300005367 | Ga0070667_100012784 | Ga0070667_1000127847 | 269 |
| 672 | 3300005548 | Ga0070665_100056914 | Ga0070665_1000569142 | 269 |
| 673 | 3300005843 | Ga0068860_100057058 | Ga0068860_1000570584 | 269 |
| 674 | 3300005844 | Ga0068862_100005926 | Ga0068862_1000059265 | 269 |
| 675 | 3300009553 | Ga0105249_10008240 | Ga0105249_100082409 | 269 |
| 676 | 3300014326 | Ga0157380_10000118 | Ga0157380_1000011811 | 269 |
| 677 | 3300014968 | Ga0157379_10027803 | Ga0157379_100278032 | 269 |
| 678 | 3300025944 | Ga0207661_10000086 | Ga0207661_1000008621 | 269 |
| 679 | 3300025961 | Ga0207712_10011344 | Ga0207712_100113448 | 269 |
| 680 | 3300025972 | Ga0207668_10007542 | Ga0207668_100075423 | 269 |
| 681 | 3300025986 | Ga0207658_10010778 | Ga0207658_100107787 | 269 |
| 682 | 3300026075 | Ga0207708_10149994 | Ga0207708_101499942 | 269 |
| 683 | 3300028380 | Ga0268265_10008034 | Ga0268265_100080347 | 269 |
| 684 | 3300028381 | Ga0268264_10032479 | Ga0268264_100324792 | 269 |
| 685 | 3300046476 | Ga0495662_0000048 | Ga0495662_0000048_32062_32940 | 269 |
| 686 | 3300046476 | Ga0495662_0003775 | Ga0495662_0003775_785_1696 | 269 |
| 687 | 3300046515 | Ga0495620_0000119 | Ga0495620_0000119_2600_3484 | 269 |
| 688 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_75535_76443 | 269 |
| 689 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_40176_41084 | 269 |
| 690 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_128528_129496 | 269 |
| 691 | 3300048912 | Ga0496109_0000033 | Ga0496109_0000033_105635_106603 | 269 |
| 692 | 3300049591 | Ga0501075_0000598 | Ga0501075_0000598_8136_9014 | 269 |
| 693 | 3300053085 | Ga0495619_0053161 | Ga0495619_0053161_589_1467 | 269 |
| 694 | 3300001979 | JGI24740J21852_10000904 | JGI24740J21852_1000090413 | 270 |
| 695 | 3300005548 | Ga0070665_100001016 | Ga0070665_1000010165 | 270 |
| 696 | 3300005616 | Ga0068852_100000013 | Ga0068852_10000001349 | 270 |
| 697 | 3300005842 | Ga0068858_100000042 | Ga0068858_10000004251 | 270 |
| 698 | 3300005983 | Ga0081540_1000115 | Ga0081540_10001153 | 270 |
| 699 | 3300009176 | Ga0105242_10001870 | Ga0105242_1000187018 | 270 |
| 700 | 3300009177 | Ga0105248_10000089 | Ga0105248_1000008956 | 270 |
| 701 | 3300025321 | Ga0207656_10000144 | Ga0207656_100001444 | 270 |
| 702 | 3300025934 | Ga0207686_10000189 | Ga0207686_1000018947 | 270 |
| 703 | 3300025941 | Ga0207711_10000083 | Ga0207711_1000008356 | 270 |
| 704 | 3300026035 | Ga0207703_10000060 | Ga0207703_1000006081 | 270 |
| 705 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002314 | 270 |
| 706 | 3300028379 | Ga0268266_10000985 | Ga0268266_1000098537 | 270 |
| 707 | 3300028556 | Ga0265337_1000013 | Ga0265337_10000134 | 270 |
| 708 | 3300028558 | Ga0265326_10000012 | Ga0265326_10000012165 | 270 |
| 709 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003452 | 270 |
| 710 | 3300028666 | Ga0265336_10011220 | Ga0265336_100112203 | 270 |
| 711 | 3300029957 | Ga0265324_10000226 | Ga0265324_1000022628 | 270 |
| 712 | 3300031239 | Ga0265328_10004572 | Ga0265328_100045722 | 270 |
| 713 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001452 | 270 |
| 714 | 3300031250 | Ga0265331_10005677 | Ga0265331_100056775 | 270 |
| 715 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003452 | 270 |
| 716 | 3300031344 | Ga0265316_10022290 | Ga0265316_100222905 | 270 |
| 717 | 3300031711 | Ga0265314_10000044 | Ga0265314_1000004415 | 270 |
| 718 | 3300032126 | Ga0307415_100015192 | Ga0307415_1000151926 | 270 |
| 719 | 3300041486 | Ga0451807_2554897 | Ga0451807_2554897_702_1613 | 270 |
| 720 | 3300046459 | Ga0495629_0009501 | Ga0495629_0009501_4538_5467 | 270 |
| 721 | 3300046507 | Ga0495606_0000045 | Ga0495606_0000045_144406_145320 | 270 |
| 722 | 3300046514 | Ga0495618_0148667 | Ga0495618_0148667_278_1189 | 270 |
| 723 | 3300046517 | Ga0495630_0048552 | Ga0495630_0048552_1928_2839 | 270 |
| 724 | 3300046529 | Ga0495652_0002702 | Ga0495652_0002702_8436_9350 | 270 |
| 725 | 3300046536 | Ga0495587_0000446 | Ga0495587_0000446_7912_8832 | 270 |
| 726 | 3300046543 | Ga0495645_0029053 | Ga0495645_0029053_1094_2008 | 270 |
| 727 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_160765_161676 | 270 |
| 728 | 3300047321 | Ga0495676_0000252 | Ga0495676_0000252_25544_26452 | 270 |
| 729 | 3300047321 | Ga0495676_0007581 | Ga0495676_0007581_916_1827 | 270 |
| 730 | 3300047321 | Ga0495676_0093228 | Ga0495676_0093228_1023_1937 | 270 |
| 731 | 3300047322 | Ga0495680_0000741 | Ga0495680_0000741_28484_29395 | 270 |
| 732 | 3300048903 | Ga0496100_0000008 | Ga0496100_0000008_53439_54347 | 270 |
| 733 | 3300048904 | Ga0496101_0000016 | Ga0496101_0000016_62221_63129 | 270 |
| 734 | 3300048909 | Ga0496106_0000086 | Ga0496106_0000086_19815_20723 | 270 |
| 735 | 3300048910 | Ga0496107_0000009 | Ga0496107_0000009_53153_54061 | 270 |
| 736 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_206117_207031 | 270 |
| 737 | 3300048918 | Ga0496115_0000212 | Ga0496115_0000212_25841_26755 | 270 |
| 738 | 3300048918 | Ga0496115_0001537 | Ga0496115_0001537_3878_4795 | 270 |
| 739 | 3300048927 | Ga0496124_0191086 | Ga0496124_0191086_470_1384 | 270 |
| 740 | 3300049586 | Ga0501070_0022040 | Ga0501070_0022040_2431_3348 | 270 |
| 741 | 3300053085 | Ga0495619_0000015 | Ga0495619_0000015_5319_6203 | 270 |
| 742 | 3300053094 | Ga0500566_0001971 | Ga0500566_0001971_1022_1951 | 270 |
| 743 | 3300005329 | Ga0070683_100022950 | Ga0070683_1000229504 | 271 |
| 744 | 3300005329 | Ga0070683_100026568 | Ga0070683_1000265684 | 271 |
| 745 | 3300005329 | Ga0070683_100060529 | Ga0070683_1000605293 | 271 |
| 746 | 3300005333 | Ga0070677_10000018 | Ga0070677_1000001814 | 271 |
| 747 | 3300005335 | Ga0070666_10044022 | Ga0070666_100440222 | 271 |
| 748 | 3300005336 | Ga0070680_100025271 | Ga0070680_1000252717 | 271 |
| 749 | 3300005337 | Ga0070682_100000029 | Ga0070682_10000002996 | 271 |
| 750 | 3300005337 | Ga0070682_100275275 | Ga0070682_1002752752 | 271 |
| 751 | 3300005341 | Ga0070691_10146659 | Ga0070691_101466592 | 271 |
| 752 | 3300005356 | Ga0070674_100000003 | Ga0070674_100000003261 | 271 |
| 753 | 3300005367 | Ga0070667_100105361 | Ga0070667_1001053612 | 271 |
| 754 | 3300005455 | Ga0070663_100005232 | Ga0070663_1000052324 | 271 |
| 755 | 3300005456 | Ga0070678_100390347 | Ga0070678_1003903472 | 271 |
| 756 | 3300005457 | Ga0070662_100000008 | Ga0070662_100000008166 | 271 |
| 757 | 3300005458 | Ga0070681_10120339 | Ga0070681_101203394 | 271 |
| 758 | 3300005458 | Ga0070681_10384651 | Ga0070681_103846512 | 271 |
| 759 | 3300005459 | Ga0068867_100001503 | Ga0068867_10000150316 | 271 |
| 760 | 3300005530 | Ga0070679_100000507 | Ga0070679_1000005078 | 271 |
| 761 | 3300005530 | Ga0070679_100000674 | Ga0070679_10000067427 | 271 |
| 762 | 3300005547 | Ga0070693_100000093 | Ga0070693_10000009334 | 271 |
| 763 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012079 | 271 |
| 764 | 3300005548 | Ga0070665_100058921 | Ga0070665_1000589214 | 271 |
| 765 | 3300005548 | Ga0070665_100280015 | Ga0070665_1002800152 | 271 |
| 766 | 3300005618 | Ga0068864_100000044 | Ga0068864_10000004453 | 271 |
| 767 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002146 | 271 |
| 768 | 3300005718 | Ga0068866_10009088 | Ga0068866_100090883 | 271 |
| 769 | 3300005841 | Ga0068863_100362307 | Ga0068863_1003623072 | 271 |
| 770 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003577 | 271 |
| 771 | 3300005843 | Ga0068860_100090940 | Ga0068860_1000909402 | 271 |
| 772 | 3300005985 | Ga0081539_10000674 | Ga0081539_1000067458 | 271 |
| 773 | 3300006163 | Ga0070715_10000015 | Ga0070715_1000001526 | 271 |
| 774 | 3300006846 | Ga0075430_100054701 | Ga0075430_1000547013 | 271 |
| 775 | 3300006852 | Ga0075433_10000058 | Ga0075433_1000005846 | 271 |
| 776 | 3300009098 | Ga0105245_10000053 | Ga0105245_1000005331 | 271 |
| 777 | 3300009098 | Ga0105245_10000488 | Ga0105245_1000048829 | 271 |
| 778 | 3300009101 | Ga0105247_10000169 | Ga0105247_1000016942 | 271 |
| 779 | 3300009176 | Ga0105242_10000017 | Ga0105242_1000001731 | 271 |
| 780 | 3300009553 | Ga0105249_10000095 | Ga0105249_1000009570 | 271 |
| 781 | 3300013104 | Ga0157370_10272017 | Ga0157370_102720172 | 271 |
| 782 | 3300013297 | Ga0157378_10341331 | Ga0157378_103413312 | 271 |
| 783 | 3300013308 | Ga0157375_10000076 | Ga0157375_1000007654 | 271 |
| 784 | 3300013308 | Ga0157375_10033964 | Ga0157375_100339643 | 271 |
| 785 | 3300014968 | Ga0157379_10442128 | Ga0157379_104421281 | 271 |
| 786 | 3300017792 | Ga0163161_10000274 | Ga0163161_100002746 | 271 |
| 787 | 3300025893 | Ga0207682_10000047 | Ga0207682_1000004714 | 271 |
| 788 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001463 | 271 |
| 789 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003463 | 271 |
| 790 | 3300025900 | Ga0207710_10000103 | Ga0207710_1000010365 | 271 |
| 791 | 3300025903 | Ga0207680_10066138 | Ga0207680_100661382 | 271 |
| 792 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001398 | 271 |
| 793 | 3300025912 | Ga0207707_10089776 | Ga0207707_100897762 | 271 |
| 794 | 3300025916 | Ga0207663_10004253 | Ga0207663_100042537 | 271 |
| 795 | 3300025917 | Ga0207660_10011227 | Ga0207660_100112276 | 271 |
| 796 | 3300025921 | Ga0207652_10000177 | Ga0207652_1000017712 | 271 |
| 797 | 3300025921 | Ga0207652_10007489 | Ga0207652_100074896 | 271 |
| 798 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002169 | 271 |
| 799 | 3300025927 | Ga0207687_10000241 | Ga0207687_1000024129 | 271 |
| 800 | 3300025932 | Ga0207690_10024415 | Ga0207690_100244154 | 271 |
| 801 | 3300025933 | Ga0207706_10000016 | Ga0207706_100000169 | 271 |
| 802 | 3300025934 | Ga0207686_10000016 | Ga0207686_1000001630 | 271 |
| 803 | 3300025934 | Ga0207686_10000029 | Ga0207686_10000029125 | 271 |
| 804 | 3300025937 | Ga0207669_10000024 | Ga0207669_1000002443 | 271 |
| 805 | 3300025944 | Ga0207661_10005229 | Ga0207661_100052298 | 271 |
| 806 | 3300025944 | Ga0207661_10009721 | Ga0207661_100097217 | 271 |
| 807 | 3300025944 | Ga0207661_10065981 | Ga0207661_100659814 | 271 |
| 808 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003564 | 271 |
| 809 | 3300026023 | Ga0207677_10000429 | Ga0207677_1000042914 | 271 |
| 810 | 3300026035 | Ga0207703_10000067 | Ga0207703_10000067110 | 271 |
| 811 | 3300026067 | Ga0207678_10012641 | Ga0207678_100126413 | 271 |
| 812 | 3300026067 | Ga0207678_10165577 | Ga0207678_101655772 | 271 |
| 813 | 3300026089 | Ga0207648_10000230 | Ga0207648_1000023059 | 271 |
| 814 | 3300026095 | Ga0207676_10000043 | Ga0207676_1000004352 | 271 |
| 815 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023439 | 271 |
| 816 | 3300028379 | Ga0268266_10000748 | Ga0268266_1000074816 | 271 |
| 817 | 3300028379 | Ga0268266_10299200 | Ga0268266_102992002 | 271 |
| 818 | 3300028563 | Ga0265319_1000044 | Ga0265319_100004452 | 271 |
| 819 | 3300028800 | Ga0265338_10000297 | Ga0265338_1000029752 | 271 |
| 820 | 3300031241 | Ga0265325_10012241 | Ga0265325_100122417 | 271 |
| 821 | 3300031250 | Ga0265331_10038269 | Ga0265331_100382693 | 271 |
| 822 | 3300035172 | Ga0373955_0168607 | Ga0373955_0168607_95_982 | 271 |
| 823 | 3300035724 | Ga0373933_0256038 | Ga0373933_0256038_32_919 | 271 |
| 824 | 3300044694 | Ga0466963_0000021 | Ga0466963_0000021_4629_5516 | 271 |
| 825 | 3300046454 | Ga0495592_0000214 | Ga0495592_0000214_8489_9379 | 271 |
| 826 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_48381_49289 | 271 |
| 827 | 3300046463 | Ga0495653_0081107 | Ga0495653_0081107_1002_1892 | 271 |
| 828 | 3300046473 | Ga0495582_0000012 | Ga0495582_0000012_79873_80763 | 271 |
| 829 | 3300046499 | Ga0495594_0000004 | Ga0495594_0000004_155623_156552 | 271 |
| 830 | 3300046511 | Ga0495608_0001397 | Ga0495608_0001397_3239_4129 | 271 |
| 831 | 3300046511 | Ga0495608_0005626 | Ga0495608_0005626_7128_8018 | 271 |
| 832 | 3300046514 | Ga0495618_0000087 | Ga0495618_0000087_56935_57825 | 271 |
| 833 | 3300046516 | Ga0495628_0002369 | Ga0495628_0002369_4261_5151 | 271 |
| 834 | 3300046516 | Ga0495628_0015291 | Ga0495628_0015291_560_1450 | 271 |
| 835 | 3300046517 | Ga0495630_0105735 | Ga0495630_0105735_636_1544 | 271 |
| 836 | 3300046533 | Ga0495640_0018734 | Ga0495640_0018734_2360_3250 | 271 |
| 837 | 3300046533 | Ga0495640_0053417 | Ga0495640_0053417_654_1583 | 271 |
| 838 | 3300046537 | Ga0495598_0000768 | Ga0495598_0000768_3636_4526 | 271 |
| 839 | 3300046539 | Ga0495621_0023623 | Ga0495621_0023623_818_1705 | 271 |
| 840 | 3300046557 | Ga0495622_0000016 | Ga0495622_0000016_127752_128681 | 271 |
| 841 | 3300046615 | Ga0495656_0000226 | Ga0495656_0000226_18339_19229 | 271 |
| 842 | 3300046642 | Ga0495634_0000755 | Ga0495634_0000755_13453_14346 | 271 |
| 843 | 3300046660 | Ga0495625_0000020 | Ga0495625_0000020_159587_160510 | 271 |
| 844 | 3300046675 | Ga0495657_0014465 | Ga0495657_0014465_4736_5623 | 271 |
| 845 | 3300046678 | Ga0495599_0007160 | Ga0495599_0007160_3303_4211 | 271 |
| 846 | 3300046680 | Ga0495646_0050297 | Ga0495646_0050297_696_1616 | 271 |
| 847 | 3300046681 | Ga0495647_0000013 | Ga0495647_0000013_35479_36387 | 271 |
| 848 | 3300046683 | Ga0495658_0000024 | Ga0495658_0000024_32142_33032 | 271 |
| 849 | 3300046684 | Ga0495669_0000251 | Ga0495669_0000251_5091_5999 | 271 |
| 850 | 3300046689 | Ga0495613_0000159 | Ga0495613_0000159_40676_41566 | 271 |
| 851 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_41524_42426 | 271 |
| 852 | 3300046690 | Ga0495624_0066395 | Ga0495624_0066395_923_1813 | 271 |
| 853 | 3300046691 | Ga0495670_0003761 | Ga0495670_0003761_5417_6307 | 271 |
| 854 | 3300046694 | Ga0495649_0001084 | Ga0495649_0001084_2499_3407 | 271 |
| 855 | 3300046809 | Ga0495600_0002351 | Ga0495600_0002351_1378_2268 | 271 |
| 856 | 3300047315 | Ga0495581_0167208 | Ga0495581_0167208_62_952 | 271 |
| 857 | 3300047319 | Ga0495674_0000025 | Ga0495674_0000025_93168_94097 | 271 |
| 858 | 3300047321 | Ga0495676_0189322 | Ga0495676_0189322_87_977 | 271 |
| 859 | 3300047322 | Ga0495680_0000286 | Ga0495680_0000286_27581_28489 | 271 |
| 860 | 3300047472 | Ga0495686_0031778 | Ga0495686_0031778_1087_2016 | 271 |
| 861 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_301197_302105 | 271 |
| 862 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_301197_302105 | 271 |
| 863 | 3300048904 | Ga0496101_0162034 | Ga0496101_0162034_440_1402 | 271 |
| 864 | 3300048905 | Ga0496102_0000054 | Ga0496102_0000054_118659_119591 | 271 |
| 865 | 3300048906 | Ga0496103_0000178 | Ga0496103_0000178_8017_8949 | 271 |
| 866 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_76828_77736 | 271 |
| 867 | 3300048908 | Ga0496105_0000031 | Ga0496105_0000031_59485_60393 | 271 |
| 868 | 3300048908 | Ga0496105_0184314 | Ga0496105_0184314_275_1162 | 271 |
| 869 | 3300048909 | Ga0496106_0000048 | Ga0496106_0000048_58701_59609 | 271 |
| 870 | 3300048909 | Ga0496106_0000052 | Ga0496106_0000052_37932_38840 | 271 |
| 871 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_192257_193165 | 271 |
| 872 | 3300048910 | Ga0496107_0195485 | Ga0496107_0195485_102_1010 | 271 |
| 873 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_164911_165819 | 271 |
| 874 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_164873_165781 | 271 |
| 875 | 3300048913 | Ga0496110_0003088 | Ga0496110_0003088_8572_9480 | 271 |
| 876 | 3300048914 | Ga0496111_0061425 | Ga0496111_0061425_54_1007 | 271 |
| 877 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_723578_724468 | 271 |
| 878 | 3300048917 | Ga0496114_0026192 | Ga0496114_0026192_285_1199 | 271 |
| 879 | 3300048927 | Ga0496124_0071588 | Ga0496124_0071588_796_1758 | 271 |
| 880 | 3300049568 | Ga0501031_0000172 | Ga0501031_0000172_24165_25124 | 271 |
| 881 | 3300049569 | Ga0501032_0000902 | Ga0501032_0000902_19029_19988 | 271 |
| 882 | 3300049570 | Ga0501033_0000211 | Ga0501033_0000211_43019_43978 | 271 |
| 883 | 3300049571 | Ga0501034_0003939 | Ga0501034_0003939_3934_4893 | 271 |
| 884 | 3300049572 | Ga0501036_0000841 | Ga0501036_0000841_11788_12747 | 271 |
| 885 | 3300049573 | Ga0501037_0000120 | Ga0501037_0000120_22956_23915 | 271 |
| 886 | 3300049574 | Ga0501038_0000139 | Ga0501038_0000139_49455_50414 | 271 |
| 887 | 3300049575 | Ga0501039_0006697 | Ga0501039_0006697_5043_6002 | 271 |
| 888 | 3300049576 | Ga0501040_0079999 | Ga0501040_0079999_954_1913 | 271 |
| 889 | 3300049576 | Ga0501040_0199644 | Ga0501040_0199644_146_1033 | 271 |
| 890 | 3300049578 | Ga0501042_0075317 | Ga0501042_0075317_223_1113 | 271 |
| 891 | 3300049579 | Ga0501043_0000203 | Ga0501043_0000203_49582_50541 | 271 |
| 892 | 3300049580 | Ga0501046_0000194 | Ga0501046_0000194_49454_50413 | 271 |
| 893 | 3300049581 | Ga0501047_0000287 | Ga0501047_0000287_45338_46297 | 271 |
| 894 | 3300049582 | Ga0501048_0000004 | Ga0501048_0000004_50225_51184 | 271 |
| 895 | 3300049584 | Ga0501068_0003838 | Ga0501068_0003838_1812_2771 | 271 |
| 896 | 3300049585 | Ga0501069_0054695 | Ga0501069_0054695_1088_2047 | 271 |
| 897 | 3300049586 | Ga0501070_0000079 | Ga0501070_0000079_948_1907 | 271 |
| 898 | 3300049586 | Ga0501070_0156923 | Ga0501070_0156923_85_1041 | 271 |
| 899 | 3300049587 | Ga0501071_0025386 | Ga0501071_0025386_2296_3255 | 271 |
| 900 | 3300049590 | Ga0501074_0005099 | Ga0501074_0005099_2871_3830 | 271 |
| 901 | 3300049590 | Ga0501074_0071035 | Ga0501074_0071035_92_1048 | 271 |
| 902 | 3300049741 | Ga0501079_0000318 | Ga0501079_0000318_17520_18479 | 271 |
| 903 | 3300049741 | Ga0501079_0033296 | Ga0501079_0033296_746_1702 | 271 |
| 904 | 3300049742 | Ga0501080_0004716 | Ga0501080_0004716_3371_4330 | 271 |
| 905 | 3300049742 | Ga0501080_0039515 | Ga0501080_0039515_1923_2879 | 271 |
| 906 | 3300049744 | Ga0501083_0008391 | Ga0501083_0008391_3163_4122 | 271 |
| 907 | 3300049822 | Ga0501035_0000059 | Ga0501035_0000059_11791_12750 | 271 |
| 908 | 3300049823 | Ga0501044_0001354 | Ga0501044_0001354_10213_11172 | 271 |
| 909 | 3300049823 | Ga0501044_0065596 | Ga0501044_0065596_1098_2054 | 271 |
| 910 | 3300050515 | nmdc:mga0a205_9_c2 | nmdc:mga0a205_9_c2_3984_4877 | 271 |
| 911 | 3300053077 | Ga0495601_0000344 | Ga0495601_0000344_4723_5631 | 271 |
| 912 | 3300053078 | Ga0495612_0000403 | Ga0495612_0000403_12543_13496 | 271 |
| 913 | 3300053083 | Ga0495655_0000003 | Ga0495655_0000003_127063_127995 | 271 |
| 914 | 3300053084 | Ga0495595_0000251 | Ga0495595_0000251_16873_17763 | 271 |
| 915 | 3300053096 | Ga0500641_0009337 | Ga0500641_0009337_1572_2492 | 271 |
| 916 | 3300053123 | Ga0500614_000039 | Ga0500614_000039_10796_11704 | 271 |
| 917 | 3300053129 | Ga0500628_000002 | Ga0500628_000002_127063_127995 | 271 |
| 918 | 3300060346 | Ga0587111_0027391 | Ga0587111_0027391_221_1111 | 271 |
| 919 | 3300060353 | Ga0501082_0004892 | Ga0501082_0004892_8737_9696 | 271 |
| 920 | 3300005456 | Ga0070678_100011408 | Ga0070678_1000114083 | 272 |
| 921 | 3300005543 | Ga0070672_100000129 | Ga0070672_10000012911 | 272 |
| 922 | 3300006881 | Ga0068865_100000001 | Ga0068865_100000001231 | 272 |
| 923 | 3300009177 | Ga0105248_10214980 | Ga0105248_102149802 | 272 |
| 924 | 3300013104 | Ga0157370_10154130 | Ga0157370_101541303 | 272 |
| 925 | 3300013297 | Ga0157378_10312796 | Ga0157378_103127962 | 272 |
| 926 | 3300014326 | Ga0157380_10000163 | Ga0157380_1000016314 | 272 |
| 927 | 3300014968 | Ga0157379_10338625 | Ga0157379_103386252 | 272 |
| 928 | 3300025935 | Ga0207709_10106828 | Ga0207709_101068282 | 272 |
| 929 | 3300025938 | Ga0207704_10000004 | Ga0207704_1000000418 | 272 |
| 930 | 3300025940 | Ga0207691_10000062 | Ga0207691_1000006233 | 272 |
| 931 | 3300025941 | Ga0207711_10070744 | Ga0207711_100707442 | 272 |
| 932 | 3300026121 | Ga0207683_10019153 | Ga0207683_100191534 | 272 |
| 933 | 3300044694 | Ga0466963_0028742 | Ga0466963_0028742_2282_3181 | 272 |
| 934 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_338049_338993 | 272 |
| 935 | 3300046663 | Ga0495635_0150255 | Ga0495635_0150255_324_1220 | 272 |
| 936 | 3300046674 | Ga0495588_0000217 | Ga0495588_0000217_51863_52816 | 272 |
| 937 | 3300046681 | Ga0495647_0002426 | Ga0495647_0002426_4667_5611 | 272 |
| 938 | 3300046689 | Ga0495613_0118969 | Ga0495613_0118969_365_1261 | 272 |
| 939 | 3300046690 | Ga0495624_0001178 | Ga0495624_0001178_159_1103 | 272 |
| 940 | 3300048089 | Ga0495614_0068210 | Ga0495614_0068210_32_928 | 272 |
| 941 | 3300048905 | Ga0496102_0211415 | Ga0496102_0211415_663_1625 | 272 |
| 942 | 3300048906 | Ga0496103_0043658 | Ga0496103_0043658_69_1031 | 272 |
| 943 | 3300048919 | Ga0496116_0000014 | Ga0496116_0000014_410217_411179 | 272 |
| 944 | 3300048920 | Ga0496117_0001369 | Ga0496117_0001369_23633_24595 | 272 |
| 945 | 3300048921 | Ga0496118_0000389 | Ga0496118_0000389_23800_24762 | 272 |
| 946 | 3300048921 | Ga0496118_0019280 | Ga0496118_0019280_5119_6081 | 272 |
| 947 | 3300048922 | Ga0496119_0000937 | Ga0496119_0000937_2653_3615 | 272 |
| 948 | 3300048922 | Ga0496119_0072208 | Ga0496119_0072208_78_1037 | 272 |
| 949 | 3300048923 | Ga0496120_0004305 | Ga0496120_0004305_11071_12033 | 272 |
| 950 | 3300048924 | Ga0496121_0071566 | Ga0496121_0071566_540_1502 | 272 |
| 951 | 3300049744 | Ga0501083_0019756 | Ga0501083_0019756_18_980 | 272 |
| 952 | 3300001977 | JGI24746J21847_1003604 | JGI24746J21847_10036042 | 273 |
| 953 | 3300005329 | Ga0070683_100000367 | Ga0070683_10000036717 | 273 |
| 954 | 3300005330 | Ga0070690_100140722 | Ga0070690_1001407222 | 273 |
| 955 | 3300005335 | Ga0070666_10013143 | Ga0070666_100131433 | 273 |
| 956 | 3300005344 | Ga0070661_100000026 | Ga0070661_100000026113 | 273 |
| 957 | 3300005347 | Ga0070668_100188703 | Ga0070668_1001887032 | 273 |
| 958 | 3300005354 | Ga0070675_100000015 | Ga0070675_10000001548 | 273 |
| 959 | 3300005366 | Ga0070659_100001759 | Ga0070659_1000017592 | 273 |
| 960 | 3300005367 | Ga0070667_100097367 | Ga0070667_1000973673 | 273 |
| 961 | 3300005436 | Ga0070713_100000014 | Ga0070713_10000001449 | 273 |
| 962 | 3300005439 | Ga0070711_100018181 | Ga0070711_1000181812 | 273 |
| 963 | 3300005535 | Ga0070684_100278799 | Ga0070684_1002787991 | 273 |
| 964 | 3300005535 | Ga0070684_100283635 | Ga0070684_1002836352 | 273 |
| 965 | 3300009098 | Ga0105245_10000045 | Ga0105245_1000004581 | 273 |
| 966 | 3300013102 | Ga0157371_10001481 | Ga0157371_100014819 | 273 |
| 967 | 3300013104 | Ga0157370_10015755 | Ga0157370_100157552 | 273 |
| 968 | 3300013104 | Ga0157370_10061195 | Ga0157370_100611953 | 273 |
| 969 | 3300022467 | Ga0224712_10011362 | Ga0224712_100113622 | 273 |
| 970 | 3300025903 | Ga0207680_10007643 | Ga0207680_100076435 | 273 |
| 971 | 3300025915 | Ga0207693_10002610 | Ga0207693_1000261018 | 273 |
| 972 | 3300025920 | Ga0207649_10000025 | Ga0207649_10000025124 | 273 |
| 973 | 3300025926 | Ga0207659_10000032 | Ga0207659_1000003227 | 273 |
| 974 | 3300025927 | Ga0207687_10000023 | Ga0207687_1000002381 | 273 |
| 975 | 3300025928 | Ga0207700_10000009 | Ga0207700_1000000978 | 273 |
| 976 | 3300025928 | Ga0207700_10078468 | Ga0207700_100784682 | 273 |
| 977 | 3300025932 | Ga0207690_10001315 | Ga0207690_100013152 | 273 |
| 978 | 3300025944 | Ga0207661_10000064 | Ga0207661_1000006417 | 273 |
| 979 | 3300025972 | Ga0207668_10059269 | Ga0207668_100592693 | 273 |
| 980 | 3300036401 | Ga0373937_0025996 | Ga0373937_0025996_804_1703 | 273 |
| 981 | 3300044842 | Ga0466957_0016840 | Ga0466957_0016840_1434_2396 | 273 |
| 982 | 3300045976 | Ga0466967_0000004 | Ga0466967_0000004_96599_97558 | 273 |
| 983 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_88860_89825 | 273 |
| 984 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_89540_90505 | 273 |
| 985 | 3300046683 | Ga0495658_0030522 | Ga0495658_0030522_447_1412 | 273 |
| 986 | 3300046689 | Ga0495613_0000040 | Ga0495613_0000040_112043_112990 | 273 |
| 987 | 3300046809 | Ga0495600_0026502 | Ga0495600_0026502_1519_2466 | 273 |
| 988 | 3300047317 | Ga0495604_0001037 | Ga0495604_0001037_13529_14476 | 273 |
| 989 | 3300047317 | Ga0495604_0003372 | Ga0495604_0003372_9835_10782 | 273 |
| 990 | 3300047317 | Ga0495604_0063409 | Ga0495604_0063409_727_1626 | 273 |
| 991 | 3300047444 | Ga0495675_0000019 | Ga0495675_0000019_23137_24102 | 273 |
| 992 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_47065_48012 | 273 |
| 993 | 3300048907 | Ga0496104_0350445 | Ga0496104_0350445_218_1147 | 273 |
| 994 | 3300048911 | Ga0496108_0051614 | Ga0496108_0051614_110_1066 | 273 |
| 995 | 3300048912 | Ga0496109_0000146 | Ga0496109_0000146_58359_59315 | 273 |
| 996 | 3300048913 | Ga0496110_0047861 | Ga0496110_0047861_2049_2948 | 273 |
| 997 | 3300048916 | Ga0496113_0305065 | Ga0496113_0305065_43_942 | 273 |
| 998 | 3300049575 | Ga0501039_0067117 | Ga0501039_0067117_1146_2042 | 273 |
| 999 | 3300049576 | Ga0501040_0095431 | Ga0501040_0095431_1018_1914 | 273 |
| 1000 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_44835_45782 | 273 |
| 1001 | 3300053077 | Ga0495601_0008897 | Ga0495601_0008897_4903_5799 | 273 |
| 1002 | 3300053078 | Ga0495612_0000100 | Ga0495612_0000100_25305_26201 | 273 |
| 1003 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_321454_322419 | 273 |
| 1004 | 3300053085 | Ga0495619_0000046 | Ga0495619_0000046_63709_64674 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rje-assembly1.cif.gz_T | complex iii2 from candida albicans, inz-5 bound | 0.9046 | 56 | 235 |
| 7jrg-assembly1.cif.gz_C | plant mitochondrial complex iii2 from vigna radiata | 0.8763 | 60 | 250 |
| 2d2c-assembly1.cif.gz_A | crystal structure of cytochrome b6f complex with dbmib from m. laminosus | 0.8705 | 52 | 243 |
| 5gup-assembly1.cif.gz_7 | cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 | 0.8682 | 55 | 249 |
| 3cwb-assembly1.cif.gz_C | chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d | 0.8642 | 55 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d2cA00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8705 | 52 | 243 | 1.20.810.10 |
| af_Q37311_1_385_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8671 | 56 | 249 | 1.20.810.10 |
| 3cwbC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8642 | 55 | 249 | 1.20.810.10 |
| 1vf5A00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8582 | 47 | 243 | 1.20.810.10 |
| af_P03879_1_263_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8456 | 43 | 235 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B0I5F4-F1-model_v4 | deleted | 0.9504 | 69 | 243 |
|
| AF-A0A8B0SW37-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9473 | 60 | 170 |
GO:0005743
GO:0009055 GO:0016491 GO:0022904 GO:0046872 |
| AF-A0A399ZUQ1-F1-model_v4 | Cytochrome b/b6 N-terminal region profile domain-containing protein | 0.9457 | 63 | 235 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 |
| AF-A0A521IEW8-F1-model_v4 | Cytochrome b/b6 N-terminal region profile domain-containing protein | 0.9415 | 63 | 235 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 |
| AF-A0A533T573-F1-model_v4 | Cytochrome B | 0.9401 | 61 | 243 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar