F487904
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1002 | 423 | 2004 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10061089|Ga0111539_100610894 |
| Length | 276 |
| Sequence | MTFPAVVGCHGRNVASLLSLAKVVSWPVWLSPGFFRYSVAAGHGYSSDQMKAADAQSLRIEIRPGETVSALLIRPQQARACYVFAHGAGAGMAHSSMETIAAGLGERGIATLRYQFPYMEKGSKRPDAPAVAHAAVRAAVAEAGRCCPSLPLIAGGKSFGGRMTSQAQALSPLPGVGGLAFLGFPLHPAGKPSSERAKHLADVKIPMLFLQGTRDALAELRLLEPVVKELGSRGRLHLLDGADHSFHVLKSSGRNDREVLDEALDAFAAWVDGIAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 241 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 242 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 243 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 244 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 245 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 378 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 379 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 380 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 388 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 390 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 392 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 393 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 396 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 397 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 403 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 406 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 407 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 408 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 409 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 410 | 2791355199 | |||
| 411 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 412 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 413 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 414 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 415 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 416 | 2904699407 | |||
| 417 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 418 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 419 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 420 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 421 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 422 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 423 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.48 |
| Nodule | 1.2 |
| Rhizoplane | 6.39 |
| Rhizosphere | 76.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10061089 | 3300009094 | Bacteria | 4464 |
| 2 | JGI24744J21845_10003077 | 3300002077 | Bacteria | 3418 |
| 3 | JGI25151J46595_10026222 | 3300003187 | Bacteria | 2356 |
| 4 | JGI25406J46586_10000053 | 3300003203 | Bacteria | 53627 |
| 5 | rootH1_10032258 | 3300003323 | Bacteria | 2987 |
| 6 | JGI25404J52841_10000607 | 3300003659 | Bacteria | 5363 |
| 7 | JGI25404J52841_10006761 | 3300003659 | Bacteria | 2406 |
| 8 | JGI25404J52841_10007695 | 3300003659 | Bacteria | 2283 |
| 9 | Ga0055526_1003550 | 3300003771 | Bacteria | 9828 |
| 10 | Ga0055526_1022860 | 3300003771 | Bacteria | 2108 |
| 11 | Ga0055524_1007614 | 3300003775 | Bacteria | 4578 |
| 12 | Ga0055524_1012951 | 3300003775 | Bacteria | 3174 |
| 13 | Ga0055531_10004270 | 3300003794 | Bacteria | 8779 |
| 14 | Ga0055531_10011319 | 3300003794 | Bacteria | 4321 |
| 15 | Ga0055531_10013753 | 3300003794 | Bacteria | 3707 |
| 16 | Ga0065707_10115043 | 3300005295 | Bacteria | 2279 |
| 17 | Ga0070676_10032114 | 3300005328 | Bacteria | 3006 |
| 18 | Ga0070690_100472282 | 3300005330 | Bacteria | 934 |
| 19 | Ga0070670_100037213 | 3300005331 | Bacteria | 4187 |
| 20 | Ga0070670_100390160 | 3300005331 | Unclassified | 1228 |
| 21 | Ga0068869_100099600 | 3300005334 | Bacteria | 2197 |
| 22 | Ga0068869_100339507 | 3300005334 | Bacteria | 1222 |
| 23 | Ga0068869_100512121 | 3300005334 | Bacteria | 1003 |
| 24 | Ga0070666_10007661 | 3300005335 | Bacteria | 6666 |
| 25 | Ga0070682_100004502 | 3300005337 | Bacteria | 7739 |
| 26 | Ga0068868_100053379 | 3300005338 | Bacteria | 3184 |
| 27 | Ga0068868_100090241 | 3300005338 | Bacteria | 2468 |
| 28 | Ga0070660_100003389 | 3300005339 | Bacteria | 10964 |
| 29 | Ga0070689_100241826 | 3300005340 | Bacteria | 1487 |
| 30 | Ga0070661_100009747 | 3300005344 | Bacteria | 6659 |
| 31 | Ga0070661_100142406 | 3300005344 | Bacteria | 1808 |
| 32 | Ga0070661_100733888 | 3300005344 | Bacteria | 807 |
| 33 | Ga0070668_100013269 | 3300005347 | Bacteria | 6148 |
| 34 | Ga0070668_100021395 | 3300005347 | Bacteria | 4885 |
| 35 | Ga0070668_100049961 | 3300005347 | Bacteria | 3218 |
| 36 | Ga0070668_100084205 | 3300005347 | Bacteria | 2497 |
| 37 | Ga0070668_100126243 | 3300005347 | Bacteria | 2049 |
| 38 | Ga0070669_100048155 | 3300005353 | Bacteria | 3111 |
| 39 | Ga0070669_100052275 | 3300005353 | Bacteria | 2988 |
| 40 | Ga0070669_100554451 | 3300005353 | Bacteria | 958 |
| 41 | Ga0070675_100001220 | 3300005354 | Bacteria | 18692 |
| 42 | Ga0070675_100106122 | 3300005354 | Bacteria | 2371 |
| 43 | Ga0070675_100157356 | 3300005354 | Bacteria | 1952 |
| 44 | Ga0070671_100125426 | 3300005355 | Bacteria | 2161 |
| 45 | Ga0070671_100130284 | 3300005355 | Bacteria | 2118 |
| 46 | Ga0070674_100042527 | 3300005356 | Bacteria | 3087 |
| 47 | Ga0070674_100107362 | 3300005356 | Bacteria | 2044 |
| 48 | Ga0070674_100224232 | 3300005356 | Bacteria | 1464 |
| 49 | Ga0070674_100267266 | 3300005356 | Bacteria | 1350 |
| 50 | Ga0070674_100285551 | 3300005356 | Bacteria | 1310 |
| 51 | Ga0070674_100409920 | 3300005356 | Bacteria | 1109 |
| 52 | Ga0070674_100798623 | 3300005356 | Bacteria | 815 |
| 53 | Ga0070673_100000479 | 3300005364 | Bacteria | 21257 |
| 54 | Ga0070673_100005052 | 3300005364 | Bacteria | 8415 |
| 55 | Ga0070673_100075753 | 3300005364 | Bacteria | 2715 |
| 56 | Ga0070673_100102034 | 3300005364 | Bacteria | 2364 |
| 57 | Ga0070673_100120137 | 3300005364 | Bacteria | 2191 |
| 58 | Ga0070659_100012064 | 3300005366 | Bacteria | 6398 |
| 59 | Ga0070667_100067544 | 3300005367 | Bacteria | 3040 |
| 60 | Ga0070667_100109981 | 3300005367 | Bacteria | 2389 |
| 61 | Ga0070667_100595094 | 3300005367 | Bacteria | 1019 |
| 62 | Ga0070701_10046520 | 3300005438 | Bacteria | 2231 |
| 63 | Ga0070711_100018468 | 3300005439 | Bacteria | 4454 |
| 64 | Ga0070700_100099052 | 3300005441 | Bacteria | 1917 |
| 65 | Ga0070700_100116428 | 3300005441 | Bacteria | 1784 |
| 66 | Ga0070700_100130390 | 3300005441 | Bacteria | 1696 |
| 67 | Ga0070700_100748395 | 3300005441 | Bacteria | 782 |
| 68 | Ga0070663_100017170 | 3300005455 | Bacteria | 4717 |
| 69 | Ga0070663_100030261 | 3300005455 | Bacteria | 3708 |
| 70 | Ga0070678_100019281 | 3300005456 | Bacteria | 4443 |
| 71 | Ga0070678_100039965 | 3300005456 | Bacteria | 3315 |
| 72 | Ga0070678_100051740 | 3300005456 | Bacteria | 2979 |
| 73 | Ga0070678_100093224 | 3300005456 | Bacteria | 2315 |
| 74 | Ga0070678_100113408 | 3300005456 | Bacteria | 2125 |
| 75 | Ga0070678_100235000 | 3300005456 | Bacteria | 1530 |
| 76 | Ga0070662_100042557 | 3300005457 | Bacteria | 3245 |
| 77 | Ga0070662_100116653 | 3300005457 | Bacteria | 2041 |
| 78 | Ga0070681_10076134 | 3300005458 | Bacteria | 3315 |
| 79 | Ga0068867_100065718 | 3300005459 | Bacteria | 2700 |
| 80 | Ga0068867_100079873 | 3300005459 | Bacteria | 2462 |
| 81 | Ga0068867_100291663 | 3300005459 | Bacteria | 1341 |
| 82 | Ga0068867_100835774 | 3300005459 | Bacteria | 824 |
| 83 | Ga0070685_10139205 | 3300005466 | Bacteria | 1526 |
| 84 | Ga0070685_10160849 | 3300005466 | Bacteria | 1431 |
| 85 | Ga0070685_10448771 | 3300005466 | Bacteria | 903 |
| 86 | Ga0070698_100882766 | 3300005471 | Bacteria | 839 |
| 87 | Ga0070684_100976059 | 3300005535 | Bacteria | 795 |
| 88 | Ga0068853_100113556 | 3300005539 | Bacteria | 2409 |
| 89 | Ga0068853_100326132 | 3300005539 | Bacteria | 1424 |
| 90 | Ga0068853_100595310 | 3300005539 | Bacteria | 1050 |
| 91 | Ga0068853_100897194 | 3300005539 | Bacteria | 851 |
| 92 | Ga0070672_100008509 | 3300005543 | Bacteria | 7024 |
| 93 | Ga0070672_100075100 | 3300005543 | Bacteria | 2698 |
| 94 | Ga0070672_100214744 | 3300005543 | Bacteria | 1612 |
| 95 | Ga0070672_100324303 | 3300005543 | Bacteria | 1309 |
| 96 | Ga0070686_100020285 | 3300005544 | Bacteria | 3930 |
| 97 | Ga0070686_100764046 | 3300005544 | Bacteria | 776 |
| 98 | Ga0070696_100035783 | 3300005546 | Bacteria | 3420 |
| 99 | Ga0070696_100236811 | 3300005546 | Bacteria | 1375 |
| 100 | Ga0070693_100112353 | 3300005547 | Bacteria | 1678 |
| 101 | Ga0070665_100000211 | 3300005548 | Bacteria | 100358 |
| 102 | Ga0070665_100004360 | 3300005548 | Bacteria | 14884 |
| 103 | Ga0070665_100015880 | 3300005548 | Bacteria | 7558 |
| 104 | Ga0070665_100043289 | 3300005548 | Bacteria | 4524 |
| 105 | Ga0070665_100043750 | 3300005548 | Bacteria | 4499 |
| 106 | Ga0070665_100044260 | 3300005548 | Bacteria | 4471 |
| 107 | Ga0070665_100099984 | 3300005548 | Bacteria | 2904 |
| 108 | Ga0070665_100103906 | 3300005548 | Bacteria | 2844 |
| 109 | Ga0070665_100109114 | 3300005548 | Bacteria | 2770 |
| 110 | Ga0070665_100234724 | 3300005548 | Bacteria | 1834 |
| 111 | Ga0070665_100402485 | 3300005548 | Bacteria | 1377 |
| 112 | Ga0070665_100423660 | 3300005548 | Bacteria | 1340 |
| 113 | Ga0068855_100000686 | 3300005563 | Bacteria | 41326 |
| 114 | Ga0068855_100005666 | 3300005563 | Bacteria | 15250 |
| 115 | Ga0070664_100035394 | 3300005564 | Bacteria | 4192 |
| 116 | Ga0070664_100053079 | 3300005564 | Bacteria | 3435 |
| 117 | Ga0070664_100826694 | 3300005564 | Bacteria | 867 |
| 118 | Ga0068857_100137632 | 3300005577 | Bacteria | 2206 |
| 119 | Ga0068852_100001192 | 3300005616 | Bacteria | 17243 |
| 120 | Ga0068852_100100551 | 3300005616 | Bacteria | 2609 |
| 121 | Ga0068852_100488223 | 3300005616 | Bacteria | 1225 |
| 122 | Ga0068859_100000414 | 3300005617 | Bacteria | 42532 |
| 123 | Ga0068859_100076320 | 3300005617 | Bacteria | 3392 |
| 124 | Ga0068859_100084314 | 3300005617 | Bacteria | 3223 |
| 125 | Ga0068859_100097520 | 3300005617 | Bacteria | 2993 |
| 126 | Ga0068859_100194909 | 3300005617 | Bacteria | 2110 |
| 127 | Ga0068859_100249133 | 3300005617 | Bacteria | 1867 |
| 128 | Ga0068859_100304490 | 3300005617 | Bacteria | 1687 |
| 129 | Ga0068859_100444783 | 3300005617 | Bacteria | 1392 |
| 130 | Ga0068864_100010492 | 3300005618 | Bacteria | 7655 |
| 131 | Ga0068864_100013481 | 3300005618 | Bacteria | 6776 |
| 132 | Ga0068864_100032170 | 3300005618 | Bacteria | 4455 |
| 133 | Ga0068864_100112221 | 3300005618 | Bacteria | 2429 |
| 134 | Ga0068864_100133739 | 3300005618 | Bacteria | 2231 |
| 135 | Ga0068866_10149453 | 3300005718 | Bacteria | 1351 |
| 136 | Ga0068861_100000358 | 3300005719 | Bacteria | 26076 |
| 137 | Ga0068861_100035625 | 3300005719 | Bacteria | 3688 |
| 138 | Ga0068861_100136011 | 3300005719 | Bacteria | 2000 |
| 139 | Ga0068861_100136925 | 3300005719 | Bacteria | 1994 |
| 140 | Ga0068861_100282613 | 3300005719 | Bacteria | 1430 |
| 141 | Ga0068851_10000587 | 3300005834 | Bacteria | 15782 |
| 142 | Ga0068851_10109691 | 3300005834 | Bacteria | 1472 |
| 143 | Ga0068870_10040871 | 3300005840 | Bacteria | 2407 |
| 144 | Ga0068870_10259444 | 3300005840 | Bacteria | 1081 |
| 145 | Ga0068863_100021364 | 3300005841 | Bacteria | 6177 |
| 146 | Ga0068863_100025725 | 3300005841 | Bacteria | 5613 |
| 147 | Ga0068863_100078929 | 3300005841 | Bacteria | 3117 |
| 148 | Ga0068863_100087559 | 3300005841 | Bacteria | 2951 |
| 149 | Ga0068863_100202201 | 3300005841 | Bacteria | 1911 |
| 150 | Ga0068863_100308506 | 3300005841 | Bacteria | 1536 |
| 151 | Ga0068863_100636779 | 3300005841 | Bacteria | 1057 |
| 152 | Ga0068858_100046117 | 3300005842 | Bacteria | 4041 |
| 153 | Ga0068858_100156792 | 3300005842 | Bacteria | 2142 |
| 154 | Ga0068858_100193540 | 3300005842 | Bacteria | 1922 |
| 155 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 156 | Ga0068860_100015398 | 3300005843 | Bacteria | 7472 |
| 157 | Ga0068860_100060092 | 3300005843 | Bacteria | 3613 |
| 158 | Ga0068860_100085141 | 3300005843 | Bacteria | 3007 |
| 159 | Ga0068860_100145234 | 3300005843 | Bacteria | 2282 |
| 160 | Ga0068860_100220037 | 3300005843 | Bacteria | 1844 |
| 161 | Ga0068860_100467297 | 3300005843 | Bacteria | 1256 |
| 162 | Ga0068862_100000047 | 3300005844 | Bacteria | 151607 |
| 163 | Ga0068862_100003056 | 3300005844 | Bacteria | 14580 |
| 164 | Ga0068862_100038278 | 3300005844 | Bacteria | 4067 |
| 165 | Ga0068862_100062032 | 3300005844 | Bacteria | 3214 |
| 166 | Ga0068862_100080054 | 3300005844 | Bacteria | 2833 |
| 167 | Ga0068862_100137438 | 3300005844 | Bacteria | 2167 |
| 168 | Ga0068862_100139068 | 3300005844 | Bacteria | 2154 |
| 169 | Ga0068862_100821827 | 3300005844 | Bacteria | 909 |
| 170 | Ga0081455_10003779 | 3300005937 | Bacteria | 17287 |
| 171 | Ga0081455_10006696 | 3300005937 | Bacteria | 12314 |
| 172 | Ga0081455_10029442 | 3300005937 | Bacteria | 5006 |
| 173 | Ga0081455_10165348 | 3300005937 | Bacteria | 1691 |
| 174 | Ga0081538_10000833 | 3300005981 | Bacteria | 33440 |
| 175 | Ga0081540_1001291 | 3300005983 | Bacteria | 21876 |
| 176 | Ga0081540_1003930 | 3300005983 | Bacteria | 11560 |
| 177 | Ga0081540_1004182 | 3300005983 | Bacteria | 11108 |
| 178 | Ga0081540_1005649 | 3300005983 | Bacteria | 9303 |
| 179 | Ga0081540_1015542 | 3300005983 | Bacteria | 4815 |
| 180 | Ga0081540_1017120 | 3300005983 | Bacteria | 4500 |
| 181 | Ga0081540_1025179 | 3300005983 | Bacteria | 3432 |
| 182 | Ga0081540_1027397 | 3300005983 | Bacteria | 3229 |
| 183 | Ga0081540_1028497 | 3300005983 | Bacteria | 3135 |
| 184 | Ga0081540_1068214 | 3300005983 | Bacteria | 1658 |
| 185 | Ga0081540_1178028 | 3300005983 | Bacteria | 800 |
| 186 | Ga0081539_10000471 | 3300005985 | Bacteria | 85272 |
| 187 | Ga0070717_10116045 | 3300006028 | Bacteria | 2289 |
| 188 | Ga0070717_10500508 | 3300006028 | Bacteria | 1098 |
| 189 | Ga0070717_10511642 | 3300006028 | Bacteria | 1086 |
| 190 | Ga0075365_10042747 | 3300006038 | Bacteria | 2964 |
| 191 | Ga0075365_10047906 | 3300006038 | Bacteria | 2811 |
| 192 | Ga0075365_10079600 | 3300006038 | Bacteria | 2217 |
| 193 | Ga0075365_10108564 | 3300006038 | Bacteria | 1905 |
| 194 | Ga0075365_10429453 | 3300006038 | Bacteria | 933 |
| 195 | Ga0075368_10013501 | 3300006042 | Bacteria | 3001 |
| 196 | Ga0075368_10023583 | 3300006042 | Bacteria | 2351 |
| 197 | Ga0075368_10091381 | 3300006042 | Bacteria | 1245 |
| 198 | Ga0075368_10140553 | 3300006042 | Bacteria | 1006 |
| 199 | Ga0075363_100283740 | 3300006048 | Bacteria | 958 |
| 200 | Ga0075364_10314867 | 3300006051 | Bacteria | 1066 |
| 201 | Ga0075364_10380246 | 3300006051 | Bacteria | 963 |
| 202 | Ga0070716_100044833 | 3300006173 | Bacteria | 2479 |
| 203 | Ga0070712_100128740 | 3300006175 | Bacteria | 1916 |
| 204 | Ga0070712_100193237 | 3300006175 | Bacteria | 1594 |
| 205 | Ga0075362_10039542 | 3300006177 | Bacteria | 2074 |
| 206 | Ga0075367_10008988 | 3300006178 | Bacteria | 5201 |
| 207 | Ga0075367_10026390 | 3300006178 | Bacteria | 3294 |
| 208 | Ga0075367_10146151 | 3300006178 | Bacteria | 1466 |
| 209 | Ga0075369_10133574 | 3300006186 | Bacteria | 1129 |
| 210 | Ga0075366_10009502 | 3300006195 | Bacteria | 5429 |
| 211 | Ga0075366_10050259 | 3300006195 | Bacteria | 2475 |
| 212 | Ga0075366_10062005 | 3300006195 | Bacteria | 2223 |
| 213 | Ga0097621_100021909 | 3300006237 | Bacteria | 4952 |
| 214 | Ga0097621_100050466 | 3300006237 | Bacteria | 3384 |
| 215 | Ga0097621_100125903 | 3300006237 | Bacteria | 2176 |
| 216 | Ga0097621_100380537 | 3300006237 | Bacteria | 1260 |
| 217 | Ga0097621_100879718 | 3300006237 | Bacteria | 833 |
| 218 | Ga0075370_10000147 | 3300006353 | Bacteria | 24004 |
| 219 | Ga0075370_10072696 | 3300006353 | Bacteria | 1968 |
| 220 | Ga0075370_10350643 | 3300006353 | Bacteria | 882 |
| 221 | Ga0068871_100128781 | 3300006358 | Bacteria | 2144 |
| 222 | Ga0068871_100494140 | 3300006358 | Bacteria | 1102 |
| 223 | Ga0068871_100783575 | 3300006358 | Bacteria | 878 |
| 224 | Ga0075428_100094610 | 3300006844 | Bacteria | 3257 |
| 225 | Ga0075428_100163564 | 3300006844 | Bacteria | 2414 |
| 226 | Ga0075428_100185986 | 3300006844 | Bacteria | 2248 |
| 227 | Ga0075430_100672211 | 3300006846 | Bacteria | 854 |
| 228 | Ga0075431_100548955 | 3300006847 | Bacteria | 1143 |
| 229 | Ga0075431_100903374 | 3300006847 | Bacteria | 853 |
| 230 | Ga0068865_100008486 | 3300006881 | Bacteria | 6352 |
| 231 | Ga0068865_100015739 | 3300006881 | Bacteria | 4826 |
| 232 | Ga0068865_100109960 | 3300006881 | Bacteria | 2032 |
| 233 | Ga0068865_100136061 | 3300006881 | Bacteria | 1847 |
| 234 | Ga0068865_100335716 | 3300006881 | Bacteria | 1220 |
| 235 | Ga0068865_100430594 | 3300006881 | Bacteria | 1087 |
| 236 | Ga0068865_100595436 | 3300006881 | Bacteria | 934 |
| 237 | Ga0097620_100000414 | 3300006931 | Bacteria | 42532 |
| 238 | Ga0097620_100076320 | 3300006931 | Bacteria | 3392 |
| 239 | Ga0097620_100084312 | 3300006931 | Bacteria | 3223 |
| 240 | Ga0097620_100097527 | 3300006931 | Bacteria | 2993 |
| 241 | Ga0097620_100194921 | 3300006931 | Bacteria | 2110 |
| 242 | Ga0097620_100249127 | 3300006931 | Bacteria | 1867 |
| 243 | Ga0097620_100304524 | 3300006931 | Bacteria | 1687 |
| 244 | Ga0097620_100444784 | 3300006931 | Bacteria | 1392 |
| 245 | Ga0075435_100118143 | 3300007076 | Bacteria | 2210 |
| 246 | Ga0075435_100128910 | 3300007076 | Bacteria | 2116 |
| 247 | Ga0099795_10023630 | 3300007788 | Bacteria | 2041 |
| 248 | Ga0099795_10041773 | 3300007788 | Bacteria | 1634 |
| 249 | Ga0105240_10000495 | 3300009093 | Bacteria | 72639 |
| 250 | Ga0105240_10024484 | 3300009093 | Bacteria | 7954 |
| 251 | Ga0105240_10141191 | 3300009093 | Bacteria | 2879 |
| 252 | Ga0105240_10158538 | 3300009093 | Bacteria | 2690 |
| 253 | Ga0105240_10226551 | 3300009093 | Bacteria | 2175 |
| 254 | Ga0105240_10248640 | 3300009093 | Bacteria | 2058 |
| 255 | Ga0111539_10463516 | 3300009094 | Bacteria | 1475 |
| 256 | Ga0111539_10464661 | 3300009094 | Bacteria | 1473 |
| 257 | Ga0111539_10766903 | 3300009094 | Bacteria | 1123 |
| 258 | Ga0105245_10004316 | 3300009098 | Bacteria | 12584 |
| 259 | Ga0105245_10193005 | 3300009098 | Bacteria | 1952 |
| 260 | Ga0105247_10022692 | 3300009101 | Bacteria | 3780 |
| 261 | Ga0105247_10359340 | 3300009101 | Bacteria | 1026 |
| 262 | Ga0114129_10064760 | 3300009147 | Bacteria | 5101 |
| 263 | Ga0114129_10136245 | 3300009147 | Bacteria | 3369 |
| 264 | Ga0114129_10206512 | 3300009147 | Bacteria | 2657 |
| 265 | Ga0114129_10815684 | 3300009147 | Bacteria | 1189 |
| 266 | Ga0105243_10020748 | 3300009148 | Bacteria | 4985 |
| 267 | Ga0105243_10058200 | 3300009148 | Bacteria | 3079 |
| 268 | Ga0105243_10086957 | 3300009148 | Bacteria | 2565 |
| 269 | Ga0105243_10106563 | 3300009148 | Bacteria | 2337 |
| 270 | Ga0105243_10110587 | 3300009148 | Bacteria | 2298 |
| 271 | Ga0105243_10157612 | 3300009148 | Bacteria | 1954 |
| 272 | Ga0105243_10184244 | 3300009148 | Bacteria | 1818 |
| 273 | Ga0105243_10747896 | 3300009148 | Bacteria | 958 |
| 274 | Ga0105241_10006238 | 3300009174 | Bacteria | 8789 |
| 275 | Ga0105241_10292311 | 3300009174 | Bacteria | 1395 |
| 276 | Ga0105242_10617578 | 3300009176 | Bacteria | 1049 |
| 277 | Ga0105248_10107747 | 3300009177 | Bacteria | 3142 |
| 278 | Ga0105248_10268827 | 3300009177 | Bacteria | 1920 |
| 279 | Ga0105248_10298774 | 3300009177 | Bacteria | 1813 |
| 280 | Ga0105248_10795765 | 3300009177 | Bacteria | 1067 |
| 281 | Ga0105248_10796537 | 3300009177 | Bacteria | 1067 |
| 282 | Ga0105237_10006381 | 3300009545 | Bacteria | 13086 |
| 283 | Ga0105237_10011342 | 3300009545 | Bacteria | 9430 |
| 284 | Ga0105237_10012122 | 3300009545 | Bacteria | 9099 |
| 285 | Ga0105237_10021683 | 3300009545 | Bacteria | 6602 |
| 286 | Ga0105237_10075633 | 3300009545 | Bacteria | 3358 |
| 287 | Ga0105238_10004494 | 3300009551 | Bacteria | 13820 |
| 288 | Ga0105238_10043206 | 3300009551 | Bacteria | 4561 |
| 289 | Ga0105238_10683922 | 3300009551 | Bacteria | 1037 |
| 290 | Ga0105249_10069096 | 3300009553 | Bacteria | 3260 |
| 291 | Ga0105249_10129440 | 3300009553 | Bacteria | 2408 |
| 292 | Ga0105249_10220819 | 3300009553 | Bacteria | 1865 |
| 293 | Ga0105249_10230409 | 3300009553 | Bacteria | 1827 |
| 294 | Ga0105249_10238325 | 3300009553 | Bacteria | 1797 |
| 295 | Ga0105249_11560800 | 3300009553 | Bacteria | 733 |
| 296 | Ga0105239_10039029 | 3300010375 | Bacteria | 5202 |
| 297 | Ga0105239_10207482 | 3300010375 | Bacteria | 2196 |
| 298 | Ga0105246_10153441 | 3300011119 | Bacteria | 1746 |
| 299 | Ga0105246_10319065 | 3300011119 | Bacteria | 1262 |
| 300 | Ga0157371_10248399 | 3300013102 | Bacteria | 1280 |
| 301 | Ga0157370_10016536 | 3300013104 | Bacteria | 7464 |
| 302 | Ga0157370_10920810 | 3300013104 | Bacteria | 793 |
| 303 | Ga0157369_10000836 | 3300013105 | Bacteria | 39329 |
| 304 | Ga0157374_10146697 | 3300013296 | Bacteria | 2292 |
| 305 | Ga0157374_10194313 | 3300013296 | Bacteria | 1986 |
| 306 | Ga0157374_10865595 | 3300013296 | Bacteria | 921 |
| 307 | Ga0157378_10002185 | 3300013297 | Bacteria | 17349 |
| 308 | Ga0157378_10007639 | 3300013297 | Bacteria | 9438 |
| 309 | Ga0157378_10022662 | 3300013297 | Bacteria | 5527 |
| 310 | Ga0157378_10418168 | 3300013297 | Bacteria | 1324 |
| 311 | Ga0157378_10679850 | 3300013297 | Bacteria | 1047 |
| 312 | Ga0163162_10027341 | 3300013306 | Bacteria | 5641 |
| 313 | Ga0163162_10047907 | 3300013306 | Bacteria | 4282 |
| 314 | Ga0163162_10150638 | 3300013306 | Bacteria | 2444 |
| 315 | Ga0163162_10182967 | 3300013306 | Bacteria | 2222 |
| 316 | Ga0163162_10217745 | 3300013306 | Bacteria | 2039 |
| 317 | Ga0163162_10373681 | 3300013306 | Bacteria | 1559 |
| 318 | Ga0163162_10754799 | 3300013306 | Bacteria | 1092 |
| 319 | Ga0157372_10001071 | 3300013307 | Bacteria | 29897 |
| 320 | Ga0157372_10032191 | 3300013307 | Bacteria | 5747 |
| 321 | Ga0157375_10012569 | 3300013308 | Bacteria | 7513 |
| 322 | Ga0157375_10044095 | 3300013308 | Bacteria | 4329 |
| 323 | Ga0157375_10079099 | 3300013308 | Bacteria | 3323 |
| 324 | Ga0157375_10130585 | 3300013308 | Bacteria | 2631 |
| 325 | Ga0157375_10188077 | 3300013308 | Bacteria | 2219 |
| 326 | Ga0157375_10248099 | 3300013308 | Bacteria | 1941 |
| 327 | Ga0157375_10261710 | 3300013308 | Bacteria | 1891 |
| 328 | Ga0163163_10000029 | 3300014325 | Bacteria | 174973 |
| 329 | Ga0163163_10007518 | 3300014325 | Bacteria | 9617 |
| 330 | Ga0163163_10014471 | 3300014325 | Bacteria | 7251 |
| 331 | Ga0163163_10015227 | 3300014325 | Bacteria | 7104 |
| 332 | Ga0163163_10032136 | 3300014325 | Bacteria | 5070 |
| 333 | Ga0163163_10121004 | 3300014325 | Bacteria | 2652 |
| 334 | Ga0163163_10123465 | 3300014325 | Bacteria | 2625 |
| 335 | Ga0163163_10237779 | 3300014325 | Bacteria | 1871 |
| 336 | Ga0157380_10011388 | 3300014326 | Bacteria | 6427 |
| 337 | Ga0157380_10060575 | 3300014326 | Bacteria | 3025 |
| 338 | Ga0157380_10082654 | 3300014326 | Bacteria | 2629 |
| 339 | Ga0157380_10103813 | 3300014326 | Bacteria | 2372 |
| 340 | Ga0157380_10137405 | 3300014326 | Bacteria | 2094 |
| 341 | Ga0157380_10275600 | 3300014326 | Bacteria | 1536 |
| 342 | Ga0157380_10324256 | 3300014326 | Bacteria | 1429 |
| 343 | Ga0157380_10611800 | 3300014326 | Bacteria | 1080 |
| 344 | Ga0157377_10128168 | 3300014745 | Bacteria | 1546 |
| 345 | Ga0157377_10225520 | 3300014745 | Bacteria | 1202 |
| 346 | Ga0157377_10295659 | 3300014745 | Bacteria | 1067 |
| 347 | Ga0157379_10023505 | 3300014968 | Bacteria | 5471 |
| 348 | Ga0157379_10051920 | 3300014968 | Bacteria | 3660 |
| 349 | Ga0157379_10110137 | 3300014968 | Bacteria | 2473 |
| 350 | Ga0157379_10191004 | 3300014968 | Bacteria | 1851 |
| 351 | Ga0157379_10294214 | 3300014968 | Unclassified | 1479 |
| 352 | Ga0157379_10310436 | 3300014968 | Bacteria | 1439 |
| 353 | Ga0157379_10615614 | 3300014968 | Bacteria | 1014 |
| 354 | Ga0157376_10125627 | 3300014969 | Bacteria | 2281 |
| 355 | Ga0157376_10296489 | 3300014969 | Bacteria | 1529 |
| 356 | Ga0182005_1055548 | 3300015265 | Bacteria | 1079 |
| 357 | Ga0163161_10028786 | 3300017792 | Bacteria | 3947 |
| 358 | Ga0163161_10282904 | 3300017792 | Bacteria | 1301 |
| 359 | Ga0163161_10389405 | 3300017792 | Bacteria | 1115 |
| 360 | Ga0163161_10498034 | 3300017792 | Bacteria | 992 |
| 361 | Ga0163161_10709337 | 3300017792 | Bacteria | 838 |
| 362 | Ga0213876_10044034 | 3300021384 | Bacteria | 2359 |
| 363 | Ga0209759_1001908 | 3300025256 | Bacteria | 10225 |
| 364 | Ga0209673_1016132 | 3300025273 | Bacteria | 2807 |
| 365 | Ga0209130_1012625 | 3300025284 | Bacteria | 2200 |
| 366 | Ga0209675_1030851 | 3300025291 | Bacteria | 1273 |
| 367 | Ga0209676_1000639 | 3300025292 | Bacteria | 50356 |
| 368 | Ga0209676_1001001 | 3300025292 | Bacteria | 33180 |
| 369 | Ga0209676_1047419 | 3300025292 | Bacteria | 1155 |
| 370 | Ga0209025_1001467 | 3300025294 | Bacteria | 30758 |
| 371 | Ga0209564_1000419 | 3300025295 | Bacteria | 74653 |
| 372 | Ga0209564_1001318 | 3300025295 | Bacteria | 26574 |
| 373 | Ga0209758_1003680 | 3300025297 | Bacteria | 13631 |
| 374 | Ga0209758_1031785 | 3300025297 | Bacteria | 2158 |
| 375 | Ga0209758_1057233 | 3300025297 | Bacteria | 1312 |
| 376 | Ga0209758_1072444 | 3300025297 | Unclassified | 1078 |
| 377 | Ga0209050_1001840 | 3300025298 | Bacteria | 20553 |
| 378 | Ga0209050_1006556 | 3300025298 | Bacteria | 6848 |
| 379 | Ga0209256_1000455 | 3300025299 | Bacteria | 61874 |
| 380 | Ga0209256_1001180 | 3300025299 | Bacteria | 29391 |
| 381 | Ga0209051_1002091 | 3300025303 | Bacteria | 15051 |
| 382 | Ga0209051_1002649 | 3300025303 | Bacteria | 12522 |
| 383 | Ga0209257_1000238 | 3300025304 | Bacteria | 128576 |
| 384 | Ga0209257_1001766 | 3300025304 | Bacteria | 23946 |
| 385 | Ga0209257_1002420 | 3300025304 | Bacteria | 18636 |
| 386 | Ga0207656_10004251 | 3300025321 | Bacteria | 4987 |
| 387 | Ga0207656_10033768 | 3300025321 | Unclassified | 2133 |
| 388 | Ga0207682_10124632 | 3300025893 | Bacteria | 1146 |
| 389 | Ga0207642_10103291 | 3300025899 | Bacteria | 1435 |
| 390 | Ga0207710_10036801 | 3300025900 | Bacteria | 2159 |
| 391 | Ga0207710_10115891 | 3300025900 | Bacteria | 1276 |
| 392 | Ga0207688_10039021 | 3300025901 | Bacteria | 2638 |
| 393 | Ga0207688_10349343 | 3300025901 | Bacteria | 911 |
| 394 | Ga0207680_10000476 | 3300025903 | Bacteria | 18981 |
| 395 | Ga0207647_10065771 | 3300025904 | Bacteria | 2200 |
| 396 | Ga0207645_10076034 | 3300025907 | Bacteria | 2150 |
| 397 | Ga0207645_10099802 | 3300025907 | Bacteria | 1872 |
| 398 | Ga0207645_10123485 | 3300025907 | Bacteria | 1682 |
| 399 | Ga0207643_10028714 | 3300025908 | Bacteria | 3092 |
| 400 | Ga0207643_10034934 | 3300025908 | Bacteria | 2818 |
| 401 | Ga0207705_10209621 | 3300025909 | Bacteria | 1478 |
| 402 | Ga0207705_10469815 | 3300025909 | Bacteria | 976 |
| 403 | Ga0207654_10009388 | 3300025911 | Bacteria | 4968 |
| 404 | Ga0207654_10036809 | 3300025911 | Bacteria | 2736 |
| 405 | Ga0207707_10007468 | 3300025912 | Bacteria | 9522 |
| 406 | Ga0207695_10000358 | 3300025913 | Bacteria | 104469 |
| 407 | Ga0207695_10004971 | 3300025913 | Bacteria | 17897 |
| 408 | Ga0207671_10002648 | 3300025914 | Bacteria | 18817 |
| 409 | Ga0207671_10157962 | 3300025914 | Bacteria | 1755 |
| 410 | Ga0207693_10176987 | 3300025915 | Bacteria | 1678 |
| 411 | Ga0207663_10045180 | 3300025916 | Bacteria | 2708 |
| 412 | Ga0207663_10404123 | 3300025916 | Bacteria | 1045 |
| 413 | Ga0207657_10023504 | 3300025919 | Bacteria | 5738 |
| 414 | Ga0207649_10129885 | 3300025920 | Bacteria | 1710 |
| 415 | Ga0207649_10191589 | 3300025920 | Bacteria | 1438 |
| 416 | Ga0207649_10278019 | 3300025920 | Bacteria | 1216 |
| 417 | Ga0207681_10031738 | 3300025923 | Bacteria | 3452 |
| 418 | Ga0207681_10054747 | 3300025923 | Bacteria | 2714 |
| 419 | Ga0207681_10094497 | 3300025923 | Bacteria | 2142 |
| 420 | Ga0207681_10386743 | 3300025923 | Bacteria | 1127 |
| 421 | Ga0207681_10648389 | 3300025923 | Bacteria | 875 |
| 422 | Ga0207694_10017133 | 3300025924 | Bacteria | 5474 |
| 423 | Ga0207694_10035310 | 3300025924 | Bacteria | 3835 |
| 424 | Ga0207694_10193577 | 3300025924 | Bacteria | 1653 |
| 425 | Ga0207694_10511624 | 3300025924 | Bacteria | 1006 |
| 426 | Ga0207650_10069290 | 3300025925 | Bacteria | 2650 |
| 427 | Ga0207650_10079549 | 3300025925 | Bacteria | 2483 |
| 428 | Ga0207650_10197695 | 3300025925 | Bacteria | 1609 |
| 429 | Ga0207659_10023857 | 3300025926 | Bacteria | 4090 |
| 430 | Ga0207659_10559398 | 3300025926 | Bacteria | 973 |
| 431 | Ga0207687_10005087 | 3300025927 | Bacteria | 8710 |
| 432 | Ga0207687_10110261 | 3300025927 | Bacteria | 2041 |
| 433 | Ga0207687_10246384 | 3300025927 | Bacteria | 1418 |
| 434 | Ga0207700_10025267 | 3300025928 | Bacteria | 4123 |
| 435 | Ga0207700_10164979 | 3300025928 | Bacteria | 1843 |
| 436 | Ga0207644_10139822 | 3300025931 | Bacteria | 1863 |
| 437 | Ga0207706_10047522 | 3300025933 | Bacteria | 3796 |
| 438 | Ga0207706_10070656 | 3300025933 | Bacteria | 3071 |
| 439 | Ga0207706_10087082 | 3300025933 | Bacteria | 2746 |
| 440 | Ga0207706_10131561 | 3300025933 | Bacteria | 2201 |
| 441 | Ga0207706_10241654 | 3300025933 | Bacteria | 1579 |
| 442 | Ga0207706_10474640 | 3300025933 | Bacteria | 1081 |
| 443 | Ga0207706_10567183 | 3300025933 | Bacteria | 976 |
| 444 | Ga0207709_10005342 | 3300025935 | Bacteria | 7309 |
| 445 | Ga0207709_10018788 | 3300025935 | Bacteria | 3876 |
| 446 | Ga0207709_10109038 | 3300025935 | Bacteria | 1847 |
| 447 | Ga0207670_10028354 | 3300025936 | Bacteria | 3554 |
| 448 | Ga0207670_10086056 | 3300025936 | Bacteria | 2210 |
| 449 | Ga0207670_10476414 | 3300025936 | Bacteria | 1010 |
| 450 | Ga0207669_10021655 | 3300025937 | Bacteria | 3398 |
| 451 | Ga0207704_10002148 | 3300025938 | Bacteria | 8837 |
| 452 | Ga0207704_10008266 | 3300025938 | Bacteria | 4962 |
| 453 | Ga0207704_10148930 | 3300025938 | Bacteria | 1649 |
| 454 | Ga0207704_10248338 | 3300025938 | Bacteria | 1334 |
| 455 | Ga0207704_10394548 | 3300025938 | Bacteria | 1090 |
| 456 | Ga0207691_10033151 | 3300025940 | Bacteria | 4810 |
| 457 | Ga0207691_10048149 | 3300025940 | Bacteria | 3909 |
| 458 | Ga0207691_10133702 | 3300025940 | Bacteria | 2189 |
| 459 | Ga0207691_10153916 | 3300025940 | Bacteria | 2020 |
| 460 | Ga0207711_10000098 | 3300025941 | Bacteria | 92296 |
| 461 | Ga0207711_10214795 | 3300025941 | Bacteria | 1758 |
| 462 | Ga0207711_10676339 | 3300025941 | Bacteria | 963 |
| 463 | Ga0207711_10724386 | 3300025941 | Bacteria | 927 |
| 464 | Ga0207689_10015154 | 3300025942 | Bacteria | 6533 |
| 465 | Ga0207689_10051342 | 3300025942 | Bacteria | 3399 |
| 466 | Ga0207689_10142227 | 3300025942 | Bacteria | 1976 |
| 467 | Ga0207689_10175349 | 3300025942 | Bacteria | 1768 |
| 468 | Ga0207689_10265302 | 3300025942 | Bacteria | 1421 |
| 469 | Ga0207689_10333701 | 3300025942 | Bacteria | 1259 |
| 470 | Ga0207661_10117107 | 3300025944 | Bacteria | 2263 |
| 471 | Ga0207679_10065919 | 3300025945 | Bacteria | 2711 |
| 472 | Ga0207679_10171680 | 3300025945 | Bacteria | 1786 |
| 473 | Ga0207667_10016864 | 3300025949 | Bacteria | 8239 |
| 474 | Ga0207667_10041888 | 3300025949 | Bacteria | 4869 |
| 475 | Ga0207667_10773533 | 3300025949 | Bacteria | 958 |
| 476 | Ga0207651_10001106 | 3300025960 | Bacteria | 11995 |
| 477 | Ga0207651_10020981 | 3300025960 | Bacteria | 3958 |
| 478 | Ga0207651_10265592 | 3300025960 | Bacteria | 1411 |
| 479 | Ga0207651_10452314 | 3300025960 | Bacteria | 1102 |
| 480 | Ga0207712_10026363 | 3300025961 | Bacteria | 3871 |
| 481 | Ga0207712_10188605 | 3300025961 | Bacteria | 1626 |
| 482 | Ga0207712_10197096 | 3300025961 | Bacteria | 1594 |
| 483 | Ga0207668_10027648 | 3300025972 | Bacteria | 3697 |
| 484 | Ga0207668_10031900 | 3300025972 | Bacteria | 3475 |
| 485 | Ga0207668_10060606 | 3300025972 | Bacteria | 2657 |
| 486 | Ga0207668_10085527 | 3300025972 | Bacteria | 2301 |
| 487 | Ga0207668_10191661 | 3300025972 | Bacteria | 1620 |
| 488 | Ga0207668_10192991 | 3300025972 | Bacteria | 1615 |
| 489 | Ga0207668_10472050 | 3300025972 | Bacteria | 1074 |
| 490 | Ga0207658_10082714 | 3300025986 | Bacteria | 2466 |
| 491 | Ga0207658_10184257 | 3300025986 | Bacteria | 1730 |
| 492 | Ga0207658_10780419 | 3300025986 | Unclassified | 867 |
| 493 | Ga0207677_10147967 | 3300026023 | Bacteria | 1807 |
| 494 | Ga0207703_10100272 | 3300026035 | Bacteria | 2453 |
| 495 | Ga0207639_10058409 | 3300026041 | Bacteria | 2967 |
| 496 | Ga0207639_10792126 | 3300026041 | Bacteria | 883 |
| 497 | Ga0207678_10005204 | 3300026067 | Bacteria | 11659 |
| 498 | Ga0207678_10017987 | 3300026067 | Bacteria | 6209 |
| 499 | Ga0207678_10050897 | 3300026067 | Bacteria | 3578 |
| 500 | Ga0207678_10060384 | 3300026067 | Bacteria | 3261 |
| 501 | Ga0207678_10090856 | 3300026067 | Bacteria | 2610 |
| 502 | Ga0207678_10242275 | 3300026067 | Bacteria | 1544 |
| 503 | Ga0207708_10069046 | 3300026075 | Bacteria | 2705 |
| 504 | Ga0207708_10105395 | 3300026075 | Bacteria | 2185 |
| 505 | Ga0207708_10113763 | 3300026075 | Bacteria | 2103 |
| 506 | Ga0207641_10016348 | 3300026088 | Bacteria | 6075 |
| 507 | Ga0207641_10148854 | 3300026088 | Bacteria | 2119 |
| 508 | Ga0207641_10217975 | 3300026088 | Bacteria | 1768 |
| 509 | Ga0207641_10242460 | 3300026088 | Bacteria | 1680 |
| 510 | Ga0207641_10339271 | 3300026088 | Bacteria | 1430 |
| 511 | Ga0207641_10382243 | 3300026088 | Bacteria | 1349 |
| 512 | Ga0207648_10003563 | 3300026089 | Bacteria | 16282 |
| 513 | Ga0207648_10009450 | 3300026089 | Bacteria | 9340 |
| 514 | Ga0207648_10015604 | 3300026089 | Bacteria | 6979 |
| 515 | Ga0207648_10017126 | 3300026089 | Bacteria | 6604 |
| 516 | Ga0207648_10060396 | 3300026089 | Bacteria | 3306 |
| 517 | Ga0207648_10143390 | 3300026089 | Bacteria | 2106 |
| 518 | Ga0207676_10015137 | 3300026095 | Bacteria | 5563 |
| 519 | Ga0207676_10032577 | 3300026095 | Bacteria | 3929 |
| 520 | Ga0207676_10039077 | 3300026095 | Bacteria | 3627 |
| 521 | Ga0207676_10290230 | 3300026095 | Bacteria | 1489 |
| 522 | Ga0207676_10396224 | 3300026095 | Bacteria | 1289 |
| 523 | Ga0207674_10085971 | 3300026116 | Bacteria | 3139 |
| 524 | Ga0207674_10337111 | 3300026116 | Bacteria | 1458 |
| 525 | Ga0207674_10375547 | 3300026116 | Bacteria | 1374 |
| 526 | Ga0207675_100001253 | 3300026118 | Bacteria | 25329 |
| 527 | Ga0207675_100004336 | 3300026118 | Bacteria | 13707 |
| 528 | Ga0207675_100013771 | 3300026118 | Bacteria | 7544 |
| 529 | Ga0207675_100024128 | 3300026118 | Bacteria | 5654 |
| 530 | Ga0207675_100036936 | 3300026118 | Bacteria | 4557 |
| 531 | Ga0207675_100043744 | 3300026118 | Bacteria | 4183 |
| 532 | Ga0207675_100112046 | 3300026118 | Bacteria | 2575 |
| 533 | Ga0207675_100112047 | 3300026118 | Bacteria | 2575 |
| 534 | Ga0207675_100410830 | 3300026118 | Bacteria | 1335 |
| 535 | Ga0207683_10008156 | 3300026121 | Bacteria | 8960 |
| 536 | Ga0207683_10017760 | 3300026121 | Bacteria | 6067 |
| 537 | Ga0207683_10018480 | 3300026121 | Bacteria | 5949 |
| 538 | Ga0207683_10037344 | 3300026121 | Bacteria | 4229 |
| 539 | Ga0207683_10041256 | 3300026121 | Bacteria | 4029 |
| 540 | Ga0207683_10044210 | 3300026121 | Bacteria | 3894 |
| 541 | Ga0207683_10050000 | 3300026121 | Bacteria | 3661 |
| 542 | Ga0207683_10082603 | 3300026121 | Bacteria | 2854 |
| 543 | Ga0207683_10505710 | 3300026121 | Bacteria | 1116 |
| 544 | Ga0207698_10000307 | 3300026142 | Bacteria | 29443 |
| 545 | Ga0207698_10025166 | 3300026142 | Bacteria | 4188 |
| 546 | Ga0207698_10363694 | 3300026142 | Bacteria | 1371 |
| 547 | Ga0207698_10702057 | 3300026142 | Bacteria | 1007 |
| 548 | Ga0209813_10029958 | 3300027866 | Bacteria | 1596 |
| 549 | Ga0209813_10111407 | 3300027866 | Bacteria | 943 |
| 550 | Ga0207428_10101190 | 3300027907 | Bacteria | 2227 |
| 551 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 552 | Ga0268266_10015866 | 3300028379 | Bacteria | 6446 |
| 553 | Ga0268266_10059884 | 3300028379 | Bacteria | 3281 |
| 554 | Ga0268266_10078606 | 3300028379 | Bacteria | 2871 |
| 555 | Ga0268266_10081919 | 3300028379 | Bacteria | 2814 |
| 556 | Ga0268266_10135597 | 3300028379 | Bacteria | 2205 |
| 557 | Ga0268266_10367367 | 3300028379 | Bacteria | 1355 |
| 558 | Ga0268266_10378172 | 3300028379 | Bacteria | 1335 |
| 559 | Ga0268266_10382864 | 3300028379 | Bacteria | 1327 |
| 560 | Ga0268265_10003524 | 3300028380 | Bacteria | 11197 |
| 561 | Ga0268265_10036581 | 3300028380 | Bacteria | 3596 |
| 562 | Ga0268265_10068580 | 3300028380 | Bacteria | 2751 |
| 563 | Ga0268265_10092769 | 3300028380 | Bacteria | 2418 |
| 564 | Ga0268265_10098633 | 3300028380 | Bacteria | 2354 |
| 565 | Ga0268265_10105532 | 3300028380 | Bacteria | 2286 |
| 566 | Ga0268265_10113956 | 3300028380 | Bacteria | 2213 |
| 567 | Ga0268265_10128340 | 3300028380 | Bacteria | 2103 |
| 568 | Ga0268265_10567846 | 3300028380 | Bacteria | 1079 |
| 569 | Ga0268265_10754741 | 3300028380 | Bacteria | 944 |
| 570 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 571 | Ga0268264_10016053 | 3300028381 | Bacteria | 6135 |
| 572 | Ga0268264_10055441 | 3300028381 | Bacteria | 3312 |
| 573 | Ga0268264_10162903 | 3300028381 | Bacteria | 2011 |
| 574 | Ga0268264_10215062 | 3300028381 | Bacteria | 1767 |
| 575 | Ga0268264_10336261 | 3300028381 | Bacteria | 1433 |
| 576 | Ga0268264_10374180 | 3300028381 | Bacteria | 1362 |
| 577 | Ga0268264_10384053 | 3300028381 | Bacteria | 1345 |
| 578 | Ga0268264_10460553 | 3300028381 | Bacteria | 1234 |
| 579 | Ga0268264_10646822 | 3300028381 | Bacteria | 1046 |
| 580 | Ga0307517_10000122 | 3300028786 | Bacteria | 116429 |
| 581 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 582 | Ga0307515_10240877 | 3300028794 | Bacteria | 1580 |
| 583 | Ga0307511_10015933 | 3300030521 | Bacteria | 7264 |
| 584 | Ga0265330_10060974 | 3300031235 | Bacteria | 1641 |
| 585 | Ga0265332_10009236 | 3300031238 | Bacteria | 4406 |
| 586 | Ga0265325_10003289 | 3300031241 | Bacteria | 10627 |
| 587 | Ga0265339_10038111 | 3300031249 | Bacteria | 2683 |
| 588 | Ga0265331_10008432 | 3300031250 | Bacteria | 5865 |
| 589 | Ga0265316_10031772 | 3300031344 | Bacteria | 4314 |
| 590 | Ga0265316_10294503 | 3300031344 | Bacteria | 1183 |
| 591 | Ga0307513_10003232 | 3300031456 | Bacteria | 22216 |
| 592 | Ga0307513_10037653 | 3300031456 | Bacteria | 5381 |
| 593 | Ga0307513_10115604 | 3300031456 | Bacteria | 2665 |
| 594 | Ga0307513_10150994 | 3300031456 | Bacteria | 2232 |
| 595 | Ga0307513_10245640 | 3300031456 | Bacteria | 1591 |
| 596 | Ga0307509_10006746 | 3300031507 | Bacteria | 15293 |
| 597 | Ga0307509_10379046 | 3300031507 | Bacteria | 1128 |
| 598 | Ga0307408_100242117 | 3300031548 | Bacteria | 1483 |
| 599 | Ga0265313_10180556 | 3300031595 | Bacteria | 887 |
| 600 | Ga0307508_10057714 | 3300031616 | Bacteria | 3435 |
| 601 | Ga0265314_10039859 | 3300031711 | Bacteria | 3378 |
| 602 | Ga0265314_10051392 | 3300031711 | Bacteria | 2871 |
| 603 | Ga0265342_10258509 | 3300031712 | Bacteria | 927 |
| 604 | Ga0307516_10015865 | 3300031730 | Bacteria | 7905 |
| 605 | Ga0307516_10126750 | 3300031730 | Bacteria | 2337 |
| 606 | Ga0307516_10172958 | 3300031730 | Bacteria | 1899 |
| 607 | Ga0307516_10365893 | 3300031730 | Bacteria | 1106 |
| 608 | Ga0307516_10596392 | 3300031730 | Bacteria | 759 |
| 609 | Ga0307405_10026876 | 3300031731 | Bacteria | 3328 |
| 610 | Ga0307413_10488115 | 3300031824 | Bacteria | 986 |
| 611 | Ga0307406_10054423 | 3300031901 | Bacteria | 2554 |
| 612 | Ga0307407_10232033 | 3300031903 | Bacteria | 1254 |
| 613 | Ga0307409_100088126 | 3300031995 | Bacteria | 2532 |
| 614 | Ga0307409_100175083 | 3300031995 | Bacteria | 1893 |
| 615 | Ga0307416_100749044 | 3300032002 | Bacteria | 1069 |
| 616 | Ga0307416_100944647 | 3300032002 | Bacteria | 964 |
| 617 | Ga0307416_101115947 | 3300032002 | Bacteria | 893 |
| 618 | Ga0307411_10105962 | 3300032005 | Bacteria | 2000 |
| 619 | Ga0307415_100006727 | 3300032126 | Bacteria | 6229 |
| 620 | Ga0307415_100337673 | 3300032126 | Bacteria | 1263 |
| 621 | Ga0307507_10014479 | 3300033179 | Bacteria | 9395 |
| 622 | Ga0307510_10003639 | 3300033180 | Bacteria | 17987 |
| 623 | Ga0307510_10161994 | 3300033180 | Bacteria | 1832 |
| 624 | Ga0373930_0037467 | 3300034816 | Bacteria | 1021 |
| 625 | Ga0373923_0202501 | 3300035111 | Bacteria | 918 |
| 626 | Ga0373939_0014548 | 3300035114 | Bacteria | 2044 |
| 627 | Ga0373953_0038921 | 3300035117 | Bacteria | 1883 |
| 628 | Ga0373956_0065226 | 3300035119 | Bacteria | 1654 |
| 629 | Ga0373957_0029749 | 3300035120 | Bacteria | 1997 |
| 630 | Ga0373960_0020924 | 3300035121 | Bacteria | 1734 |
| 631 | Ga0373943_0064276 | 3300035170 | Bacteria | 1842 |
| 632 | Ga0373946_0097256 | 3300035171 | Unclassified | 1314 |
| 633 | Ga0373955_0016397 | 3300035172 | Bacteria | 3645 |
| 634 | Ga0373961_0018582 | 3300035241 | Bacteria | 1817 |
| 635 | Ga0373924_0068274 | 3300035410 | Bacteria | 1496 |
| 636 | Ga0373931_0010343 | 3300035691 | Bacteria | 4483 |
| 637 | Ga0373931_0037521 | 3300035691 | Bacteria | 2530 |
| 638 | Ga0373931_0048401 | 3300035691 | Bacteria | 2254 |
| 639 | Ga0373935_0026016 | 3300035692 | Bacteria | 3608 |
| 640 | Ga0373935_0095842 | 3300035692 | Bacteria | 1949 |
| 641 | Ga0373935_0096650 | 3300035692 | Bacteria | 1942 |
| 642 | Ga0373935_0508185 | 3300035692 | Bacteria | 875 |
| 643 | Ga0373927_0128053 | 3300035695 | Bacteria | 1658 |
| 644 | Ga0373927_0152284 | 3300035695 | Bacteria | 1514 |
| 645 | Ga0373927_0193248 | 3300035695 | Bacteria | 1335 |
| 646 | Ga0373927_0270446 | 3300035695 | Bacteria | 1117 |
| 647 | Ga0373947_0017715 | 3300035725 | Bacteria | 4098 |
| 648 | Ga0373947_0097679 | 3300035725 | Bacteria | 1841 |
| 649 | Ga0373947_0155317 | 3300035725 | Bacteria | 1476 |
| 650 | Ga0373947_0473944 | 3300035725 | Bacteria | 849 |
| 651 | Ga0373937_0142991 | 3300036401 | Bacteria | 2239 |
| 652 | Ga0373937_0169314 | 3300036401 | Bacteria | 2049 |
| 653 | Ga0373937_0615681 | 3300036401 | Bacteria | 1030 |
| 654 | Ga0373937_1124905 | 3300036401 | Bacteria | 734 |
| 655 | Ga0373925_0014079 | 3300037068 | Bacteria | 5788 |
| 656 | Ga0373925_0022521 | 3300037068 | Bacteria | 4596 |
| 657 | Ga0395900_0005340 | 3300037418 | Bacteria | 13462 |
| 658 | Ga0395900_0145751 | 3300037418 | Bacteria | 2421 |
| 659 | Ga0395900_0301587 | 3300037418 | Bacteria | 1588 |
| 660 | Ga0395898_0019044 | 3300037466 | Bacteria | 6989 |
| 661 | Ga0395898_0116371 | 3300037466 | Bacteria | 2562 |
| 662 | Ga0395898_0241165 | 3300037466 | Bacteria | 1724 |
| 663 | Ga0395905_0001012 | 3300037471 | Bacteria | 35880 |
| 664 | Ga0395905_0184415 | 3300037471 | Bacteria | 1959 |
| 665 | Ga0436364_0601084 | 3300037853 | Bacteria | 4650 |
| 666 | Ga0436364_0920940 | 3300037853 | Bacteria | 1242 |
| 667 | Ga0395901_0004257 | 3300038443 | Bacteria | 14438 |
| 668 | Ga0395901_0605203 | 3300038443 | Bacteria | 1105 |
| 669 | Ga0436365_0610368 | 3300039437 | Bacteria | 2011 |
| 670 | Ga0436365_1007984 | 3300039437 | Bacteria | 7106 |
| 671 | Ga0436365_1315860 | 3300039437 | Bacteria | 1171 |
| 672 | Ga0439461_0004108 | 3300041410 | Bacteria | 2419 |
| 673 | Ga0439465_0003417 | 3300041413 | Bacteria | 5179 |
| 674 | Ga0439465_0033690 | 3300041413 | Bacteria | 1638 |
| 675 | Ga0439465_0103235 | 3300041413 | Bacteria | 986 |
| 676 | Ga0451807_0624241 | 3300041486 | Bacteria | 1022 |
| 677 | Ga0451807_1847672 | 3300041486 | Bacteria | 1531 |
| 678 | Ga0451837_1740338 | 3300041494 | Bacteria | 1026 |
| 679 | Ga0439431_0055205 | 3300041997 | Bacteria | 1037 |
| 680 | Ga0439433_0001608 | 3300041999 | Bacteria | 4693 |
| 681 | Ga0439441_021595 | 3300042001 | Bacteria | 1190 |
| 682 | Ga0439442_014784 | 3300042002 | Bacteria | 1607 |
| 683 | Ga0439445_0014539 | 3300042004 | Bacteria | 1917 |
| 684 | Ga0439449_0004078 | 3300042007 | Bacteria | 5653 |
| 685 | Ga0439457_007831 | 3300042014 | Bacteria | 2546 |
| 686 | Ga0439462_0003601 | 3300042015 | Bacteria | 3730 |
| 687 | Ga0439435_0001742 | 3300042436 | Bacteria | 4127 |
| 688 | Ga0439444_0035010 | 3300042437 | Bacteria | 961 |
| 689 | Ga0439464_0062731 | 3300042439 | Bacteria | 1090 |
| 690 | Ga0439460_0005243 | 3300042461 | Bacteria | 3176 |
| 691 | Ga0466965_0230104 | 3300044683 | Bacteria | 990 |
| 692 | Ga0466966_0058361 | 3300044684 | Unclassified | 2439 |
| 693 | Ga0466960_0002956 | 3300044901 | Bacteria | 6476 |
| 694 | Ga0466959_0044856 | 3300045049 | Bacteria | 3257 |
| 695 | Ga0451576_0122843 | 3300045051 | Bacteria | 2704 |
| 696 | Ga0466958_0001042 | 3300045836 | Bacteria | 12677 |
| 697 | Ga0495617_018903 | 3300046452 | Bacteria | 2331 |
| 698 | Ga0495617_124614 | 3300046452 | Bacteria | 829 |
| 699 | Ga0495603_0025997 | 3300046455 | Bacteria | 3539 |
| 700 | Ga0495603_0069753 | 3300046455 | Bacteria | 2067 |
| 701 | Ga0495629_0037804 | 3300046459 | Bacteria | 3402 |
| 702 | Ga0495629_0142404 | 3300046459 | Bacteria | 1668 |
| 703 | Ga0495638_0002597 | 3300046460 | Bacteria | 14580 |
| 704 | Ga0495651_0056427 | 3300046462 | Bacteria | 3017 |
| 705 | Ga0495653_0096208 | 3300046463 | Bacteria | 2153 |
| 706 | Ga0495650_0083879 | 3300046471 | Bacteria | 1224 |
| 707 | Ga0495580_0034696 | 3300046472 | Bacteria | 3631 |
| 708 | Ga0495639_0150366 | 3300046475 | Bacteria | 1123 |
| 709 | Ga0495664_0191287 | 3300046477 | Bacteria | 1240 |
| 710 | Ga0495664_0199801 | 3300046477 | Bacteria | 1211 |
| 711 | Ga0495584_0044555 | 3300046491 | Bacteria | 2239 |
| 712 | Ga0495584_0091744 | 3300046491 | Bacteria | 1532 |
| 713 | Ga0495594_0252893 | 3300046499 | Bacteria | 1004 |
| 714 | Ga0495606_0067194 | 3300046507 | Bacteria | 2271 |
| 715 | Ga0495606_0239771 | 3300046507 | Bacteria | 1012 |
| 716 | Ga0495610_0128106 | 3300046512 | Bacteria | 1105 |
| 717 | Ga0495631_0106893 | 3300046518 | Bacteria | 1203 |
| 718 | Ga0495644_0029773 | 3300046523 | Bacteria | 2062 |
| 719 | Ga0495644_0102310 | 3300046523 | Bacteria | 1084 |
| 720 | Ga0495644_0212731 | 3300046523 | Bacteria | 746 |
| 721 | Ga0495652_0126016 | 3300046529 | Bacteria | 2034 |
| 722 | Ga0495652_0482796 | 3300046529 | Unclassified | 862 |
| 723 | Ga0495586_0303933 | 3300046535 | Bacteria | 914 |
| 724 | Ga0495598_0001642 | 3300046537 | Bacteria | 4487 |
| 725 | Ga0495609_0073014 | 3300046538 | Bacteria | 1506 |
| 726 | Ga0495645_0107866 | 3300046543 | Bacteria | 1973 |
| 727 | Ga0495622_0022506 | 3300046557 | Bacteria | 2937 |
| 728 | Ga0495667_0057622 | 3300046559 | Bacteria | 2553 |
| 729 | Ga0495656_0002575 | 3300046615 | Bacteria | 6045 |
| 730 | Ga0495656_0012197 | 3300046615 | Bacteria | 3166 |
| 731 | Ga0495656_0077293 | 3300046615 | Bacteria | 1493 |
| 732 | Ga0495668_0010364 | 3300046616 | Bacteria | 5642 |
| 733 | Ga0495668_0037381 | 3300046616 | Bacteria | 2716 |
| 734 | Ga0495668_0150554 | 3300046616 | Bacteria | 1274 |
| 735 | Ga0495634_0071448 | 3300046642 | Bacteria | 2285 |
| 736 | Ga0495611_0071182 | 3300046648 | Bacteria | 1590 |
| 737 | Ga0495625_0012065 | 3300046660 | Bacteria | 7013 |
| 738 | Ga0495625_0069527 | 3300046660 | Bacteria | 2474 |
| 739 | Ga0495625_0289328 | 3300046660 | Bacteria | 1052 |
| 740 | Ga0495635_0087217 | 3300046663 | Bacteria | 2135 |
| 741 | Ga0495659_0031613 | 3300046664 | Bacteria | 1848 |
| 742 | Ga0495588_0047898 | 3300046674 | Bacteria | 2195 |
| 743 | Ga0495657_0069074 | 3300046675 | Bacteria | 2313 |
| 744 | Ga0495599_0219876 | 3300046678 | Bacteria | 1163 |
| 745 | Ga0495623_0041564 | 3300046679 | Bacteria | 2931 |
| 746 | Ga0495658_0306148 | 3300046683 | Bacteria | 1006 |
| 747 | Ga0495669_0000964 | 3300046684 | Bacteria | 12015 |
| 748 | Ga0495669_0098495 | 3300046684 | Bacteria | 1356 |
| 749 | Ga0495669_0151182 | 3300046684 | Bacteria | 1099 |
| 750 | Ga0495613_0199314 | 3300046689 | Bacteria | 1412 |
| 751 | Ga0495670_0063191 | 3300046691 | Bacteria | 1864 |
| 752 | Ga0495670_0113975 | 3300046691 | Bacteria | 1401 |
| 753 | Ga0495670_0115131 | 3300046691 | Bacteria | 1394 |
| 754 | Ga0495671_0116062 | 3300046692 | Bacteria | 1307 |
| 755 | Ga0495589_0092334 | 3300046794 | Bacteria | 1470 |
| 756 | Ga0495589_0257695 | 3300046794 | Bacteria | 814 |
| 757 | Ga0495600_0383054 | 3300046809 | Unclassified | 877 |
| 758 | Ga0495581_0027007 | 3300047315 | Bacteria | 3329 |
| 759 | Ga0495636_0014193 | 3300047318 | Bacteria | 3168 |
| 760 | Ga0495674_0158434 | 3300047319 | Bacteria | 1895 |
| 761 | Ga0495674_0254637 | 3300047319 | Bacteria | 1444 |
| 762 | Ga0495672_0032048 | 3300047320 | Bacteria | 3274 |
| 763 | Ga0495672_0173928 | 3300047320 | Bacteria | 1096 |
| 764 | Ga0495675_0011843 | 3300047444 | Bacteria | 5481 |
| 765 | Ga0495673_0051908 | 3300047469 | Bacteria | 1794 |
| 766 | Ga0495684_0182813 | 3300047471 | Bacteria | 1553 |
| 767 | Ga0495602_0227064 | 3300048088 | Bacteria | 1405 |
| 768 | Ga0495602_0249811 | 3300048088 | Bacteria | 1322 |
| 769 | Ga0495602_0283373 | 3300048088 | Bacteria | 1220 |
| 770 | Ga0496100_0012121 | 3300048903 | Bacteria | 4932 |
| 771 | Ga0496100_0057455 | 3300048903 | Bacteria | 2549 |
| 772 | Ga0496100_0096698 | 3300048903 | Bacteria | 2027 |
| 773 | Ga0496100_0351901 | 3300048903 | Bacteria | 1113 |
| 774 | Ga0496100_0437155 | 3300048903 | Bacteria | 1001 |
| 775 | Ga0496101_0023542 | 3300048904 | Bacteria | 4256 |
| 776 | Ga0496101_0091977 | 3300048904 | Bacteria | 2258 |
| 777 | Ga0496101_0395561 | 3300048904 | Bacteria | 1088 |
| 778 | Ga0496102_0004326 | 3300048905 | Bacteria | 12013 |
| 779 | Ga0496102_0034264 | 3300048905 | Bacteria | 4566 |
| 780 | Ga0496102_0107644 | 3300048905 | Bacteria | 2596 |
| 781 | Ga0496102_0556044 | 3300048905 | Bacteria | 1070 |
| 782 | Ga0496102_0717895 | 3300048905 | Bacteria | 922 |
| 783 | Ga0496104_0090962 | 3300048907 | Bacteria | 2916 |
| 784 | Ga0496104_0096898 | 3300048907 | Bacteria | 2822 |
| 785 | Ga0496104_0107333 | 3300048907 | Bacteria | 2675 |
| 786 | Ga0496104_0550860 | 3300048907 | Bacteria | 1064 |
| 787 | Ga0496105_0006457 | 3300048908 | Bacteria | 9017 |
| 788 | Ga0496105_0039757 | 3300048908 | Bacteria | 3878 |
| 789 | Ga0496105_0222252 | 3300048908 | Bacteria | 1537 |
| 790 | Ga0496105_0327509 | 3300048908 | Bacteria | 1227 |
| 791 | Ga0496106_0003360 | 3300048909 | Bacteria | 11929 |
| 792 | Ga0496106_0016237 | 3300048909 | Bacteria | 5508 |
| 793 | Ga0496106_0350450 | 3300048909 | Bacteria | 1186 |
| 794 | Ga0496106_0835426 | 3300048909 | Bacteria | 729 |
| 795 | Ga0496107_0071687 | 3300048910 | Bacteria | 2518 |
| 796 | Ga0496107_0175093 | 3300048910 | Bacteria | 1593 |
| 797 | Ga0496107_0554321 | 3300048910 | Bacteria | 851 |
| 798 | Ga0496108_0006585 | 3300048911 | Bacteria | 9422 |
| 799 | Ga0496108_0010340 | 3300048911 | Bacteria | 7577 |
| 800 | Ga0496108_0157770 | 3300048911 | Bacteria | 1960 |
| 801 | Ga0496109_0006126 | 3300048912 | Bacteria | 10106 |
| 802 | Ga0496109_0011401 | 3300048912 | Bacteria | 7639 |
| 803 | Ga0496109_0198128 | 3300048912 | Bacteria | 1888 |
| 804 | Ga0496109_0270699 | 3300048912 | Bacteria | 1600 |
| 805 | Ga0496110_0023135 | 3300048913 | Bacteria | 5284 |
| 806 | Ga0496110_0046061 | 3300048913 | Bacteria | 3814 |
| 807 | Ga0496110_0112471 | 3300048913 | Bacteria | 2448 |
| 808 | Ga0496110_0228619 | 3300048913 | Bacteria | 1691 |
| 809 | Ga0496110_0266373 | 3300048913 | Bacteria | 1560 |
| 810 | Ga0496110_0433558 | 3300048913 | Bacteria | 1198 |
| 811 | Ga0496110_0461289 | 3300048913 | Bacteria | 1158 |
| 812 | Ga0496110_0732973 | 3300048913 | Bacteria | 891 |
| 813 | Ga0496111_0037948 | 3300048914 | Bacteria | 3449 |
| 814 | Ga0496111_0116203 | 3300048914 | Bacteria | 1973 |
| 815 | Ga0496112_0092212 | 3300048915 | Bacteria | 2999 |
| 816 | Ga0496112_0356725 | 3300048915 | Bacteria | 1404 |
| 817 | Ga0496112_0377201 | 3300048915 | Bacteria | 1359 |
| 818 | Ga0496112_0408951 | 3300048915 | Bacteria | 1296 |
| 819 | Ga0496112_0699460 | 3300048915 | Bacteria | 941 |
| 820 | Ga0496113_0000320 | 3300048916 | Bacteria | 22841 |
| 821 | Ga0496113_0001582 | 3300048916 | Bacteria | 12777 |
| 822 | Ga0496113_0138616 | 3300048916 | Bacteria | 1913 |
| 823 | Ga0496114_0004567 | 3300048917 | Bacteria | 10753 |
| 824 | Ga0496114_0057402 | 3300048917 | Bacteria | 3250 |
| 825 | Ga0496114_0081747 | 3300048917 | Bacteria | 2730 |
| 826 | Ga0496114_0226461 | 3300048917 | Bacteria | 1642 |
| 827 | Ga0496114_0931260 | 3300048917 | Bacteria | 751 |
| 828 | Ga0496115_0010306 | 3300048918 | Bacteria | 6977 |
| 829 | Ga0496115_0041743 | 3300048918 | Bacteria | 3652 |
| 830 | Ga0496115_0174637 | 3300048918 | Bacteria | 1777 |
| 831 | Ga0496115_0423003 | 3300048918 | Bacteria | 1079 |
| 832 | Ga0496117_0204783 | 3300048920 | Bacteria | 1112 |
| 833 | Ga0496121_0015212 | 3300048924 | Bacteria | 8086 |
| 834 | Ga0496121_0074288 | 3300048924 | Bacteria | 2720 |
| 835 | Ga0496121_0130861 | 3300048924 | Bacteria | 1878 |
| 836 | Ga0496121_0343318 | 3300048924 | Bacteria | 997 |
| 837 | Ga0496124_0000273 | 3300048927 | Bacteria | 99505 |
| 838 | Ga0496124_0072888 | 3300048927 | Bacteria | 2843 |
| 839 | Ga0496125_0025541 | 3300048928 | Bacteria | 5406 |
| 840 | Ga0496125_0133791 | 3300048928 | Bacteria | 1739 |
| 841 | Ga0496126_0043505 | 3300048929 | Bacteria | 4143 |
| 842 | Ga0496126_0084620 | 3300048929 | Bacteria | 2797 |
| 843 | Ga0496126_0089878 | 3300048929 | Bacteria | 2702 |
| 844 | Ga0496126_0130695 | 3300048929 | Bacteria | 2170 |
| 845 | Ga0495682_0067438 | 3300049460 | Bacteria | 1289 |
| 846 | Ga0501031_0000753 | 3300049568 | Bacteria | 19473 |
| 847 | Ga0501032_0000136 | 3300049569 | Bacteria | 59896 |
| 848 | Ga0501033_0000202 | 3300049570 | Bacteria | 57109 |
| 849 | Ga0501033_0048226 | 3300049570 | Bacteria | 3164 |
| 850 | Ga0501033_0300749 | 3300049570 | Bacteria | 1129 |
| 851 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 852 | Ga0501034_0139242 | 3300049571 | Bacteria | 2407 |
| 853 | Ga0501036_0000059 | 3300049572 | Bacteria | 72347 |
| 854 | Ga0501037_0000270 | 3300049573 | Bacteria | 44650 |
| 855 | Ga0501038_0000774 | 3300049574 | Bacteria | 28322 |
| 856 | Ga0501039_0000067 | 3300049575 | Bacteria | 79511 |
| 857 | Ga0501040_0167868 | 3300049576 | Unclassified | 1553 |
| 858 | Ga0501042_0126544 | 3300049578 | Bacteria | 1840 |
| 859 | Ga0501042_0464350 | 3300049578 | Bacteria | 918 |
| 860 | Ga0501043_0000017 | 3300049579 | Bacteria | 166630 |
| 861 | Ga0501046_0000174 | 3300049580 | Bacteria | 65566 |
| 862 | Ga0501047_0005957 | 3300049581 | Bacteria | 11456 |
| 863 | Ga0501048_0000127 | 3300049582 | Bacteria | 44609 |
| 864 | Ga0501048_0201065 | 3300049582 | Bacteria | 1412 |
| 865 | Ga0501067_0000833 | 3300049583 | Bacteria | 16590 |
| 866 | Ga0501068_0004830 | 3300049584 | Bacteria | 7338 |
| 867 | Ga0501069_0002149 | 3300049585 | Bacteria | 9925 |
| 868 | Ga0501069_0088674 | 3300049585 | Bacteria | 1748 |
| 869 | Ga0501070_0009120 | 3300049586 | Bacteria | 8389 |
| 870 | Ga0501070_0102336 | 3300049586 | Bacteria | 2369 |
| 871 | Ga0501070_0265459 | 3300049586 | Bacteria | 1402 |
| 872 | Ga0501071_0078396 | 3300049587 | Bacteria | 2414 |
| 873 | Ga0501071_0282021 | 3300049587 | Bacteria | 1257 |
| 874 | Ga0501071_0518923 | 3300049587 | Bacteria | 914 |
| 875 | Ga0501072_0017358 | 3300049588 | Bacteria | 5529 |
| 876 | Ga0501073_0000069 | 3300049589 | Bacteria | 63198 |
| 877 | Ga0501073_0089049 | 3300049589 | Bacteria | 2146 |
| 878 | Ga0501073_0389392 | 3300049589 | Bacteria | 963 |
| 879 | Ga0501074_0000507 | 3300049590 | Bacteria | 23842 |
| 880 | Ga0501074_0028902 | 3300049590 | Bacteria | 4015 |
| 881 | Ga0501074_0061582 | 3300049590 | Bacteria | 2704 |
| 882 | Ga0501075_0034209 | 3300049591 | Bacteria | 3783 |
| 883 | Ga0501076_0014693 | 3300049592 | Bacteria | 5903 |
| 884 | Ga0501079_0143012 | 3300049741 | Unclassified | 1863 |
| 885 | Ga0501080_0000593 | 3300049742 | Bacteria | 28623 |
| 886 | Ga0501080_0159402 | 3300049742 | Bacteria | 2084 |
| 887 | Ga0501080_0209512 | 3300049742 | Bacteria | 1786 |
| 888 | Ga0501081_0015033 | 3300049743 | Bacteria | 5107 |
| 889 | Ga0501081_0192184 | 3300049743 | Bacteria | 1478 |
| 890 | Ga0501083_0000336 | 3300049744 | Bacteria | 29766 |
| 891 | Ga0501083_0047097 | 3300049744 | Bacteria | 2914 |
| 892 | Ga0501083_0251662 | 3300049744 | Bacteria | 1150 |
| 893 | Ga0501035_0000393 | 3300049822 | Bacteria | 49959 |
| 894 | Ga0501035_0168014 | 3300049822 | Bacteria | 1896 |
| 895 | Ga0501035_0277837 | 3300049822 | Bacteria | 1416 |
| 896 | Ga0501044_0000387 | 3300049823 | Bacteria | 54729 |
| 897 | Ga0501044_0015271 | 3300049823 | Bacteria | 8271 |
| 898 | Ga0501044_0090851 | 3300049823 | Bacteria | 3080 |
| 899 | Ga0501045_0019923 | 3300049824 | Bacteria | 4787 |
| 900 | Ga0501045_0140758 | 3300049824 | Bacteria | 1794 |
| 901 | Ga0501045_0426253 | 3300049824 | Bacteria | 987 |
| 902 | nmdc:mga03683_39524_c1 | 3300050489 | Bacteria | 1931 |
| 903 | nmdc:mga03683_82834_c1 | 3300050489 | Bacteria | 1388 |
| 904 | nmdc:mga03n38_112773_c1 | 3300050490 | Bacteria | 1326 |
| 905 | nmdc:mga03n38_160169_c1 | 3300050490 | Bacteria | 1139 |
| 906 | nmdc:mga03n38_279282_c1 | 3300050490 | Bacteria | 891 |
| 907 | nmdc:mga03n38_6268_c1 | 3300050490 | Bacteria | 4120 |
| 908 | nmdc:mga00v17_52318_c1 | 3300050491 | Bacteria | 2484 |
| 909 | nmdc:mga0yw44_10122_c1 | 3300050492 | Bacteria | 4803 |
| 910 | nmdc:mga0yw44_17650_c1 | 3300050492 | Bacteria | 3889 |
| 911 | nmdc:mga0yw44_332022_c1 | 3300050492 | Bacteria | 1022 |
| 912 | nmdc:mga0k408_253369_c1 | 3300050493 | Bacteria | 1051 |
| 913 | nmdc:mga0k408_30599_c1 | 3300050493 | Bacteria | 3070 |
| 914 | nmdc:mga0k408_84524_c1 | 3300050493 | Bacteria | 1862 |
| 915 | nmdc:mga06z11_135036_c1 | 3300050494 | Bacteria | 1389 |
| 916 | nmdc:mga06z11_304506_c1 | 3300050494 | Bacteria | 948 |
| 917 | nmdc:mga06z11_70690_c1 | 3300050494 | Bacteria | 1846 |
| 918 | nmdc:mga04h51_28453_c1 | 3300050495 | Bacteria | 1743 |
| 919 | nmdc:mga07m45_103717_c1 | 3300050496 | Bacteria | 1635 |
| 920 | nmdc:mga07m45_14161_c1 | 3300050496 | Bacteria | 4242 |
| 921 | nmdc:mga07m45_174808_c1 | 3300050496 | Bacteria | 1249 |
| 922 | nmdc:mga07m45_39889_c1 | 3300050496 | Bacteria | 2626 |
| 923 | nmdc:mga07m45_424766_c1 | 3300050496 | Bacteria | 771 |
| 924 | nmdc:mga05p37_22572_c1 | 3300050507 | Bacteria | 7631 |
| 925 | nmdc:mga06r32_463968_c1 | 3300050510 | Bacteria | 1245 |
| 926 | nmdc:mga06r32_738397_c1 | 3300050510 | Bacteria | 948 |
| 927 | nmdc:mga08y16_125147_c1 | 3300050511 | Bacteria | 2674 |
| 928 | nmdc:mga08y16_269467_c1 | 3300050511 | Bacteria | 1758 |
| 929 | nmdc:mga0n895_61208_c1 | 3300050512 | Bacteria | 3715 |
| 930 | nmdc:mga0n895_716909_c1 | 3300050512 | Bacteria | 995 |
| 931 | nmdc:mga0n895_90050_c1 | 3300050512 | Bacteria | 3069 |
| 932 | nmdc:mga0rr50_187562_c1 | 3300050513 | Bacteria | 1693 |
| 933 | nmdc:mga0rr50_244691_c1 | 3300050513 | Bacteria | 1488 |
| 934 | nmdc:mga0rr50_334824_c1 | 3300050513 | Bacteria | 1271 |
| 935 | nmdc:mga0a205_102260_c1 | 3300050515 | Bacteria | 2764 |
| 936 | nmdc:mga0a205_178341_c1 | 3300050515 | Bacteria | 2019 |
| 937 | nmdc:mga0sz30_75405_c1 | 3300050516 | Bacteria | 1455 |
| 938 | Ga0495601_0032289 | 3300053077 | Bacteria | 3259 |
| 939 | Ga0495601_0124641 | 3300053077 | Bacteria | 1675 |
| 940 | Ga0500610_0000237 | 3300053079 | Bacteria | 16642 |
| 941 | Ga0500635_0059072 | 3300053080 | Bacteria | 1333 |
| 942 | Ga0495619_0026355 | 3300053085 | Bacteria | 3739 |
| 943 | Ga0500581_094759 | 3300053089 | Bacteria | 1475 |
| 944 | Ga0500646_0085796 | 3300053090 | Bacteria | 968 |
| 945 | Ga0500647_0018336 | 3300053091 | Bacteria | 3241 |
| 946 | Ga0500651_0202913 | 3300053093 | Bacteria | 1169 |
| 947 | Ga0500566_0000149 | 3300053094 | Bacteria | 35997 |
| 948 | Ga0500641_0035698 | 3300053096 | Bacteria | 1985 |
| 949 | Ga0500641_0074109 | 3300053096 | Bacteria | 1437 |
| 950 | Ga0500554_075187 | 3300053102 | Bacteria | 1105 |
| 951 | Ga0500594_0150022 | 3300053118 | Bacteria | 749 |
| 952 | Ga0500595_000336 | 3300053119 | Bacteria | 30876 |
| 953 | Ga0500595_000870 | 3300053119 | Bacteria | 17254 |
| 954 | Ga0500595_006384 | 3300053119 | Bacteria | 5004 |
| 955 | Ga0500595_034365 | 3300053119 | Bacteria | 1677 |
| 956 | Ga0500608_063733 | 3300053122 | Bacteria | 1759 |
| 957 | Ga0500642_0020733 | 3300053130 | Bacteria | 2589 |
| 958 | Ga0500642_0047674 | 3300053130 | Bacteria | 1879 |
| 959 | Ga0500655_003937 | 3300053133 | Bacteria | 2678 |
| 960 | Ga0500559_0019051 | 3300053136 | Bacteria | 2900 |
| 961 | Ga0500559_0094641 | 3300053136 | Bacteria | 1371 |
| 962 | Ga0500573_0004501 | 3300053140 | Bacteria | 7360 |
| 963 | Ga0500577_0182878 | 3300053142 | Bacteria | 900 |
| 964 | Ga0500586_010049 | 3300053145 | Bacteria | 2654 |
| 965 | Ga0500588_0015778 | 3300053146 | Bacteria | 1942 |
| 966 | Ga0500603_008164 | 3300053150 | Bacteria | 2314 |
| 967 | Ga0500604_0025643 | 3300053151 | Bacteria | 1696 |
| 968 | Ga0500622_0091414 | 3300053156 | Bacteria | 1510 |
| 969 | Ga0500630_094713 | 3300053159 | Bacteria | 1372 |
| 970 | Ga0500638_000529 | 3300053162 | Bacteria | 9538 |
| 971 | Ga0500636_0010678 | 3300053177 | Bacteria | 5361 |
| 972 | Ga0500636_0035110 | 3300053177 | Bacteria | 2968 |
| 973 | Ga0500636_0250444 | 3300053177 | Bacteria | 903 |
| 974 | Ga0500637_0000289 | 3300053178 | Bacteria | 18843 |
| 975 | Ga0500645_000493 | 3300053730 | Bacteria | 26655 |
| 976 | Ga0500645_027134 | 3300053730 | Bacteria | 1738 |
| 977 | Ga0501084_0000898 | 3300054114 | Bacteria | 23029 |
| 978 | Ga0501084_0025166 | 3300054114 | Bacteria | 4966 |
| 979 | Ga0501084_0514181 | 3300054114 | Bacteria | 1012 |
| 980 | Ga0500661_002949 | 3300055283 | Bacteria | 3202 |
| 981 | Ga0590075_012620 | 3300059424 | Bacteria | 2054 |
| 982 | Ga0501082_0003002 | 3300060353 | Bacteria | 14744 |
| 983 | Ga0501082_0046564 | 3300060353 | Unclassified | 3738 |
| 984 | 2524466399 | 2524023210 | Bacteria | 9029266 |
| 985 | 2524539845 | 2524023228 | Bacteria | 10118060 |
| 986 | 2644255942 | 2643221646 | Bacteria | 6433402 |
| 987 | 2723849270 | 2721755755 | Bacteria | 8322773 |
| 988 | 2793067165 | 2791355197 | Bacteria | 8420563 |
| 989 | 2793081627 | |||
| 990 | 2874608495 | 2874604998 | Bacteria | 7834745 |
| 991 | 2876813851 | 2876808645 | Bacteria | 8824342 |
| 992 | 2879112725 | 2879110137 | Bacteria | 8907982 |
| 993 | 2885194161 | 2885192300 | Bacteria | 5882526 |
| 994 | 2889035947 | 2889033259 | Bacteria | 9099371 |
| 995 | 2904707688 | |||
| 996 | 8006936833 | 8006933436 | Bacteria | 10410654 |
| 997 | 8006967801 | 8006964411 | Bacteria | 8966052 |
| 998 | 8006976803 | 8006973647 | Bacteria | 10679141 |
| 999 | 8019561860 | 8019555841 | Bacteria | 9642137 |
| 1000 | 8019571936 | 8019565922 | Bacteria | 9639779 |
| 1001 | 8056678524 | 8056673599 | Bacteria | 7871253 |
| 1002 | 8056683105 | 8056681323 | Bacteria | 8472857 |
| 1003 | Ga0111539_10061089 | |||
| 1004 | JGI24744J21845_10003077 | |||
| 1005 | JGI25151J46595_10026222 | |||
| 1006 | JGI25406J46586_10000053 | |||
| 1007 | rootH1_10032258 | |||
| 1008 | JGI25404J52841_10000607 | |||
| 1009 | JGI25404J52841_10006761 | |||
| 1010 | JGI25404J52841_10007695 | |||
| 1011 | Ga0055526_1003550 | |||
| 1012 | Ga0055526_1022860 | |||
| 1013 | Ga0055524_1007614 | |||
| 1014 | Ga0055524_1012951 | |||
| 1015 | Ga0055531_10004270 | |||
| 1016 | Ga0055531_10011319 | |||
| 1017 | Ga0055531_10013753 | |||
| 1018 | Ga0065707_10115043 | |||
| 1019 | Ga0070676_10032114 | |||
| 1020 | Ga0070690_100472282 | |||
| 1021 | Ga0070670_100037213 | |||
| 1022 | Ga0070670_100390160 | |||
| 1023 | Ga0068869_100099600 | |||
| 1024 | Ga0068869_100339507 | |||
| 1025 | Ga0068869_100512121 | |||
| 1026 | Ga0070666_10007661 | |||
| 1027 | Ga0070682_100004502 | |||
| 1028 | Ga0068868_100053379 | |||
| 1029 | Ga0068868_100090241 | |||
| 1030 | Ga0070660_100003389 | |||
| 1031 | Ga0070689_100241826 | |||
| 1032 | Ga0070661_100009747 | |||
| 1033 | Ga0070661_100142406 | |||
| 1034 | Ga0070661_100733888 | |||
| 1035 | Ga0070668_100013269 | |||
| 1036 | Ga0070668_100021395 | |||
| 1037 | Ga0070668_100049961 | |||
| 1038 | Ga0070668_100084205 | |||
| 1039 | Ga0070668_100126243 | |||
| 1040 | Ga0070669_100048155 | |||
| 1041 | Ga0070669_100052275 | |||
| 1042 | Ga0070669_100554451 | |||
| 1043 | Ga0070675_100001220 | |||
| 1044 | Ga0070675_100106122 | |||
| 1045 | Ga0070675_100157356 | |||
| 1046 | Ga0070671_100125426 | |||
| 1047 | Ga0070671_100130284 | |||
| 1048 | Ga0070674_100042527 | |||
| 1049 | Ga0070674_100107362 | |||
| 1050 | Ga0070674_100224232 | |||
| 1051 | Ga0070674_100267266 | |||
| 1052 | Ga0070674_100285551 | |||
| 1053 | Ga0070674_100409920 | |||
| 1054 | Ga0070674_100798623 | |||
| 1055 | Ga0070673_100000479 | |||
| 1056 | Ga0070673_100005052 | |||
| 1057 | Ga0070673_100075753 | |||
| 1058 | Ga0070673_100102034 | |||
| 1059 | Ga0070673_100120137 | |||
| 1060 | Ga0070659_100012064 | |||
| 1061 | Ga0070667_100067544 | |||
| 1062 | Ga0070667_100109981 | |||
| 1063 | Ga0070667_100595094 | |||
| 1064 | Ga0070701_10046520 | |||
| 1065 | Ga0070711_100018468 | |||
| 1066 | Ga0070700_100099052 | |||
| 1067 | Ga0070700_100116428 | |||
| 1068 | Ga0070700_100130390 | |||
| 1069 | Ga0070700_100748395 | |||
| 1070 | Ga0070663_100017170 | |||
| 1071 | Ga0070663_100030261 | |||
| 1072 | Ga0070678_100019281 | |||
| 1073 | Ga0070678_100039965 | |||
| 1074 | Ga0070678_100051740 | |||
| 1075 | Ga0070678_100093224 | |||
| 1076 | Ga0070678_100113408 | |||
| 1077 | Ga0070678_100235000 | |||
| 1078 | Ga0070662_100042557 | |||
| 1079 | Ga0070662_100116653 | |||
| 1080 | Ga0070681_10076134 | |||
| 1081 | Ga0068867_100065718 | |||
| 1082 | Ga0068867_100079873 | |||
| 1083 | Ga0068867_100291663 | |||
| 1084 | Ga0068867_100835774 | |||
| 1085 | Ga0070685_10139205 | |||
| 1086 | Ga0070685_10160849 | |||
| 1087 | Ga0070685_10448771 | |||
| 1088 | Ga0070698_100882766 | |||
| 1089 | Ga0070684_100976059 | |||
| 1090 | Ga0068853_100113556 | |||
| 1091 | Ga0068853_100326132 | |||
| 1092 | Ga0068853_100595310 | |||
| 1093 | Ga0068853_100897194 | |||
| 1094 | Ga0070672_100008509 | |||
| 1095 | Ga0070672_100075100 | |||
| 1096 | Ga0070672_100214744 | |||
| 1097 | Ga0070672_100324303 | |||
| 1098 | Ga0070686_100020285 | |||
| 1099 | Ga0070686_100764046 | |||
| 1100 | Ga0070696_100035783 | |||
| 1101 | Ga0070696_100236811 | |||
| 1102 | Ga0070693_100112353 | |||
| 1103 | Ga0070665_100000211 | |||
| 1104 | Ga0070665_100004360 | |||
| 1105 | Ga0070665_100015880 | |||
| 1106 | Ga0070665_100043289 | |||
| 1107 | Ga0070665_100043750 | |||
| 1108 | Ga0070665_100044260 | |||
| 1109 | Ga0070665_100099984 | |||
| 1110 | Ga0070665_100103906 | |||
| 1111 | Ga0070665_100109114 | |||
| 1112 | Ga0070665_100234724 | |||
| 1113 | Ga0070665_100402485 | |||
| 1114 | Ga0070665_100423660 | |||
| 1115 | Ga0068855_100000686 | |||
| 1116 | Ga0068855_100005666 | |||
| 1117 | Ga0070664_100035394 | |||
| 1118 | Ga0070664_100053079 | |||
| 1119 | Ga0070664_100826694 | |||
| 1120 | Ga0068857_100137632 | |||
| 1121 | Ga0068852_100001192 | |||
| 1122 | Ga0068852_100100551 | |||
| 1123 | Ga0068852_100488223 | |||
| 1124 | Ga0068859_100000414 | |||
| 1125 | Ga0068859_100076320 | |||
| 1126 | Ga0068859_100084314 | |||
| 1127 | Ga0068859_100097520 | |||
| 1128 | Ga0068859_100194909 | |||
| 1129 | Ga0068859_100249133 | |||
| 1130 | Ga0068859_100304490 | |||
| 1131 | Ga0068859_100444783 | |||
| 1132 | Ga0068864_100010492 | |||
| 1133 | Ga0068864_100013481 | |||
| 1134 | Ga0068864_100032170 | |||
| 1135 | Ga0068864_100112221 | |||
| 1136 | Ga0068864_100133739 | |||
| 1137 | Ga0068866_10149453 | |||
| 1138 | Ga0068861_100000358 | |||
| 1139 | Ga0068861_100035625 | |||
| 1140 | Ga0068861_100136011 | |||
| 1141 | Ga0068861_100136925 | |||
| 1142 | Ga0068861_100282613 | |||
| 1143 | Ga0068851_10000587 | |||
| 1144 | Ga0068851_10109691 | |||
| 1145 | Ga0068870_10040871 | |||
| 1146 | Ga0068870_10259444 | |||
| 1147 | Ga0068863_100021364 | |||
| 1148 | Ga0068863_100025725 | |||
| 1149 | Ga0068863_100078929 | |||
| 1150 | Ga0068863_100087559 | |||
| 1151 | Ga0068863_100202201 | |||
| 1152 | Ga0068863_100308506 | |||
| 1153 | Ga0068863_100636779 | |||
| 1154 | Ga0068858_100046117 | |||
| 1155 | Ga0068858_100156792 | |||
| 1156 | Ga0068858_100193540 | |||
| 1157 | Ga0068860_100000101 | |||
| 1158 | Ga0068860_100015398 | |||
| 1159 | Ga0068860_100060092 | |||
| 1160 | Ga0068860_100085141 | |||
| 1161 | Ga0068860_100145234 | |||
| 1162 | Ga0068860_100220037 | |||
| 1163 | Ga0068860_100467297 | |||
| 1164 | Ga0068862_100000047 | |||
| 1165 | Ga0068862_100003056 | |||
| 1166 | Ga0068862_100038278 | |||
| 1167 | Ga0068862_100062032 | |||
| 1168 | Ga0068862_100080054 | |||
| 1169 | Ga0068862_100137438 | |||
| 1170 | Ga0068862_100139068 | |||
| 1171 | Ga0068862_100821827 | |||
| 1172 | Ga0081455_10003779 | |||
| 1173 | Ga0081455_10006696 | |||
| 1174 | Ga0081455_10029442 | |||
| 1175 | Ga0081455_10165348 | |||
| 1176 | Ga0081538_10000833 | |||
| 1177 | Ga0081540_1001291 | |||
| 1178 | Ga0081540_1003930 | |||
| 1179 | Ga0081540_1004182 | |||
| 1180 | Ga0081540_1005649 | |||
| 1181 | Ga0081540_1015542 | |||
| 1182 | Ga0081540_1017120 | |||
| 1183 | Ga0081540_1025179 | |||
| 1184 | Ga0081540_1027397 | |||
| 1185 | Ga0081540_1028497 | |||
| 1186 | Ga0081540_1068214 | |||
| 1187 | Ga0081540_1178028 | |||
| 1188 | Ga0081539_10000471 | |||
| 1189 | Ga0070717_10116045 | |||
| 1190 | Ga0070717_10500508 | |||
| 1191 | Ga0070717_10511642 | |||
| 1192 | Ga0075365_10042747 | |||
| 1193 | Ga0075365_10047906 | |||
| 1194 | Ga0075365_10079600 | |||
| 1195 | Ga0075365_10108564 | |||
| 1196 | Ga0075365_10429453 | |||
| 1197 | Ga0075368_10013501 | |||
| 1198 | Ga0075368_10023583 | |||
| 1199 | Ga0075368_10091381 | |||
| 1200 | Ga0075368_10140553 | |||
| 1201 | Ga0075363_100283740 | |||
| 1202 | Ga0075364_10314867 | |||
| 1203 | Ga0075364_10380246 | |||
| 1204 | Ga0070716_100044833 | |||
| 1205 | Ga0070712_100128740 | |||
| 1206 | Ga0070712_100193237 | |||
| 1207 | Ga0075362_10039542 | |||
| 1208 | Ga0075367_10008988 | |||
| 1209 | Ga0075367_10026390 | |||
| 1210 | Ga0075367_10146151 | |||
| 1211 | Ga0075369_10133574 | |||
| 1212 | Ga0075366_10009502 | |||
| 1213 | Ga0075366_10050259 | |||
| 1214 | Ga0075366_10062005 | |||
| 1215 | Ga0097621_100021909 | |||
| 1216 | Ga0097621_100050466 | |||
| 1217 | Ga0097621_100125903 | |||
| 1218 | Ga0097621_100380537 | |||
| 1219 | Ga0097621_100879718 | |||
| 1220 | Ga0075370_10000147 | |||
| 1221 | Ga0075370_10072696 | |||
| 1222 | Ga0075370_10350643 | |||
| 1223 | Ga0068871_100128781 | |||
| 1224 | Ga0068871_100494140 | |||
| 1225 | Ga0068871_100783575 | |||
| 1226 | Ga0075428_100094610 | |||
| 1227 | Ga0075428_100163564 | |||
| 1228 | Ga0075428_100185986 | |||
| 1229 | Ga0075430_100672211 | |||
| 1230 | Ga0075431_100548955 | |||
| 1231 | Ga0075431_100903374 | |||
| 1232 | Ga0068865_100008486 | |||
| 1233 | Ga0068865_100015739 | |||
| 1234 | Ga0068865_100109960 | |||
| 1235 | Ga0068865_100136061 | |||
| 1236 | Ga0068865_100335716 | |||
| 1237 | Ga0068865_100430594 | |||
| 1238 | Ga0068865_100595436 | |||
| 1239 | Ga0097620_100000414 | |||
| 1240 | Ga0097620_100076320 | |||
| 1241 | Ga0097620_100084312 | |||
| 1242 | Ga0097620_100097527 | |||
| 1243 | Ga0097620_100194921 | |||
| 1244 | Ga0097620_100249127 | |||
| 1245 | Ga0097620_100304524 | |||
| 1246 | Ga0097620_100444784 | |||
| 1247 | Ga0075435_100118143 | |||
| 1248 | Ga0075435_100128910 | |||
| 1249 | Ga0099795_10023630 | |||
| 1250 | Ga0099795_10041773 | |||
| 1251 | Ga0105240_10000495 | |||
| 1252 | Ga0105240_10024484 | |||
| 1253 | Ga0105240_10141191 | |||
| 1254 | Ga0105240_10158538 | |||
| 1255 | Ga0105240_10226551 | |||
| 1256 | Ga0105240_10248640 | |||
| 1257 | Ga0111539_10463516 | |||
| 1258 | Ga0111539_10464661 | |||
| 1259 | Ga0111539_10766903 | |||
| 1260 | Ga0105245_10004316 | |||
| 1261 | Ga0105245_10193005 | |||
| 1262 | Ga0105247_10022692 | |||
| 1263 | Ga0105247_10359340 | |||
| 1264 | Ga0114129_10064760 | |||
| 1265 | Ga0114129_10136245 | |||
| 1266 | Ga0114129_10206512 | |||
| 1267 | Ga0114129_10815684 | |||
| 1268 | Ga0105243_10020748 | |||
| 1269 | Ga0105243_10058200 | |||
| 1270 | Ga0105243_10086957 | |||
| 1271 | Ga0105243_10106563 | |||
| 1272 | Ga0105243_10110587 | |||
| 1273 | Ga0105243_10157612 | |||
| 1274 | Ga0105243_10184244 | |||
| 1275 | Ga0105243_10747896 | |||
| 1276 | Ga0105241_10006238 | |||
| 1277 | Ga0105241_10292311 | |||
| 1278 | Ga0105242_10617578 | |||
| 1279 | Ga0105248_10107747 | |||
| 1280 | Ga0105248_10268827 | |||
| 1281 | Ga0105248_10298774 | |||
| 1282 | Ga0105248_10795765 | |||
| 1283 | Ga0105248_10796537 | |||
| 1284 | Ga0105237_10006381 | |||
| 1285 | Ga0105237_10011342 | |||
| 1286 | Ga0105237_10012122 | |||
| 1287 | Ga0105237_10021683 | |||
| 1288 | Ga0105237_10075633 | |||
| 1289 | Ga0105238_10004494 | |||
| 1290 | Ga0105238_10043206 | |||
| 1291 | Ga0105238_10683922 | |||
| 1292 | Ga0105249_10069096 | |||
| 1293 | Ga0105249_10129440 | |||
| 1294 | Ga0105249_10220819 | |||
| 1295 | Ga0105249_10230409 | |||
| 1296 | Ga0105249_10238325 | |||
| 1297 | Ga0105249_11560800 | |||
| 1298 | Ga0105239_10039029 | |||
| 1299 | Ga0105239_10207482 | |||
| 1300 | Ga0105246_10153441 | |||
| 1301 | Ga0105246_10319065 | |||
| 1302 | Ga0157371_10248399 | |||
| 1303 | Ga0157370_10016536 | |||
| 1304 | Ga0157370_10920810 | |||
| 1305 | Ga0157369_10000836 | |||
| 1306 | Ga0157374_10146697 | |||
| 1307 | Ga0157374_10194313 | |||
| 1308 | Ga0157374_10865595 | |||
| 1309 | Ga0157378_10002185 | |||
| 1310 | Ga0157378_10007639 | |||
| 1311 | Ga0157378_10022662 | |||
| 1312 | Ga0157378_10418168 | |||
| 1313 | Ga0157378_10679850 | |||
| 1314 | Ga0163162_10027341 | |||
| 1315 | Ga0163162_10047907 | |||
| 1316 | Ga0163162_10150638 | |||
| 1317 | Ga0163162_10182967 | |||
| 1318 | Ga0163162_10217745 | |||
| 1319 | Ga0163162_10373681 | |||
| 1320 | Ga0163162_10754799 | |||
| 1321 | Ga0157372_10001071 | |||
| 1322 | Ga0157372_10032191 | |||
| 1323 | Ga0157375_10012569 | |||
| 1324 | Ga0157375_10044095 | |||
| 1325 | Ga0157375_10079099 | |||
| 1326 | Ga0157375_10130585 | |||
| 1327 | Ga0157375_10188077 | |||
| 1328 | Ga0157375_10248099 | |||
| 1329 | Ga0157375_10261710 | |||
| 1330 | Ga0163163_10000029 | |||
| 1331 | Ga0163163_10007518 | |||
| 1332 | Ga0163163_10014471 | |||
| 1333 | Ga0163163_10015227 | |||
| 1334 | Ga0163163_10032136 | |||
| 1335 | Ga0163163_10121004 | |||
| 1336 | Ga0163163_10123465 | |||
| 1337 | Ga0163163_10237779 | |||
| 1338 | Ga0157380_10011388 | |||
| 1339 | Ga0157380_10060575 | |||
| 1340 | Ga0157380_10082654 | |||
| 1341 | Ga0157380_10103813 | |||
| 1342 | Ga0157380_10137405 | |||
| 1343 | Ga0157380_10275600 | |||
| 1344 | Ga0157380_10324256 | |||
| 1345 | Ga0157380_10611800 | |||
| 1346 | Ga0157377_10128168 | |||
| 1347 | Ga0157377_10225520 | |||
| 1348 | Ga0157377_10295659 | |||
| 1349 | Ga0157379_10023505 | |||
| 1350 | Ga0157379_10051920 | |||
| 1351 | Ga0157379_10110137 | |||
| 1352 | Ga0157379_10191004 | |||
| 1353 | Ga0157379_10294214 | |||
| 1354 | Ga0157379_10310436 | |||
| 1355 | Ga0157379_10615614 | |||
| 1356 | Ga0157376_10125627 | |||
| 1357 | Ga0157376_10296489 | |||
| 1358 | Ga0182005_1055548 | |||
| 1359 | Ga0163161_10028786 | |||
| 1360 | Ga0163161_10282904 | |||
| 1361 | Ga0163161_10389405 | |||
| 1362 | Ga0163161_10498034 | |||
| 1363 | Ga0163161_10709337 | |||
| 1364 | Ga0213876_10044034 | |||
| 1365 | Ga0209759_1001908 | |||
| 1366 | Ga0209673_1016132 | |||
| 1367 | Ga0209130_1012625 | |||
| 1368 | Ga0209675_1030851 | |||
| 1369 | Ga0209676_1000639 | |||
| 1370 | Ga0209676_1001001 | |||
| 1371 | Ga0209676_1047419 | |||
| 1372 | Ga0209025_1001467 | |||
| 1373 | Ga0209564_1000419 | |||
| 1374 | Ga0209564_1001318 | |||
| 1375 | Ga0209758_1003680 | |||
| 1376 | Ga0209758_1031785 | |||
| 1377 | Ga0209758_1057233 | |||
| 1378 | Ga0209758_1072444 | |||
| 1379 | Ga0209050_1001840 | |||
| 1380 | Ga0209050_1006556 | |||
| 1381 | Ga0209256_1000455 | |||
| 1382 | Ga0209256_1001180 | |||
| 1383 | Ga0209051_1002091 | |||
| 1384 | Ga0209051_1002649 | |||
| 1385 | Ga0209257_1000238 | |||
| 1386 | Ga0209257_1001766 | |||
| 1387 | Ga0209257_1002420 | |||
| 1388 | Ga0207656_10004251 | |||
| 1389 | Ga0207656_10033768 | |||
| 1390 | Ga0207682_10124632 | |||
| 1391 | Ga0207642_10103291 | |||
| 1392 | Ga0207710_10036801 | |||
| 1393 | Ga0207710_10115891 | |||
| 1394 | Ga0207688_10039021 | |||
| 1395 | Ga0207688_10349343 | |||
| 1396 | Ga0207680_10000476 | |||
| 1397 | Ga0207647_10065771 | |||
| 1398 | Ga0207645_10076034 | |||
| 1399 | Ga0207645_10099802 | |||
| 1400 | Ga0207645_10123485 | |||
| 1401 | Ga0207643_10028714 | |||
| 1402 | Ga0207643_10034934 | |||
| 1403 | Ga0207705_10209621 | |||
| 1404 | Ga0207705_10469815 | |||
| 1405 | Ga0207654_10009388 | |||
| 1406 | Ga0207654_10036809 | |||
| 1407 | Ga0207707_10007468 | |||
| 1408 | Ga0207695_10000358 | |||
| 1409 | Ga0207695_10004971 | |||
| 1410 | Ga0207671_10002648 | |||
| 1411 | Ga0207671_10157962 | |||
| 1412 | Ga0207693_10176987 | |||
| 1413 | Ga0207663_10045180 | |||
| 1414 | Ga0207663_10404123 | |||
| 1415 | Ga0207657_10023504 | |||
| 1416 | Ga0207649_10129885 | |||
| 1417 | Ga0207649_10191589 | |||
| 1418 | Ga0207649_10278019 | |||
| 1419 | Ga0207681_10031738 | |||
| 1420 | Ga0207681_10054747 | |||
| 1421 | Ga0207681_10094497 | |||
| 1422 | Ga0207681_10386743 | |||
| 1423 | Ga0207681_10648389 | |||
| 1424 | Ga0207694_10017133 | |||
| 1425 | Ga0207694_10035310 | |||
| 1426 | Ga0207694_10193577 | |||
| 1427 | Ga0207694_10511624 | |||
| 1428 | Ga0207650_10069290 | |||
| 1429 | Ga0207650_10079549 | |||
| 1430 | Ga0207650_10197695 | |||
| 1431 | Ga0207659_10023857 | |||
| 1432 | Ga0207659_10559398 | |||
| 1433 | Ga0207687_10005087 | |||
| 1434 | Ga0207687_10110261 | |||
| 1435 | Ga0207687_10246384 | |||
| 1436 | Ga0207700_10025267 | |||
| 1437 | Ga0207700_10164979 | |||
| 1438 | Ga0207644_10139822 | |||
| 1439 | Ga0207706_10047522 | |||
| 1440 | Ga0207706_10070656 | |||
| 1441 | Ga0207706_10087082 | |||
| 1442 | Ga0207706_10131561 | |||
| 1443 | Ga0207706_10241654 | |||
| 1444 | Ga0207706_10474640 | |||
| 1445 | Ga0207706_10567183 | |||
| 1446 | Ga0207709_10005342 | |||
| 1447 | Ga0207709_10018788 | |||
| 1448 | Ga0207709_10109038 | |||
| 1449 | Ga0207670_10028354 | |||
| 1450 | Ga0207670_10086056 | |||
| 1451 | Ga0207670_10476414 | |||
| 1452 | Ga0207669_10021655 | |||
| 1453 | Ga0207704_10002148 | |||
| 1454 | Ga0207704_10008266 | |||
| 1455 | Ga0207704_10148930 | |||
| 1456 | Ga0207704_10248338 | |||
| 1457 | Ga0207704_10394548 | |||
| 1458 | Ga0207691_10033151 | |||
| 1459 | Ga0207691_10048149 | |||
| 1460 | Ga0207691_10133702 | |||
| 1461 | Ga0207691_10153916 | |||
| 1462 | Ga0207711_10000098 | |||
| 1463 | Ga0207711_10214795 | |||
| 1464 | Ga0207711_10676339 | |||
| 1465 | Ga0207711_10724386 | |||
| 1466 | Ga0207689_10015154 | |||
| 1467 | Ga0207689_10051342 | |||
| 1468 | Ga0207689_10142227 | |||
| 1469 | Ga0207689_10175349 | |||
| 1470 | Ga0207689_10265302 | |||
| 1471 | Ga0207689_10333701 | |||
| 1472 | Ga0207661_10117107 | |||
| 1473 | Ga0207679_10065919 | |||
| 1474 | Ga0207679_10171680 | |||
| 1475 | Ga0207667_10016864 | |||
| 1476 | Ga0207667_10041888 | |||
| 1477 | Ga0207667_10773533 | |||
| 1478 | Ga0207651_10001106 | |||
| 1479 | Ga0207651_10020981 | |||
| 1480 | Ga0207651_10265592 | |||
| 1481 | Ga0207651_10452314 | |||
| 1482 | Ga0207712_10026363 | |||
| 1483 | Ga0207712_10188605 | |||
| 1484 | Ga0207712_10197096 | |||
| 1485 | Ga0207668_10027648 | |||
| 1486 | Ga0207668_10031900 | |||
| 1487 | Ga0207668_10060606 | |||
| 1488 | Ga0207668_10085527 | |||
| 1489 | Ga0207668_10191661 | |||
| 1490 | Ga0207668_10192991 | |||
| 1491 | Ga0207668_10472050 | |||
| 1492 | Ga0207658_10082714 | |||
| 1493 | Ga0207658_10184257 | |||
| 1494 | Ga0207658_10780419 | |||
| 1495 | Ga0207677_10147967 | |||
| 1496 | Ga0207703_10100272 | |||
| 1497 | Ga0207639_10058409 | |||
| 1498 | Ga0207639_10792126 | |||
| 1499 | Ga0207678_10005204 | |||
| 1500 | Ga0207678_10017987 | |||
| 1501 | Ga0207678_10050897 | |||
| 1502 | Ga0207678_10060384 | |||
| 1503 | Ga0207678_10090856 | |||
| 1504 | Ga0207678_10242275 | |||
| 1505 | Ga0207708_10069046 | |||
| 1506 | Ga0207708_10105395 | |||
| 1507 | Ga0207708_10113763 | |||
| 1508 | Ga0207641_10016348 | |||
| 1509 | Ga0207641_10148854 | |||
| 1510 | Ga0207641_10217975 | |||
| 1511 | Ga0207641_10242460 | |||
| 1512 | Ga0207641_10339271 | |||
| 1513 | Ga0207641_10382243 | |||
| 1514 | Ga0207648_10003563 | |||
| 1515 | Ga0207648_10009450 | |||
| 1516 | Ga0207648_10015604 | |||
| 1517 | Ga0207648_10017126 | |||
| 1518 | Ga0207648_10060396 | |||
| 1519 | Ga0207648_10143390 | |||
| 1520 | Ga0207676_10015137 | |||
| 1521 | Ga0207676_10032577 | |||
| 1522 | Ga0207676_10039077 | |||
| 1523 | Ga0207676_10290230 | |||
| 1524 | Ga0207676_10396224 | |||
| 1525 | Ga0207674_10085971 | |||
| 1526 | Ga0207674_10337111 | |||
| 1527 | Ga0207674_10375547 | |||
| 1528 | Ga0207675_100001253 | |||
| 1529 | Ga0207675_100004336 | |||
| 1530 | Ga0207675_100013771 | |||
| 1531 | Ga0207675_100024128 | |||
| 1532 | Ga0207675_100036936 | |||
| 1533 | Ga0207675_100043744 | |||
| 1534 | Ga0207675_100112046 | |||
| 1535 | Ga0207675_100112047 | |||
| 1536 | Ga0207675_100410830 | |||
| 1537 | Ga0207683_10008156 | |||
| 1538 | Ga0207683_10017760 | |||
| 1539 | Ga0207683_10018480 | |||
| 1540 | Ga0207683_10037344 | |||
| 1541 | Ga0207683_10041256 | |||
| 1542 | Ga0207683_10044210 | |||
| 1543 | Ga0207683_10050000 | |||
| 1544 | Ga0207683_10082603 | |||
| 1545 | Ga0207683_10505710 | |||
| 1546 | Ga0207698_10000307 | |||
| 1547 | Ga0207698_10025166 | |||
| 1548 | Ga0207698_10363694 | |||
| 1549 | Ga0207698_10702057 | |||
| 1550 | Ga0209813_10029958 | |||
| 1551 | Ga0209813_10111407 | |||
| 1552 | Ga0207428_10101190 | |||
| 1553 | Ga0268266_10000001 | |||
| 1554 | Ga0268266_10015866 | |||
| 1555 | Ga0268266_10059884 | |||
| 1556 | Ga0268266_10078606 | |||
| 1557 | Ga0268266_10081919 | |||
| 1558 | Ga0268266_10135597 | |||
| 1559 | Ga0268266_10367367 | |||
| 1560 | Ga0268266_10378172 | |||
| 1561 | Ga0268266_10382864 | |||
| 1562 | Ga0268265_10003524 | |||
| 1563 | Ga0268265_10036581 | |||
| 1564 | Ga0268265_10068580 | |||
| 1565 | Ga0268265_10092769 | |||
| 1566 | Ga0268265_10098633 | |||
| 1567 | Ga0268265_10105532 | |||
| 1568 | Ga0268265_10113956 | |||
| 1569 | Ga0268265_10128340 | |||
| 1570 | Ga0268265_10567846 | |||
| 1571 | Ga0268265_10754741 | |||
| 1572 | Ga0268264_10000030 | |||
| 1573 | Ga0268264_10016053 | |||
| 1574 | Ga0268264_10055441 | |||
| 1575 | Ga0268264_10162903 | |||
| 1576 | Ga0268264_10215062 | |||
| 1577 | Ga0268264_10336261 | |||
| 1578 | Ga0268264_10374180 | |||
| 1579 | Ga0268264_10384053 | |||
| 1580 | Ga0268264_10460553 | |||
| 1581 | Ga0268264_10646822 | |||
| 1582 | Ga0307517_10000122 | |||
| 1583 | Ga0307515_10000043 | |||
| 1584 | Ga0307515_10240877 | |||
| 1585 | Ga0307511_10015933 | |||
| 1586 | Ga0265330_10060974 | |||
| 1587 | Ga0265332_10009236 | |||
| 1588 | Ga0265325_10003289 | |||
| 1589 | Ga0265339_10038111 | |||
| 1590 | Ga0265331_10008432 | |||
| 1591 | Ga0265316_10031772 | |||
| 1592 | Ga0265316_10294503 | |||
| 1593 | Ga0307513_10003232 | |||
| 1594 | Ga0307513_10037653 | |||
| 1595 | Ga0307513_10115604 | |||
| 1596 | Ga0307513_10150994 | |||
| 1597 | Ga0307513_10245640 | |||
| 1598 | Ga0307509_10006746 | |||
| 1599 | Ga0307509_10379046 | |||
| 1600 | Ga0307408_100242117 | |||
| 1601 | Ga0265313_10180556 | |||
| 1602 | Ga0307508_10057714 | |||
| 1603 | Ga0265314_10039859 | |||
| 1604 | Ga0265314_10051392 | |||
| 1605 | Ga0265342_10258509 | |||
| 1606 | Ga0307516_10015865 | |||
| 1607 | Ga0307516_10126750 | |||
| 1608 | Ga0307516_10172958 | |||
| 1609 | Ga0307516_10365893 | |||
| 1610 | Ga0307516_10596392 | |||
| 1611 | Ga0307405_10026876 | |||
| 1612 | Ga0307413_10488115 | |||
| 1613 | Ga0307406_10054423 | |||
| 1614 | Ga0307407_10232033 | |||
| 1615 | Ga0307409_100088126 | |||
| 1616 | Ga0307409_100175083 | |||
| 1617 | Ga0307416_100749044 | |||
| 1618 | Ga0307416_100944647 | |||
| 1619 | Ga0307416_101115947 | |||
| 1620 | Ga0307411_10105962 | |||
| 1621 | Ga0307415_100006727 | |||
| 1622 | Ga0307415_100337673 | |||
| 1623 | Ga0307507_10014479 | |||
| 1624 | Ga0307510_10003639 | |||
| 1625 | Ga0307510_10161994 | |||
| 1626 | Ga0373930_0037467 | |||
| 1627 | Ga0373923_0202501 | |||
| 1628 | Ga0373939_0014548 | |||
| 1629 | Ga0373953_0038921 | |||
| 1630 | Ga0373956_0065226 | |||
| 1631 | Ga0373957_0029749 | |||
| 1632 | Ga0373960_0020924 | |||
| 1633 | Ga0373943_0064276 | |||
| 1634 | Ga0373946_0097256 | |||
| 1635 | Ga0373955_0016397 | |||
| 1636 | Ga0373961_0018582 | |||
| 1637 | Ga0373924_0068274 | |||
| 1638 | Ga0373931_0010343 | |||
| 1639 | Ga0373931_0037521 | |||
| 1640 | Ga0373931_0048401 | |||
| 1641 | Ga0373935_0026016 | |||
| 1642 | Ga0373935_0095842 | |||
| 1643 | Ga0373935_0096650 | |||
| 1644 | Ga0373935_0508185 | |||
| 1645 | Ga0373927_0128053 | |||
| 1646 | Ga0373927_0152284 | |||
| 1647 | Ga0373927_0193248 | |||
| 1648 | Ga0373927_0270446 | |||
| 1649 | Ga0373947_0017715 | |||
| 1650 | Ga0373947_0097679 | |||
| 1651 | Ga0373947_0155317 | |||
| 1652 | Ga0373947_0473944 | |||
| 1653 | Ga0373937_0142991 | |||
| 1654 | Ga0373937_0169314 | |||
| 1655 | Ga0373937_0615681 | |||
| 1656 | Ga0373937_1124905 | |||
| 1657 | Ga0373925_0014079 | |||
| 1658 | Ga0373925_0022521 | |||
| 1659 | Ga0395900_0005340 | |||
| 1660 | Ga0395900_0145751 | |||
| 1661 | Ga0395900_0301587 | |||
| 1662 | Ga0395898_0019044 | |||
| 1663 | Ga0395898_0116371 | |||
| 1664 | Ga0395898_0241165 | |||
| 1665 | Ga0395905_0001012 | |||
| 1666 | Ga0395905_0184415 | |||
| 1667 | Ga0436364_0601084 | |||
| 1668 | Ga0436364_0920940 | |||
| 1669 | Ga0395901_0004257 | |||
| 1670 | Ga0395901_0605203 | |||
| 1671 | Ga0436365_0610368 | |||
| 1672 | Ga0436365_1007984 | |||
| 1673 | Ga0436365_1315860 | |||
| 1674 | Ga0439461_0004108 | |||
| 1675 | Ga0439465_0003417 | |||
| 1676 | Ga0439465_0033690 | |||
| 1677 | Ga0439465_0103235 | |||
| 1678 | Ga0451807_0624241 | |||
| 1679 | Ga0451807_1847672 | |||
| 1680 | Ga0451837_1740338 | |||
| 1681 | Ga0439431_0055205 | |||
| 1682 | Ga0439433_0001608 | |||
| 1683 | Ga0439441_021595 | |||
| 1684 | Ga0439442_014784 | |||
| 1685 | Ga0439445_0014539 | |||
| 1686 | Ga0439449_0004078 | |||
| 1687 | Ga0439457_007831 | |||
| 1688 | Ga0439462_0003601 | |||
| 1689 | Ga0439435_0001742 | |||
| 1690 | Ga0439444_0035010 | |||
| 1691 | Ga0439464_0062731 | |||
| 1692 | Ga0439460_0005243 | |||
| 1693 | Ga0466965_0230104 | |||
| 1694 | Ga0466966_0058361 | |||
| 1695 | Ga0466960_0002956 | |||
| 1696 | Ga0466959_0044856 | |||
| 1697 | Ga0451576_0122843 | |||
| 1698 | Ga0466958_0001042 | |||
| 1699 | Ga0495617_018903 | |||
| 1700 | Ga0495617_124614 | |||
| 1701 | Ga0495603_0025997 | |||
| 1702 | Ga0495603_0069753 | |||
| 1703 | Ga0495629_0037804 | |||
| 1704 | Ga0495629_0142404 | |||
| 1705 | Ga0495638_0002597 | |||
| 1706 | Ga0495651_0056427 | |||
| 1707 | Ga0495653_0096208 | |||
| 1708 | Ga0495650_0083879 | |||
| 1709 | Ga0495580_0034696 | |||
| 1710 | Ga0495639_0150366 | |||
| 1711 | Ga0495664_0191287 | |||
| 1712 | Ga0495664_0199801 | |||
| 1713 | Ga0495584_0044555 | |||
| 1714 | Ga0495584_0091744 | |||
| 1715 | Ga0495594_0252893 | |||
| 1716 | Ga0495606_0067194 | |||
| 1717 | Ga0495606_0239771 | |||
| 1718 | Ga0495610_0128106 | |||
| 1719 | Ga0495631_0106893 | |||
| 1720 | Ga0495644_0029773 | |||
| 1721 | Ga0495644_0102310 | |||
| 1722 | Ga0495644_0212731 | |||
| 1723 | Ga0495652_0126016 | |||
| 1724 | Ga0495652_0482796 | |||
| 1725 | Ga0495586_0303933 | |||
| 1726 | Ga0495598_0001642 | |||
| 1727 | Ga0495609_0073014 | |||
| 1728 | Ga0495645_0107866 | |||
| 1729 | Ga0495622_0022506 | |||
| 1730 | Ga0495667_0057622 | |||
| 1731 | Ga0495656_0002575 | |||
| 1732 | Ga0495656_0012197 | |||
| 1733 | Ga0495656_0077293 | |||
| 1734 | Ga0495668_0010364 | |||
| 1735 | Ga0495668_0037381 | |||
| 1736 | Ga0495668_0150554 | |||
| 1737 | Ga0495634_0071448 | |||
| 1738 | Ga0495611_0071182 | |||
| 1739 | Ga0495625_0012065 | |||
| 1740 | Ga0495625_0069527 | |||
| 1741 | Ga0495625_0289328 | |||
| 1742 | Ga0495635_0087217 | |||
| 1743 | Ga0495659_0031613 | |||
| 1744 | Ga0495588_0047898 | |||
| 1745 | Ga0495657_0069074 | |||
| 1746 | Ga0495599_0219876 | |||
| 1747 | Ga0495623_0041564 | |||
| 1748 | Ga0495658_0306148 | |||
| 1749 | Ga0495669_0000964 | |||
| 1750 | Ga0495669_0098495 | |||
| 1751 | Ga0495669_0151182 | |||
| 1752 | Ga0495613_0199314 | |||
| 1753 | Ga0495670_0063191 | |||
| 1754 | Ga0495670_0113975 | |||
| 1755 | Ga0495670_0115131 | |||
| 1756 | Ga0495671_0116062 | |||
| 1757 | Ga0495589_0092334 | |||
| 1758 | Ga0495589_0257695 | |||
| 1759 | Ga0495600_0383054 | |||
| 1760 | Ga0495581_0027007 | |||
| 1761 | Ga0495636_0014193 | |||
| 1762 | Ga0495674_0158434 | |||
| 1763 | Ga0495674_0254637 | |||
| 1764 | Ga0495672_0032048 | |||
| 1765 | Ga0495672_0173928 | |||
| 1766 | Ga0495675_0011843 | |||
| 1767 | Ga0495673_0051908 | |||
| 1768 | Ga0495684_0182813 | |||
| 1769 | Ga0495602_0227064 | |||
| 1770 | Ga0495602_0249811 | |||
| 1771 | Ga0495602_0283373 | |||
| 1772 | Ga0496100_0012121 | |||
| 1773 | Ga0496100_0057455 | |||
| 1774 | Ga0496100_0096698 | |||
| 1775 | Ga0496100_0351901 | |||
| 1776 | Ga0496100_0437155 | |||
| 1777 | Ga0496101_0023542 | |||
| 1778 | Ga0496101_0091977 | |||
| 1779 | Ga0496101_0395561 | |||
| 1780 | Ga0496102_0004326 | |||
| 1781 | Ga0496102_0034264 | |||
| 1782 | Ga0496102_0107644 | |||
| 1783 | Ga0496102_0556044 | |||
| 1784 | Ga0496102_0717895 | |||
| 1785 | Ga0496104_0090962 | |||
| 1786 | Ga0496104_0096898 | |||
| 1787 | Ga0496104_0107333 | |||
| 1788 | Ga0496104_0550860 | |||
| 1789 | Ga0496105_0006457 | |||
| 1790 | Ga0496105_0039757 | |||
| 1791 | Ga0496105_0222252 | |||
| 1792 | Ga0496105_0327509 | |||
| 1793 | Ga0496106_0003360 | |||
| 1794 | Ga0496106_0016237 | |||
| 1795 | Ga0496106_0350450 | |||
| 1796 | Ga0496106_0835426 | |||
| 1797 | Ga0496107_0071687 | |||
| 1798 | Ga0496107_0175093 | |||
| 1799 | Ga0496107_0554321 | |||
| 1800 | Ga0496108_0006585 | |||
| 1801 | Ga0496108_0010340 | |||
| 1802 | Ga0496108_0157770 | |||
| 1803 | Ga0496109_0006126 | |||
| 1804 | Ga0496109_0011401 | |||
| 1805 | Ga0496109_0198128 | |||
| 1806 | Ga0496109_0270699 | |||
| 1807 | Ga0496110_0023135 | |||
| 1808 | Ga0496110_0046061 | |||
| 1809 | Ga0496110_0112471 | |||
| 1810 | Ga0496110_0228619 | |||
| 1811 | Ga0496110_0266373 | |||
| 1812 | Ga0496110_0433558 | |||
| 1813 | Ga0496110_0461289 | |||
| 1814 | Ga0496110_0732973 | |||
| 1815 | Ga0496111_0037948 | |||
| 1816 | Ga0496111_0116203 | |||
| 1817 | Ga0496112_0092212 | |||
| 1818 | Ga0496112_0356725 | |||
| 1819 | Ga0496112_0377201 | |||
| 1820 | Ga0496112_0408951 | |||
| 1821 | Ga0496112_0699460 | |||
| 1822 | Ga0496113_0000320 | |||
| 1823 | Ga0496113_0001582 | |||
| 1824 | Ga0496113_0138616 | |||
| 1825 | Ga0496114_0004567 | |||
| 1826 | Ga0496114_0057402 | |||
| 1827 | Ga0496114_0081747 | |||
| 1828 | Ga0496114_0226461 | |||
| 1829 | Ga0496114_0931260 | |||
| 1830 | Ga0496115_0010306 | |||
| 1831 | Ga0496115_0041743 | |||
| 1832 | Ga0496115_0174637 | |||
| 1833 | Ga0496115_0423003 | |||
| 1834 | Ga0496117_0204783 | |||
| 1835 | Ga0496121_0015212 | |||
| 1836 | Ga0496121_0074288 | |||
| 1837 | Ga0496121_0130861 | |||
| 1838 | Ga0496121_0343318 | |||
| 1839 | Ga0496124_0000273 | |||
| 1840 | Ga0496124_0072888 | |||
| 1841 | Ga0496125_0025541 | |||
| 1842 | Ga0496125_0133791 | |||
| 1843 | Ga0496126_0043505 | |||
| 1844 | Ga0496126_0084620 | |||
| 1845 | Ga0496126_0089878 | |||
| 1846 | Ga0496126_0130695 | |||
| 1847 | Ga0495682_0067438 | |||
| 1848 | Ga0501031_0000753 | |||
| 1849 | Ga0501032_0000136 | |||
| 1850 | Ga0501033_0000202 | |||
| 1851 | Ga0501033_0048226 | |||
| 1852 | Ga0501033_0300749 | |||
| 1853 | Ga0501034_0000113 | |||
| 1854 | Ga0501034_0139242 | |||
| 1855 | Ga0501036_0000059 | |||
| 1856 | Ga0501037_0000270 | |||
| 1857 | Ga0501038_0000774 | |||
| 1858 | Ga0501039_0000067 | |||
| 1859 | Ga0501040_0167868 | |||
| 1860 | Ga0501042_0126544 | |||
| 1861 | Ga0501042_0464350 | |||
| 1862 | Ga0501043_0000017 | |||
| 1863 | Ga0501046_0000174 | |||
| 1864 | Ga0501047_0005957 | |||
| 1865 | Ga0501048_0000127 | |||
| 1866 | Ga0501048_0201065 | |||
| 1867 | Ga0501067_0000833 | |||
| 1868 | Ga0501068_0004830 | |||
| 1869 | Ga0501069_0002149 | |||
| 1870 | Ga0501069_0088674 | |||
| 1871 | Ga0501070_0009120 | |||
| 1872 | Ga0501070_0102336 | |||
| 1873 | Ga0501070_0265459 | |||
| 1874 | Ga0501071_0078396 | |||
| 1875 | Ga0501071_0282021 | |||
| 1876 | Ga0501071_0518923 | |||
| 1877 | Ga0501072_0017358 | |||
| 1878 | Ga0501073_0000069 | |||
| 1879 | Ga0501073_0089049 | |||
| 1880 | Ga0501073_0389392 | |||
| 1881 | Ga0501074_0000507 | |||
| 1882 | Ga0501074_0028902 | |||
| 1883 | Ga0501074_0061582 | |||
| 1884 | Ga0501075_0034209 | |||
| 1885 | Ga0501076_0014693 | |||
| 1886 | Ga0501079_0143012 | |||
| 1887 | Ga0501080_0000593 | |||
| 1888 | Ga0501080_0159402 | |||
| 1889 | Ga0501080_0209512 | |||
| 1890 | Ga0501081_0015033 | |||
| 1891 | Ga0501081_0192184 | |||
| 1892 | Ga0501083_0000336 | |||
| 1893 | Ga0501083_0047097 | |||
| 1894 | Ga0501083_0251662 | |||
| 1895 | Ga0501035_0000393 | |||
| 1896 | Ga0501035_0168014 | |||
| 1897 | Ga0501035_0277837 | |||
| 1898 | Ga0501044_0000387 | |||
| 1899 | Ga0501044_0015271 | |||
| 1900 | Ga0501044_0090851 | |||
| 1901 | Ga0501045_0019923 | |||
| 1902 | Ga0501045_0140758 | |||
| 1903 | Ga0501045_0426253 | |||
| 1904 | nmdc:mga03683_39524_c1 | |||
| 1905 | nmdc:mga03683_82834_c1 | |||
| 1906 | nmdc:mga03n38_112773_c1 | |||
| 1907 | nmdc:mga03n38_160169_c1 | |||
| 1908 | nmdc:mga03n38_279282_c1 | |||
| 1909 | nmdc:mga03n38_6268_c1 | |||
| 1910 | nmdc:mga00v17_52318_c1 | |||
| 1911 | nmdc:mga0yw44_10122_c1 | |||
| 1912 | nmdc:mga0yw44_17650_c1 | |||
| 1913 | nmdc:mga0yw44_332022_c1 | |||
| 1914 | nmdc:mga0k408_253369_c1 | |||
| 1915 | nmdc:mga0k408_30599_c1 | |||
| 1916 | nmdc:mga0k408_84524_c1 | |||
| 1917 | nmdc:mga06z11_135036_c1 | |||
| 1918 | nmdc:mga06z11_304506_c1 | |||
| 1919 | nmdc:mga06z11_70690_c1 | |||
| 1920 | nmdc:mga04h51_28453_c1 | |||
| 1921 | nmdc:mga07m45_103717_c1 | |||
| 1922 | nmdc:mga07m45_14161_c1 | |||
| 1923 | nmdc:mga07m45_174808_c1 | |||
| 1924 | nmdc:mga07m45_39889_c1 | |||
| 1925 | nmdc:mga07m45_424766_c1 | |||
| 1926 | nmdc:mga05p37_22572_c1 | |||
| 1927 | nmdc:mga06r32_463968_c1 | |||
| 1928 | nmdc:mga06r32_738397_c1 | |||
| 1929 | nmdc:mga08y16_125147_c1 | |||
| 1930 | nmdc:mga08y16_269467_c1 | |||
| 1931 | nmdc:mga0n895_61208_c1 | |||
| 1932 | nmdc:mga0n895_716909_c1 | |||
| 1933 | nmdc:mga0n895_90050_c1 | |||
| 1934 | nmdc:mga0rr50_187562_c1 | |||
| 1935 | nmdc:mga0rr50_244691_c1 | |||
| 1936 | nmdc:mga0rr50_334824_c1 | |||
| 1937 | nmdc:mga0a205_102260_c1 | |||
| 1938 | nmdc:mga0a205_178341_c1 | |||
| 1939 | nmdc:mga0sz30_75405_c1 | |||
| 1940 | Ga0495601_0032289 | |||
| 1941 | Ga0495601_0124641 | |||
| 1942 | Ga0500610_0000237 | |||
| 1943 | Ga0500635_0059072 | |||
| 1944 | Ga0495619_0026355 | |||
| 1945 | Ga0500581_094759 | |||
| 1946 | Ga0500646_0085796 | |||
| 1947 | Ga0500647_0018336 | |||
| 1948 | Ga0500651_0202913 | |||
| 1949 | Ga0500566_0000149 | |||
| 1950 | Ga0500641_0035698 | |||
| 1951 | Ga0500641_0074109 | |||
| 1952 | Ga0500554_075187 | |||
| 1953 | Ga0500594_0150022 | |||
| 1954 | Ga0500595_000336 | |||
| 1955 | Ga0500595_000870 | |||
| 1956 | Ga0500595_006384 | |||
| 1957 | Ga0500595_034365 | |||
| 1958 | Ga0500608_063733 | |||
| 1959 | Ga0500642_0020733 | |||
| 1960 | Ga0500642_0047674 | |||
| 1961 | Ga0500655_003937 | |||
| 1962 | Ga0500559_0019051 | |||
| 1963 | Ga0500559_0094641 | |||
| 1964 | Ga0500573_0004501 | |||
| 1965 | Ga0500577_0182878 | |||
| 1966 | Ga0500586_010049 | |||
| 1967 | Ga0500588_0015778 | |||
| 1968 | Ga0500603_008164 | |||
| 1969 | Ga0500604_0025643 | |||
| 1970 | Ga0500622_0091414 | |||
| 1971 | Ga0500630_094713 | |||
| 1972 | Ga0500638_000529 | |||
| 1973 | Ga0500636_0010678 | |||
| 1974 | Ga0500636_0035110 | |||
| 1975 | Ga0500636_0250444 | |||
| 1976 | Ga0500637_0000289 | |||
| 1977 | Ga0500645_000493 | |||
| 1978 | Ga0500645_027134 | |||
| 1979 | Ga0501084_0000898 | |||
| 1980 | Ga0501084_0025166 | |||
| 1981 | Ga0501084_0514181 | |||
| 1982 | Ga0500661_002949 | |||
| 1983 | Ga0590075_012620 | |||
| 1984 | Ga0501082_0003002 | |||
| 1985 | Ga0501082_0046564 | |||
| 1986 | 2524466399 | |||
| 1987 | 2524539845 | |||
| 1988 | 2644255942 | |||
| 1989 | 2723849270 | |||
| 1990 | 2793067165 | |||
| 1991 | 2793081627 | |||
| 1992 | 2874608495 | |||
| 1993 | 2876813851 | |||
| 1994 | 2879112725 | |||
| 1995 | 2885194161 | |||
| 1996 | 2889035947 | |||
| 1997 | 2904707688 | |||
| 1998 | 8006936833 | |||
| 1999 | 8006967801 | |||
| 2000 | 8006976803 | |||
| 2001 | 8019561860 | |||
| 2002 | 8019571936 | |||
| 2003 | 8056678524 | |||
| 2004 | 8056683105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3trd-assembly1.cif.gz_A | structure of an alpha-beta serine hydrolase homologue from coxiella burnetii | 0.8375 | 24 | 234 |
| 2o2g-assembly1.cif.gz_A | crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution | 0.8273 | 20 | 238 |
| 3trd-assembly1.cif.gz_A | structure of an alpha-beta serine hydrolase homologue from coxiella burnetii | 0.8046 | 24 | 234 |
| 2o2g-assembly1.cif.gz_A | crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution | 0.7992 | 20 | 238 |
| 6eic-assembly1.cif.gz_C | crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis | 0.7876 | 21 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FGW5_14_203_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8888 | 44 | 220 | 3.40.50.1820 |
| af_I1K6A2_1_89_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8498 | 144 | 222 | 3.40.50.1820 |
| af_A0A2R8RQ35_2_224_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8447 | 21 | 243 | 3.40.50.1820 |
| af_P96267_2_202_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8413 | 38 | 237 | 3.40.50.1820 |
| af_A0A2R8RQ35_2_224_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8411 | 21 | 243 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UCT2-F1-model_v4 | Alpha/beta hydrolase | 0.9994 | 34 | 225 |
GO:0016787
|
| AF-H0T9F2-F1-model_v4 | KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein | 0.9965 | 20 | 242 |
|
| AF-A0A537YB30-F1-model_v4 | Alpha/beta hydrolase | 0.9952 | 19 | 222 |
GO:0016787
|
| AF-A0A3N1M5G4-F1-model_v4 | KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein | 0.995 | 21 | 239 |
|
| AF-A0A562KXC6-F1-model_v4 | KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein | 0.9943 | 23 | 240 |
|