F487904

General Info

Members Datasets Scaffolds Average Seq Length
1002 423 2004 228

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10061089|Ga0111539_100610894
Length 276
Sequence MTFPAVVGCHGRNVASLLSLAKVVSWPVWLSPGFFRYSVAAGHGYSSDQMKAADAQSLRIEIRPGETVSALLIRPQQARACYVFAHGAGAGMAHSSMETIAAGLGERGIATLRYQFPYMEKGSKRPDAPAVAHAAVRAAVAEAGRCCPSLPLIAGGKSFGGRMTSQAQALSPLPGVGGLAFLGFPLHPAGKPSSERAKHLADVKIPMLFLQGTRDALAELRLLEPVVKELGSRGRLHLLDGADHSFHVLKSSGRNDREVLDEALDAFAAWVDGIAG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
374 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
387 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
390 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
391 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
392 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
393 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
397 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
398 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
399 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
403 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
406 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
407 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
408 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
409 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
410 2791355199
411 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
412 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
413 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
414 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
415 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
416 2904699407
417 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
418 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
419 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
420 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
421 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
422 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
423 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 1.2
Rhizoplane 6.39
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10061089 3300009094 Bacteria 4464
2 JGI24744J21845_10003077 3300002077 Bacteria 3418
3 JGI25151J46595_10026222 3300003187 Bacteria 2356
4 JGI25406J46586_10000053 3300003203 Bacteria 53627
5 rootH1_10032258 3300003323 Bacteria 2987
6 JGI25404J52841_10000607 3300003659 Bacteria 5363
7 JGI25404J52841_10006761 3300003659 Bacteria 2406
8 JGI25404J52841_10007695 3300003659 Bacteria 2283
9 Ga0055526_1003550 3300003771 Bacteria 9828
10 Ga0055526_1022860 3300003771 Bacteria 2108
11 Ga0055524_1007614 3300003775 Bacteria 4578
12 Ga0055524_1012951 3300003775 Bacteria 3174
13 Ga0055531_10004270 3300003794 Bacteria 8779
14 Ga0055531_10011319 3300003794 Bacteria 4321
15 Ga0055531_10013753 3300003794 Bacteria 3707
16 Ga0065707_10115043 3300005295 Bacteria 2279
17 Ga0070676_10032114 3300005328 Bacteria 3006
18 Ga0070690_100472282 3300005330 Bacteria 934
19 Ga0070670_100037213 3300005331 Bacteria 4187
20 Ga0070670_100390160 3300005331 Unclassified 1228
21 Ga0068869_100099600 3300005334 Bacteria 2197
22 Ga0068869_100339507 3300005334 Bacteria 1222
23 Ga0068869_100512121 3300005334 Bacteria 1003
24 Ga0070666_10007661 3300005335 Bacteria 6666
25 Ga0070682_100004502 3300005337 Bacteria 7739
26 Ga0068868_100053379 3300005338 Bacteria 3184
27 Ga0068868_100090241 3300005338 Bacteria 2468
28 Ga0070660_100003389 3300005339 Bacteria 10964
29 Ga0070689_100241826 3300005340 Bacteria 1487
30 Ga0070661_100009747 3300005344 Bacteria 6659
31 Ga0070661_100142406 3300005344 Bacteria 1808
32 Ga0070661_100733888 3300005344 Bacteria 807
33 Ga0070668_100013269 3300005347 Bacteria 6148
34 Ga0070668_100021395 3300005347 Bacteria 4885
35 Ga0070668_100049961 3300005347 Bacteria 3218
36 Ga0070668_100084205 3300005347 Bacteria 2497
37 Ga0070668_100126243 3300005347 Bacteria 2049
38 Ga0070669_100048155 3300005353 Bacteria 3111
39 Ga0070669_100052275 3300005353 Bacteria 2988
40 Ga0070669_100554451 3300005353 Bacteria 958
41 Ga0070675_100001220 3300005354 Bacteria 18692
42 Ga0070675_100106122 3300005354 Bacteria 2371
43 Ga0070675_100157356 3300005354 Bacteria 1952
44 Ga0070671_100125426 3300005355 Bacteria 2161
45 Ga0070671_100130284 3300005355 Bacteria 2118
46 Ga0070674_100042527 3300005356 Bacteria 3087
47 Ga0070674_100107362 3300005356 Bacteria 2044
48 Ga0070674_100224232 3300005356 Bacteria 1464
49 Ga0070674_100267266 3300005356 Bacteria 1350
50 Ga0070674_100285551 3300005356 Bacteria 1310
51 Ga0070674_100409920 3300005356 Bacteria 1109
52 Ga0070674_100798623 3300005356 Bacteria 815
53 Ga0070673_100000479 3300005364 Bacteria 21257
54 Ga0070673_100005052 3300005364 Bacteria 8415
55 Ga0070673_100075753 3300005364 Bacteria 2715
56 Ga0070673_100102034 3300005364 Bacteria 2364
57 Ga0070673_100120137 3300005364 Bacteria 2191
58 Ga0070659_100012064 3300005366 Bacteria 6398
59 Ga0070667_100067544 3300005367 Bacteria 3040
60 Ga0070667_100109981 3300005367 Bacteria 2389
61 Ga0070667_100595094 3300005367 Bacteria 1019
62 Ga0070701_10046520 3300005438 Bacteria 2231
63 Ga0070711_100018468 3300005439 Bacteria 4454
64 Ga0070700_100099052 3300005441 Bacteria 1917
65 Ga0070700_100116428 3300005441 Bacteria 1784
66 Ga0070700_100130390 3300005441 Bacteria 1696
67 Ga0070700_100748395 3300005441 Bacteria 782
68 Ga0070663_100017170 3300005455 Bacteria 4717
69 Ga0070663_100030261 3300005455 Bacteria 3708
70 Ga0070678_100019281 3300005456 Bacteria 4443
71 Ga0070678_100039965 3300005456 Bacteria 3315
72 Ga0070678_100051740 3300005456 Bacteria 2979
73 Ga0070678_100093224 3300005456 Bacteria 2315
74 Ga0070678_100113408 3300005456 Bacteria 2125
75 Ga0070678_100235000 3300005456 Bacteria 1530
76 Ga0070662_100042557 3300005457 Bacteria 3245
77 Ga0070662_100116653 3300005457 Bacteria 2041
78 Ga0070681_10076134 3300005458 Bacteria 3315
79 Ga0068867_100065718 3300005459 Bacteria 2700
80 Ga0068867_100079873 3300005459 Bacteria 2462
81 Ga0068867_100291663 3300005459 Bacteria 1341
82 Ga0068867_100835774 3300005459 Bacteria 824
83 Ga0070685_10139205 3300005466 Bacteria 1526
84 Ga0070685_10160849 3300005466 Bacteria 1431
85 Ga0070685_10448771 3300005466 Bacteria 903
86 Ga0070698_100882766 3300005471 Bacteria 839
87 Ga0070684_100976059 3300005535 Bacteria 795
88 Ga0068853_100113556 3300005539 Bacteria 2409
89 Ga0068853_100326132 3300005539 Bacteria 1424
90 Ga0068853_100595310 3300005539 Bacteria 1050
91 Ga0068853_100897194 3300005539 Bacteria 851
92 Ga0070672_100008509 3300005543 Bacteria 7024
93 Ga0070672_100075100 3300005543 Bacteria 2698
94 Ga0070672_100214744 3300005543 Bacteria 1612
95 Ga0070672_100324303 3300005543 Bacteria 1309
96 Ga0070686_100020285 3300005544 Bacteria 3930
97 Ga0070686_100764046 3300005544 Bacteria 776
98 Ga0070696_100035783 3300005546 Bacteria 3420
99 Ga0070696_100236811 3300005546 Bacteria 1375
100 Ga0070693_100112353 3300005547 Bacteria 1678
101 Ga0070665_100000211 3300005548 Bacteria 100358
102 Ga0070665_100004360 3300005548 Bacteria 14884
103 Ga0070665_100015880 3300005548 Bacteria 7558
104 Ga0070665_100043289 3300005548 Bacteria 4524
105 Ga0070665_100043750 3300005548 Bacteria 4499
106 Ga0070665_100044260 3300005548 Bacteria 4471
107 Ga0070665_100099984 3300005548 Bacteria 2904
108 Ga0070665_100103906 3300005548 Bacteria 2844
109 Ga0070665_100109114 3300005548 Bacteria 2770
110 Ga0070665_100234724 3300005548 Bacteria 1834
111 Ga0070665_100402485 3300005548 Bacteria 1377
112 Ga0070665_100423660 3300005548 Bacteria 1340
113 Ga0068855_100000686 3300005563 Bacteria 41326
114 Ga0068855_100005666 3300005563 Bacteria 15250
115 Ga0070664_100035394 3300005564 Bacteria 4192
116 Ga0070664_100053079 3300005564 Bacteria 3435
117 Ga0070664_100826694 3300005564 Bacteria 867
118 Ga0068857_100137632 3300005577 Bacteria 2206
119 Ga0068852_100001192 3300005616 Bacteria 17243
120 Ga0068852_100100551 3300005616 Bacteria 2609
121 Ga0068852_100488223 3300005616 Bacteria 1225
122 Ga0068859_100000414 3300005617 Bacteria 42532
123 Ga0068859_100076320 3300005617 Bacteria 3392
124 Ga0068859_100084314 3300005617 Bacteria 3223
125 Ga0068859_100097520 3300005617 Bacteria 2993
126 Ga0068859_100194909 3300005617 Bacteria 2110
127 Ga0068859_100249133 3300005617 Bacteria 1867
128 Ga0068859_100304490 3300005617 Bacteria 1687
129 Ga0068859_100444783 3300005617 Bacteria 1392
130 Ga0068864_100010492 3300005618 Bacteria 7655
131 Ga0068864_100013481 3300005618 Bacteria 6776
132 Ga0068864_100032170 3300005618 Bacteria 4455
133 Ga0068864_100112221 3300005618 Bacteria 2429
134 Ga0068864_100133739 3300005618 Bacteria 2231
135 Ga0068866_10149453 3300005718 Bacteria 1351
136 Ga0068861_100000358 3300005719 Bacteria 26076
137 Ga0068861_100035625 3300005719 Bacteria 3688
138 Ga0068861_100136011 3300005719 Bacteria 2000
139 Ga0068861_100136925 3300005719 Bacteria 1994
140 Ga0068861_100282613 3300005719 Bacteria 1430
141 Ga0068851_10000587 3300005834 Bacteria 15782
142 Ga0068851_10109691 3300005834 Bacteria 1472
143 Ga0068870_10040871 3300005840 Bacteria 2407
144 Ga0068870_10259444 3300005840 Bacteria 1081
145 Ga0068863_100021364 3300005841 Bacteria 6177
146 Ga0068863_100025725 3300005841 Bacteria 5613
147 Ga0068863_100078929 3300005841 Bacteria 3117
148 Ga0068863_100087559 3300005841 Bacteria 2951
149 Ga0068863_100202201 3300005841 Bacteria 1911
150 Ga0068863_100308506 3300005841 Bacteria 1536
151 Ga0068863_100636779 3300005841 Bacteria 1057
152 Ga0068858_100046117 3300005842 Bacteria 4041
153 Ga0068858_100156792 3300005842 Bacteria 2142
154 Ga0068858_100193540 3300005842 Bacteria 1922
155 Ga0068860_100000101 3300005843 Bacteria 142856
156 Ga0068860_100015398 3300005843 Bacteria 7472
157 Ga0068860_100060092 3300005843 Bacteria 3613
158 Ga0068860_100085141 3300005843 Bacteria 3007
159 Ga0068860_100145234 3300005843 Bacteria 2282
160 Ga0068860_100220037 3300005843 Bacteria 1844
161 Ga0068860_100467297 3300005843 Bacteria 1256
162 Ga0068862_100000047 3300005844 Bacteria 151607
163 Ga0068862_100003056 3300005844 Bacteria 14580
164 Ga0068862_100038278 3300005844 Bacteria 4067
165 Ga0068862_100062032 3300005844 Bacteria 3214
166 Ga0068862_100080054 3300005844 Bacteria 2833
167 Ga0068862_100137438 3300005844 Bacteria 2167
168 Ga0068862_100139068 3300005844 Bacteria 2154
169 Ga0068862_100821827 3300005844 Bacteria 909
170 Ga0081455_10003779 3300005937 Bacteria 17287
171 Ga0081455_10006696 3300005937 Bacteria 12314
172 Ga0081455_10029442 3300005937 Bacteria 5006
173 Ga0081455_10165348 3300005937 Bacteria 1691
174 Ga0081538_10000833 3300005981 Bacteria 33440
175 Ga0081540_1001291 3300005983 Bacteria 21876
176 Ga0081540_1003930 3300005983 Bacteria 11560
177 Ga0081540_1004182 3300005983 Bacteria 11108
178 Ga0081540_1005649 3300005983 Bacteria 9303
179 Ga0081540_1015542 3300005983 Bacteria 4815
180 Ga0081540_1017120 3300005983 Bacteria 4500
181 Ga0081540_1025179 3300005983 Bacteria 3432
182 Ga0081540_1027397 3300005983 Bacteria 3229
183 Ga0081540_1028497 3300005983 Bacteria 3135
184 Ga0081540_1068214 3300005983 Bacteria 1658
185 Ga0081540_1178028 3300005983 Bacteria 800
186 Ga0081539_10000471 3300005985 Bacteria 85272
187 Ga0070717_10116045 3300006028 Bacteria 2289
188 Ga0070717_10500508 3300006028 Bacteria 1098
189 Ga0070717_10511642 3300006028 Bacteria 1086
190 Ga0075365_10042747 3300006038 Bacteria 2964
191 Ga0075365_10047906 3300006038 Bacteria 2811
192 Ga0075365_10079600 3300006038 Bacteria 2217
193 Ga0075365_10108564 3300006038 Bacteria 1905
194 Ga0075365_10429453 3300006038 Bacteria 933
195 Ga0075368_10013501 3300006042 Bacteria 3001
196 Ga0075368_10023583 3300006042 Bacteria 2351
197 Ga0075368_10091381 3300006042 Bacteria 1245
198 Ga0075368_10140553 3300006042 Bacteria 1006
199 Ga0075363_100283740 3300006048 Bacteria 958
200 Ga0075364_10314867 3300006051 Bacteria 1066
201 Ga0075364_10380246 3300006051 Bacteria 963
202 Ga0070716_100044833 3300006173 Bacteria 2479
203 Ga0070712_100128740 3300006175 Bacteria 1916
204 Ga0070712_100193237 3300006175 Bacteria 1594
205 Ga0075362_10039542 3300006177 Bacteria 2074
206 Ga0075367_10008988 3300006178 Bacteria 5201
207 Ga0075367_10026390 3300006178 Bacteria 3294
208 Ga0075367_10146151 3300006178 Bacteria 1466
209 Ga0075369_10133574 3300006186 Bacteria 1129
210 Ga0075366_10009502 3300006195 Bacteria 5429
211 Ga0075366_10050259 3300006195 Bacteria 2475
212 Ga0075366_10062005 3300006195 Bacteria 2223
213 Ga0097621_100021909 3300006237 Bacteria 4952
214 Ga0097621_100050466 3300006237 Bacteria 3384
215 Ga0097621_100125903 3300006237 Bacteria 2176
216 Ga0097621_100380537 3300006237 Bacteria 1260
217 Ga0097621_100879718 3300006237 Bacteria 833
218 Ga0075370_10000147 3300006353 Bacteria 24004
219 Ga0075370_10072696 3300006353 Bacteria 1968
220 Ga0075370_10350643 3300006353 Bacteria 882
221 Ga0068871_100128781 3300006358 Bacteria 2144
222 Ga0068871_100494140 3300006358 Bacteria 1102
223 Ga0068871_100783575 3300006358 Bacteria 878
224 Ga0075428_100094610 3300006844 Bacteria 3257
225 Ga0075428_100163564 3300006844 Bacteria 2414
226 Ga0075428_100185986 3300006844 Bacteria 2248
227 Ga0075430_100672211 3300006846 Bacteria 854
228 Ga0075431_100548955 3300006847 Bacteria 1143
229 Ga0075431_100903374 3300006847 Bacteria 853
230 Ga0068865_100008486 3300006881 Bacteria 6352
231 Ga0068865_100015739 3300006881 Bacteria 4826
232 Ga0068865_100109960 3300006881 Bacteria 2032
233 Ga0068865_100136061 3300006881 Bacteria 1847
234 Ga0068865_100335716 3300006881 Bacteria 1220
235 Ga0068865_100430594 3300006881 Bacteria 1087
236 Ga0068865_100595436 3300006881 Bacteria 934
237 Ga0097620_100000414 3300006931 Bacteria 42532
238 Ga0097620_100076320 3300006931 Bacteria 3392
239 Ga0097620_100084312 3300006931 Bacteria 3223
240 Ga0097620_100097527 3300006931 Bacteria 2993
241 Ga0097620_100194921 3300006931 Bacteria 2110
242 Ga0097620_100249127 3300006931 Bacteria 1867
243 Ga0097620_100304524 3300006931 Bacteria 1687
244 Ga0097620_100444784 3300006931 Bacteria 1392
245 Ga0075435_100118143 3300007076 Bacteria 2210
246 Ga0075435_100128910 3300007076 Bacteria 2116
247 Ga0099795_10023630 3300007788 Bacteria 2041
248 Ga0099795_10041773 3300007788 Bacteria 1634
249 Ga0105240_10000495 3300009093 Bacteria 72639
250 Ga0105240_10024484 3300009093 Bacteria 7954
251 Ga0105240_10141191 3300009093 Bacteria 2879
252 Ga0105240_10158538 3300009093 Bacteria 2690
253 Ga0105240_10226551 3300009093 Bacteria 2175
254 Ga0105240_10248640 3300009093 Bacteria 2058
255 Ga0111539_10463516 3300009094 Bacteria 1475
256 Ga0111539_10464661 3300009094 Bacteria 1473
257 Ga0111539_10766903 3300009094 Bacteria 1123
258 Ga0105245_10004316 3300009098 Bacteria 12584
259 Ga0105245_10193005 3300009098 Bacteria 1952
260 Ga0105247_10022692 3300009101 Bacteria 3780
261 Ga0105247_10359340 3300009101 Bacteria 1026
262 Ga0114129_10064760 3300009147 Bacteria 5101
263 Ga0114129_10136245 3300009147 Bacteria 3369
264 Ga0114129_10206512 3300009147 Bacteria 2657
265 Ga0114129_10815684 3300009147 Bacteria 1189
266 Ga0105243_10020748 3300009148 Bacteria 4985
267 Ga0105243_10058200 3300009148 Bacteria 3079
268 Ga0105243_10086957 3300009148 Bacteria 2565
269 Ga0105243_10106563 3300009148 Bacteria 2337
270 Ga0105243_10110587 3300009148 Bacteria 2298
271 Ga0105243_10157612 3300009148 Bacteria 1954
272 Ga0105243_10184244 3300009148 Bacteria 1818
273 Ga0105243_10747896 3300009148 Bacteria 958
274 Ga0105241_10006238 3300009174 Bacteria 8789
275 Ga0105241_10292311 3300009174 Bacteria 1395
276 Ga0105242_10617578 3300009176 Bacteria 1049
277 Ga0105248_10107747 3300009177 Bacteria 3142
278 Ga0105248_10268827 3300009177 Bacteria 1920
279 Ga0105248_10298774 3300009177 Bacteria 1813
280 Ga0105248_10795765 3300009177 Bacteria 1067
281 Ga0105248_10796537 3300009177 Bacteria 1067
282 Ga0105237_10006381 3300009545 Bacteria 13086
283 Ga0105237_10011342 3300009545 Bacteria 9430
284 Ga0105237_10012122 3300009545 Bacteria 9099
285 Ga0105237_10021683 3300009545 Bacteria 6602
286 Ga0105237_10075633 3300009545 Bacteria 3358
287 Ga0105238_10004494 3300009551 Bacteria 13820
288 Ga0105238_10043206 3300009551 Bacteria 4561
289 Ga0105238_10683922 3300009551 Bacteria 1037
290 Ga0105249_10069096 3300009553 Bacteria 3260
291 Ga0105249_10129440 3300009553 Bacteria 2408
292 Ga0105249_10220819 3300009553 Bacteria 1865
293 Ga0105249_10230409 3300009553 Bacteria 1827
294 Ga0105249_10238325 3300009553 Bacteria 1797
295 Ga0105249_11560800 3300009553 Bacteria 733
296 Ga0105239_10039029 3300010375 Bacteria 5202
297 Ga0105239_10207482 3300010375 Bacteria 2196
298 Ga0105246_10153441 3300011119 Bacteria 1746
299 Ga0105246_10319065 3300011119 Bacteria 1262
300 Ga0157371_10248399 3300013102 Bacteria 1280
301 Ga0157370_10016536 3300013104 Bacteria 7464
302 Ga0157370_10920810 3300013104 Bacteria 793
303 Ga0157369_10000836 3300013105 Bacteria 39329
304 Ga0157374_10146697 3300013296 Bacteria 2292
305 Ga0157374_10194313 3300013296 Bacteria 1986
306 Ga0157374_10865595 3300013296 Bacteria 921
307 Ga0157378_10002185 3300013297 Bacteria 17349
308 Ga0157378_10007639 3300013297 Bacteria 9438
309 Ga0157378_10022662 3300013297 Bacteria 5527
310 Ga0157378_10418168 3300013297 Bacteria 1324
311 Ga0157378_10679850 3300013297 Bacteria 1047
312 Ga0163162_10027341 3300013306 Bacteria 5641
313 Ga0163162_10047907 3300013306 Bacteria 4282
314 Ga0163162_10150638 3300013306 Bacteria 2444
315 Ga0163162_10182967 3300013306 Bacteria 2222
316 Ga0163162_10217745 3300013306 Bacteria 2039
317 Ga0163162_10373681 3300013306 Bacteria 1559
318 Ga0163162_10754799 3300013306 Bacteria 1092
319 Ga0157372_10001071 3300013307 Bacteria 29897
320 Ga0157372_10032191 3300013307 Bacteria 5747
321 Ga0157375_10012569 3300013308 Bacteria 7513
322 Ga0157375_10044095 3300013308 Bacteria 4329
323 Ga0157375_10079099 3300013308 Bacteria 3323
324 Ga0157375_10130585 3300013308 Bacteria 2631
325 Ga0157375_10188077 3300013308 Bacteria 2219
326 Ga0157375_10248099 3300013308 Bacteria 1941
327 Ga0157375_10261710 3300013308 Bacteria 1891
328 Ga0163163_10000029 3300014325 Bacteria 174973
329 Ga0163163_10007518 3300014325 Bacteria 9617
330 Ga0163163_10014471 3300014325 Bacteria 7251
331 Ga0163163_10015227 3300014325 Bacteria 7104
332 Ga0163163_10032136 3300014325 Bacteria 5070
333 Ga0163163_10121004 3300014325 Bacteria 2652
334 Ga0163163_10123465 3300014325 Bacteria 2625
335 Ga0163163_10237779 3300014325 Bacteria 1871
336 Ga0157380_10011388 3300014326 Bacteria 6427
337 Ga0157380_10060575 3300014326 Bacteria 3025
338 Ga0157380_10082654 3300014326 Bacteria 2629
339 Ga0157380_10103813 3300014326 Bacteria 2372
340 Ga0157380_10137405 3300014326 Bacteria 2094
341 Ga0157380_10275600 3300014326 Bacteria 1536
342 Ga0157380_10324256 3300014326 Bacteria 1429
343 Ga0157380_10611800 3300014326 Bacteria 1080
344 Ga0157377_10128168 3300014745 Bacteria 1546
345 Ga0157377_10225520 3300014745 Bacteria 1202
346 Ga0157377_10295659 3300014745 Bacteria 1067
347 Ga0157379_10023505 3300014968 Bacteria 5471
348 Ga0157379_10051920 3300014968 Bacteria 3660
349 Ga0157379_10110137 3300014968 Bacteria 2473
350 Ga0157379_10191004 3300014968 Bacteria 1851
351 Ga0157379_10294214 3300014968 Unclassified 1479
352 Ga0157379_10310436 3300014968 Bacteria 1439
353 Ga0157379_10615614 3300014968 Bacteria 1014
354 Ga0157376_10125627 3300014969 Bacteria 2281
355 Ga0157376_10296489 3300014969 Bacteria 1529
356 Ga0182005_1055548 3300015265 Bacteria 1079
357 Ga0163161_10028786 3300017792 Bacteria 3947
358 Ga0163161_10282904 3300017792 Bacteria 1301
359 Ga0163161_10389405 3300017792 Bacteria 1115
360 Ga0163161_10498034 3300017792 Bacteria 992
361 Ga0163161_10709337 3300017792 Bacteria 838
362 Ga0213876_10044034 3300021384 Bacteria 2359
363 Ga0209759_1001908 3300025256 Bacteria 10225
364 Ga0209673_1016132 3300025273 Bacteria 2807
365 Ga0209130_1012625 3300025284 Bacteria 2200
366 Ga0209675_1030851 3300025291 Bacteria 1273
367 Ga0209676_1000639 3300025292 Bacteria 50356
368 Ga0209676_1001001 3300025292 Bacteria 33180
369 Ga0209676_1047419 3300025292 Bacteria 1155
370 Ga0209025_1001467 3300025294 Bacteria 30758
371 Ga0209564_1000419 3300025295 Bacteria 74653
372 Ga0209564_1001318 3300025295 Bacteria 26574
373 Ga0209758_1003680 3300025297 Bacteria 13631
374 Ga0209758_1031785 3300025297 Bacteria 2158
375 Ga0209758_1057233 3300025297 Bacteria 1312
376 Ga0209758_1072444 3300025297 Unclassified 1078
377 Ga0209050_1001840 3300025298 Bacteria 20553
378 Ga0209050_1006556 3300025298 Bacteria 6848
379 Ga0209256_1000455 3300025299 Bacteria 61874
380 Ga0209256_1001180 3300025299 Bacteria 29391
381 Ga0209051_1002091 3300025303 Bacteria 15051
382 Ga0209051_1002649 3300025303 Bacteria 12522
383 Ga0209257_1000238 3300025304 Bacteria 128576
384 Ga0209257_1001766 3300025304 Bacteria 23946
385 Ga0209257_1002420 3300025304 Bacteria 18636
386 Ga0207656_10004251 3300025321 Bacteria 4987
387 Ga0207656_10033768 3300025321 Unclassified 2133
388 Ga0207682_10124632 3300025893 Bacteria 1146
389 Ga0207642_10103291 3300025899 Bacteria 1435
390 Ga0207710_10036801 3300025900 Bacteria 2159
391 Ga0207710_10115891 3300025900 Bacteria 1276
392 Ga0207688_10039021 3300025901 Bacteria 2638
393 Ga0207688_10349343 3300025901 Bacteria 911
394 Ga0207680_10000476 3300025903 Bacteria 18981
395 Ga0207647_10065771 3300025904 Bacteria 2200
396 Ga0207645_10076034 3300025907 Bacteria 2150
397 Ga0207645_10099802 3300025907 Bacteria 1872
398 Ga0207645_10123485 3300025907 Bacteria 1682
399 Ga0207643_10028714 3300025908 Bacteria 3092
400 Ga0207643_10034934 3300025908 Bacteria 2818
401 Ga0207705_10209621 3300025909 Bacteria 1478
402 Ga0207705_10469815 3300025909 Bacteria 976
403 Ga0207654_10009388 3300025911 Bacteria 4968
404 Ga0207654_10036809 3300025911 Bacteria 2736
405 Ga0207707_10007468 3300025912 Bacteria 9522
406 Ga0207695_10000358 3300025913 Bacteria 104469
407 Ga0207695_10004971 3300025913 Bacteria 17897
408 Ga0207671_10002648 3300025914 Bacteria 18817
409 Ga0207671_10157962 3300025914 Bacteria 1755
410 Ga0207693_10176987 3300025915 Bacteria 1678
411 Ga0207663_10045180 3300025916 Bacteria 2708
412 Ga0207663_10404123 3300025916 Bacteria 1045
413 Ga0207657_10023504 3300025919 Bacteria 5738
414 Ga0207649_10129885 3300025920 Bacteria 1710
415 Ga0207649_10191589 3300025920 Bacteria 1438
416 Ga0207649_10278019 3300025920 Bacteria 1216
417 Ga0207681_10031738 3300025923 Bacteria 3452
418 Ga0207681_10054747 3300025923 Bacteria 2714
419 Ga0207681_10094497 3300025923 Bacteria 2142
420 Ga0207681_10386743 3300025923 Bacteria 1127
421 Ga0207681_10648389 3300025923 Bacteria 875
422 Ga0207694_10017133 3300025924 Bacteria 5474
423 Ga0207694_10035310 3300025924 Bacteria 3835
424 Ga0207694_10193577 3300025924 Bacteria 1653
425 Ga0207694_10511624 3300025924 Bacteria 1006
426 Ga0207650_10069290 3300025925 Bacteria 2650
427 Ga0207650_10079549 3300025925 Bacteria 2483
428 Ga0207650_10197695 3300025925 Bacteria 1609
429 Ga0207659_10023857 3300025926 Bacteria 4090
430 Ga0207659_10559398 3300025926 Bacteria 973
431 Ga0207687_10005087 3300025927 Bacteria 8710
432 Ga0207687_10110261 3300025927 Bacteria 2041
433 Ga0207687_10246384 3300025927 Bacteria 1418
434 Ga0207700_10025267 3300025928 Bacteria 4123
435 Ga0207700_10164979 3300025928 Bacteria 1843
436 Ga0207644_10139822 3300025931 Bacteria 1863
437 Ga0207706_10047522 3300025933 Bacteria 3796
438 Ga0207706_10070656 3300025933 Bacteria 3071
439 Ga0207706_10087082 3300025933 Bacteria 2746
440 Ga0207706_10131561 3300025933 Bacteria 2201
441 Ga0207706_10241654 3300025933 Bacteria 1579
442 Ga0207706_10474640 3300025933 Bacteria 1081
443 Ga0207706_10567183 3300025933 Bacteria 976
444 Ga0207709_10005342 3300025935 Bacteria 7309
445 Ga0207709_10018788 3300025935 Bacteria 3876
446 Ga0207709_10109038 3300025935 Bacteria 1847
447 Ga0207670_10028354 3300025936 Bacteria 3554
448 Ga0207670_10086056 3300025936 Bacteria 2210
449 Ga0207670_10476414 3300025936 Bacteria 1010
450 Ga0207669_10021655 3300025937 Bacteria 3398
451 Ga0207704_10002148 3300025938 Bacteria 8837
452 Ga0207704_10008266 3300025938 Bacteria 4962
453 Ga0207704_10148930 3300025938 Bacteria 1649
454 Ga0207704_10248338 3300025938 Bacteria 1334
455 Ga0207704_10394548 3300025938 Bacteria 1090
456 Ga0207691_10033151 3300025940 Bacteria 4810
457 Ga0207691_10048149 3300025940 Bacteria 3909
458 Ga0207691_10133702 3300025940 Bacteria 2189
459 Ga0207691_10153916 3300025940 Bacteria 2020
460 Ga0207711_10000098 3300025941 Bacteria 92296
461 Ga0207711_10214795 3300025941 Bacteria 1758
462 Ga0207711_10676339 3300025941 Bacteria 963
463 Ga0207711_10724386 3300025941 Bacteria 927
464 Ga0207689_10015154 3300025942 Bacteria 6533
465 Ga0207689_10051342 3300025942 Bacteria 3399
466 Ga0207689_10142227 3300025942 Bacteria 1976
467 Ga0207689_10175349 3300025942 Bacteria 1768
468 Ga0207689_10265302 3300025942 Bacteria 1421
469 Ga0207689_10333701 3300025942 Bacteria 1259
470 Ga0207661_10117107 3300025944 Bacteria 2263
471 Ga0207679_10065919 3300025945 Bacteria 2711
472 Ga0207679_10171680 3300025945 Bacteria 1786
473 Ga0207667_10016864 3300025949 Bacteria 8239
474 Ga0207667_10041888 3300025949 Bacteria 4869
475 Ga0207667_10773533 3300025949 Bacteria 958
476 Ga0207651_10001106 3300025960 Bacteria 11995
477 Ga0207651_10020981 3300025960 Bacteria 3958
478 Ga0207651_10265592 3300025960 Bacteria 1411
479 Ga0207651_10452314 3300025960 Bacteria 1102
480 Ga0207712_10026363 3300025961 Bacteria 3871
481 Ga0207712_10188605 3300025961 Bacteria 1626
482 Ga0207712_10197096 3300025961 Bacteria 1594
483 Ga0207668_10027648 3300025972 Bacteria 3697
484 Ga0207668_10031900 3300025972 Bacteria 3475
485 Ga0207668_10060606 3300025972 Bacteria 2657
486 Ga0207668_10085527 3300025972 Bacteria 2301
487 Ga0207668_10191661 3300025972 Bacteria 1620
488 Ga0207668_10192991 3300025972 Bacteria 1615
489 Ga0207668_10472050 3300025972 Bacteria 1074
490 Ga0207658_10082714 3300025986 Bacteria 2466
491 Ga0207658_10184257 3300025986 Bacteria 1730
492 Ga0207658_10780419 3300025986 Unclassified 867
493 Ga0207677_10147967 3300026023 Bacteria 1807
494 Ga0207703_10100272 3300026035 Bacteria 2453
495 Ga0207639_10058409 3300026041 Bacteria 2967
496 Ga0207639_10792126 3300026041 Bacteria 883
497 Ga0207678_10005204 3300026067 Bacteria 11659
498 Ga0207678_10017987 3300026067 Bacteria 6209
499 Ga0207678_10050897 3300026067 Bacteria 3578
500 Ga0207678_10060384 3300026067 Bacteria 3261
501 Ga0207678_10090856 3300026067 Bacteria 2610
502 Ga0207678_10242275 3300026067 Bacteria 1544
503 Ga0207708_10069046 3300026075 Bacteria 2705
504 Ga0207708_10105395 3300026075 Bacteria 2185
505 Ga0207708_10113763 3300026075 Bacteria 2103
506 Ga0207641_10016348 3300026088 Bacteria 6075
507 Ga0207641_10148854 3300026088 Bacteria 2119
508 Ga0207641_10217975 3300026088 Bacteria 1768
509 Ga0207641_10242460 3300026088 Bacteria 1680
510 Ga0207641_10339271 3300026088 Bacteria 1430
511 Ga0207641_10382243 3300026088 Bacteria 1349
512 Ga0207648_10003563 3300026089 Bacteria 16282
513 Ga0207648_10009450 3300026089 Bacteria 9340
514 Ga0207648_10015604 3300026089 Bacteria 6979
515 Ga0207648_10017126 3300026089 Bacteria 6604
516 Ga0207648_10060396 3300026089 Bacteria 3306
517 Ga0207648_10143390 3300026089 Bacteria 2106
518 Ga0207676_10015137 3300026095 Bacteria 5563
519 Ga0207676_10032577 3300026095 Bacteria 3929
520 Ga0207676_10039077 3300026095 Bacteria 3627
521 Ga0207676_10290230 3300026095 Bacteria 1489
522 Ga0207676_10396224 3300026095 Bacteria 1289
523 Ga0207674_10085971 3300026116 Bacteria 3139
524 Ga0207674_10337111 3300026116 Bacteria 1458
525 Ga0207674_10375547 3300026116 Bacteria 1374
526 Ga0207675_100001253 3300026118 Bacteria 25329
527 Ga0207675_100004336 3300026118 Bacteria 13707
528 Ga0207675_100013771 3300026118 Bacteria 7544
529 Ga0207675_100024128 3300026118 Bacteria 5654
530 Ga0207675_100036936 3300026118 Bacteria 4557
531 Ga0207675_100043744 3300026118 Bacteria 4183
532 Ga0207675_100112046 3300026118 Bacteria 2575
533 Ga0207675_100112047 3300026118 Bacteria 2575
534 Ga0207675_100410830 3300026118 Bacteria 1335
535 Ga0207683_10008156 3300026121 Bacteria 8960
536 Ga0207683_10017760 3300026121 Bacteria 6067
537 Ga0207683_10018480 3300026121 Bacteria 5949
538 Ga0207683_10037344 3300026121 Bacteria 4229
539 Ga0207683_10041256 3300026121 Bacteria 4029
540 Ga0207683_10044210 3300026121 Bacteria 3894
541 Ga0207683_10050000 3300026121 Bacteria 3661
542 Ga0207683_10082603 3300026121 Bacteria 2854
543 Ga0207683_10505710 3300026121 Bacteria 1116
544 Ga0207698_10000307 3300026142 Bacteria 29443
545 Ga0207698_10025166 3300026142 Bacteria 4188
546 Ga0207698_10363694 3300026142 Bacteria 1371
547 Ga0207698_10702057 3300026142 Bacteria 1007
548 Ga0209813_10029958 3300027866 Bacteria 1596
549 Ga0209813_10111407 3300027866 Bacteria 943
550 Ga0207428_10101190 3300027907 Bacteria 2227
551 Ga0268266_10000001 3300028379 Bacteria 4040580
552 Ga0268266_10015866 3300028379 Bacteria 6446
553 Ga0268266_10059884 3300028379 Bacteria 3281
554 Ga0268266_10078606 3300028379 Bacteria 2871
555 Ga0268266_10081919 3300028379 Bacteria 2814
556 Ga0268266_10135597 3300028379 Bacteria 2205
557 Ga0268266_10367367 3300028379 Bacteria 1355
558 Ga0268266_10378172 3300028379 Bacteria 1335
559 Ga0268266_10382864 3300028379 Bacteria 1327
560 Ga0268265_10003524 3300028380 Bacteria 11197
561 Ga0268265_10036581 3300028380 Bacteria 3596
562 Ga0268265_10068580 3300028380 Bacteria 2751
563 Ga0268265_10092769 3300028380 Bacteria 2418
564 Ga0268265_10098633 3300028380 Bacteria 2354
565 Ga0268265_10105532 3300028380 Bacteria 2286
566 Ga0268265_10113956 3300028380 Bacteria 2213
567 Ga0268265_10128340 3300028380 Bacteria 2103
568 Ga0268265_10567846 3300028380 Bacteria 1079
569 Ga0268265_10754741 3300028380 Bacteria 944
570 Ga0268264_10000030 3300028381 Bacteria 418542
571 Ga0268264_10016053 3300028381 Bacteria 6135
572 Ga0268264_10055441 3300028381 Bacteria 3312
573 Ga0268264_10162903 3300028381 Bacteria 2011
574 Ga0268264_10215062 3300028381 Bacteria 1767
575 Ga0268264_10336261 3300028381 Bacteria 1433
576 Ga0268264_10374180 3300028381 Bacteria 1362
577 Ga0268264_10384053 3300028381 Bacteria 1345
578 Ga0268264_10460553 3300028381 Bacteria 1234
579 Ga0268264_10646822 3300028381 Bacteria 1046
580 Ga0307517_10000122 3300028786 Bacteria 116429
581 Ga0307515_10000043 3300028794 Bacteria 304612
582 Ga0307515_10240877 3300028794 Bacteria 1580
583 Ga0307511_10015933 3300030521 Bacteria 7264
584 Ga0265330_10060974 3300031235 Bacteria 1641
585 Ga0265332_10009236 3300031238 Bacteria 4406
586 Ga0265325_10003289 3300031241 Bacteria 10627
587 Ga0265339_10038111 3300031249 Bacteria 2683
588 Ga0265331_10008432 3300031250 Bacteria 5865
589 Ga0265316_10031772 3300031344 Bacteria 4314
590 Ga0265316_10294503 3300031344 Bacteria 1183
591 Ga0307513_10003232 3300031456 Bacteria 22216
592 Ga0307513_10037653 3300031456 Bacteria 5381
593 Ga0307513_10115604 3300031456 Bacteria 2665
594 Ga0307513_10150994 3300031456 Bacteria 2232
595 Ga0307513_10245640 3300031456 Bacteria 1591
596 Ga0307509_10006746 3300031507 Bacteria 15293
597 Ga0307509_10379046 3300031507 Bacteria 1128
598 Ga0307408_100242117 3300031548 Bacteria 1483
599 Ga0265313_10180556 3300031595 Bacteria 887
600 Ga0307508_10057714 3300031616 Bacteria 3435
601 Ga0265314_10039859 3300031711 Bacteria 3378
602 Ga0265314_10051392 3300031711 Bacteria 2871
603 Ga0265342_10258509 3300031712 Bacteria 927
604 Ga0307516_10015865 3300031730 Bacteria 7905
605 Ga0307516_10126750 3300031730 Bacteria 2337
606 Ga0307516_10172958 3300031730 Bacteria 1899
607 Ga0307516_10365893 3300031730 Bacteria 1106
608 Ga0307516_10596392 3300031730 Bacteria 759
609 Ga0307405_10026876 3300031731 Bacteria 3328
610 Ga0307413_10488115 3300031824 Bacteria 986
611 Ga0307406_10054423 3300031901 Bacteria 2554
612 Ga0307407_10232033 3300031903 Bacteria 1254
613 Ga0307409_100088126 3300031995 Bacteria 2532
614 Ga0307409_100175083 3300031995 Bacteria 1893
615 Ga0307416_100749044 3300032002 Bacteria 1069
616 Ga0307416_100944647 3300032002 Bacteria 964
617 Ga0307416_101115947 3300032002 Bacteria 893
618 Ga0307411_10105962 3300032005 Bacteria 2000
619 Ga0307415_100006727 3300032126 Bacteria 6229
620 Ga0307415_100337673 3300032126 Bacteria 1263
621 Ga0307507_10014479 3300033179 Bacteria 9395
622 Ga0307510_10003639 3300033180 Bacteria 17987
623 Ga0307510_10161994 3300033180 Bacteria 1832
624 Ga0373930_0037467 3300034816 Bacteria 1021
625 Ga0373923_0202501 3300035111 Bacteria 918
626 Ga0373939_0014548 3300035114 Bacteria 2044
627 Ga0373953_0038921 3300035117 Bacteria 1883
628 Ga0373956_0065226 3300035119 Bacteria 1654
629 Ga0373957_0029749 3300035120 Bacteria 1997
630 Ga0373960_0020924 3300035121 Bacteria 1734
631 Ga0373943_0064276 3300035170 Bacteria 1842
632 Ga0373946_0097256 3300035171 Unclassified 1314
633 Ga0373955_0016397 3300035172 Bacteria 3645
634 Ga0373961_0018582 3300035241 Bacteria 1817
635 Ga0373924_0068274 3300035410 Bacteria 1496
636 Ga0373931_0010343 3300035691 Bacteria 4483
637 Ga0373931_0037521 3300035691 Bacteria 2530
638 Ga0373931_0048401 3300035691 Bacteria 2254
639 Ga0373935_0026016 3300035692 Bacteria 3608
640 Ga0373935_0095842 3300035692 Bacteria 1949
641 Ga0373935_0096650 3300035692 Bacteria 1942
642 Ga0373935_0508185 3300035692 Bacteria 875
643 Ga0373927_0128053 3300035695 Bacteria 1658
644 Ga0373927_0152284 3300035695 Bacteria 1514
645 Ga0373927_0193248 3300035695 Bacteria 1335
646 Ga0373927_0270446 3300035695 Bacteria 1117
647 Ga0373947_0017715 3300035725 Bacteria 4098
648 Ga0373947_0097679 3300035725 Bacteria 1841
649 Ga0373947_0155317 3300035725 Bacteria 1476
650 Ga0373947_0473944 3300035725 Bacteria 849
651 Ga0373937_0142991 3300036401 Bacteria 2239
652 Ga0373937_0169314 3300036401 Bacteria 2049
653 Ga0373937_0615681 3300036401 Bacteria 1030
654 Ga0373937_1124905 3300036401 Bacteria 734
655 Ga0373925_0014079 3300037068 Bacteria 5788
656 Ga0373925_0022521 3300037068 Bacteria 4596
657 Ga0395900_0005340 3300037418 Bacteria 13462
658 Ga0395900_0145751 3300037418 Bacteria 2421
659 Ga0395900_0301587 3300037418 Bacteria 1588
660 Ga0395898_0019044 3300037466 Bacteria 6989
661 Ga0395898_0116371 3300037466 Bacteria 2562
662 Ga0395898_0241165 3300037466 Bacteria 1724
663 Ga0395905_0001012 3300037471 Bacteria 35880
664 Ga0395905_0184415 3300037471 Bacteria 1959
665 Ga0436364_0601084 3300037853 Bacteria 4650
666 Ga0436364_0920940 3300037853 Bacteria 1242
667 Ga0395901_0004257 3300038443 Bacteria 14438
668 Ga0395901_0605203 3300038443 Bacteria 1105
669 Ga0436365_0610368 3300039437 Bacteria 2011
670 Ga0436365_1007984 3300039437 Bacteria 7106
671 Ga0436365_1315860 3300039437 Bacteria 1171
672 Ga0439461_0004108 3300041410 Bacteria 2419
673 Ga0439465_0003417 3300041413 Bacteria 5179
674 Ga0439465_0033690 3300041413 Bacteria 1638
675 Ga0439465_0103235 3300041413 Bacteria 986
676 Ga0451807_0624241 3300041486 Bacteria 1022
677 Ga0451807_1847672 3300041486 Bacteria 1531
678 Ga0451837_1740338 3300041494 Bacteria 1026
679 Ga0439431_0055205 3300041997 Bacteria 1037
680 Ga0439433_0001608 3300041999 Bacteria 4693
681 Ga0439441_021595 3300042001 Bacteria 1190
682 Ga0439442_014784 3300042002 Bacteria 1607
683 Ga0439445_0014539 3300042004 Bacteria 1917
684 Ga0439449_0004078 3300042007 Bacteria 5653
685 Ga0439457_007831 3300042014 Bacteria 2546
686 Ga0439462_0003601 3300042015 Bacteria 3730
687 Ga0439435_0001742 3300042436 Bacteria 4127
688 Ga0439444_0035010 3300042437 Bacteria 961
689 Ga0439464_0062731 3300042439 Bacteria 1090
690 Ga0439460_0005243 3300042461 Bacteria 3176
691 Ga0466965_0230104 3300044683 Bacteria 990
692 Ga0466966_0058361 3300044684 Unclassified 2439
693 Ga0466960_0002956 3300044901 Bacteria 6476
694 Ga0466959_0044856 3300045049 Bacteria 3257
695 Ga0451576_0122843 3300045051 Bacteria 2704
696 Ga0466958_0001042 3300045836 Bacteria 12677
697 Ga0495617_018903 3300046452 Bacteria 2331
698 Ga0495617_124614 3300046452 Bacteria 829
699 Ga0495603_0025997 3300046455 Bacteria 3539
700 Ga0495603_0069753 3300046455 Bacteria 2067
701 Ga0495629_0037804 3300046459 Bacteria 3402
702 Ga0495629_0142404 3300046459 Bacteria 1668
703 Ga0495638_0002597 3300046460 Bacteria 14580
704 Ga0495651_0056427 3300046462 Bacteria 3017
705 Ga0495653_0096208 3300046463 Bacteria 2153
706 Ga0495650_0083879 3300046471 Bacteria 1224
707 Ga0495580_0034696 3300046472 Bacteria 3631
708 Ga0495639_0150366 3300046475 Bacteria 1123
709 Ga0495664_0191287 3300046477 Bacteria 1240
710 Ga0495664_0199801 3300046477 Bacteria 1211
711 Ga0495584_0044555 3300046491 Bacteria 2239
712 Ga0495584_0091744 3300046491 Bacteria 1532
713 Ga0495594_0252893 3300046499 Bacteria 1004
714 Ga0495606_0067194 3300046507 Bacteria 2271
715 Ga0495606_0239771 3300046507 Bacteria 1012
716 Ga0495610_0128106 3300046512 Bacteria 1105
717 Ga0495631_0106893 3300046518 Bacteria 1203
718 Ga0495644_0029773 3300046523 Bacteria 2062
719 Ga0495644_0102310 3300046523 Bacteria 1084
720 Ga0495644_0212731 3300046523 Bacteria 746
721 Ga0495652_0126016 3300046529 Bacteria 2034
722 Ga0495652_0482796 3300046529 Unclassified 862
723 Ga0495586_0303933 3300046535 Bacteria 914
724 Ga0495598_0001642 3300046537 Bacteria 4487
725 Ga0495609_0073014 3300046538 Bacteria 1506
726 Ga0495645_0107866 3300046543 Bacteria 1973
727 Ga0495622_0022506 3300046557 Bacteria 2937
728 Ga0495667_0057622 3300046559 Bacteria 2553
729 Ga0495656_0002575 3300046615 Bacteria 6045
730 Ga0495656_0012197 3300046615 Bacteria 3166
731 Ga0495656_0077293 3300046615 Bacteria 1493
732 Ga0495668_0010364 3300046616 Bacteria 5642
733 Ga0495668_0037381 3300046616 Bacteria 2716
734 Ga0495668_0150554 3300046616 Bacteria 1274
735 Ga0495634_0071448 3300046642 Bacteria 2285
736 Ga0495611_0071182 3300046648 Bacteria 1590
737 Ga0495625_0012065 3300046660 Bacteria 7013
738 Ga0495625_0069527 3300046660 Bacteria 2474
739 Ga0495625_0289328 3300046660 Bacteria 1052
740 Ga0495635_0087217 3300046663 Bacteria 2135
741 Ga0495659_0031613 3300046664 Bacteria 1848
742 Ga0495588_0047898 3300046674 Bacteria 2195
743 Ga0495657_0069074 3300046675 Bacteria 2313
744 Ga0495599_0219876 3300046678 Bacteria 1163
745 Ga0495623_0041564 3300046679 Bacteria 2931
746 Ga0495658_0306148 3300046683 Bacteria 1006
747 Ga0495669_0000964 3300046684 Bacteria 12015
748 Ga0495669_0098495 3300046684 Bacteria 1356
749 Ga0495669_0151182 3300046684 Bacteria 1099
750 Ga0495613_0199314 3300046689 Bacteria 1412
751 Ga0495670_0063191 3300046691 Bacteria 1864
752 Ga0495670_0113975 3300046691 Bacteria 1401
753 Ga0495670_0115131 3300046691 Bacteria 1394
754 Ga0495671_0116062 3300046692 Bacteria 1307
755 Ga0495589_0092334 3300046794 Bacteria 1470
756 Ga0495589_0257695 3300046794 Bacteria 814
757 Ga0495600_0383054 3300046809 Unclassified 877
758 Ga0495581_0027007 3300047315 Bacteria 3329
759 Ga0495636_0014193 3300047318 Bacteria 3168
760 Ga0495674_0158434 3300047319 Bacteria 1895
761 Ga0495674_0254637 3300047319 Bacteria 1444
762 Ga0495672_0032048 3300047320 Bacteria 3274
763 Ga0495672_0173928 3300047320 Bacteria 1096
764 Ga0495675_0011843 3300047444 Bacteria 5481
765 Ga0495673_0051908 3300047469 Bacteria 1794
766 Ga0495684_0182813 3300047471 Bacteria 1553
767 Ga0495602_0227064 3300048088 Bacteria 1405
768 Ga0495602_0249811 3300048088 Bacteria 1322
769 Ga0495602_0283373 3300048088 Bacteria 1220
770 Ga0496100_0012121 3300048903 Bacteria 4932
771 Ga0496100_0057455 3300048903 Bacteria 2549
772 Ga0496100_0096698 3300048903 Bacteria 2027
773 Ga0496100_0351901 3300048903 Bacteria 1113
774 Ga0496100_0437155 3300048903 Bacteria 1001
775 Ga0496101_0023542 3300048904 Bacteria 4256
776 Ga0496101_0091977 3300048904 Bacteria 2258
777 Ga0496101_0395561 3300048904 Bacteria 1088
778 Ga0496102_0004326 3300048905 Bacteria 12013
779 Ga0496102_0034264 3300048905 Bacteria 4566
780 Ga0496102_0107644 3300048905 Bacteria 2596
781 Ga0496102_0556044 3300048905 Bacteria 1070
782 Ga0496102_0717895 3300048905 Bacteria 922
783 Ga0496104_0090962 3300048907 Bacteria 2916
784 Ga0496104_0096898 3300048907 Bacteria 2822
785 Ga0496104_0107333 3300048907 Bacteria 2675
786 Ga0496104_0550860 3300048907 Bacteria 1064
787 Ga0496105_0006457 3300048908 Bacteria 9017
788 Ga0496105_0039757 3300048908 Bacteria 3878
789 Ga0496105_0222252 3300048908 Bacteria 1537
790 Ga0496105_0327509 3300048908 Bacteria 1227
791 Ga0496106_0003360 3300048909 Bacteria 11929
792 Ga0496106_0016237 3300048909 Bacteria 5508
793 Ga0496106_0350450 3300048909 Bacteria 1186
794 Ga0496106_0835426 3300048909 Bacteria 729
795 Ga0496107_0071687 3300048910 Bacteria 2518
796 Ga0496107_0175093 3300048910 Bacteria 1593
797 Ga0496107_0554321 3300048910 Bacteria 851
798 Ga0496108_0006585 3300048911 Bacteria 9422
799 Ga0496108_0010340 3300048911 Bacteria 7577
800 Ga0496108_0157770 3300048911 Bacteria 1960
801 Ga0496109_0006126 3300048912 Bacteria 10106
802 Ga0496109_0011401 3300048912 Bacteria 7639
803 Ga0496109_0198128 3300048912 Bacteria 1888
804 Ga0496109_0270699 3300048912 Bacteria 1600
805 Ga0496110_0023135 3300048913 Bacteria 5284
806 Ga0496110_0046061 3300048913 Bacteria 3814
807 Ga0496110_0112471 3300048913 Bacteria 2448
808 Ga0496110_0228619 3300048913 Bacteria 1691
809 Ga0496110_0266373 3300048913 Bacteria 1560
810 Ga0496110_0433558 3300048913 Bacteria 1198
811 Ga0496110_0461289 3300048913 Bacteria 1158
812 Ga0496110_0732973 3300048913 Bacteria 891
813 Ga0496111_0037948 3300048914 Bacteria 3449
814 Ga0496111_0116203 3300048914 Bacteria 1973
815 Ga0496112_0092212 3300048915 Bacteria 2999
816 Ga0496112_0356725 3300048915 Bacteria 1404
817 Ga0496112_0377201 3300048915 Bacteria 1359
818 Ga0496112_0408951 3300048915 Bacteria 1296
819 Ga0496112_0699460 3300048915 Bacteria 941
820 Ga0496113_0000320 3300048916 Bacteria 22841
821 Ga0496113_0001582 3300048916 Bacteria 12777
822 Ga0496113_0138616 3300048916 Bacteria 1913
823 Ga0496114_0004567 3300048917 Bacteria 10753
824 Ga0496114_0057402 3300048917 Bacteria 3250
825 Ga0496114_0081747 3300048917 Bacteria 2730
826 Ga0496114_0226461 3300048917 Bacteria 1642
827 Ga0496114_0931260 3300048917 Bacteria 751
828 Ga0496115_0010306 3300048918 Bacteria 6977
829 Ga0496115_0041743 3300048918 Bacteria 3652
830 Ga0496115_0174637 3300048918 Bacteria 1777
831 Ga0496115_0423003 3300048918 Bacteria 1079
832 Ga0496117_0204783 3300048920 Bacteria 1112
833 Ga0496121_0015212 3300048924 Bacteria 8086
834 Ga0496121_0074288 3300048924 Bacteria 2720
835 Ga0496121_0130861 3300048924 Bacteria 1878
836 Ga0496121_0343318 3300048924 Bacteria 997
837 Ga0496124_0000273 3300048927 Bacteria 99505
838 Ga0496124_0072888 3300048927 Bacteria 2843
839 Ga0496125_0025541 3300048928 Bacteria 5406
840 Ga0496125_0133791 3300048928 Bacteria 1739
841 Ga0496126_0043505 3300048929 Bacteria 4143
842 Ga0496126_0084620 3300048929 Bacteria 2797
843 Ga0496126_0089878 3300048929 Bacteria 2702
844 Ga0496126_0130695 3300048929 Bacteria 2170
845 Ga0495682_0067438 3300049460 Bacteria 1289
846 Ga0501031_0000753 3300049568 Bacteria 19473
847 Ga0501032_0000136 3300049569 Bacteria 59896
848 Ga0501033_0000202 3300049570 Bacteria 57109
849 Ga0501033_0048226 3300049570 Bacteria 3164
850 Ga0501033_0300749 3300049570 Bacteria 1129
851 Ga0501034_0000113 3300049571 Bacteria 149824
852 Ga0501034_0139242 3300049571 Bacteria 2407
853 Ga0501036_0000059 3300049572 Bacteria 72347
854 Ga0501037_0000270 3300049573 Bacteria 44650
855 Ga0501038_0000774 3300049574 Bacteria 28322
856 Ga0501039_0000067 3300049575 Bacteria 79511
857 Ga0501040_0167868 3300049576 Unclassified 1553
858 Ga0501042_0126544 3300049578 Bacteria 1840
859 Ga0501042_0464350 3300049578 Bacteria 918
860 Ga0501043_0000017 3300049579 Bacteria 166630
861 Ga0501046_0000174 3300049580 Bacteria 65566
862 Ga0501047_0005957 3300049581 Bacteria 11456
863 Ga0501048_0000127 3300049582 Bacteria 44609
864 Ga0501048_0201065 3300049582 Bacteria 1412
865 Ga0501067_0000833 3300049583 Bacteria 16590
866 Ga0501068_0004830 3300049584 Bacteria 7338
867 Ga0501069_0002149 3300049585 Bacteria 9925
868 Ga0501069_0088674 3300049585 Bacteria 1748
869 Ga0501070_0009120 3300049586 Bacteria 8389
870 Ga0501070_0102336 3300049586 Bacteria 2369
871 Ga0501070_0265459 3300049586 Bacteria 1402
872 Ga0501071_0078396 3300049587 Bacteria 2414
873 Ga0501071_0282021 3300049587 Bacteria 1257
874 Ga0501071_0518923 3300049587 Bacteria 914
875 Ga0501072_0017358 3300049588 Bacteria 5529
876 Ga0501073_0000069 3300049589 Bacteria 63198
877 Ga0501073_0089049 3300049589 Bacteria 2146
878 Ga0501073_0389392 3300049589 Bacteria 963
879 Ga0501074_0000507 3300049590 Bacteria 23842
880 Ga0501074_0028902 3300049590 Bacteria 4015
881 Ga0501074_0061582 3300049590 Bacteria 2704
882 Ga0501075_0034209 3300049591 Bacteria 3783
883 Ga0501076_0014693 3300049592 Bacteria 5903
884 Ga0501079_0143012 3300049741 Unclassified 1863
885 Ga0501080_0000593 3300049742 Bacteria 28623
886 Ga0501080_0159402 3300049742 Bacteria 2084
887 Ga0501080_0209512 3300049742 Bacteria 1786
888 Ga0501081_0015033 3300049743 Bacteria 5107
889 Ga0501081_0192184 3300049743 Bacteria 1478
890 Ga0501083_0000336 3300049744 Bacteria 29766
891 Ga0501083_0047097 3300049744 Bacteria 2914
892 Ga0501083_0251662 3300049744 Bacteria 1150
893 Ga0501035_0000393 3300049822 Bacteria 49959
894 Ga0501035_0168014 3300049822 Bacteria 1896
895 Ga0501035_0277837 3300049822 Bacteria 1416
896 Ga0501044_0000387 3300049823 Bacteria 54729
897 Ga0501044_0015271 3300049823 Bacteria 8271
898 Ga0501044_0090851 3300049823 Bacteria 3080
899 Ga0501045_0019923 3300049824 Bacteria 4787
900 Ga0501045_0140758 3300049824 Bacteria 1794
901 Ga0501045_0426253 3300049824 Bacteria 987
902 nmdc:mga03683_39524_c1 3300050489 Bacteria 1931
903 nmdc:mga03683_82834_c1 3300050489 Bacteria 1388
904 nmdc:mga03n38_112773_c1 3300050490 Bacteria 1326
905 nmdc:mga03n38_160169_c1 3300050490 Bacteria 1139
906 nmdc:mga03n38_279282_c1 3300050490 Bacteria 891
907 nmdc:mga03n38_6268_c1 3300050490 Bacteria 4120
908 nmdc:mga00v17_52318_c1 3300050491 Bacteria 2484
909 nmdc:mga0yw44_10122_c1 3300050492 Bacteria 4803
910 nmdc:mga0yw44_17650_c1 3300050492 Bacteria 3889
911 nmdc:mga0yw44_332022_c1 3300050492 Bacteria 1022
912 nmdc:mga0k408_253369_c1 3300050493 Bacteria 1051
913 nmdc:mga0k408_30599_c1 3300050493 Bacteria 3070
914 nmdc:mga0k408_84524_c1 3300050493 Bacteria 1862
915 nmdc:mga06z11_135036_c1 3300050494 Bacteria 1389
916 nmdc:mga06z11_304506_c1 3300050494 Bacteria 948
917 nmdc:mga06z11_70690_c1 3300050494 Bacteria 1846
918 nmdc:mga04h51_28453_c1 3300050495 Bacteria 1743
919 nmdc:mga07m45_103717_c1 3300050496 Bacteria 1635
920 nmdc:mga07m45_14161_c1 3300050496 Bacteria 4242
921 nmdc:mga07m45_174808_c1 3300050496 Bacteria 1249
922 nmdc:mga07m45_39889_c1 3300050496 Bacteria 2626
923 nmdc:mga07m45_424766_c1 3300050496 Bacteria 771
924 nmdc:mga05p37_22572_c1 3300050507 Bacteria 7631
925 nmdc:mga06r32_463968_c1 3300050510 Bacteria 1245
926 nmdc:mga06r32_738397_c1 3300050510 Bacteria 948
927 nmdc:mga08y16_125147_c1 3300050511 Bacteria 2674
928 nmdc:mga08y16_269467_c1 3300050511 Bacteria 1758
929 nmdc:mga0n895_61208_c1 3300050512 Bacteria 3715
930 nmdc:mga0n895_716909_c1 3300050512 Bacteria 995
931 nmdc:mga0n895_90050_c1 3300050512 Bacteria 3069
932 nmdc:mga0rr50_187562_c1 3300050513 Bacteria 1693
933 nmdc:mga0rr50_244691_c1 3300050513 Bacteria 1488
934 nmdc:mga0rr50_334824_c1 3300050513 Bacteria 1271
935 nmdc:mga0a205_102260_c1 3300050515 Bacteria 2764
936 nmdc:mga0a205_178341_c1 3300050515 Bacteria 2019
937 nmdc:mga0sz30_75405_c1 3300050516 Bacteria 1455
938 Ga0495601_0032289 3300053077 Bacteria 3259
939 Ga0495601_0124641 3300053077 Bacteria 1675
940 Ga0500610_0000237 3300053079 Bacteria 16642
941 Ga0500635_0059072 3300053080 Bacteria 1333
942 Ga0495619_0026355 3300053085 Bacteria 3739
943 Ga0500581_094759 3300053089 Bacteria 1475
944 Ga0500646_0085796 3300053090 Bacteria 968
945 Ga0500647_0018336 3300053091 Bacteria 3241
946 Ga0500651_0202913 3300053093 Bacteria 1169
947 Ga0500566_0000149 3300053094 Bacteria 35997
948 Ga0500641_0035698 3300053096 Bacteria 1985
949 Ga0500641_0074109 3300053096 Bacteria 1437
950 Ga0500554_075187 3300053102 Bacteria 1105
951 Ga0500594_0150022 3300053118 Bacteria 749
952 Ga0500595_000336 3300053119 Bacteria 30876
953 Ga0500595_000870 3300053119 Bacteria 17254
954 Ga0500595_006384 3300053119 Bacteria 5004
955 Ga0500595_034365 3300053119 Bacteria 1677
956 Ga0500608_063733 3300053122 Bacteria 1759
957 Ga0500642_0020733 3300053130 Bacteria 2589
958 Ga0500642_0047674 3300053130 Bacteria 1879
959 Ga0500655_003937 3300053133 Bacteria 2678
960 Ga0500559_0019051 3300053136 Bacteria 2900
961 Ga0500559_0094641 3300053136 Bacteria 1371
962 Ga0500573_0004501 3300053140 Bacteria 7360
963 Ga0500577_0182878 3300053142 Bacteria 900
964 Ga0500586_010049 3300053145 Bacteria 2654
965 Ga0500588_0015778 3300053146 Bacteria 1942
966 Ga0500603_008164 3300053150 Bacteria 2314
967 Ga0500604_0025643 3300053151 Bacteria 1696
968 Ga0500622_0091414 3300053156 Bacteria 1510
969 Ga0500630_094713 3300053159 Bacteria 1372
970 Ga0500638_000529 3300053162 Bacteria 9538
971 Ga0500636_0010678 3300053177 Bacteria 5361
972 Ga0500636_0035110 3300053177 Bacteria 2968
973 Ga0500636_0250444 3300053177 Bacteria 903
974 Ga0500637_0000289 3300053178 Bacteria 18843
975 Ga0500645_000493 3300053730 Bacteria 26655
976 Ga0500645_027134 3300053730 Bacteria 1738
977 Ga0501084_0000898 3300054114 Bacteria 23029
978 Ga0501084_0025166 3300054114 Bacteria 4966
979 Ga0501084_0514181 3300054114 Bacteria 1012
980 Ga0500661_002949 3300055283 Bacteria 3202
981 Ga0590075_012620 3300059424 Bacteria 2054
982 Ga0501082_0003002 3300060353 Bacteria 14744
983 Ga0501082_0046564 3300060353 Unclassified 3738
984 2524466399 2524023210 Bacteria 9029266
985 2524539845 2524023228 Bacteria 10118060
986 2644255942 2643221646 Bacteria 6433402
987 2723849270 2721755755 Bacteria 8322773
988 2793067165 2791355197 Bacteria 8420563
989 2793081627
990 2874608495 2874604998 Bacteria 7834745
991 2876813851 2876808645 Bacteria 8824342
992 2879112725 2879110137 Bacteria 8907982
993 2885194161 2885192300 Bacteria 5882526
994 2889035947 2889033259 Bacteria 9099371
995 2904707688
996 8006936833 8006933436 Bacteria 10410654
997 8006967801 8006964411 Bacteria 8966052
998 8006976803 8006973647 Bacteria 10679141
999 8019561860 8019555841 Bacteria 9642137
1000 8019571936 8019565922 Bacteria 9639779
1001 8056678524 8056673599 Bacteria 7871253
1002 8056683105 8056681323 Bacteria 8472857
1003 Ga0111539_10061089
1004 JGI24744J21845_10003077
1005 JGI25151J46595_10026222
1006 JGI25406J46586_10000053
1007 rootH1_10032258
1008 JGI25404J52841_10000607
1009 JGI25404J52841_10006761
1010 JGI25404J52841_10007695
1011 Ga0055526_1003550
1012 Ga0055526_1022860
1013 Ga0055524_1007614
1014 Ga0055524_1012951
1015 Ga0055531_10004270
1016 Ga0055531_10011319
1017 Ga0055531_10013753
1018 Ga0065707_10115043
1019 Ga0070676_10032114
1020 Ga0070690_100472282
1021 Ga0070670_100037213
1022 Ga0070670_100390160
1023 Ga0068869_100099600
1024 Ga0068869_100339507
1025 Ga0068869_100512121
1026 Ga0070666_10007661
1027 Ga0070682_100004502
1028 Ga0068868_100053379
1029 Ga0068868_100090241
1030 Ga0070660_100003389
1031 Ga0070689_100241826
1032 Ga0070661_100009747
1033 Ga0070661_100142406
1034 Ga0070661_100733888
1035 Ga0070668_100013269
1036 Ga0070668_100021395
1037 Ga0070668_100049961
1038 Ga0070668_100084205
1039 Ga0070668_100126243
1040 Ga0070669_100048155
1041 Ga0070669_100052275
1042 Ga0070669_100554451
1043 Ga0070675_100001220
1044 Ga0070675_100106122
1045 Ga0070675_100157356
1046 Ga0070671_100125426
1047 Ga0070671_100130284
1048 Ga0070674_100042527
1049 Ga0070674_100107362
1050 Ga0070674_100224232
1051 Ga0070674_100267266
1052 Ga0070674_100285551
1053 Ga0070674_100409920
1054 Ga0070674_100798623
1055 Ga0070673_100000479
1056 Ga0070673_100005052
1057 Ga0070673_100075753
1058 Ga0070673_100102034
1059 Ga0070673_100120137
1060 Ga0070659_100012064
1061 Ga0070667_100067544
1062 Ga0070667_100109981
1063 Ga0070667_100595094
1064 Ga0070701_10046520
1065 Ga0070711_100018468
1066 Ga0070700_100099052
1067 Ga0070700_100116428
1068 Ga0070700_100130390
1069 Ga0070700_100748395
1070 Ga0070663_100017170
1071 Ga0070663_100030261
1072 Ga0070678_100019281
1073 Ga0070678_100039965
1074 Ga0070678_100051740
1075 Ga0070678_100093224
1076 Ga0070678_100113408
1077 Ga0070678_100235000
1078 Ga0070662_100042557
1079 Ga0070662_100116653
1080 Ga0070681_10076134
1081 Ga0068867_100065718
1082 Ga0068867_100079873
1083 Ga0068867_100291663
1084 Ga0068867_100835774
1085 Ga0070685_10139205
1086 Ga0070685_10160849
1087 Ga0070685_10448771
1088 Ga0070698_100882766
1089 Ga0070684_100976059
1090 Ga0068853_100113556
1091 Ga0068853_100326132
1092 Ga0068853_100595310
1093 Ga0068853_100897194
1094 Ga0070672_100008509
1095 Ga0070672_100075100
1096 Ga0070672_100214744
1097 Ga0070672_100324303
1098 Ga0070686_100020285
1099 Ga0070686_100764046
1100 Ga0070696_100035783
1101 Ga0070696_100236811
1102 Ga0070693_100112353
1103 Ga0070665_100000211
1104 Ga0070665_100004360
1105 Ga0070665_100015880
1106 Ga0070665_100043289
1107 Ga0070665_100043750
1108 Ga0070665_100044260
1109 Ga0070665_100099984
1110 Ga0070665_100103906
1111 Ga0070665_100109114
1112 Ga0070665_100234724
1113 Ga0070665_100402485
1114 Ga0070665_100423660
1115 Ga0068855_100000686
1116 Ga0068855_100005666
1117 Ga0070664_100035394
1118 Ga0070664_100053079
1119 Ga0070664_100826694
1120 Ga0068857_100137632
1121 Ga0068852_100001192
1122 Ga0068852_100100551
1123 Ga0068852_100488223
1124 Ga0068859_100000414
1125 Ga0068859_100076320
1126 Ga0068859_100084314
1127 Ga0068859_100097520
1128 Ga0068859_100194909
1129 Ga0068859_100249133
1130 Ga0068859_100304490
1131 Ga0068859_100444783
1132 Ga0068864_100010492
1133 Ga0068864_100013481
1134 Ga0068864_100032170
1135 Ga0068864_100112221
1136 Ga0068864_100133739
1137 Ga0068866_10149453
1138 Ga0068861_100000358
1139 Ga0068861_100035625
1140 Ga0068861_100136011
1141 Ga0068861_100136925
1142 Ga0068861_100282613
1143 Ga0068851_10000587
1144 Ga0068851_10109691
1145 Ga0068870_10040871
1146 Ga0068870_10259444
1147 Ga0068863_100021364
1148 Ga0068863_100025725
1149 Ga0068863_100078929
1150 Ga0068863_100087559
1151 Ga0068863_100202201
1152 Ga0068863_100308506
1153 Ga0068863_100636779
1154 Ga0068858_100046117
1155 Ga0068858_100156792
1156 Ga0068858_100193540
1157 Ga0068860_100000101
1158 Ga0068860_100015398
1159 Ga0068860_100060092
1160 Ga0068860_100085141
1161 Ga0068860_100145234
1162 Ga0068860_100220037
1163 Ga0068860_100467297
1164 Ga0068862_100000047
1165 Ga0068862_100003056
1166 Ga0068862_100038278
1167 Ga0068862_100062032
1168 Ga0068862_100080054
1169 Ga0068862_100137438
1170 Ga0068862_100139068
1171 Ga0068862_100821827
1172 Ga0081455_10003779
1173 Ga0081455_10006696
1174 Ga0081455_10029442
1175 Ga0081455_10165348
1176 Ga0081538_10000833
1177 Ga0081540_1001291
1178 Ga0081540_1003930
1179 Ga0081540_1004182
1180 Ga0081540_1005649
1181 Ga0081540_1015542
1182 Ga0081540_1017120
1183 Ga0081540_1025179
1184 Ga0081540_1027397
1185 Ga0081540_1028497
1186 Ga0081540_1068214
1187 Ga0081540_1178028
1188 Ga0081539_10000471
1189 Ga0070717_10116045
1190 Ga0070717_10500508
1191 Ga0070717_10511642
1192 Ga0075365_10042747
1193 Ga0075365_10047906
1194 Ga0075365_10079600
1195 Ga0075365_10108564
1196 Ga0075365_10429453
1197 Ga0075368_10013501
1198 Ga0075368_10023583
1199 Ga0075368_10091381
1200 Ga0075368_10140553
1201 Ga0075363_100283740
1202 Ga0075364_10314867
1203 Ga0075364_10380246
1204 Ga0070716_100044833
1205 Ga0070712_100128740
1206 Ga0070712_100193237
1207 Ga0075362_10039542
1208 Ga0075367_10008988
1209 Ga0075367_10026390
1210 Ga0075367_10146151
1211 Ga0075369_10133574
1212 Ga0075366_10009502
1213 Ga0075366_10050259
1214 Ga0075366_10062005
1215 Ga0097621_100021909
1216 Ga0097621_100050466
1217 Ga0097621_100125903
1218 Ga0097621_100380537
1219 Ga0097621_100879718
1220 Ga0075370_10000147
1221 Ga0075370_10072696
1222 Ga0075370_10350643
1223 Ga0068871_100128781
1224 Ga0068871_100494140
1225 Ga0068871_100783575
1226 Ga0075428_100094610
1227 Ga0075428_100163564
1228 Ga0075428_100185986
1229 Ga0075430_100672211
1230 Ga0075431_100548955
1231 Ga0075431_100903374
1232 Ga0068865_100008486
1233 Ga0068865_100015739
1234 Ga0068865_100109960
1235 Ga0068865_100136061
1236 Ga0068865_100335716
1237 Ga0068865_100430594
1238 Ga0068865_100595436
1239 Ga0097620_100000414
1240 Ga0097620_100076320
1241 Ga0097620_100084312
1242 Ga0097620_100097527
1243 Ga0097620_100194921
1244 Ga0097620_100249127
1245 Ga0097620_100304524
1246 Ga0097620_100444784
1247 Ga0075435_100118143
1248 Ga0075435_100128910
1249 Ga0099795_10023630
1250 Ga0099795_10041773
1251 Ga0105240_10000495
1252 Ga0105240_10024484
1253 Ga0105240_10141191
1254 Ga0105240_10158538
1255 Ga0105240_10226551
1256 Ga0105240_10248640
1257 Ga0111539_10463516
1258 Ga0111539_10464661
1259 Ga0111539_10766903
1260 Ga0105245_10004316
1261 Ga0105245_10193005
1262 Ga0105247_10022692
1263 Ga0105247_10359340
1264 Ga0114129_10064760
1265 Ga0114129_10136245
1266 Ga0114129_10206512
1267 Ga0114129_10815684
1268 Ga0105243_10020748
1269 Ga0105243_10058200
1270 Ga0105243_10086957
1271 Ga0105243_10106563
1272 Ga0105243_10110587
1273 Ga0105243_10157612
1274 Ga0105243_10184244
1275 Ga0105243_10747896
1276 Ga0105241_10006238
1277 Ga0105241_10292311
1278 Ga0105242_10617578
1279 Ga0105248_10107747
1280 Ga0105248_10268827
1281 Ga0105248_10298774
1282 Ga0105248_10795765
1283 Ga0105248_10796537
1284 Ga0105237_10006381
1285 Ga0105237_10011342
1286 Ga0105237_10012122
1287 Ga0105237_10021683
1288 Ga0105237_10075633
1289 Ga0105238_10004494
1290 Ga0105238_10043206
1291 Ga0105238_10683922
1292 Ga0105249_10069096
1293 Ga0105249_10129440
1294 Ga0105249_10220819
1295 Ga0105249_10230409
1296 Ga0105249_10238325
1297 Ga0105249_11560800
1298 Ga0105239_10039029
1299 Ga0105239_10207482
1300 Ga0105246_10153441
1301 Ga0105246_10319065
1302 Ga0157371_10248399
1303 Ga0157370_10016536
1304 Ga0157370_10920810
1305 Ga0157369_10000836
1306 Ga0157374_10146697
1307 Ga0157374_10194313
1308 Ga0157374_10865595
1309 Ga0157378_10002185
1310 Ga0157378_10007639
1311 Ga0157378_10022662
1312 Ga0157378_10418168
1313 Ga0157378_10679850
1314 Ga0163162_10027341
1315 Ga0163162_10047907
1316 Ga0163162_10150638
1317 Ga0163162_10182967
1318 Ga0163162_10217745
1319 Ga0163162_10373681
1320 Ga0163162_10754799
1321 Ga0157372_10001071
1322 Ga0157372_10032191
1323 Ga0157375_10012569
1324 Ga0157375_10044095
1325 Ga0157375_10079099
1326 Ga0157375_10130585
1327 Ga0157375_10188077
1328 Ga0157375_10248099
1329 Ga0157375_10261710
1330 Ga0163163_10000029
1331 Ga0163163_10007518
1332 Ga0163163_10014471
1333 Ga0163163_10015227
1334 Ga0163163_10032136
1335 Ga0163163_10121004
1336 Ga0163163_10123465
1337 Ga0163163_10237779
1338 Ga0157380_10011388
1339 Ga0157380_10060575
1340 Ga0157380_10082654
1341 Ga0157380_10103813
1342 Ga0157380_10137405
1343 Ga0157380_10275600
1344 Ga0157380_10324256
1345 Ga0157380_10611800
1346 Ga0157377_10128168
1347 Ga0157377_10225520
1348 Ga0157377_10295659
1349 Ga0157379_10023505
1350 Ga0157379_10051920
1351 Ga0157379_10110137
1352 Ga0157379_10191004
1353 Ga0157379_10294214
1354 Ga0157379_10310436
1355 Ga0157379_10615614
1356 Ga0157376_10125627
1357 Ga0157376_10296489
1358 Ga0182005_1055548
1359 Ga0163161_10028786
1360 Ga0163161_10282904
1361 Ga0163161_10389405
1362 Ga0163161_10498034
1363 Ga0163161_10709337
1364 Ga0213876_10044034
1365 Ga0209759_1001908
1366 Ga0209673_1016132
1367 Ga0209130_1012625
1368 Ga0209675_1030851
1369 Ga0209676_1000639
1370 Ga0209676_1001001
1371 Ga0209676_1047419
1372 Ga0209025_1001467
1373 Ga0209564_1000419
1374 Ga0209564_1001318
1375 Ga0209758_1003680
1376 Ga0209758_1031785
1377 Ga0209758_1057233
1378 Ga0209758_1072444
1379 Ga0209050_1001840
1380 Ga0209050_1006556
1381 Ga0209256_1000455
1382 Ga0209256_1001180
1383 Ga0209051_1002091
1384 Ga0209051_1002649
1385 Ga0209257_1000238
1386 Ga0209257_1001766
1387 Ga0209257_1002420
1388 Ga0207656_10004251
1389 Ga0207656_10033768
1390 Ga0207682_10124632
1391 Ga0207642_10103291
1392 Ga0207710_10036801
1393 Ga0207710_10115891
1394 Ga0207688_10039021
1395 Ga0207688_10349343
1396 Ga0207680_10000476
1397 Ga0207647_10065771
1398 Ga0207645_10076034
1399 Ga0207645_10099802
1400 Ga0207645_10123485
1401 Ga0207643_10028714
1402 Ga0207643_10034934
1403 Ga0207705_10209621
1404 Ga0207705_10469815
1405 Ga0207654_10009388
1406 Ga0207654_10036809
1407 Ga0207707_10007468
1408 Ga0207695_10000358
1409 Ga0207695_10004971
1410 Ga0207671_10002648
1411 Ga0207671_10157962
1412 Ga0207693_10176987
1413 Ga0207663_10045180
1414 Ga0207663_10404123
1415 Ga0207657_10023504
1416 Ga0207649_10129885
1417 Ga0207649_10191589
1418 Ga0207649_10278019
1419 Ga0207681_10031738
1420 Ga0207681_10054747
1421 Ga0207681_10094497
1422 Ga0207681_10386743
1423 Ga0207681_10648389
1424 Ga0207694_10017133
1425 Ga0207694_10035310
1426 Ga0207694_10193577
1427 Ga0207694_10511624
1428 Ga0207650_10069290
1429 Ga0207650_10079549
1430 Ga0207650_10197695
1431 Ga0207659_10023857
1432 Ga0207659_10559398
1433 Ga0207687_10005087
1434 Ga0207687_10110261
1435 Ga0207687_10246384
1436 Ga0207700_10025267
1437 Ga0207700_10164979
1438 Ga0207644_10139822
1439 Ga0207706_10047522
1440 Ga0207706_10070656
1441 Ga0207706_10087082
1442 Ga0207706_10131561
1443 Ga0207706_10241654
1444 Ga0207706_10474640
1445 Ga0207706_10567183
1446 Ga0207709_10005342
1447 Ga0207709_10018788
1448 Ga0207709_10109038
1449 Ga0207670_10028354
1450 Ga0207670_10086056
1451 Ga0207670_10476414
1452 Ga0207669_10021655
1453 Ga0207704_10002148
1454 Ga0207704_10008266
1455 Ga0207704_10148930
1456 Ga0207704_10248338
1457 Ga0207704_10394548
1458 Ga0207691_10033151
1459 Ga0207691_10048149
1460 Ga0207691_10133702
1461 Ga0207691_10153916
1462 Ga0207711_10000098
1463 Ga0207711_10214795
1464 Ga0207711_10676339
1465 Ga0207711_10724386
1466 Ga0207689_10015154
1467 Ga0207689_10051342
1468 Ga0207689_10142227
1469 Ga0207689_10175349
1470 Ga0207689_10265302
1471 Ga0207689_10333701
1472 Ga0207661_10117107
1473 Ga0207679_10065919
1474 Ga0207679_10171680
1475 Ga0207667_10016864
1476 Ga0207667_10041888
1477 Ga0207667_10773533
1478 Ga0207651_10001106
1479 Ga0207651_10020981
1480 Ga0207651_10265592
1481 Ga0207651_10452314
1482 Ga0207712_10026363
1483 Ga0207712_10188605
1484 Ga0207712_10197096
1485 Ga0207668_10027648
1486 Ga0207668_10031900
1487 Ga0207668_10060606
1488 Ga0207668_10085527
1489 Ga0207668_10191661
1490 Ga0207668_10192991
1491 Ga0207668_10472050
1492 Ga0207658_10082714
1493 Ga0207658_10184257
1494 Ga0207658_10780419
1495 Ga0207677_10147967
1496 Ga0207703_10100272
1497 Ga0207639_10058409
1498 Ga0207639_10792126
1499 Ga0207678_10005204
1500 Ga0207678_10017987
1501 Ga0207678_10050897
1502 Ga0207678_10060384
1503 Ga0207678_10090856
1504 Ga0207678_10242275
1505 Ga0207708_10069046
1506 Ga0207708_10105395
1507 Ga0207708_10113763
1508 Ga0207641_10016348
1509 Ga0207641_10148854
1510 Ga0207641_10217975
1511 Ga0207641_10242460
1512 Ga0207641_10339271
1513 Ga0207641_10382243
1514 Ga0207648_10003563
1515 Ga0207648_10009450
1516 Ga0207648_10015604
1517 Ga0207648_10017126
1518 Ga0207648_10060396
1519 Ga0207648_10143390
1520 Ga0207676_10015137
1521 Ga0207676_10032577
1522 Ga0207676_10039077
1523 Ga0207676_10290230
1524 Ga0207676_10396224
1525 Ga0207674_10085971
1526 Ga0207674_10337111
1527 Ga0207674_10375547
1528 Ga0207675_100001253
1529 Ga0207675_100004336
1530 Ga0207675_100013771
1531 Ga0207675_100024128
1532 Ga0207675_100036936
1533 Ga0207675_100043744
1534 Ga0207675_100112046
1535 Ga0207675_100112047
1536 Ga0207675_100410830
1537 Ga0207683_10008156
1538 Ga0207683_10017760
1539 Ga0207683_10018480
1540 Ga0207683_10037344
1541 Ga0207683_10041256
1542 Ga0207683_10044210
1543 Ga0207683_10050000
1544 Ga0207683_10082603
1545 Ga0207683_10505710
1546 Ga0207698_10000307
1547 Ga0207698_10025166
1548 Ga0207698_10363694
1549 Ga0207698_10702057
1550 Ga0209813_10029958
1551 Ga0209813_10111407
1552 Ga0207428_10101190
1553 Ga0268266_10000001
1554 Ga0268266_10015866
1555 Ga0268266_10059884
1556 Ga0268266_10078606
1557 Ga0268266_10081919
1558 Ga0268266_10135597
1559 Ga0268266_10367367
1560 Ga0268266_10378172
1561 Ga0268266_10382864
1562 Ga0268265_10003524
1563 Ga0268265_10036581
1564 Ga0268265_10068580
1565 Ga0268265_10092769
1566 Ga0268265_10098633
1567 Ga0268265_10105532
1568 Ga0268265_10113956
1569 Ga0268265_10128340
1570 Ga0268265_10567846
1571 Ga0268265_10754741
1572 Ga0268264_10000030
1573 Ga0268264_10016053
1574 Ga0268264_10055441
1575 Ga0268264_10162903
1576 Ga0268264_10215062
1577 Ga0268264_10336261
1578 Ga0268264_10374180
1579 Ga0268264_10384053
1580 Ga0268264_10460553
1581 Ga0268264_10646822
1582 Ga0307517_10000122
1583 Ga0307515_10000043
1584 Ga0307515_10240877
1585 Ga0307511_10015933
1586 Ga0265330_10060974
1587 Ga0265332_10009236
1588 Ga0265325_10003289
1589 Ga0265339_10038111
1590 Ga0265331_10008432
1591 Ga0265316_10031772
1592 Ga0265316_10294503
1593 Ga0307513_10003232
1594 Ga0307513_10037653
1595 Ga0307513_10115604
1596 Ga0307513_10150994
1597 Ga0307513_10245640
1598 Ga0307509_10006746
1599 Ga0307509_10379046
1600 Ga0307408_100242117
1601 Ga0265313_10180556
1602 Ga0307508_10057714
1603 Ga0265314_10039859
1604 Ga0265314_10051392
1605 Ga0265342_10258509
1606 Ga0307516_10015865
1607 Ga0307516_10126750
1608 Ga0307516_10172958
1609 Ga0307516_10365893
1610 Ga0307516_10596392
1611 Ga0307405_10026876
1612 Ga0307413_10488115
1613 Ga0307406_10054423
1614 Ga0307407_10232033
1615 Ga0307409_100088126
1616 Ga0307409_100175083
1617 Ga0307416_100749044
1618 Ga0307416_100944647
1619 Ga0307416_101115947
1620 Ga0307411_10105962
1621 Ga0307415_100006727
1622 Ga0307415_100337673
1623 Ga0307507_10014479
1624 Ga0307510_10003639
1625 Ga0307510_10161994
1626 Ga0373930_0037467
1627 Ga0373923_0202501
1628 Ga0373939_0014548
1629 Ga0373953_0038921
1630 Ga0373956_0065226
1631 Ga0373957_0029749
1632 Ga0373960_0020924
1633 Ga0373943_0064276
1634 Ga0373946_0097256
1635 Ga0373955_0016397
1636 Ga0373961_0018582
1637 Ga0373924_0068274
1638 Ga0373931_0010343
1639 Ga0373931_0037521
1640 Ga0373931_0048401
1641 Ga0373935_0026016
1642 Ga0373935_0095842
1643 Ga0373935_0096650
1644 Ga0373935_0508185
1645 Ga0373927_0128053
1646 Ga0373927_0152284
1647 Ga0373927_0193248
1648 Ga0373927_0270446
1649 Ga0373947_0017715
1650 Ga0373947_0097679
1651 Ga0373947_0155317
1652 Ga0373947_0473944
1653 Ga0373937_0142991
1654 Ga0373937_0169314
1655 Ga0373937_0615681
1656 Ga0373937_1124905
1657 Ga0373925_0014079
1658 Ga0373925_0022521
1659 Ga0395900_0005340
1660 Ga0395900_0145751
1661 Ga0395900_0301587
1662 Ga0395898_0019044
1663 Ga0395898_0116371
1664 Ga0395898_0241165
1665 Ga0395905_0001012
1666 Ga0395905_0184415
1667 Ga0436364_0601084
1668 Ga0436364_0920940
1669 Ga0395901_0004257
1670 Ga0395901_0605203
1671 Ga0436365_0610368
1672 Ga0436365_1007984
1673 Ga0436365_1315860
1674 Ga0439461_0004108
1675 Ga0439465_0003417
1676 Ga0439465_0033690
1677 Ga0439465_0103235
1678 Ga0451807_0624241
1679 Ga0451807_1847672
1680 Ga0451837_1740338
1681 Ga0439431_0055205
1682 Ga0439433_0001608
1683 Ga0439441_021595
1684 Ga0439442_014784
1685 Ga0439445_0014539
1686 Ga0439449_0004078
1687 Ga0439457_007831
1688 Ga0439462_0003601
1689 Ga0439435_0001742
1690 Ga0439444_0035010
1691 Ga0439464_0062731
1692 Ga0439460_0005243
1693 Ga0466965_0230104
1694 Ga0466966_0058361
1695 Ga0466960_0002956
1696 Ga0466959_0044856
1697 Ga0451576_0122843
1698 Ga0466958_0001042
1699 Ga0495617_018903
1700 Ga0495617_124614
1701 Ga0495603_0025997
1702 Ga0495603_0069753
1703 Ga0495629_0037804
1704 Ga0495629_0142404
1705 Ga0495638_0002597
1706 Ga0495651_0056427
1707 Ga0495653_0096208
1708 Ga0495650_0083879
1709 Ga0495580_0034696
1710 Ga0495639_0150366
1711 Ga0495664_0191287
1712 Ga0495664_0199801
1713 Ga0495584_0044555
1714 Ga0495584_0091744
1715 Ga0495594_0252893
1716 Ga0495606_0067194
1717 Ga0495606_0239771
1718 Ga0495610_0128106
1719 Ga0495631_0106893
1720 Ga0495644_0029773
1721 Ga0495644_0102310
1722 Ga0495644_0212731
1723 Ga0495652_0126016
1724 Ga0495652_0482796
1725 Ga0495586_0303933
1726 Ga0495598_0001642
1727 Ga0495609_0073014
1728 Ga0495645_0107866
1729 Ga0495622_0022506
1730 Ga0495667_0057622
1731 Ga0495656_0002575
1732 Ga0495656_0012197
1733 Ga0495656_0077293
1734 Ga0495668_0010364
1735 Ga0495668_0037381
1736 Ga0495668_0150554
1737 Ga0495634_0071448
1738 Ga0495611_0071182
1739 Ga0495625_0012065
1740 Ga0495625_0069527
1741 Ga0495625_0289328
1742 Ga0495635_0087217
1743 Ga0495659_0031613
1744 Ga0495588_0047898
1745 Ga0495657_0069074
1746 Ga0495599_0219876
1747 Ga0495623_0041564
1748 Ga0495658_0306148
1749 Ga0495669_0000964
1750 Ga0495669_0098495
1751 Ga0495669_0151182
1752 Ga0495613_0199314
1753 Ga0495670_0063191
1754 Ga0495670_0113975
1755 Ga0495670_0115131
1756 Ga0495671_0116062
1757 Ga0495589_0092334
1758 Ga0495589_0257695
1759 Ga0495600_0383054
1760 Ga0495581_0027007
1761 Ga0495636_0014193
1762 Ga0495674_0158434
1763 Ga0495674_0254637
1764 Ga0495672_0032048
1765 Ga0495672_0173928
1766 Ga0495675_0011843
1767 Ga0495673_0051908
1768 Ga0495684_0182813
1769 Ga0495602_0227064
1770 Ga0495602_0249811
1771 Ga0495602_0283373
1772 Ga0496100_0012121
1773 Ga0496100_0057455
1774 Ga0496100_0096698
1775 Ga0496100_0351901
1776 Ga0496100_0437155
1777 Ga0496101_0023542
1778 Ga0496101_0091977
1779 Ga0496101_0395561
1780 Ga0496102_0004326
1781 Ga0496102_0034264
1782 Ga0496102_0107644
1783 Ga0496102_0556044
1784 Ga0496102_0717895
1785 Ga0496104_0090962
1786 Ga0496104_0096898
1787 Ga0496104_0107333
1788 Ga0496104_0550860
1789 Ga0496105_0006457
1790 Ga0496105_0039757
1791 Ga0496105_0222252
1792 Ga0496105_0327509
1793 Ga0496106_0003360
1794 Ga0496106_0016237
1795 Ga0496106_0350450
1796 Ga0496106_0835426
1797 Ga0496107_0071687
1798 Ga0496107_0175093
1799 Ga0496107_0554321
1800 Ga0496108_0006585
1801 Ga0496108_0010340
1802 Ga0496108_0157770
1803 Ga0496109_0006126
1804 Ga0496109_0011401
1805 Ga0496109_0198128
1806 Ga0496109_0270699
1807 Ga0496110_0023135
1808 Ga0496110_0046061
1809 Ga0496110_0112471
1810 Ga0496110_0228619
1811 Ga0496110_0266373
1812 Ga0496110_0433558
1813 Ga0496110_0461289
1814 Ga0496110_0732973
1815 Ga0496111_0037948
1816 Ga0496111_0116203
1817 Ga0496112_0092212
1818 Ga0496112_0356725
1819 Ga0496112_0377201
1820 Ga0496112_0408951
1821 Ga0496112_0699460
1822 Ga0496113_0000320
1823 Ga0496113_0001582
1824 Ga0496113_0138616
1825 Ga0496114_0004567
1826 Ga0496114_0057402
1827 Ga0496114_0081747
1828 Ga0496114_0226461
1829 Ga0496114_0931260
1830 Ga0496115_0010306
1831 Ga0496115_0041743
1832 Ga0496115_0174637
1833 Ga0496115_0423003
1834 Ga0496117_0204783
1835 Ga0496121_0015212
1836 Ga0496121_0074288
1837 Ga0496121_0130861
1838 Ga0496121_0343318
1839 Ga0496124_0000273
1840 Ga0496124_0072888
1841 Ga0496125_0025541
1842 Ga0496125_0133791
1843 Ga0496126_0043505
1844 Ga0496126_0084620
1845 Ga0496126_0089878
1846 Ga0496126_0130695
1847 Ga0495682_0067438
1848 Ga0501031_0000753
1849 Ga0501032_0000136
1850 Ga0501033_0000202
1851 Ga0501033_0048226
1852 Ga0501033_0300749
1853 Ga0501034_0000113
1854 Ga0501034_0139242
1855 Ga0501036_0000059
1856 Ga0501037_0000270
1857 Ga0501038_0000774
1858 Ga0501039_0000067
1859 Ga0501040_0167868
1860 Ga0501042_0126544
1861 Ga0501042_0464350
1862 Ga0501043_0000017
1863 Ga0501046_0000174
1864 Ga0501047_0005957
1865 Ga0501048_0000127
1866 Ga0501048_0201065
1867 Ga0501067_0000833
1868 Ga0501068_0004830
1869 Ga0501069_0002149
1870 Ga0501069_0088674
1871 Ga0501070_0009120
1872 Ga0501070_0102336
1873 Ga0501070_0265459
1874 Ga0501071_0078396
1875 Ga0501071_0282021
1876 Ga0501071_0518923
1877 Ga0501072_0017358
1878 Ga0501073_0000069
1879 Ga0501073_0089049
1880 Ga0501073_0389392
1881 Ga0501074_0000507
1882 Ga0501074_0028902
1883 Ga0501074_0061582
1884 Ga0501075_0034209
1885 Ga0501076_0014693
1886 Ga0501079_0143012
1887 Ga0501080_0000593
1888 Ga0501080_0159402
1889 Ga0501080_0209512
1890 Ga0501081_0015033
1891 Ga0501081_0192184
1892 Ga0501083_0000336
1893 Ga0501083_0047097
1894 Ga0501083_0251662
1895 Ga0501035_0000393
1896 Ga0501035_0168014
1897 Ga0501035_0277837
1898 Ga0501044_0000387
1899 Ga0501044_0015271
1900 Ga0501044_0090851
1901 Ga0501045_0019923
1902 Ga0501045_0140758
1903 Ga0501045_0426253
1904 nmdc:mga03683_39524_c1
1905 nmdc:mga03683_82834_c1
1906 nmdc:mga03n38_112773_c1
1907 nmdc:mga03n38_160169_c1
1908 nmdc:mga03n38_279282_c1
1909 nmdc:mga03n38_6268_c1
1910 nmdc:mga00v17_52318_c1
1911 nmdc:mga0yw44_10122_c1
1912 nmdc:mga0yw44_17650_c1
1913 nmdc:mga0yw44_332022_c1
1914 nmdc:mga0k408_253369_c1
1915 nmdc:mga0k408_30599_c1
1916 nmdc:mga0k408_84524_c1
1917 nmdc:mga06z11_135036_c1
1918 nmdc:mga06z11_304506_c1
1919 nmdc:mga06z11_70690_c1
1920 nmdc:mga04h51_28453_c1
1921 nmdc:mga07m45_103717_c1
1922 nmdc:mga07m45_14161_c1
1923 nmdc:mga07m45_174808_c1
1924 nmdc:mga07m45_39889_c1
1925 nmdc:mga07m45_424766_c1
1926 nmdc:mga05p37_22572_c1
1927 nmdc:mga06r32_463968_c1
1928 nmdc:mga06r32_738397_c1
1929 nmdc:mga08y16_125147_c1
1930 nmdc:mga08y16_269467_c1
1931 nmdc:mga0n895_61208_c1
1932 nmdc:mga0n895_716909_c1
1933 nmdc:mga0n895_90050_c1
1934 nmdc:mga0rr50_187562_c1
1935 nmdc:mga0rr50_244691_c1
1936 nmdc:mga0rr50_334824_c1
1937 nmdc:mga0a205_102260_c1
1938 nmdc:mga0a205_178341_c1
1939 nmdc:mga0sz30_75405_c1
1940 Ga0495601_0032289
1941 Ga0495601_0124641
1942 Ga0500610_0000237
1943 Ga0500635_0059072
1944 Ga0495619_0026355
1945 Ga0500581_094759
1946 Ga0500646_0085796
1947 Ga0500647_0018336
1948 Ga0500651_0202913
1949 Ga0500566_0000149
1950 Ga0500641_0035698
1951 Ga0500641_0074109
1952 Ga0500554_075187
1953 Ga0500594_0150022
1954 Ga0500595_000336
1955 Ga0500595_000870
1956 Ga0500595_006384
1957 Ga0500595_034365
1958 Ga0500608_063733
1959 Ga0500642_0020733
1960 Ga0500642_0047674
1961 Ga0500655_003937
1962 Ga0500559_0019051
1963 Ga0500559_0094641
1964 Ga0500573_0004501
1965 Ga0500577_0182878
1966 Ga0500586_010049
1967 Ga0500588_0015778
1968 Ga0500603_008164
1969 Ga0500604_0025643
1970 Ga0500622_0091414
1971 Ga0500630_094713
1972 Ga0500638_000529
1973 Ga0500636_0010678
1974 Ga0500636_0035110
1975 Ga0500636_0250444
1976 Ga0500637_0000289
1977 Ga0500645_000493
1978 Ga0500645_027134
1979 Ga0501084_0000898
1980 Ga0501084_0025166
1981 Ga0501084_0514181
1982 Ga0500661_002949
1983 Ga0590075_012620
1984 Ga0501082_0003002
1985 Ga0501082_0046564
1986 2524466399
1987 2524539845
1988 2644255942
1989 2723849270
1990 2793067165
1991 2793081627
1992 2874608495
1993 2876813851
1994 2879112725
1995 2885194161
1996 2889035947
1997 2904707688
1998 8006936833
1999 8006967801
2000 8006976803
2001 8019561860
2002 8019571936
2003 8056678524
2004 8056683105

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

78

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8375 24 234
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8273 20 238
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8046 24 234
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7992 20 238
6eic-assembly1.cif.gz_C crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.7876 21 241
ID Description Score Start End Superfamily
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8888 44 220 3.40.50.1820
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8498 144 222 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8447 21 243 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8413 38 237 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8411 21 243 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A536UCT2-F1-model_v4 Alpha/beta hydrolase 0.9994 34 225 GO:0016787
AF-H0T9F2-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9965 20 242
AF-A0A537YB30-F1-model_v4 Alpha/beta hydrolase 0.9952 19 222 GO:0016787
AF-A0A3N1M5G4-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.995 21 239
AF-A0A562KXC6-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9943 23 240

Map