F487885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1001 | 363 | 999 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100802873|Ga0070694_1008028732 |
| Length | 165 |
| Sequence | MPVKEGWTGRVYEDFEVGDIYQHPLGRTVLPVDNSWFTLLSQNTNPIHFDRHYAAQTEFGQPLVNSTLTLALVVGLTVSDISQNAVNLGWDEVRLPAPVFEGDTIYAQTEVLSTRDSGSRPSMGIVEIRTTGFKQDGTVVMTFRRTILVYRRGQAPVRPTPTIKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 3 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 208 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 210 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 2.6 |
| Rhizosphere | 96.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2333552 | 2162886007 | Bacteria | 914 |
| 2 | JGI24749J21850_1027340 | 3300002076 | Bacteria | 814 |
| 3 | JGI25406J46586_10002299 | 3300003203 | Bacteria | 9016 |
| 4 | Ga0055532_1000335 | 3300003758 | Bacteria | 25726 |
| 5 | Ga0065704_10005291 | 3300005289 | Bacteria | 5665 |
| 6 | Ga0065712_10004822 | 3300005290 | Bacteria | 3908 |
| 7 | Ga0065712_10097465 | 3300005290 | Bacteria | 2150 |
| 8 | Ga0065712_10122688 | 3300005290 | Bacteria | 1648 |
| 9 | Ga0065712_10410678 | 3300005290 | Bacteria | 722 |
| 10 | Ga0065712_10528120 | 3300005290 | Bacteria | 631 |
| 11 | Ga0065715_10159844 | 3300005293 | Bacteria | 1640 |
| 12 | Ga0065715_10256818 | 3300005293 | Bacteria | 1150 |
| 13 | Ga0065715_10750698 | 3300005293 | Unclassified | 630 |
| 14 | Ga0065715_10772688 | 3300005293 | Bacteria | 621 |
| 15 | Ga0065707_10112237 | 3300005295 | Unclassified | 2367 |
| 16 | Ga0065707_10457655 | 3300005295 | Bacteria | 794 |
| 17 | Ga0070658_11561338 | 3300005327 | Bacteria | 572 |
| 18 | Ga0070683_100028567 | 3300005329 | Bacteria | 5041 |
| 19 | Ga0070683_100037387 | 3300005329 | Bacteria | 4444 |
| 20 | Ga0070683_100281589 | 3300005329 | Bacteria | 1582 |
| 21 | Ga0070683_100636737 | 3300005329 | Bacteria | 1021 |
| 22 | Ga0070683_101919745 | 3300005329 | Bacteria | 569 |
| 23 | Ga0070690_100062327 | 3300005330 | Bacteria | 2405 |
| 24 | Ga0070690_100798290 | 3300005330 | Unclassified | 732 |
| 25 | Ga0070690_100987079 | 3300005330 | Bacteria | 663 |
| 26 | Ga0070670_100012431 | 3300005331 | Bacteria | 7286 |
| 27 | Ga0070670_100034911 | 3300005331 | Bacteria | 4328 |
| 28 | Ga0070670_100074814 | 3300005331 | Unclassified | 2910 |
| 29 | Ga0070670_101451578 | 3300005331 | Bacteria | 629 |
| 30 | Ga0070677_10158599 | 3300005333 | Bacteria | 1060 |
| 31 | Ga0068869_100297635 | 3300005334 | Bacteria | 1302 |
| 32 | Ga0068869_100298008 | 3300005334 | Bacteria | 1301 |
| 33 | Ga0070666_10124473 | 3300005335 | Bacteria | 1789 |
| 34 | Ga0070666_10734973 | 3300005335 | Bacteria | 725 |
| 35 | Ga0070680_100267546 | 3300005336 | Bacteria | 1447 |
| 36 | Ga0068868_100229300 | 3300005338 | Unclassified | 1557 |
| 37 | Ga0068868_100723500 | 3300005338 | Unclassified | 892 |
| 38 | Ga0068868_101392715 | 3300005338 | Bacteria | 654 |
| 39 | Ga0070689_100058884 | 3300005340 | Bacteria | 2984 |
| 40 | Ga0070689_100068765 | 3300005340 | Bacteria | 2762 |
| 41 | Ga0070689_100088433 | 3300005340 | Bacteria | 2438 |
| 42 | Ga0070691_10659441 | 3300005341 | Bacteria | 624 |
| 43 | Ga0070687_100061165 | 3300005343 | Bacteria | 1990 |
| 44 | Ga0070687_100196382 | 3300005343 | Bacteria | 1219 |
| 45 | Ga0070687_100197999 | 3300005343 | Bacteria | 1215 |
| 46 | Ga0070661_100956963 | 3300005344 | Bacteria | 709 |
| 47 | Ga0070692_10023802 | 3300005345 | Bacteria | 3004 |
| 48 | Ga0070692_10029173 | 3300005345 | Bacteria | 2748 |
| 49 | Ga0070668_100083742 | 3300005347 | Bacteria | 2504 |
| 50 | Ga0070669_100006800 | 3300005353 | Bacteria | 8226 |
| 51 | Ga0070669_100060029 | 3300005353 | Bacteria | 2793 |
| 52 | Ga0070669_100471062 | 3300005353 | Bacteria | 1038 |
| 53 | Ga0070675_100027446 | 3300005354 | Bacteria | 4573 |
| 54 | Ga0070675_100052580 | 3300005354 | Bacteria | 3349 |
| 55 | Ga0070675_100397355 | 3300005354 | Bacteria | 1229 |
| 56 | Ga0070675_100399743 | 3300005354 | Bacteria | 1225 |
| 57 | Ga0070675_100513487 | 3300005354 | Bacteria | 1081 |
| 58 | Ga0070671_100010405 | 3300005355 | Bacteria | 7460 |
| 59 | Ga0070671_100141250 | 3300005355 | Bacteria | 2032 |
| 60 | Ga0070671_100690822 | 3300005355 | Bacteria | 885 |
| 61 | Ga0070674_100817027 | 3300005356 | Bacteria | 806 |
| 62 | Ga0070674_101294150 | 3300005356 | Bacteria | 650 |
| 63 | Ga0070673_100025830 | 3300005364 | Bacteria | 4329 |
| 64 | Ga0070673_100074718 | 3300005364 | Bacteria | 2732 |
| 65 | Ga0070673_100095316 | 3300005364 | Bacteria | 2441 |
| 66 | Ga0070673_100205036 | 3300005364 | Bacteria | 1700 |
| 67 | Ga0070673_100295045 | 3300005364 | Unclassified | 1426 |
| 68 | Ga0070673_100509190 | 3300005364 | Unclassified | 1090 |
| 69 | Ga0070673_100791974 | 3300005364 | Bacteria | 875 |
| 70 | Ga0070688_100013824 | 3300005365 | Bacteria | 4565 |
| 71 | Ga0070688_100020555 | 3300005365 | Bacteria | 3840 |
| 72 | Ga0070659_100853036 | 3300005366 | Bacteria | 794 |
| 73 | Ga0070667_100316293 | 3300005367 | Bacteria | 1408 |
| 74 | Ga0070667_101425437 | 3300005367 | Bacteria | 650 |
| 75 | Ga0070709_10082442 | 3300005434 | Bacteria | 2101 |
| 76 | Ga0070709_10176931 | 3300005434 | Bacteria | 1495 |
| 77 | Ga0070709_10178635 | 3300005434 | Bacteria | 1489 |
| 78 | Ga0070714_100071194 | 3300005435 | Bacteria | 3006 |
| 79 | Ga0070713_100008727 | 3300005436 | Bacteria | 7210 |
| 80 | Ga0070713_100012499 | 3300005436 | Bacteria | 6230 |
| 81 | Ga0070713_100096486 | 3300005436 | Bacteria | 2552 |
| 82 | Ga0070713_100103707 | 3300005436 | Bacteria | 2468 |
| 83 | Ga0070713_100214365 | 3300005436 | Bacteria | 1745 |
| 84 | Ga0070713_101405073 | 3300005436 | Bacteria | 677 |
| 85 | Ga0070710_10025665 | 3300005437 | Bacteria | 3122 |
| 86 | Ga0070701_10040427 | 3300005438 | Bacteria | 2370 |
| 87 | Ga0070701_10113992 | 3300005438 | Bacteria | 1514 |
| 88 | Ga0070701_10154658 | 3300005438 | Unclassified | 1323 |
| 89 | Ga0070701_10393739 | 3300005438 | Bacteria | 876 |
| 90 | Ga0070711_100019524 | 3300005439 | Bacteria | 4349 |
| 91 | Ga0070711_100367297 | 3300005439 | Bacteria | 1160 |
| 92 | Ga0070705_100008138 | 3300005440 | Bacteria | 5186 |
| 93 | Ga0070705_100061747 | 3300005440 | Bacteria | 2228 |
| 94 | Ga0070705_100144025 | 3300005440 | Bacteria | 1572 |
| 95 | Ga0070700_100060103 | 3300005441 | Bacteria | 2395 |
| 96 | Ga0070700_101121135 | 3300005441 | Unclassified | 653 |
| 97 | Ga0070694_100000734 | 3300005444 | Bacteria | 18310 |
| 98 | Ga0070694_100001223 | 3300005444 | Bacteria | 14829 |
| 99 | Ga0070694_100044903 | 3300005444 | Bacteria | 2959 |
| 100 | Ga0070694_100132349 | 3300005444 | Bacteria | 1803 |
| 101 | Ga0070694_100298533 | 3300005444 | Bacteria | 1234 |
| 102 | Ga0070694_100802873 | 3300005444 | Bacteria | 772 |
| 103 | Ga0070694_100963429 | 3300005444 | Bacteria | 707 |
| 104 | Ga0070708_100988463 | 3300005445 | Bacteria | 789 |
| 105 | Ga0070678_100644799 | 3300005456 | Bacteria | 949 |
| 106 | Ga0070662_100046004 | 3300005457 | Unclassified | 3134 |
| 107 | Ga0070662_100060308 | 3300005457 | Bacteria | 2766 |
| 108 | Ga0070662_100075719 | 3300005457 | Bacteria | 2493 |
| 109 | Ga0070681_10024842 | 3300005458 | Bacteria | 6028 |
| 110 | Ga0070681_10199585 | 3300005458 | Bacteria | 1919 |
| 111 | Ga0070681_10235379 | 3300005458 | Bacteria | 1745 |
| 112 | Ga0070681_10497643 | 3300005458 | Unclassified | 1132 |
| 113 | Ga0070681_10982140 | 3300005458 | Bacteria | 764 |
| 114 | Ga0070681_11178390 | 3300005458 | Bacteria | 688 |
| 115 | Ga0070681_11347782 | 3300005458 | Bacteria | 637 |
| 116 | Ga0068867_100003655 | 3300005459 | Bacteria | 10823 |
| 117 | Ga0068867_100056439 | 3300005459 | Bacteria | 2906 |
| 118 | Ga0068867_100507684 | 3300005459 | Bacteria | 1037 |
| 119 | Ga0068867_101752232 | 3300005459 | Bacteria | 583 |
| 120 | Ga0070685_10087372 | 3300005466 | Bacteria | 1881 |
| 121 | Ga0070685_10105691 | 3300005466 | Bacteria | 1726 |
| 122 | Ga0070685_10275614 | 3300005466 | Bacteria | 1124 |
| 123 | Ga0070706_101417025 | 3300005467 | Bacteria | 636 |
| 124 | Ga0070707_100007200 | 3300005468 | Bacteria | 10318 |
| 125 | Ga0070707_100080166 | 3300005468 | Bacteria | 3151 |
| 126 | Ga0070707_100085229 | 3300005468 | Bacteria | 3054 |
| 127 | Ga0070707_100316489 | 3300005468 | Bacteria | 1517 |
| 128 | Ga0070707_100723962 | 3300005468 | Bacteria | 958 |
| 129 | Ga0070698_100001371 | 3300005471 | Bacteria | 27083 |
| 130 | Ga0070698_100014372 | 3300005471 | Bacteria | 8363 |
| 131 | Ga0070698_100021898 | 3300005471 | Bacteria | 6692 |
| 132 | Ga0070699_100000912 | 3300005518 | Bacteria | 27543 |
| 133 | Ga0070699_100788126 | 3300005518 | Bacteria | 870 |
| 134 | Ga0070679_100055706 | 3300005530 | Bacteria | 3938 |
| 135 | Ga0070679_101104079 | 3300005530 | Unclassified | 738 |
| 136 | Ga0070679_101126194 | 3300005530 | Bacteria | 730 |
| 137 | Ga0070684_100006317 | 3300005535 | Bacteria | 9156 |
| 138 | Ga0070684_100238927 | 3300005535 | Bacteria | 1659 |
| 139 | Ga0070684_100488072 | 3300005535 | Bacteria | 1140 |
| 140 | Ga0070697_100061942 | 3300005536 | Bacteria | 3052 |
| 141 | Ga0070697_100352231 | 3300005536 | Bacteria | 1272 |
| 142 | Ga0070697_100523006 | 3300005536 | Bacteria | 1039 |
| 143 | Ga0068853_100044977 | 3300005539 | Bacteria | 3780 |
| 144 | Ga0068853_100083918 | 3300005539 | Bacteria | 2791 |
| 145 | Ga0068853_100884379 | 3300005539 | Bacteria | 857 |
| 146 | Ga0070672_100142431 | 3300005543 | Bacteria | 1978 |
| 147 | Ga0070672_100309139 | 3300005543 | Unclassified | 1341 |
| 148 | Ga0070672_100385337 | 3300005543 | Bacteria | 1199 |
| 149 | Ga0070672_100411979 | 3300005543 | Unclassified | 1160 |
| 150 | Ga0070672_100931825 | 3300005543 | Unclassified | 768 |
| 151 | Ga0070672_101265810 | 3300005543 | Bacteria | 658 |
| 152 | Ga0070672_101723492 | 3300005543 | Unclassified | 563 |
| 153 | Ga0070686_100026526 | 3300005544 | Bacteria | 3498 |
| 154 | Ga0070686_100076723 | 3300005544 | Bacteria | 2202 |
| 155 | Ga0070686_100100383 | 3300005544 | Bacteria | 1954 |
| 156 | Ga0070686_100163142 | 3300005544 | Unclassified | 1571 |
| 157 | Ga0070686_100440496 | 3300005544 | Bacteria | 999 |
| 158 | Ga0070686_100494399 | 3300005544 | Bacteria | 948 |
| 159 | Ga0070695_100004284 | 3300005545 | Bacteria | 8347 |
| 160 | Ga0070695_100005772 | 3300005545 | Bacteria | 7293 |
| 161 | Ga0070695_100127042 | 3300005545 | Bacteria | 1752 |
| 162 | Ga0070695_100555299 | 3300005545 | Bacteria | 896 |
| 163 | Ga0070696_100005384 | 3300005546 | Bacteria | 8536 |
| 164 | Ga0070696_100006916 | 3300005546 | Bacteria | 7573 |
| 165 | Ga0070696_100008858 | 3300005546 | Bacteria | 6730 |
| 166 | Ga0070696_100046884 | 3300005546 | Bacteria | 2998 |
| 167 | Ga0070693_100020383 | 3300005547 | Bacteria | 3495 |
| 168 | Ga0070693_100119505 | 3300005547 | Bacteria | 1632 |
| 169 | Ga0070693_100851487 | 3300005547 | Bacteria | 680 |
| 170 | Ga0070665_100080194 | 3300005548 | Bacteria | 3269 |
| 171 | Ga0070665_100673562 | 3300005548 | Unclassified | 1047 |
| 172 | Ga0070704_100001828 | 3300005549 | Bacteria | 11724 |
| 173 | Ga0070704_100003478 | 3300005549 | Bacteria | 9042 |
| 174 | Ga0070704_100035596 | 3300005549 | Bacteria | 3385 |
| 175 | Ga0070704_100310949 | 3300005549 | Bacteria | 1316 |
| 176 | Ga0070704_100549664 | 3300005549 | Bacteria | 1009 |
| 177 | Ga0070704_100678714 | 3300005549 | Bacteria | 912 |
| 178 | Ga0068855_100475390 | 3300005563 | Bacteria | 1361 |
| 179 | Ga0068855_100693483 | 3300005563 | Bacteria | 1090 |
| 180 | Ga0070664_100027979 | 3300005564 | Bacteria | 4689 |
| 181 | Ga0070664_100091525 | 3300005564 | Bacteria | 2632 |
| 182 | Ga0070664_100172395 | 3300005564 | Bacteria | 1920 |
| 183 | Ga0068857_100037232 | 3300005577 | Bacteria | 4309 |
| 184 | Ga0068857_100074413 | 3300005577 | Bacteria | 3026 |
| 185 | Ga0068854_100011869 | 3300005578 | Bacteria | 5689 |
| 186 | Ga0068854_100067182 | 3300005578 | Bacteria | 2611 |
| 187 | Ga0068854_100763491 | 3300005578 | Bacteria | 840 |
| 188 | Ga0068856_100120159 | 3300005614 | Bacteria | 2629 |
| 189 | Ga0070702_100205270 | 3300005615 | Bacteria | 1307 |
| 190 | Ga0070702_100475743 | 3300005615 | Bacteria | 912 |
| 191 | Ga0068852_100093651 | 3300005616 | Bacteria | 2693 |
| 192 | Ga0068852_101760386 | 3300005616 | Unclassified | 642 |
| 193 | Ga0068859_100120800 | 3300005617 | Bacteria | 2687 |
| 194 | Ga0068859_100451967 | 3300005617 | Bacteria | 1381 |
| 195 | Ga0068864_100149664 | 3300005618 | Bacteria | 2113 |
| 196 | Ga0068864_100362662 | 3300005618 | Bacteria | 1370 |
| 197 | Ga0068861_100003935 | 3300005719 | Bacteria | 9932 |
| 198 | Ga0068861_100033182 | 3300005719 | Bacteria | 3806 |
| 199 | Ga0068861_100051200 | 3300005719 | Bacteria | 3134 |
| 200 | Ga0068861_100084987 | 3300005719 | Bacteria | 2485 |
| 201 | Ga0068861_100844527 | 3300005719 | Unclassified | 863 |
| 202 | Ga0068851_10119275 | 3300005834 | Bacteria | 1416 |
| 203 | Ga0068870_10002012 | 3300005840 | Bacteria | 8402 |
| 204 | Ga0068863_100055817 | 3300005841 | Bacteria | 3740 |
| 205 | Ga0068863_100108057 | 3300005841 | Bacteria | 2648 |
| 206 | Ga0068863_101385447 | 3300005841 | Bacteria | 711 |
| 207 | Ga0068863_101673793 | 3300005841 | Unclassified | 646 |
| 208 | Ga0068858_100007327 | 3300005842 | Bacteria | 10678 |
| 209 | Ga0068860_100118951 | 3300005843 | Bacteria | 2529 |
| 210 | Ga0068860_100420304 | 3300005843 | Bacteria | 1325 |
| 211 | Ga0068860_101388001 | 3300005843 | Bacteria | 724 |
| 212 | Ga0068860_101670818 | 3300005843 | Bacteria | 659 |
| 213 | Ga0068862_100000603 | 3300005844 | Bacteria | 37377 |
| 214 | Ga0068862_100078368 | 3300005844 | Bacteria | 2863 |
| 215 | Ga0068862_100344980 | 3300005844 | Bacteria | 1380 |
| 216 | Ga0081539_10000034 | 3300005985 | Bacteria | 307597 |
| 217 | Ga0081539_10081756 | 3300005985 | Bacteria | 1695 |
| 218 | Ga0070717_10070235 | 3300006028 | Bacteria | 2918 |
| 219 | Ga0070717_10227176 | 3300006028 | Unclassified | 1642 |
| 220 | Ga0070717_10634191 | 3300006028 | Bacteria | 970 |
| 221 | Ga0075432_10154696 | 3300006058 | Unclassified | 883 |
| 222 | Ga0070715_10015083 | 3300006163 | Bacteria | 2875 |
| 223 | Ga0070715_10216154 | 3300006163 | Bacteria | 983 |
| 224 | Ga0070715_10249609 | 3300006163 | Unclassified | 927 |
| 225 | Ga0070715_10528596 | 3300006163 | Bacteria | 680 |
| 226 | Ga0070716_100041278 | 3300006173 | Bacteria | 2570 |
| 227 | Ga0070716_100605158 | 3300006173 | Bacteria | 825 |
| 228 | Ga0070712_100019700 | 3300006175 | Bacteria | 4405 |
| 229 | Ga0070712_100154776 | 3300006175 | Bacteria | 1764 |
| 230 | Ga0070712_100737142 | 3300006175 | Bacteria | 842 |
| 231 | Ga0097621_100003000 | 3300006237 | Bacteria | 11595 |
| 232 | Ga0097621_100435050 | 3300006237 | Bacteria | 1179 |
| 233 | Ga0068871_100005784 | 3300006358 | Bacteria | 8686 |
| 234 | Ga0068871_100073686 | 3300006358 | Bacteria | 2815 |
| 235 | Ga0068871_100116449 | 3300006358 | Bacteria | 2253 |
| 236 | Ga0075428_100001276 | 3300006844 | Bacteria | 26863 |
| 237 | Ga0075428_100017144 | 3300006844 | Bacteria | 8001 |
| 238 | Ga0075428_100237921 | 3300006844 | Unclassified | 1965 |
| 239 | Ga0075428_100603093 | 3300006844 | Bacteria | 1173 |
| 240 | Ga0075428_100734863 | 3300006844 | Bacteria | 1051 |
| 241 | Ga0075428_100748144 | 3300006844 | Bacteria | 1040 |
| 242 | Ga0075430_100003017 | 3300006846 | Bacteria | 14089 |
| 243 | Ga0075430_100010836 | 3300006846 | Bacteria | 7723 |
| 244 | Ga0075430_100514456 | 3300006846 | Bacteria | 988 |
| 245 | Ga0075431_100006823 | 3300006847 | Bacteria | 11341 |
| 246 | Ga0075431_100010900 | 3300006847 | Bacteria | 9144 |
| 247 | Ga0075431_100059822 | 3300006847 | Bacteria | 3931 |
| 248 | Ga0075431_100137060 | 3300006847 | Bacteria | 2523 |
| 249 | Ga0075431_100518399 | 3300006847 | Bacteria | 1182 |
| 250 | Ga0075433_10000445 | 3300006852 | Bacteria | 26756 |
| 251 | Ga0075433_10017052 | 3300006852 | Bacteria | 6004 |
| 252 | Ga0075433_10044841 | 3300006852 | Bacteria | 3842 |
| 253 | Ga0075433_10131072 | 3300006852 | Bacteria | 2227 |
| 254 | Ga0075433_10733640 | 3300006852 | Bacteria | 864 |
| 255 | Ga0075434_100000026 | 3300006871 | Bacteria | 68165 |
| 256 | Ga0075434_100000579 | 3300006871 | Bacteria | 28227 |
| 257 | Ga0075434_100001041 | 3300006871 | Bacteria | 22625 |
| 258 | Ga0075434_100001436 | 3300006871 | Bacteria | 20006 |
| 259 | Ga0075434_100066668 | 3300006871 | Bacteria | 3586 |
| 260 | Ga0075434_100067337 | 3300006871 | Bacteria | 3567 |
| 261 | Ga0075434_100255507 | 3300006871 | Bacteria | 1771 |
| 262 | Ga0075434_100271569 | 3300006871 | Bacteria | 1715 |
| 263 | Ga0075434_100427078 | 3300006871 | Bacteria | 1346 |
| 264 | Ga0075434_100510589 | 3300006871 | Bacteria | 1223 |
| 265 | Ga0075434_100719973 | 3300006871 | Bacteria | 1015 |
| 266 | Ga0075429_100001340 | 3300006880 | Bacteria | 20116 |
| 267 | Ga0075429_100012788 | 3300006880 | Bacteria | 7280 |
| 268 | Ga0075429_100046300 | 3300006880 | Unclassified | 3785 |
| 269 | Ga0075429_100139220 | 3300006880 | Bacteria | 2124 |
| 270 | Ga0068865_100026112 | 3300006881 | Bacteria | 3848 |
| 271 | Ga0068865_100640234 | 3300006881 | Unclassified | 902 |
| 272 | Ga0075436_100000600 | 3300006914 | Bacteria | 23619 |
| 273 | Ga0075436_100420698 | 3300006914 | Bacteria | 970 |
| 274 | Ga0075436_100646460 | 3300006914 | Bacteria | 781 |
| 275 | Ga0097620_100120800 | 3300006931 | Bacteria | 2687 |
| 276 | Ga0097620_100451924 | 3300006931 | Bacteria | 1381 |
| 277 | Ga0097620_101220627 | 3300006931 | Bacteria | 828 |
| 278 | Ga0075435_100000017 | 3300007076 | Bacteria | 99666 |
| 279 | Ga0075435_100004530 | 3300007076 | Bacteria | 9555 |
| 280 | Ga0075435_100013525 | 3300007076 | Bacteria | 6074 |
| 281 | Ga0075435_100015367 | 3300007076 | Bacteria | 5753 |
| 282 | Ga0075435_100043537 | 3300007076 | Bacteria | 3593 |
| 283 | Ga0075435_100127534 | 3300007076 | Bacteria | 2127 |
| 284 | Ga0075435_100379246 | 3300007076 | Bacteria | 1215 |
| 285 | Ga0099795_10004644 | 3300007788 | Bacteria | 3570 |
| 286 | Ga0105240_10178259 | 3300009093 | Bacteria | 2510 |
| 287 | Ga0111539_10003598 | 3300009094 | Bacteria | 20431 |
| 288 | Ga0111539_10023669 | 3300009094 | Bacteria | 7546 |
| 289 | Ga0111539_10035363 | 3300009094 | Bacteria | 6049 |
| 290 | Ga0111539_10046561 | 3300009094 | Bacteria | 5187 |
| 291 | Ga0111539_10655651 | 3300009094 | Bacteria | 1222 |
| 292 | Ga0111539_11046726 | 3300009094 | Bacteria | 949 |
| 293 | Ga0105245_10007977 | 3300009098 | Bacteria | 9257 |
| 294 | Ga0105245_10051163 | 3300009098 | Bacteria | 3704 |
| 295 | Ga0105245_10334890 | 3300009098 | Unclassified | 1495 |
| 296 | Ga0105245_10510738 | 3300009098 | Bacteria | 1219 |
| 297 | Ga0105247_10246143 | 3300009101 | Bacteria | 1220 |
| 298 | Ga0114129_10008065 | 3300009147 | Bacteria | 15007 |
| 299 | Ga0114129_10021791 | 3300009147 | Bacteria | 9096 |
| 300 | Ga0114129_10039575 | 3300009147 | Bacteria | 6647 |
| 301 | Ga0114129_10040478 | 3300009147 | Bacteria | 6569 |
| 302 | Ga0114129_10091939 | 3300009147 | Bacteria | 4203 |
| 303 | Ga0114129_10102673 | 3300009147 | Bacteria | 3954 |
| 304 | Ga0114129_10103944 | 3300009147 | Bacteria | 3926 |
| 305 | Ga0114129_10255212 | 3300009147 | Bacteria | 2352 |
| 306 | Ga0114129_10644060 | 3300009147 | Bacteria | 1368 |
| 307 | Ga0114129_10752145 | 3300009147 | Bacteria | 1248 |
| 308 | Ga0114129_11409622 | 3300009147 | Unclassified | 859 |
| 309 | Ga0105243_10015301 | 3300009148 | Bacteria | 5804 |
| 310 | Ga0105243_10067131 | 3300009148 | Unclassified | 2887 |
| 311 | Ga0105243_10154629 | 3300009148 | Bacteria | 1971 |
| 312 | Ga0105243_10355420 | 3300009148 | Bacteria | 1347 |
| 313 | Ga0105243_10728622 | 3300009148 | Unclassified | 970 |
| 314 | Ga0105243_11184013 | 3300009148 | Unclassified | 776 |
| 315 | Ga0105241_10087408 | 3300009174 | Bacteria | 2454 |
| 316 | Ga0105241_10228887 | 3300009174 | Unclassified | 1566 |
| 317 | Ga0105241_10674781 | 3300009174 | Bacteria | 941 |
| 318 | Ga0105242_10012262 | 3300009176 | Bacteria | 6597 |
| 319 | Ga0105242_10044981 | 3300009176 | Bacteria | 3576 |
| 320 | Ga0105242_10400747 | 3300009176 | Unclassified | 1280 |
| 321 | Ga0105242_10588065 | 3300009176 | Bacteria | 1073 |
| 322 | Ga0105242_10954246 | 3300009176 | Bacteria | 862 |
| 323 | Ga0105248_10011812 | 3300009177 | Bacteria | 9634 |
| 324 | Ga0105248_10027169 | 3300009177 | Bacteria | 6366 |
| 325 | Ga0105248_10274840 | 3300009177 | Bacteria | 1897 |
| 326 | Ga0105248_10281528 | 3300009177 | Bacteria | 1872 |
| 327 | Ga0105248_10360827 | 3300009177 | Bacteria | 1636 |
| 328 | Ga0105248_10428598 | 3300009177 | Unclassified | 1490 |
| 329 | Ga0105248_11406967 | 3300009177 | Bacteria | 789 |
| 330 | Ga0105237_10265025 | 3300009545 | Bacteria | 1721 |
| 331 | Ga0105237_10515783 | 3300009545 | Unclassified | 1202 |
| 332 | Ga0105238_10008383 | 3300009551 | Bacteria | 10339 |
| 333 | Ga0105238_10040699 | 3300009551 | Bacteria | 4709 |
| 334 | Ga0105238_10185539 | 3300009551 | Unclassified | 2056 |
| 335 | Ga0105238_10731453 | 3300009551 | Bacteria | 1003 |
| 336 | Ga0105249_10017654 | 3300009553 | Bacteria | 6337 |
| 337 | Ga0105249_10204558 | 3300009553 | Bacteria | 1934 |
| 338 | Ga0105249_12222284 | 3300009553 | Unclassified | 621 |
| 339 | Ga0099796_10005759 | 3300010159 | Bacteria | 3117 |
| 340 | Ga0105239_10079529 | 3300010375 | Bacteria | 3607 |
| 341 | Ga0105239_10190258 | 3300010375 | Bacteria | 2297 |
| 342 | Ga0105239_10345322 | 3300010375 | Bacteria | 1680 |
| 343 | Ga0105246_10293055 | 3300011119 | Bacteria | 1310 |
| 344 | Ga0105246_10736608 | 3300011119 | Bacteria | 868 |
| 345 | Ga0105246_11064717 | 3300011119 | Bacteria | 736 |
| 346 | Ga0157369_10030006 | 3300013105 | Bacteria | 6000 |
| 347 | Ga0157369_10201990 | 3300013105 | Unclassified | 2086 |
| 348 | Ga0157369_11639597 | 3300013105 | Bacteria | 654 |
| 349 | Ga0157374_10028827 | 3300013296 | Bacteria | 5019 |
| 350 | Ga0157374_10109340 | 3300013296 | Bacteria | 2657 |
| 351 | Ga0157374_10138644 | 3300013296 | Bacteria | 2360 |
| 352 | Ga0157374_10322002 | 3300013296 | Unclassified | 1532 |
| 353 | Ga0157374_11532744 | 3300013296 | Unclassified | 690 |
| 354 | Ga0157374_11747112 | 3300013296 | Bacteria | 647 |
| 355 | Ga0157378_10010601 | 3300013297 | Bacteria | 8055 |
| 356 | Ga0157378_10030110 | 3300013297 | Bacteria | 4795 |
| 357 | Ga0157378_10131292 | 3300013297 | Bacteria | 2319 |
| 358 | Ga0157378_10264794 | 3300013297 | Bacteria | 1651 |
| 359 | Ga0157378_10665819 | 3300013297 | Bacteria | 1058 |
| 360 | Ga0163162_10523793 | 3300013306 | Bacteria | 1315 |
| 361 | Ga0157372_10386304 | 3300013307 | Bacteria | 1631 |
| 362 | Ga0157372_11156966 | 3300013307 | Bacteria | 894 |
| 363 | Ga0157375_10008416 | 3300013308 | Bacteria | 9035 |
| 364 | Ga0157375_10123341 | 3300013308 | Bacteria | 2703 |
| 365 | Ga0157375_10181881 | 3300013308 | Bacteria | 2254 |
| 366 | Ga0157375_10916427 | 3300013308 | Bacteria | 1020 |
| 367 | Ga0157375_11315551 | 3300013308 | Bacteria | 850 |
| 368 | Ga0157375_12337496 | 3300013308 | Archaea | 637 |
| 369 | Ga0163163_10020746 | 3300014325 | Bacteria | 6193 |
| 370 | Ga0163163_10607746 | 3300014325 | Bacteria | 1157 |
| 371 | Ga0163163_11452316 | 3300014325 | Bacteria | 747 |
| 372 | Ga0157380_10017015 | 3300014326 | Bacteria | 5371 |
| 373 | Ga0157380_10085509 | 3300014326 | Bacteria | 2588 |
| 374 | Ga0157380_10096165 | 3300014326 | Bacteria | 2455 |
| 375 | Ga0157380_10143336 | 3300014326 | Unclassified | 2056 |
| 376 | Ga0157380_10239949 | 3300014326 | Bacteria | 1633 |
| 377 | Ga0157380_10546512 | 3300014326 | Bacteria | 1135 |
| 378 | Ga0157380_10675744 | 3300014326 | Bacteria | 1034 |
| 379 | Ga0157377_10055537 | 3300014745 | Bacteria | 2246 |
| 380 | Ga0157379_10722673 | 3300014968 | Bacteria | 936 |
| 381 | Ga0157379_11218164 | 3300014968 | Unclassified | 724 |
| 382 | Ga0157376_10022962 | 3300014969 | Bacteria | 4873 |
| 383 | Ga0157376_10078321 | 3300014969 | Unclassified | 2830 |
| 384 | Ga0157376_10166998 | 3300014969 | Bacteria | 2000 |
| 385 | Ga0157376_10313027 | 3300014969 | Bacteria | 1490 |
| 386 | Ga0157376_10337512 | 3300014969 | Bacteria | 1438 |
| 387 | Ga0157376_10553873 | 3300014969 | Bacteria | 1138 |
| 388 | Ga0163161_10539744 | 3300017792 | Bacteria | 954 |
| 389 | Ga0224712_10277304 | 3300022467 | Unclassified | 780 |
| 390 | Ga0209147_100155 | 3300025229 | Bacteria | 93839 |
| 391 | Ga0207656_10316035 | 3300025321 | Unclassified | 775 |
| 392 | Ga0207653_10013702 | 3300025885 | Bacteria | 2540 |
| 393 | Ga0207682_10074944 | 3300025893 | Bacteria | 1440 |
| 394 | Ga0207642_10141684 | 3300025899 | Bacteria | 1268 |
| 395 | Ga0207710_10099750 | 3300025900 | Bacteria | 1368 |
| 396 | Ga0207688_10343944 | 3300025901 | Bacteria | 918 |
| 397 | Ga0207680_10128853 | 3300025903 | Bacteria | 1665 |
| 398 | Ga0207680_10131982 | 3300025903 | Bacteria | 1647 |
| 399 | Ga0207680_10258693 | 3300025903 | Unclassified | 1204 |
| 400 | Ga0207680_10394754 | 3300025903 | Bacteria | 977 |
| 401 | Ga0207647_10113090 | 3300025904 | Bacteria | 1604 |
| 402 | Ga0207685_10162133 | 3300025905 | Bacteria | 1022 |
| 403 | Ga0207699_10072542 | 3300025906 | Bacteria | 2109 |
| 404 | Ga0207699_10546861 | 3300025906 | Bacteria | 839 |
| 405 | Ga0207699_10655034 | 3300025906 | Bacteria | 767 |
| 406 | Ga0207645_10006229 | 3300025907 | Bacteria | 8572 |
| 407 | Ga0207645_10069063 | 3300025907 | Bacteria | 2260 |
| 408 | Ga0207645_10184593 | 3300025907 | Bacteria | 1369 |
| 409 | Ga0207643_10003460 | 3300025908 | Bacteria | 8498 |
| 410 | Ga0207643_10198778 | 3300025908 | Bacteria | 1220 |
| 411 | Ga0207654_10046467 | 3300025911 | Bacteria | 2476 |
| 412 | Ga0207654_10157655 | 3300025911 | Unclassified | 1463 |
| 413 | Ga0207654_10622809 | 3300025911 | Bacteria | 771 |
| 414 | Ga0207707_10120830 | 3300025912 | Bacteria | 2290 |
| 415 | Ga0207707_10395319 | 3300025912 | Unclassified | 1187 |
| 416 | Ga0207707_10526993 | 3300025912 | Bacteria | 1006 |
| 417 | Ga0207707_10585552 | 3300025912 | Bacteria | 945 |
| 418 | Ga0207707_10764527 | 3300025912 | Bacteria | 807 |
| 419 | Ga0207707_10767414 | 3300025912 | Bacteria | 805 |
| 420 | Ga0207695_10229148 | 3300025913 | Unclassified | 1763 |
| 421 | Ga0207695_11125106 | 3300025913 | Bacteria | 665 |
| 422 | Ga0207693_10022733 | 3300025915 | Bacteria | 4981 |
| 423 | Ga0207693_10035419 | 3300025915 | Bacteria | 3936 |
| 424 | Ga0207693_10142549 | 3300025915 | Bacteria | 1884 |
| 425 | Ga0207663_10000828 | 3300025916 | Bacteria | 13994 |
| 426 | Ga0207663_10292878 | 3300025916 | Bacteria | 1213 |
| 427 | Ga0207663_10344079 | 3300025916 | Bacteria | 1127 |
| 428 | Ga0207660_10179365 | 3300025917 | Bacteria | 1644 |
| 429 | Ga0207660_10632512 | 3300025917 | Bacteria | 872 |
| 430 | Ga0207662_10032509 | 3300025918 | Bacteria | 3038 |
| 431 | Ga0207662_10144066 | 3300025918 | Bacteria | 1511 |
| 432 | Ga0207662_10234207 | 3300025918 | Bacteria | 1200 |
| 433 | Ga0207662_10299272 | 3300025918 | Bacteria | 1069 |
| 434 | Ga0207662_10319344 | 3300025918 | Bacteria | 1036 |
| 435 | Ga0207649_10299408 | 3300025920 | Bacteria | 1175 |
| 436 | Ga0207652_10102288 | 3300025921 | Bacteria | 2532 |
| 437 | Ga0207652_10346605 | 3300025921 | Bacteria | 1341 |
| 438 | Ga0207646_10011093 | 3300025922 | Bacteria | 8748 |
| 439 | Ga0207646_10037481 | 3300025922 | Bacteria | 4371 |
| 440 | Ga0207646_10055712 | 3300025922 | Bacteria | 3534 |
| 441 | Ga0207681_10002902 | 3300025923 | Bacteria | 10837 |
| 442 | Ga0207681_10005270 | 3300025923 | Bacteria | 7942 |
| 443 | Ga0207681_10036611 | 3300025923 | Bacteria | 3239 |
| 444 | Ga0207681_10320463 | 3300025923 | Bacteria | 1232 |
| 445 | Ga0207694_10049897 | 3300025924 | Bacteria | 3240 |
| 446 | Ga0207694_10547227 | 3300025924 | Bacteria | 971 |
| 447 | Ga0207650_10005494 | 3300025925 | Bacteria | 8651 |
| 448 | Ga0207650_10024820 | 3300025925 | Bacteria | 4266 |
| 449 | Ga0207650_11169813 | 3300025925 | Bacteria | 655 |
| 450 | Ga0207659_10001772 | 3300025926 | Bacteria | 12765 |
| 451 | Ga0207659_10060150 | 3300025926 | Bacteria | 2733 |
| 452 | Ga0207659_10152347 | 3300025926 | Bacteria | 1807 |
| 453 | Ga0207687_10022884 | 3300025927 | Bacteria | 4161 |
| 454 | Ga0207687_10266071 | 3300025927 | Bacteria | 1369 |
| 455 | Ga0207687_10356272 | 3300025927 | Unclassified | 1193 |
| 456 | Ga0207700_10014728 | 3300025928 | Bacteria | 5133 |
| 457 | Ga0207700_10034412 | 3300025928 | Bacteria | 3637 |
| 458 | Ga0207700_10177709 | 3300025928 | Bacteria | 1780 |
| 459 | Ga0207700_10221299 | 3300025928 | Bacteria | 1605 |
| 460 | Ga0207700_10333277 | 3300025928 | Bacteria | 1317 |
| 461 | Ga0207700_10416768 | 3300025928 | Bacteria | 1179 |
| 462 | Ga0207664_10528688 | 3300025929 | Bacteria | 1057 |
| 463 | Ga0207664_11076146 | 3300025929 | Unclassified | 719 |
| 464 | Ga0207644_10088321 | 3300025931 | Bacteria | 2306 |
| 465 | Ga0207644_10249988 | 3300025931 | Bacteria | 1414 |
| 466 | Ga0207644_10364043 | 3300025931 | Bacteria | 1177 |
| 467 | Ga0207706_10018920 | 3300025933 | Bacteria | 6193 |
| 468 | Ga0207706_10082533 | 3300025933 | Bacteria | 2825 |
| 469 | Ga0207706_10083758 | 3300025933 | Bacteria | 2804 |
| 470 | Ga0207706_10245894 | 3300025933 | Unclassified | 1563 |
| 471 | Ga0207706_10335720 | 3300025933 | Bacteria | 1315 |
| 472 | Ga0207706_10573845 | 3300025933 | Bacteria | 970 |
| 473 | Ga0207686_10007851 | 3300025934 | Bacteria | 5752 |
| 474 | Ga0207686_10498455 | 3300025934 | Bacteria | 944 |
| 475 | Ga0207709_10025110 | 3300025935 | Bacteria | 3409 |
| 476 | Ga0207709_10074584 | 3300025935 | Bacteria | 2165 |
| 477 | Ga0207709_10231311 | 3300025935 | Bacteria | 1339 |
| 478 | Ga0207670_10039200 | 3300025936 | Bacteria | 3101 |
| 479 | Ga0207670_10088977 | 3300025936 | Bacteria | 2179 |
| 480 | Ga0207669_10629163 | 3300025937 | Bacteria | 875 |
| 481 | Ga0207704_10008010 | 3300025938 | Bacteria | 5026 |
| 482 | Ga0207704_10174758 | 3300025938 | Unclassified | 1545 |
| 483 | Ga0207665_10000626 | 3300025939 | Bacteria | 23678 |
| 484 | Ga0207665_10084466 | 3300025939 | Bacteria | 2191 |
| 485 | Ga0207691_10052371 | 3300025940 | Bacteria | 3728 |
| 486 | Ga0207691_10129364 | 3300025940 | Bacteria | 2231 |
| 487 | Ga0207691_10216292 | 3300025940 | Bacteria | 1663 |
| 488 | Ga0207691_10650470 | 3300025940 | Bacteria | 891 |
| 489 | Ga0207691_10749443 | 3300025940 | Bacteria | 822 |
| 490 | Ga0207711_10017308 | 3300025941 | Bacteria | 5989 |
| 491 | Ga0207711_10149630 | 3300025941 | Unclassified | 2106 |
| 492 | Ga0207711_10816202 | 3300025941 | Unclassified | 868 |
| 493 | Ga0207711_10899476 | 3300025941 | Bacteria | 823 |
| 494 | Ga0207711_10939045 | 3300025941 | Bacteria | 804 |
| 495 | Ga0207711_11445836 | 3300025941 | Unclassified | 630 |
| 496 | Ga0207689_10118929 | 3300025942 | Bacteria | 2173 |
| 497 | Ga0207689_10296107 | 3300025942 | Bacteria | 1341 |
| 498 | Ga0207689_10719748 | 3300025942 | Unclassified | 842 |
| 499 | Ga0207689_10751458 | 3300025942 | Bacteria | 823 |
| 500 | Ga0207661_10009719 | 3300025944 | Bacteria | 6905 |
| 501 | Ga0207661_10096409 | 3300025944 | Bacteria | 2475 |
| 502 | Ga0207661_10111269 | 3300025944 | Bacteria | 2317 |
| 503 | Ga0207661_10215033 | 3300025944 | Bacteria | 1696 |
| 504 | Ga0207661_11739329 | 3300025944 | Bacteria | 569 |
| 505 | Ga0207679_10085404 | 3300025945 | Unclassified | 2424 |
| 506 | Ga0207679_10267621 | 3300025945 | Bacteria | 1460 |
| 507 | Ga0207679_10957186 | 3300025945 | Bacteria | 784 |
| 508 | Ga0207667_10015602 | 3300025949 | Bacteria | 8618 |
| 509 | Ga0207667_10175771 | 3300025949 | Bacteria | 2200 |
| 510 | Ga0207651_10010667 | 3300025960 | Bacteria | 5104 |
| 511 | Ga0207651_10108689 | 3300025960 | Bacteria | 2076 |
| 512 | Ga0207651_10120737 | 3300025960 | Bacteria | 1987 |
| 513 | Ga0207651_10176693 | 3300025960 | Bacteria | 1689 |
| 514 | Ga0207651_10303233 | 3300025960 | Bacteria | 1329 |
| 515 | Ga0207712_10003929 | 3300025961 | Bacteria | 9393 |
| 516 | Ga0207712_11460866 | 3300025961 | Bacteria | 612 |
| 517 | Ga0207668_10068691 | 3300025972 | Bacteria | 2520 |
| 518 | Ga0207668_11037298 | 3300025972 | Bacteria | 734 |
| 519 | Ga0207640_10063962 | 3300025981 | Bacteria | 2447 |
| 520 | Ga0207658_10622769 | 3300025986 | Bacteria | 971 |
| 521 | Ga0207658_10829681 | 3300025986 | Bacteria | 840 |
| 522 | Ga0207677_10050514 | 3300026023 | Bacteria | 2813 |
| 523 | Ga0207677_10115288 | 3300026023 | Bacteria | 2010 |
| 524 | Ga0207677_10359074 | 3300026023 | Unclassified | 1223 |
| 525 | Ga0207677_11349562 | 3300026023 | Bacteria | 656 |
| 526 | Ga0207703_10007003 | 3300026035 | Bacteria | 8971 |
| 527 | Ga0207639_10038425 | 3300026041 | Bacteria | 3560 |
| 528 | Ga0207639_10977129 | 3300026041 | Bacteria | 793 |
| 529 | Ga0207639_11092448 | 3300026041 | Unclassified | 748 |
| 530 | Ga0207639_11204216 | 3300026041 | Unclassified | 711 |
| 531 | Ga0207708_10021795 | 3300026075 | Bacteria | 4834 |
| 532 | Ga0207708_10308962 | 3300026075 | Bacteria | 1288 |
| 533 | Ga0207702_10211242 | 3300026078 | Bacteria | 1804 |
| 534 | Ga0207702_10807045 | 3300026078 | Bacteria | 928 |
| 535 | Ga0207641_10179142 | 3300026088 | Bacteria | 1940 |
| 536 | Ga0207641_10188463 | 3300026088 | Bacteria | 1894 |
| 537 | Ga0207641_10904875 | 3300026088 | Bacteria | 876 |
| 538 | Ga0207641_11019404 | 3300026088 | Bacteria | 825 |
| 539 | Ga0207648_10005118 | 3300026089 | Bacteria | 13285 |
| 540 | Ga0207648_10023589 | 3300026089 | Bacteria | 5509 |
| 541 | Ga0207648_10146600 | 3300026089 | Bacteria | 2082 |
| 542 | Ga0207648_10151575 | 3300026089 | Bacteria | 2046 |
| 543 | Ga0207648_11265020 | 3300026089 | Unclassified | 693 |
| 544 | Ga0207676_10074704 | 3300026095 | Bacteria | 2732 |
| 545 | Ga0207676_10090926 | 3300026095 | Bacteria | 2506 |
| 546 | Ga0207676_10341671 | 3300026095 | Bacteria | 1381 |
| 547 | Ga0207676_10392450 | 3300026095 | Bacteria | 1295 |
| 548 | Ga0207676_10416992 | 3300026095 | Bacteria | 1258 |
| 549 | Ga0207674_10019767 | 3300026116 | Bacteria | 7288 |
| 550 | Ga0207674_10044070 | 3300026116 | Bacteria | 4598 |
| 551 | Ga0207674_10591185 | 3300026116 | Bacteria | 1072 |
| 552 | Ga0207675_100005677 | 3300026118 | Bacteria | 11941 |
| 553 | Ga0207675_100008364 | 3300026118 | Bacteria | 9751 |
| 554 | Ga0207675_100580755 | 3300026118 | Bacteria | 1122 |
| 555 | Ga0207675_100625221 | 3300026118 | Unclassified | 1081 |
| 556 | Ga0207675_100892257 | 3300026118 | Unclassified | 905 |
| 557 | Ga0207675_101042357 | 3300026118 | Bacteria | 837 |
| 558 | Ga0207683_10070792 | 3300026121 | Bacteria | 3082 |
| 559 | Ga0207683_10631476 | 3300026121 | Bacteria | 992 |
| 560 | Ga0207698_10105280 | 3300026142 | Bacteria | 2350 |
| 561 | Ga0207698_10174534 | 3300026142 | Bacteria | 1896 |
| 562 | Ga0207428_10000592 | 3300027907 | Bacteria | 42773 |
| 563 | Ga0207428_10003760 | 3300027907 | Bacteria | 14571 |
| 564 | Ga0207428_10023427 | 3300027907 | Bacteria | 5192 |
| 565 | Ga0207428_10028470 | 3300027907 | Bacteria | 4642 |
| 566 | Ga0207428_10072328 | 3300027907 | Bacteria | 2707 |
| 567 | Ga0268266_10205547 | 3300028379 | Bacteria | 1804 |
| 568 | Ga0268266_10209645 | 3300028379 | Bacteria | 1786 |
| 569 | Ga0268265_10000485 | 3300028380 | Bacteria | 41537 |
| 570 | Ga0268265_10065702 | 3300028380 | Bacteria | 2801 |
| 571 | Ga0268265_10577665 | 3300028380 | Unclassified | 1071 |
| 572 | Ga0268265_10792415 | 3300028380 | Bacteria | 923 |
| 573 | Ga0268265_10911425 | 3300028380 | Bacteria | 864 |
| 574 | Ga0268264_10014737 | 3300028381 | Bacteria | 6423 |
| 575 | Ga0268264_10135905 | 3300028381 | Bacteria | 2186 |
| 576 | Ga0268264_10329927 | 3300028381 | Bacteria | 1445 |
| 577 | Ga0268264_10483655 | 3300028381 | Bacteria | 1205 |
| 578 | Ga0268264_10618231 | 3300028381 | Bacteria | 1069 |
| 579 | Ga0268264_11639279 | 3300028381 | Bacteria | 654 |
| 580 | Ga0265336_10026712 | 3300028666 | Bacteria | 1813 |
| 581 | Ga0265338_10218335 | 3300028800 | Bacteria | 1426 |
| 582 | Ga0265760_10012496 | 3300031090 | Bacteria | 2428 |
| 583 | Ga0265320_10111172 | 3300031240 | Bacteria | 1255 |
| 584 | Ga0307408_100064860 | 3300031548 | Bacteria | 2677 |
| 585 | Ga0307408_101186574 | 3300031548 | Bacteria | 711 |
| 586 | Ga0307413_10012320 | 3300031824 | Bacteria | 4252 |
| 587 | Ga0307410_10019421 | 3300031852 | Bacteria | 4134 |
| 588 | Ga0307410_10111737 | 3300031852 | Bacteria | 1978 |
| 589 | Ga0307410_10479250 | 3300031852 | Bacteria | 1020 |
| 590 | Ga0307410_10804391 | 3300031852 | Bacteria | 800 |
| 591 | Ga0307410_10986862 | 3300031852 | Bacteria | 726 |
| 592 | Ga0307406_10255865 | 3300031901 | Bacteria | 1322 |
| 593 | Ga0307407_10009690 | 3300031903 | Bacteria | 4500 |
| 594 | Ga0307409_100021343 | 3300031995 | Bacteria | 4438 |
| 595 | Ga0307409_100078951 | 3300031995 | Bacteria | 2650 |
| 596 | Ga0307409_101876234 | 3300031995 | Bacteria | 629 |
| 597 | Ga0307416_100008751 | 3300032002 | Bacteria | 6559 |
| 598 | Ga0307416_100185490 | 3300032002 | Bacteria | 1955 |
| 599 | Ga0307416_100486321 | 3300032002 | Bacteria | 1295 |
| 600 | Ga0307414_10275647 | 3300032004 | Bacteria | 1411 |
| 601 | Ga0307411_10037452 | 3300032005 | Bacteria | 3050 |
| 602 | Ga0307411_10172656 | 3300032005 | Bacteria | 1632 |
| 603 | Ga0307415_100011854 | 3300032126 | Bacteria | 5013 |
| 604 | Ga0307415_100185628 | 3300032126 | Bacteria | 1636 |
| 605 | Ga0307507_10051799 | 3300033179 | Bacteria | 3945 |
| 606 | Ga0373948_0000724 | 3300034817 | Bacteria | 4300 |
| 607 | Ga0373950_0003632 | 3300034818 | Bacteria | 2219 |
| 608 | Ga0373958_0026305 | 3300034819 | Unclassified | 1113 |
| 609 | Ga0373958_0073464 | 3300034819 | Bacteria | 763 |
| 610 | Ga0373959_0005256 | 3300034820 | Bacteria | 2119 |
| 611 | Ga0373938_0035439 | 3300034957 | Unclassified | 1088 |
| 612 | Ga0373926_0028655 | 3300035083 | Bacteria | 1955 |
| 613 | Ga0373926_0178215 | 3300035083 | Bacteria | 814 |
| 614 | Ga0373928_0000662 | 3300035084 | Bacteria | 6779 |
| 615 | Ga0373929_0003363 | 3300035085 | Bacteria | 2886 |
| 616 | Ga0373934_0027268 | 3300035086 | Bacteria | 2219 |
| 617 | Ga0373934_0042570 | 3300035086 | Bacteria | 1794 |
| 618 | Ga0373940_0050848 | 3300035088 | Unclassified | 1164 |
| 619 | Ga0373940_0094211 | 3300035088 | Bacteria | 901 |
| 620 | Ga0373940_0218115 | 3300035088 | Bacteria | 633 |
| 621 | Ga0373944_0276315 | 3300035089 | Bacteria | 625 |
| 622 | Ga0373949_0001792 | 3300035090 | Bacteria | 5886 |
| 623 | Ga0373949_0008199 | 3300035090 | Bacteria | 2289 |
| 624 | Ga0373951_0009750 | 3300035091 | Bacteria | 2159 |
| 625 | Ga0373952_0000417 | 3300035092 | Bacteria | 7342 |
| 626 | Ga0373952_0042898 | 3300035092 | Bacteria | 1052 |
| 627 | Ga0373923_0022324 | 3300035111 | Bacteria | 2481 |
| 628 | Ga0373923_0047672 | 3300035111 | Bacteria | 1787 |
| 629 | Ga0373923_0158116 | 3300035111 | Bacteria | 1033 |
| 630 | Ga0373923_0266204 | 3300035111 | Bacteria | 805 |
| 631 | Ga0373932_0002200 | 3300035112 | Bacteria | 5030 |
| 632 | Ga0373936_0030441 | 3300035113 | Bacteria | 2128 |
| 633 | Ga0373936_0056302 | 3300035113 | Bacteria | 1598 |
| 634 | Ga0373936_0105594 | 3300035113 | Bacteria | 1192 |
| 635 | Ga0373936_0186355 | 3300035113 | Unclassified | 912 |
| 636 | Ga0373939_0000394 | 3300035114 | Bacteria | 11029 |
| 637 | Ga0373939_0030314 | 3300035114 | Bacteria | 1555 |
| 638 | Ga0373939_0204986 | 3300035114 | Bacteria | 748 |
| 639 | Ga0373941_0003864 | 3300035115 | Bacteria | 3431 |
| 640 | Ga0373941_0059681 | 3300035115 | Bacteria | 1238 |
| 641 | Ga0373945_0009552 | 3300035116 | Bacteria | 3180 |
| 642 | Ga0373956_0116751 | 3300035119 | Bacteria | 1245 |
| 643 | Ga0373956_0434182 | 3300035119 | Bacteria | 627 |
| 644 | Ga0373957_0038393 | 3300035120 | Bacteria | 1793 |
| 645 | Ga0373957_0094351 | 3300035120 | Bacteria | 1192 |
| 646 | Ga0373957_0278113 | 3300035120 | Bacteria | 707 |
| 647 | Ga0373960_0000197 | 3300035121 | Bacteria | 10990 |
| 648 | Ga0373943_0007046 | 3300035170 | Bacteria | 5044 |
| 649 | Ga0373943_0047983 | 3300035170 | Bacteria | 2090 |
| 650 | Ga0373946_0004137 | 3300035171 | Bacteria | 5167 |
| 651 | Ga0373946_0013092 | 3300035171 | Bacteria | 3112 |
| 652 | Ga0373946_0107666 | 3300035171 | Bacteria | 1258 |
| 653 | Ga0373955_0064576 | 3300035172 | Bacteria | 2030 |
| 654 | Ga0373955_0128687 | 3300035172 | Bacteria | 1477 |
| 655 | Ga0373955_0173817 | 3300035172 | Bacteria | 1276 |
| 656 | Ga0373955_0304219 | 3300035172 | Unclassified | 962 |
| 657 | Ga0373955_0396382 | 3300035172 | Bacteria | 838 |
| 658 | Ga0373942_0055043 | 3300035207 | Unclassified | 1125 |
| 659 | Ga0373961_0001941 | 3300035241 | Bacteria | 5604 |
| 660 | Ga0373962_0266447 | 3300035242 | Unclassified | 599 |
| 661 | Ga0373924_0000041 | 3300035410 | Bacteria | 33035 |
| 662 | Ga0373924_0011752 | 3300035410 | Bacteria | 3257 |
| 663 | Ga0373924_0036807 | 3300035410 | Bacteria | 1990 |
| 664 | Ga0373924_0063026 | 3300035410 | Bacteria | 1554 |
| 665 | Ga0373931_0000978 | 3300035691 | Bacteria | 12094 |
| 666 | Ga0373931_0125985 | 3300035691 | Bacteria | 1469 |
| 667 | Ga0373935_0040333 | 3300035692 | Unclassified | 2930 |
| 668 | Ga0373935_0068402 | 3300035692 | Bacteria | 2285 |
| 669 | Ga0373935_0089341 | 3300035692 | Bacteria | 2014 |
| 670 | Ga0373935_0153931 | 3300035692 | Bacteria | 1562 |
| 671 | Ga0373935_0359397 | 3300035692 | Bacteria | 1039 |
| 672 | Ga0373935_0448184 | 3300035692 | Bacteria | 932 |
| 673 | Ga0373935_0575852 | 3300035692 | Bacteria | 822 |
| 674 | Ga0373927_0013234 | 3300035695 | Bacteria | 5485 |
| 675 | Ga0373927_0170508 | 3300035695 | Unclassified | 1426 |
| 676 | Ga0373927_0218911 | 3300035695 | Bacteria | 1251 |
| 677 | Ga0373927_0248601 | 3300035695 | Bacteria | 1169 |
| 678 | Ga0373933_0158261 | 3300035724 | Bacteria | 1438 |
| 679 | Ga0373947_0061841 | 3300035725 | Bacteria | 2276 |
| 680 | Ga0373947_0077498 | 3300035725 | Unclassified | 2050 |
| 681 | Ga0373947_0158447 | 3300035725 | Bacteria | 1462 |
| 682 | Ga0373947_0429958 | 3300035725 | Bacteria | 893 |
| 683 | Ga0373937_0000225 | 3300036401 | Bacteria | 54909 |
| 684 | Ga0373937_0007134 | 3300036401 | Bacteria | 9656 |
| 685 | Ga0373937_0039250 | 3300036401 | Bacteria | 4315 |
| 686 | Ga0373937_0080180 | 3300036401 | Bacteria | 3018 |
| 687 | Ga0373937_0172127 | 3300036401 | Bacteria | 2032 |
| 688 | Ga0373937_0565703 | 3300036401 | Bacteria | 1080 |
| 689 | Ga0373937_0873030 | 3300036401 | Bacteria | 848 |
| 690 | Ga0373937_1053935 | 3300036401 | Bacteria | 762 |
| 691 | Ga0373925_0116779 | 3300037068 | Bacteria | 2067 |
| 692 | Ga0373925_0131189 | 3300037068 | Bacteria | 1954 |
| 693 | Ga0373925_0136692 | 3300037068 | Bacteria | 1915 |
| 694 | Ga0373925_0137218 | 3300037068 | Bacteria | 1912 |
| 695 | Ga0373925_0137595 | 3300037068 | Bacteria | 1909 |
| 696 | Ga0373925_0217947 | 3300037068 | Bacteria | 1522 |
| 697 | Ga0373925_0352874 | 3300037068 | Bacteria | 1194 |
| 698 | Ga0436363_0585404 | 3300039450 | Bacteria | 898 |
| 699 | Ga0451804_0801631 | 3300041463 | Bacteria | 932 |
| 700 | Ga0451853_2201637 | 3300041512 | Bacteria | 662 |
| 701 | Ga0450894_036407 | 3300042131 | Bacteria | 698 |
| 702 | Ga0439434_0071865 | 3300042435 | Bacteria | 1090 |
| 703 | Ga0439440_0046891 | 3300042993 | Bacteria | 1069 |
| 704 | Ga0466965_0100620 | 3300044683 | Bacteria | 1478 |
| 705 | Ga0466965_0185679 | 3300044683 | Bacteria | 1098 |
| 706 | Ga0466966_0288715 | 3300044684 | Bacteria | 986 |
| 707 | Ga0466963_0018760 | 3300044694 | Bacteria | 4330 |
| 708 | Ga0466963_0072065 | 3300044694 | Bacteria | 2326 |
| 709 | Ga0466963_0255292 | 3300044694 | Bacteria | 1230 |
| 710 | Ga0466964_0152633 | 3300044706 | Bacteria | 1072 |
| 711 | Ga0466971_0217146 | 3300044719 | Bacteria | 905 |
| 712 | Ga0466971_0327091 | 3300044719 | Bacteria | 739 |
| 713 | Ga0466957_0001629 | 3300044842 | Bacteria | 11776 |
| 714 | Ga0466957_0040962 | 3300044842 | Bacteria | 2800 |
| 715 | Ga0466960_0080692 | 3300044901 | Bacteria | 1639 |
| 716 | Ga0466959_0588410 | 3300045049 | Unclassified | 749 |
| 717 | Ga0451576_0009698 | 3300045051 | Bacteria | 11138 |
| 718 | Ga0451576_0025141 | 3300045051 | Bacteria | 6420 |
| 719 | Ga0451576_0076152 | 3300045051 | Bacteria | 3492 |
| 720 | Ga0451576_0161658 | 3300045051 | Bacteria | 2337 |
| 721 | Ga0451576_0224161 | 3300045051 | Bacteria | 1963 |
| 722 | Ga0451576_0748290 | 3300045051 | Bacteria | 1027 |
| 723 | Ga0451576_0843756 | 3300045051 | Unclassified | 962 |
| 724 | Ga0466958_0175530 | 3300045836 | Bacteria | 1358 |
| 725 | Ga0466958_0176816 | 3300045836 | Bacteria | 1353 |
| 726 | Ga0466967_0004769 | 3300045976 | Bacteria | 9234 |
| 727 | Ga0466967_0227640 | 3300045976 | Bacteria | 1774 |
| 728 | Ga0495592_0017680 | 3300046454 | Bacteria | 5418 |
| 729 | Ga0495592_0021436 | 3300046454 | Bacteria | 4914 |
| 730 | Ga0495592_0084794 | 3300046454 | Bacteria | 2285 |
| 731 | Ga0495592_0444128 | 3300046454 | Bacteria | 814 |
| 732 | Ga0495603_0032738 | 3300046455 | Bacteria | 3127 |
| 733 | Ga0495603_0071185 | 3300046455 | Bacteria | 2044 |
| 734 | Ga0495629_0088814 | 3300046459 | Bacteria | 2156 |
| 735 | Ga0495641_0330210 | 3300046461 | Bacteria | 688 |
| 736 | Ga0495651_0000793 | 3300046462 | Bacteria | 24515 |
| 737 | Ga0495651_0071311 | 3300046462 | Unclassified | 2641 |
| 738 | Ga0495651_0138202 | 3300046462 | Bacteria | 1770 |
| 739 | Ga0495651_0187782 | 3300046462 | Bacteria | 1457 |
| 740 | Ga0495653_0005283 | 3300046463 | Bacteria | 10507 |
| 741 | Ga0495653_0020914 | 3300046463 | Bacteria | 5301 |
| 742 | Ga0495580_0061699 | 3300046472 | Unclassified | 2631 |
| 743 | Ga0495580_0097457 | 3300046472 | Bacteria | 2045 |
| 744 | Ga0495580_0159876 | 3300046472 | Bacteria | 1559 |
| 745 | Ga0495580_0353544 | 3300046472 | Bacteria | 995 |
| 746 | Ga0495639_0025762 | 3300046475 | Bacteria | 2595 |
| 747 | Ga0495639_0290905 | 3300046475 | Bacteria | 813 |
| 748 | Ga0495639_0357297 | 3300046475 | Bacteria | 734 |
| 749 | Ga0495639_0393636 | 3300046475 | Bacteria | 699 |
| 750 | Ga0495662_0089095 | 3300046476 | Bacteria | 1503 |
| 751 | Ga0495664_0009759 | 3300046477 | Bacteria | 5380 |
| 752 | Ga0495664_0018376 | 3300046477 | Bacteria | 4004 |
| 753 | Ga0495664_0061549 | 3300046477 | Unclassified | 2235 |
| 754 | Ga0495664_0131016 | 3300046477 | Bacteria | 1518 |
| 755 | Ga0495584_0064230 | 3300046491 | Unclassified | 1845 |
| 756 | Ga0495584_0242924 | 3300046491 | Bacteria | 916 |
| 757 | Ga0495594_0015489 | 3300046499 | Bacteria | 4006 |
| 758 | Ga0495594_0051213 | 3300046499 | Bacteria | 2272 |
| 759 | Ga0495608_0007214 | 3300046511 | Bacteria | 7863 |
| 760 | Ga0495608_0027317 | 3300046511 | Bacteria | 3883 |
| 761 | Ga0495618_0011523 | 3300046514 | Bacteria | 5364 |
| 762 | Ga0495618_0013469 | 3300046514 | Bacteria | 4974 |
| 763 | Ga0495628_0000589 | 3300046516 | Bacteria | 33428 |
| 764 | Ga0495628_0009875 | 3300046516 | Bacteria | 8128 |
| 765 | Ga0495628_0016860 | 3300046516 | Bacteria | 6088 |
| 766 | Ga0495628_0202433 | 3300046516 | Bacteria | 1495 |
| 767 | Ga0495628_0611960 | 3300046516 | Bacteria | 777 |
| 768 | Ga0495630_0135724 | 3300046517 | Bacteria | 1869 |
| 769 | Ga0495630_0409126 | 3300046517 | Bacteria | 1039 |
| 770 | Ga0495630_0497332 | 3300046517 | Bacteria | 935 |
| 771 | Ga0495630_0889861 | 3300046517 | Bacteria | 678 |
| 772 | Ga0495643_0021593 | 3300046522 | Bacteria | 3691 |
| 773 | Ga0495663_0040409 | 3300046525 | Bacteria | 1416 |
| 774 | Ga0495663_0219331 | 3300046525 | Bacteria | 668 |
| 775 | Ga0495663_0227689 | 3300046525 | Bacteria | 657 |
| 776 | Ga0495666_0025290 | 3300046526 | Unclassified | 2932 |
| 777 | Ga0495666_0049957 | 3300046526 | Bacteria | 2011 |
| 778 | Ga0495642_0092654 | 3300046528 | Bacteria | 1280 |
| 779 | Ga0495652_0022761 | 3300046529 | Bacteria | 5560 |
| 780 | Ga0495652_0162009 | 3300046529 | Bacteria | 1735 |
| 781 | Ga0495652_0603033 | 3300046529 | Bacteria | 749 |
| 782 | Ga0495652_0855663 | 3300046529 | Bacteria | 602 |
| 783 | Ga0495665_0002320 | 3300046531 | Bacteria | 10280 |
| 784 | Ga0495640_0159480 | 3300046533 | Bacteria | 1446 |
| 785 | Ga0495586_0004213 | 3300046535 | Bacteria | 7703 |
| 786 | Ga0495586_0184352 | 3300046535 | Bacteria | 1181 |
| 787 | Ga0495587_0000591 | 3300046536 | Bacteria | 24874 |
| 788 | Ga0495587_0042909 | 3300046536 | Bacteria | 2695 |
| 789 | Ga0495587_0059774 | 3300046536 | Unclassified | 2236 |
| 790 | Ga0495598_0027076 | 3300046537 | Bacteria | 1578 |
| 791 | Ga0495598_0044648 | 3300046537 | Bacteria | 1310 |
| 792 | Ga0495598_0063592 | 3300046537 | Bacteria | 1145 |
| 793 | Ga0495598_0067860 | 3300046537 | Bacteria | 1116 |
| 794 | Ga0495598_0078498 | 3300046537 | Bacteria | 1054 |
| 795 | Ga0495609_0131346 | 3300046538 | Bacteria | 1072 |
| 796 | Ga0495621_0002713 | 3300046539 | Bacteria | 4799 |
| 797 | Ga0495621_0004604 | 3300046539 | Bacteria | 3896 |
| 798 | Ga0495621_0104714 | 3300046539 | Unclassified | 1080 |
| 799 | Ga0495645_0003622 | 3300046543 | Bacteria | 10486 |
| 800 | Ga0495645_0008699 | 3300046543 | Bacteria | 7089 |
| 801 | Ga0495645_0027947 | 3300046543 | Bacteria | 4097 |
| 802 | Ga0495645_0054607 | 3300046543 | Bacteria | 2902 |
| 803 | Ga0495645_0473144 | 3300046543 | Bacteria | 787 |
| 804 | Ga0495633_0281219 | 3300046558 | Bacteria | 757 |
| 805 | Ga0495667_0006598 | 3300046559 | Bacteria | 7878 |
| 806 | Ga0495667_0011701 | 3300046559 | Bacteria | 5941 |
| 807 | Ga0495667_0188617 | 3300046559 | Bacteria | 1322 |
| 808 | Ga0495656_0571089 | 3300046615 | Unclassified | 604 |
| 809 | Ga0495634_0008578 | 3300046642 | Bacteria | 7589 |
| 810 | Ga0495634_0037869 | 3300046642 | Bacteria | 3293 |
| 811 | Ga0495634_0068214 | 3300046642 | Bacteria | 2350 |
| 812 | Ga0495634_0194521 | 3300046642 | Bacteria | 1263 |
| 813 | Ga0495611_0373619 | 3300046648 | Unclassified | 653 |
| 814 | Ga0495635_0328675 | 3300046663 | Bacteria | 1022 |
| 815 | Ga0495659_0004711 | 3300046664 | Bacteria | 4293 |
| 816 | Ga0495659_0032273 | 3300046664 | Bacteria | 1832 |
| 817 | Ga0495659_0051084 | 3300046664 | Bacteria | 1505 |
| 818 | Ga0495659_0128011 | 3300046664 | Bacteria | 1005 |
| 819 | Ga0495659_0170127 | 3300046664 | Bacteria | 883 |
| 820 | Ga0495588_0002399 | 3300046674 | Bacteria | 8011 |
| 821 | Ga0495657_0024342 | 3300046675 | Unclassified | 4314 |
| 822 | Ga0495657_0024569 | 3300046675 | Bacteria | 4290 |
| 823 | Ga0495657_0072447 | 3300046675 | Bacteria | 2247 |
| 824 | Ga0495657_0183160 | 3300046675 | Bacteria | 1284 |
| 825 | Ga0495599_0003547 | 3300046678 | Bacteria | 9137 |
| 826 | Ga0495599_0042389 | 3300046678 | Bacteria | 2856 |
| 827 | Ga0495599_0118390 | 3300046678 | Bacteria | 1647 |
| 828 | Ga0495623_0029854 | 3300046679 | Bacteria | 3508 |
| 829 | Ga0495623_0031919 | 3300046679 | Bacteria | 3386 |
| 830 | Ga0495623_0103436 | 3300046679 | Bacteria | 1733 |
| 831 | Ga0495646_0161395 | 3300046680 | Unclassified | 1240 |
| 832 | Ga0495646_0170695 | 3300046680 | Bacteria | 1199 |
| 833 | Ga0495647_0130578 | 3300046681 | Bacteria | 1064 |
| 834 | Ga0495647_0192779 | 3300046681 | Bacteria | 891 |
| 835 | Ga0495658_0032165 | 3300046683 | Bacteria | 2863 |
| 836 | Ga0495669_0002615 | 3300046684 | Bacteria | 7366 |
| 837 | Ga0495669_0016533 | 3300046684 | Bacteria | 3161 |
| 838 | Ga0495669_0428356 | 3300046684 | Bacteria | 642 |
| 839 | Ga0495669_0504288 | 3300046684 | Bacteria | 588 |
| 840 | Ga0495613_0000156 | 3300046689 | Bacteria | 66824 |
| 841 | Ga0495613_0021516 | 3300046689 | Bacteria | 4806 |
| 842 | Ga0495613_0188182 | 3300046689 | Bacteria | 1460 |
| 843 | Ga0495613_0432559 | 3300046689 | Unclassified | 894 |
| 844 | Ga0495613_0448082 | 3300046689 | Bacteria | 875 |
| 845 | Ga0495624_0016974 | 3300046690 | Bacteria | 4894 |
| 846 | Ga0495624_0068516 | 3300046690 | Bacteria | 2212 |
| 847 | Ga0495624_0179141 | 3300046690 | Bacteria | 1292 |
| 848 | Ga0495600_0002070 | 3300046809 | Bacteria | 11320 |
| 849 | Ga0495581_0050388 | 3300047315 | Bacteria | 2405 |
| 850 | Ga0495581_0215726 | 3300047315 | Bacteria | 1122 |
| 851 | Ga0495604_0000323 | 3300047317 | Bacteria | 42953 |
| 852 | Ga0495604_0118638 | 3300047317 | Unclassified | 1917 |
| 853 | Ga0495636_0011820 | 3300047318 | Bacteria | 3458 |
| 854 | Ga0495636_0119356 | 3300047318 | Bacteria | 1165 |
| 855 | Ga0495636_0139853 | 3300047318 | Bacteria | 1081 |
| 856 | Ga0495674_0010221 | 3300047319 | Bacteria | 8886 |
| 857 | Ga0495674_0067517 | 3300047319 | Bacteria | 3098 |
| 858 | Ga0495674_0098386 | 3300047319 | Bacteria | 2491 |
| 859 | Ga0495672_0463122 | 3300047320 | Bacteria | 569 |
| 860 | Ga0495676_0417748 | 3300047321 | Bacteria | 888 |
| 861 | Ga0495676_0515794 | 3300047321 | Bacteria | 783 |
| 862 | Ga0495680_0010538 | 3300047322 | Bacteria | 8251 |
| 863 | Ga0495680_0030111 | 3300047322 | Bacteria | 4436 |
| 864 | Ga0495675_0000155 | 3300047444 | Bacteria | 48300 |
| 865 | Ga0495675_0060996 | 3300047444 | Bacteria | 2389 |
| 866 | Ga0495675_0191871 | 3300047444 | Bacteria | 1247 |
| 867 | Ga0495675_0294825 | 3300047444 | Bacteria | 964 |
| 868 | Ga0495677_0083043 | 3300047445 | Bacteria | 1202 |
| 869 | Ga0495677_0280225 | 3300047445 | Bacteria | 654 |
| 870 | Ga0495684_0000087 | 3300047471 | Bacteria | 64920 |
| 871 | Ga0495684_0005550 | 3300047471 | Bacteria | 9830 |
| 872 | Ga0495684_0076211 | 3300047471 | Bacteria | 2547 |
| 873 | Ga0495684_0245418 | 3300047471 | Bacteria | 1305 |
| 874 | Ga0495684_0568826 | 3300047471 | Bacteria | 769 |
| 875 | Ga0495593_0036992 | 3300047673 | Unclassified | 2643 |
| 876 | Ga0495602_0062770 | 3300048088 | Unclassified | 3222 |
| 877 | Ga0495602_0207059 | 3300048088 | Bacteria | 1492 |
| 878 | Ga0495602_0305317 | 3300048088 | Bacteria | 1163 |
| 879 | Ga0495614_0031678 | 3300048089 | Bacteria | 2276 |
| 880 | Ga0496100_0048123 | 3300048903 | Bacteria | 2751 |
| 881 | Ga0496101_0001189 | 3300048904 | Bacteria | 15572 |
| 882 | Ga0496102_0012504 | 3300048905 | Bacteria | 7350 |
| 883 | Ga0496102_0107251 | 3300048905 | Bacteria | 2601 |
| 884 | Ga0496102_1303648 | 3300048905 | Bacteria | 645 |
| 885 | Ga0496104_0229309 | 3300048907 | Bacteria | 1769 |
| 886 | Ga0496104_0608405 | 3300048907 | Unclassified | 1003 |
| 887 | Ga0496105_0028973 | 3300048908 | Bacteria | 4530 |
| 888 | Ga0496106_0135530 | 3300048909 | Bacteria | 1934 |
| 889 | Ga0496106_0860708 | 3300048909 | Bacteria | 717 |
| 890 | Ga0496107_0195514 | 3300048910 | Unclassified | 1503 |
| 891 | Ga0496109_0384312 | 3300048912 | Bacteria | 1326 |
| 892 | Ga0496109_0763318 | 3300048912 | Bacteria | 905 |
| 893 | Ga0496110_0011808 | 3300048913 | Bacteria | 7170 |
| 894 | Ga0496111_0009322 | 3300048914 | Bacteria | 6546 |
| 895 | Ga0496112_0047672 | 3300048915 | Bacteria | 4203 |
| 896 | Ga0496112_0184625 | 3300048915 | Bacteria | 2049 |
| 897 | Ga0496112_1179273 | 3300048915 | Bacteria | 683 |
| 898 | Ga0496113_0002200 | 3300048916 | Bacteria | 11247 |
| 899 | Ga0496113_0255507 | 3300048916 | Bacteria | 1399 |
| 900 | Ga0496114_0000423 | 3300048917 | Bacteria | 31229 |
| 901 | Ga0496114_0201737 | 3300048917 | Bacteria | 1742 |
| 902 | Ga0496114_0671444 | 3300048917 | Unclassified | 910 |
| 903 | Ga0496114_0949513 | 3300048917 | Unclassified | 742 |
| 904 | Ga0496114_1132759 | 3300048917 | Bacteria | 668 |
| 905 | Ga0501298_097940 | 3300049521 | Bacteria | 665 |
| 906 | Ga0501036_0136070 | 3300049572 | Bacteria | 2074 |
| 907 | Ga0501040_0220223 | 3300049576 | Bacteria | 1350 |
| 908 | Ga0501041_0787920 | 3300049577 | Bacteria | 609 |
| 909 | Ga0501042_0000065 | 3300049578 | Bacteria | 38092 |
| 910 | Ga0501046_0812071 | 3300049580 | Bacteria | 655 |
| 911 | Ga0501048_0097980 | 3300049582 | Bacteria | 2069 |
| 912 | Ga0501067_0222968 | 3300049583 | Bacteria | 1050 |
| 913 | Ga0501069_0233699 | 3300049585 | Bacteria | 1071 |
| 914 | Ga0501072_0483151 | 3300049588 | Bacteria | 980 |
| 915 | Ga0501075_0315948 | 3300049591 | Bacteria | 1190 |
| 916 | Ga0501075_1111933 | 3300049591 | Bacteria | 600 |
| 917 | Ga0501076_0192654 | 3300049592 | Bacteria | 1664 |
| 918 | Ga0501076_0507548 | 3300049592 | Bacteria | 994 |
| 919 | Ga0501079_0553431 | 3300049741 | Bacteria | 905 |
| 920 | Ga0501081_0070945 | 3300049743 | Bacteria | 2428 |
| 921 | Ga0501045_0076771 | 3300049824 | Bacteria | 2462 |
| 922 | Ga0501045_1131598 | 3300049824 | Bacteria | 572 |
| 923 | nmdc:mga06z11_658198_c1 | 3300050494 | Bacteria | 638 |
| 924 | nmdc:mga05p37_137575_c1 | 3300050507 | Unclassified | 2994 |
| 925 | nmdc:mga05p37_155458_c1 | 3300050507 | Bacteria | 2795 |
| 926 | nmdc:mga05p37_163934_c1 | 3300050507 | Bacteria | 2713 |
| 927 | nmdc:mga05p37_321894_c1 | 3300050507 | Bacteria | 1830 |
| 928 | nmdc:mga05p37_336272_c1 | 3300050507 | Unclassified | 1782 |
| 929 | nmdc:mga05p37_48721_c1 | 3300050507 | Bacteria | 5210 |
| 930 | nmdc:mga05p37_54751_c1 | 3300050507 | Bacteria | 4908 |
| 931 | nmdc:mga05p37_5997_c1 | 3300050507 | Bacteria | 14305 |
| 932 | nmdc:mga05p37_84224_c1 | 3300050507 | Bacteria | 3917 |
| 933 | nmdc:mga05p37_8871_c1 | 3300050507 | Bacteria | 11878 |
| 934 | nmdc:mga09592_1063_c1 | 3300050508 | Bacteria | 21797 |
| 935 | nmdc:mga09592_17640_c1 | 3300050508 | Bacteria | 5850 |
| 936 | nmdc:mga09592_252203_c1 | 3300050508 | Bacteria | 1530 |
| 937 | nmdc:mga09592_363863_c1 | 3300050508 | Bacteria | 1251 |
| 938 | nmdc:mga09592_450245_c1 | 3300050508 | Bacteria | 1111 |
| 939 | nmdc:mga09592_8416_c1 | 3300050508 | Bacteria | 8386 |
| 940 | nmdc:mga0qj67_1322_c1 | 3300050509 | Bacteria | 12051 |
| 941 | nmdc:mga0qj67_143396_c1 | 3300050509 | Bacteria | 1937 |
| 942 | nmdc:mga0qj67_578069_c1 | 3300050509 | Bacteria | 900 |
| 943 | nmdc:mga0qj67_71883_c1 | 3300050509 | Bacteria | 2761 |
| 944 | nmdc:mga06r32_1437932_c1 | 3300050510 | Unclassified | 631 |
| 945 | nmdc:mga06r32_143805_c1 | 3300050510 | Bacteria | 2362 |
| 946 | nmdc:mga06r32_15063_c1 | 3300050510 | Bacteria | 7022 |
| 947 | nmdc:mga06r32_189927_c1 | 3300050510 | Bacteria | 2042 |
| 948 | nmdc:mga06r32_6362_c1 | 3300050510 | Bacteria | 10613 |
| 949 | nmdc:mga08y16_247020_c1 | 3300050511 | Bacteria | 1844 |
| 950 | nmdc:mga08y16_26870_c1 | 3300050511 | Bacteria | 6066 |
| 951 | nmdc:mga08y16_2706_c1 | 3300050511 | Bacteria | 18192 |
| 952 | nmdc:mga08y16_416073_c1 | 3300050511 | Bacteria | 1374 |
| 953 | nmdc:mga08y16_43741_c1 | 3300050511 | Bacteria | 4694 |
| 954 | nmdc:mga08y16_96564_c1 | 3300050511 | Bacteria | 3078 |
| 955 | nmdc:mga0n895_108215_c1 | 3300050512 | Unclassified | 2794 |
| 956 | nmdc:mga0n895_1115874_c1 | 3300050512 | Bacteria | 766 |
| 957 | nmdc:mga0n895_119371_c1 | 3300050512 | Unclassified | 2658 |
| 958 | nmdc:mga0n895_148619_c1 | 3300050512 | Bacteria | 2372 |
| 959 | nmdc:mga0n895_37063_c1 | 3300050512 | Bacteria | 4714 |
| 960 | nmdc:mga0n895_379842_c1 | 3300050512 | Bacteria | 1430 |
| 961 | nmdc:mga0n895_37_c1 | 3300050512 | Bacteria | 77167 |
| 962 | nmdc:mga0n895_38297_c1 | 3300050512 | Bacteria | 4644 |
| 963 | nmdc:mga0n895_47985_c1 | 3300050512 | Bacteria | 4178 |
| 964 | nmdc:mga0n895_574_c1 | 3300050512 | Bacteria | 25246 |
| 965 | nmdc:mga0n895_7430_c1 | 3300050512 | Bacteria | 9402 |
| 966 | nmdc:mga0n895_876126_c1 | 3300050512 | Bacteria | 884 |
| 967 | nmdc:mga0rr50_1039101_c1 | 3300050513 | Bacteria | 698 |
| 968 | nmdc:mga0rr50_1173164_c1 | 3300050513 | Bacteria | 653 |
| 969 | nmdc:mga0rr50_14_c1 | 3300050513 | Bacteria | 196574 |
| 970 | nmdc:mga0rr50_1724_c1 | 3300050513 | Bacteria | 12052 |
| 971 | nmdc:mga0rr50_35177_c1 | 3300050513 | Bacteria | 3595 |
| 972 | nmdc:mga0rr50_37823_c1 | 3300050513 | Bacteria | 3487 |
| 973 | nmdc:mga0rr50_595873_c1 | 3300050513 | Bacteria | 942 |
| 974 | nmdc:mga0rr50_694666_c1 | 3300050513 | Unclassified | 868 |
| 975 | nmdc:mga0rr50_85758_c1 | 3300050513 | Bacteria | 2441 |
| 976 | nmdc:mga0rr50_866586_c1 | 3300050513 | Bacteria | 770 |
| 977 | nmdc:mga08x19_111707_c1 | 3300050514 | Bacteria | 1824 |
| 978 | nmdc:mga08x19_170913_c1 | 3300050514 | Bacteria | 1480 |
| 979 | nmdc:mga08x19_275_c1 | 3300050514 | Bacteria | 38855 |
| 980 | nmdc:mga08x19_803569_c1 | 3300050514 | Bacteria | 668 |
| 981 | nmdc:mga0a205_150611_c1 | 3300050515 | Unclassified | 2226 |
| 982 | nmdc:mga0a205_169318_c1 | 3300050515 | Unclassified | 2080 |
| 983 | nmdc:mga0a205_5377_c1 | 3300050515 | Bacteria | 11544 |
| 984 | nmdc:mga0a205_58744_c1 | 3300050515 | Bacteria | 3715 |
| 985 | nmdc:mga0a205_813_c1 | 3300050515 | Bacteria | 25396 |
| 986 | nmdc:mga0a205_91983_c1 | 3300050515 | Bacteria | 2931 |
| 987 | Ga0495601_0017354 | 3300053077 | Bacteria | 4368 |
| 988 | Ga0495601_0027605 | 3300053077 | Bacteria | 3510 |
| 989 | Ga0495601_0068658 | 3300053077 | Bacteria | 2259 |
| 990 | Ga0495601_0204544 | 3300053077 | Bacteria | 1290 |
| 991 | Ga0495601_0762754 | 3300053077 | Bacteria | 615 |
| 992 | Ga0495612_0022792 | 3300053078 | Bacteria | 2510 |
| 993 | Ga0495619_0005404 | 3300053085 | Bacteria | 8095 |
| 994 | Ga0495619_0015732 | 3300053085 | Bacteria | 4790 |
| 995 | Ga0495619_0040752 | 3300053085 | Bacteria | 3036 |
| 996 | Ga0495619_0206099 | 3300053085 | Bacteria | 1361 |
| 997 | Ga0501082_0262091 | 3300060353 | Bacteria | 1504 |
| 998 | Ga0466962_0017687 | 3300061719 | Bacteria | 3432 |
| 999 | Ga0466962_0144677 | 3300061719 | Bacteria | 1152 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100007200 | Ga0070707_1000072008 | 157 |
| 2 | 3300005468 | Ga0070707_100080166 | Ga0070707_1000801662 | 157 |
| 3 | 3300005518 | Ga0070699_100788126 | Ga0070699_1007881261 | 157 |
| 4 | 3300005544 | Ga0070686_100440496 | Ga0070686_1004404961 | 157 |
| 5 | 3300006173 | Ga0070716_100041278 | Ga0070716_1000412783 | 157 |
| 6 | 3300006871 | Ga0075434_100000026 | Ga0075434_10000002642 | 157 |
| 7 | 3300006871 | Ga0075434_100066668 | Ga0075434_1000666682 | 157 |
| 8 | 3300006914 | Ga0075436_100000600 | Ga0075436_10000060019 | 157 |
| 9 | 3300007076 | Ga0075435_100000017 | Ga0075435_10000001751 | 157 |
| 10 | 3300025922 | Ga0207646_10011093 | Ga0207646_100110937 | 157 |
| 11 | 3300025922 | Ga0207646_10055712 | Ga0207646_100557122 | 157 |
| 12 | 3300025939 | Ga0207665_10084466 | Ga0207665_100844662 | 157 |
| 13 | 3300044901 | Ga0466960_0080692 | Ga0466960_0080692_904_1386 | 157 |
| 14 | 3300048912 | Ga0496109_0763318 | Ga0496109_0763318_351_830 | 157 |
| 15 | 3300050512 | nmdc:mga0n895_37_c1 | nmdc:mga0n895_37_c1_29615_30091 | 157 |
| 16 | 3300050513 | nmdc:mga0rr50_14_c1 | nmdc:mga0rr50_14_c1_97396_97872 | 157 |
| 17 | 3300050514 | nmdc:mga08x19_275_c1 | nmdc:mga08x19_275_c1_18599_19075 | 157 |
| 18 | 3300005293 | Ga0065715_10750698 | Ga0065715_107506982 | 158 |
| 19 | 3300005330 | Ga0070690_100798290 | Ga0070690_1007982902 | 158 |
| 20 | 3300005331 | Ga0070670_101451578 | Ga0070670_1014515781 | 158 |
| 21 | 3300005343 | Ga0070687_100061165 | Ga0070687_1000611651 | 158 |
| 22 | 3300005457 | Ga0070662_100060308 | Ga0070662_1000603082 | 158 |
| 23 | 3300005459 | Ga0068867_101752232 | Ga0068867_1017522321 | 158 |
| 24 | 3300005543 | Ga0070672_101723492 | Ga0070672_1017234921 | 158 |
| 25 | 3300005545 | Ga0070695_100127042 | Ga0070695_1001270422 | 158 |
| 26 | 3300005719 | Ga0068861_100051200 | Ga0068861_1000512003 | 158 |
| 27 | 3300005843 | Ga0068860_100420304 | Ga0068860_1004203042 | 158 |
| 28 | 3300006844 | Ga0075428_100748144 | Ga0075428_1007481442 | 158 |
| 29 | 3300009094 | Ga0111539_10035363 | Ga0111539_100353635 | 158 |
| 30 | 3300009148 | Ga0105243_11184013 | Ga0105243_111840131 | 158 |
| 31 | 3300009177 | Ga0105248_10274840 | Ga0105248_102748402 | 158 |
| 32 | 3300025901 | Ga0207688_10343944 | Ga0207688_103439441 | 158 |
| 33 | 3300025906 | Ga0207699_10655034 | Ga0207699_106550342 | 158 |
| 34 | 3300025918 | Ga0207662_10234207 | Ga0207662_102342072 | 158 |
| 35 | 3300025925 | Ga0207650_11169813 | Ga0207650_111698131 | 158 |
| 36 | 3300025933 | Ga0207706_10083758 | Ga0207706_100837582 | 158 |
| 37 | 3300025949 | Ga0207667_10175771 | Ga0207667_101757712 | 158 |
| 38 | 3300025960 | Ga0207651_10120737 | Ga0207651_101207372 | 158 |
| 39 | 3300026118 | Ga0207675_100580755 | Ga0207675_1005807552 | 158 |
| 40 | 3300027907 | Ga0207428_10028470 | Ga0207428_100284702 | 158 |
| 41 | 3300028381 | Ga0268264_10329927 | Ga0268264_103299272 | 158 |
| 42 | 3300028381 | Ga0268264_10483655 | Ga0268264_104836552 | 158 |
| 43 | 3300035242 | Ga0373962_0266447 | Ga0373962_0266447_82_564 | 158 |
| 44 | 3300035725 | Ga0373947_0429958 | Ga0373947_0429958_76_555 | 158 |
| 45 | 3300044719 | Ga0466971_0327091 | Ga0466971_0327091_155_640 | 158 |
| 46 | 3300046537 | Ga0495598_0067860 | Ga0495598_0067860_138_620 | 158 |
| 47 | 3300050511 | nmdc:mga08y16_26870_c1 | nmdc:mga08y16_26870_c1_1008_1490 | 158 |
| 48 | 3300050514 | nmdc:mga08x19_111707_c1 | nmdc:mga08x19_111707_c1_127_609 | 158 |
| 49 | 3300005329 | Ga0070683_100281589 | Ga0070683_1002815892 | 159 |
| 50 | 3300005458 | Ga0070681_11347782 | Ga0070681_113477822 | 159 |
| 51 | 3300005468 | Ga0070707_100723962 | Ga0070707_1007239622 | 159 |
| 52 | 3300005535 | Ga0070684_100238927 | Ga0070684_1002389272 | 159 |
| 53 | 3300009553 | Ga0105249_12222284 | Ga0105249_122222842 | 159 |
| 54 | 3300025944 | Ga0207661_10215033 | Ga0207661_102150332 | 159 |
| 55 | 3300044683 | Ga0466965_0100620 | Ga0466965_0100620_391_879 | 159 |
| 56 | 3300044683 | Ga0466965_0185679 | Ga0466965_0185679_415_903 | 159 |
| 57 | 3300044694 | Ga0466963_0018760 | Ga0466963_0018760_1992_2480 | 159 |
| 58 | 3300044694 | Ga0466963_0072065 | Ga0466963_0072065_327_815 | 159 |
| 59 | 3300044694 | Ga0466963_0255292 | Ga0466963_0255292_339_848 | 159 |
| 60 | 3300044706 | Ga0466964_0152633 | Ga0466964_0152633_527_1015 | 159 |
| 61 | 3300044719 | Ga0466971_0217146 | Ga0466971_0217146_388_876 | 159 |
| 62 | 3300044842 | Ga0466957_0040962 | Ga0466957_0040962_794_1282 | 159 |
| 63 | 3300045836 | Ga0466958_0175530 | Ga0466958_0175530_627_1115 | 159 |
| 64 | 3300045836 | Ga0466958_0176816 | Ga0466958_0176816_244_732 | 159 |
| 65 | 3300045976 | Ga0466967_0004769 | Ga0466967_0004769_1106_1615 | 159 |
| 66 | 3300045976 | Ga0466967_0227640 | Ga0466967_0227640_882_1370 | 159 |
| 67 | 3300048915 | Ga0496112_0184625 | Ga0496112_0184625_818_1306 | 159 |
| 68 | 3300048917 | Ga0496114_0201737 | Ga0496114_0201737_1130_1615 | 159 |
| 69 | 3300061719 | Ga0466962_0017687 | Ga0466962_0017687_211_699 | 159 |
| 70 | 3300061719 | Ga0466962_0144677 | Ga0466962_0144677_604_1092 | 159 |
| 71 | 3300005343 | Ga0070687_100196382 | Ga0070687_1001963821 | 160 |
| 72 | 3300005343 | Ga0070687_100197999 | Ga0070687_1001979992 | 160 |
| 73 | 3300005353 | Ga0070669_100471062 | Ga0070669_1004710622 | 160 |
| 74 | 3300005364 | Ga0070673_100095316 | Ga0070673_1000953163 | 160 |
| 75 | 3300005438 | Ga0070701_10040427 | Ga0070701_100404272 | 160 |
| 76 | 3300005440 | Ga0070705_100061747 | Ga0070705_1000617473 | 160 |
| 77 | 3300005444 | Ga0070694_100044903 | Ga0070694_1000449033 | 160 |
| 78 | 3300005543 | Ga0070672_101265810 | Ga0070672_1012658101 | 160 |
| 79 | 3300005544 | Ga0070686_100026526 | Ga0070686_1000265263 | 160 |
| 80 | 3300005544 | Ga0070686_100494399 | Ga0070686_1004943992 | 160 |
| 81 | 3300005545 | Ga0070695_100005772 | Ga0070695_1000057724 | 160 |
| 82 | 3300005546 | Ga0070696_100005384 | Ga0070696_1000053846 | 160 |
| 83 | 3300005546 | Ga0070696_100006916 | Ga0070696_1000069163 | 160 |
| 84 | 3300005549 | Ga0070704_100001828 | Ga0070704_1000018284 | 160 |
| 85 | 3300005578 | Ga0068854_100011869 | Ga0068854_1000118695 | 160 |
| 86 | 3300005719 | Ga0068861_100033182 | Ga0068861_1000331823 | 160 |
| 87 | 3300005843 | Ga0068860_101670818 | Ga0068860_1016708181 | 160 |
| 88 | 3300006881 | Ga0068865_100026112 | Ga0068865_1000261122 | 160 |
| 89 | 3300007076 | Ga0075435_100004530 | Ga0075435_1000045303 | 160 |
| 90 | 3300009148 | Ga0105243_10015301 | Ga0105243_100153015 | 160 |
| 91 | 3300009148 | Ga0105243_10355420 | Ga0105243_103554201 | 160 |
| 92 | 3300009174 | Ga0105241_10228887 | Ga0105241_102288872 | 160 |
| 93 | 3300009174 | Ga0105241_10674781 | Ga0105241_106747812 | 160 |
| 94 | 3300009176 | Ga0105242_10400747 | Ga0105242_104007472 | 160 |
| 95 | 3300009177 | Ga0105248_10360827 | Ga0105248_103608272 | 160 |
| 96 | 3300025903 | Ga0207680_10258693 | Ga0207680_102586932 | 160 |
| 97 | 3300025907 | Ga0207645_10006229 | Ga0207645_100062299 | 160 |
| 98 | 3300025911 | Ga0207654_10157655 | Ga0207654_101576552 | 160 |
| 99 | 3300025911 | Ga0207654_10622809 | Ga0207654_106228092 | 160 |
| 100 | 3300025918 | Ga0207662_10144066 | Ga0207662_101440661 | 160 |
| 101 | 3300025923 | Ga0207681_10005270 | Ga0207681_100052706 | 160 |
| 102 | 3300025935 | Ga0207709_10025110 | Ga0207709_100251103 | 160 |
| 103 | 3300025938 | Ga0207704_10008010 | Ga0207704_100080104 | 160 |
| 104 | 3300025940 | Ga0207691_10650470 | Ga0207691_106504701 | 160 |
| 105 | 3300025941 | Ga0207711_11445836 | Ga0207711_114458361 | 160 |
| 106 | 3300025960 | Ga0207651_10108689 | Ga0207651_101086892 | 160 |
| 107 | 3300026118 | Ga0207675_100005677 | Ga0207675_1000056775 | 160 |
| 108 | 3300028381 | Ga0268264_11639279 | Ga0268264_116392791 | 160 |
| 109 | 3300034817 | Ga0373948_0000724 | Ga0373948_0000724_136_624 | 160 |
| 110 | 3300034818 | Ga0373950_0003632 | Ga0373950_0003632_810_1298 | 160 |
| 111 | 3300034819 | Ga0373958_0026305 | Ga0373958_0026305_376_864 | 160 |
| 112 | 3300034820 | Ga0373959_0005256 | Ga0373959_0005256_363_851 | 160 |
| 113 | 3300034957 | Ga0373938_0035439 | Ga0373938_0035439_455_943 | 160 |
| 114 | 3300035084 | Ga0373928_0000662 | Ga0373928_0000662_1335_1823 | 160 |
| 115 | 3300035085 | Ga0373929_0003363 | Ga0373929_0003363_521_1009 | 160 |
| 116 | 3300035088 | Ga0373940_0050848 | Ga0373940_0050848_156_644 | 160 |
| 117 | 3300035090 | Ga0373949_0001792 | Ga0373949_0001792_4939_5427 | 160 |
| 118 | 3300035091 | Ga0373951_0009750 | Ga0373951_0009750_649_1137 | 160 |
| 119 | 3300035092 | Ga0373952_0000417 | Ga0373952_0000417_1358_1846 | 160 |
| 120 | 3300035112 | Ga0373932_0002200 | Ga0373932_0002200_2826_3314 | 160 |
| 121 | 3300035114 | Ga0373939_0000394 | Ga0373939_0000394_9592_10080 | 160 |
| 122 | 3300035115 | Ga0373941_0003864 | Ga0373941_0003864_1224_1712 | 160 |
| 123 | 3300035121 | Ga0373960_0000197 | Ga0373960_0000197_130_618 | 160 |
| 124 | 3300035207 | Ga0373942_0055043 | Ga0373942_0055043_237_725 | 160 |
| 125 | 3300035241 | Ga0373961_0001941 | Ga0373961_0001941_1160_1648 | 160 |
| 126 | 3300035691 | Ga0373931_0000978 | Ga0373931_0000978_654_1142 | 160 |
| 127 | 3300045051 | Ga0451576_0009698 | Ga0451576_0009698_6333_6821 | 160 |
| 128 | 3300045051 | Ga0451576_0843756 | Ga0451576_0843756_351_836 | 160 |
| 129 | 3300046454 | Ga0495592_0444128 | Ga0495592_0444128_48_554 | 160 |
| 130 | 3300046529 | Ga0495652_0603033 | Ga0495652_0603033_99_605 | 160 |
| 131 | 3300048905 | Ga0496102_0107251 | Ga0496102_0107251_1104_1592 | 160 |
| 132 | 3300048909 | Ga0496106_0135530 | Ga0496106_0135530_298_786 | 160 |
| 133 | 3300050512 | nmdc:mga0n895_38297_c1 | nmdc:mga0n895_38297_c1_263_751 | 160 |
| 134 | 3300050513 | nmdc:mga0rr50_1724_c1 | nmdc:mga0rr50_1724_c1_10175_10663 | 160 |
| 135 | 3300050514 | nmdc:mga08x19_170913_c1 | nmdc:mga08x19_170913_c1_588_1076 | 160 |
| 136 | 3300053085 | Ga0495619_0206099 | Ga0495619_0206099_725_1231 | 160 |
| 137 | 3300005458 | Ga0070681_11178390 | Ga0070681_111783901 | 161 |
| 138 | 3300005468 | Ga0070707_100316489 | Ga0070707_1003164892 | 161 |
| 139 | 3300005530 | Ga0070679_101126194 | Ga0070679_1011261942 | 161 |
| 140 | 3300006058 | Ga0075432_10154696 | Ga0075432_101546962 | 161 |
| 141 | 3300006237 | Ga0097621_100003000 | Ga0097621_1000030007 | 161 |
| 142 | 3300006358 | Ga0068871_100005784 | Ga0068871_1000057847 | 161 |
| 143 | 3300006844 | Ga0075428_100603093 | Ga0075428_1006030932 | 161 |
| 144 | 3300006880 | Ga0075429_100046300 | Ga0075429_1000463003 | 161 |
| 145 | 3300009147 | Ga0114129_10091939 | Ga0114129_100919393 | 161 |
| 146 | 3300013307 | Ga0157372_11156966 | Ga0157372_111569662 | 161 |
| 147 | 3300014326 | Ga0157380_10675744 | Ga0157380_106757442 | 161 |
| 148 | 3300014969 | Ga0157376_10022962 | Ga0157376_100229622 | 161 |
| 149 | 3300025912 | Ga0207707_10764527 | Ga0207707_107645272 | 161 |
| 150 | 3300025921 | Ga0207652_10346605 | Ga0207652_103466052 | 161 |
| 151 | 3300026089 | Ga0207648_11265020 | Ga0207648_112650202 | 161 |
| 152 | 3300028666 | Ga0265336_10026712 | Ga0265336_100267122 | 161 |
| 153 | 3300031240 | Ga0265320_10111172 | Ga0265320_101111722 | 161 |
| 154 | 3300033179 | Ga0307507_10051799 | Ga0307507_100517993 | 161 |
| 155 | 3300035114 | Ga0373939_0204986 | Ga0373939_0204986_211_702 | 161 |
| 156 | 3300035692 | Ga0373935_0575852 | Ga0373935_0575852_172_663 | 161 |
| 157 | 3300046475 | Ga0495639_0025762 | Ga0495639_0025762_944_1435 | 161 |
| 158 | 3300046535 | Ga0495586_0184352 | Ga0495586_0184352_467_958 | 161 |
| 159 | 3300046681 | Ga0495647_0130578 | Ga0495647_0130578_529_1020 | 161 |
| 160 | 3300047315 | Ga0495581_0050388 | Ga0495581_0050388_1740_2231 | 161 |
| 161 | 3300049572 | Ga0501036_0136070 | Ga0501036_0136070_1009_1569 | 161 |
| 162 | 3300049576 | Ga0501040_0220223 | Ga0501040_0220223_751_1311 | 161 |
| 163 | 3300049580 | Ga0501046_0812071 | Ga0501046_0812071_77_637 | 161 |
| 164 | 3300049582 | Ga0501048_0097980 | Ga0501048_0097980_1456_2016 | 161 |
| 165 | 3300049585 | Ga0501069_0233699 | Ga0501069_0233699_263_823 | 161 |
| 166 | 3300049588 | Ga0501072_0483151 | Ga0501072_0483151_32_592 | 161 |
| 167 | 3300049591 | Ga0501075_0315948 | Ga0501075_0315948_432_992 | 161 |
| 168 | 3300049592 | Ga0501076_0192654 | Ga0501076_0192654_882_1442 | 161 |
| 169 | 3300049741 | Ga0501079_0553431 | Ga0501079_0553431_114_674 | 161 |
| 170 | 3300049743 | Ga0501081_0070945 | Ga0501081_0070945_1771_2331 | 161 |
| 171 | 3300049824 | Ga0501045_0076771 | Ga0501045_0076771_755_1315 | 161 |
| 172 | 3300050494 | nmdc:mga06z11_658198_c1 | nmdc:mga06z11_658198_c1_64_558 | 161 |
| 173 | 3300050507 | nmdc:mga05p37_336272_c1 | nmdc:mga05p37_336272_c1_1148_1639 | 161 |
| 174 | 3300050507 | nmdc:mga05p37_54751_c1 | nmdc:mga05p37_54751_c1_1394_1885 | 161 |
| 175 | 3300050508 | nmdc:mga09592_450245_c1 | nmdc:mga09592_450245_c1_557_1048 | 161 |
| 176 | 3300050510 | nmdc:mga06r32_143805_c1 | nmdc:mga06r32_143805_c1_98_589 | 161 |
| 177 | 3300050513 | nmdc:mga0rr50_694666_c1 | nmdc:mga0rr50_694666_c1_10_501 | 161 |
| 178 | 3300050515 | nmdc:mga0a205_169318_c1 | nmdc:mga0a205_169318_c1_102_593 | 161 |
| 179 | 3300060353 | Ga0501082_0262091 | Ga0501082_0262091_313_873 | 161 |
| 180 | 3300005436 | Ga0070713_100008727 | Ga0070713_1000087275 | 162 |
| 181 | 3300005548 | Ga0070665_100673562 | Ga0070665_1006735622 | 162 |
| 182 | 3300005578 | Ga0068854_100763491 | Ga0068854_1007634912 | 162 |
| 183 | 3300006844 | Ga0075428_100734863 | Ga0075428_1007348632 | 162 |
| 184 | 3300006852 | Ga0075433_10131072 | Ga0075433_101310722 | 162 |
| 185 | 3300009147 | Ga0114129_10255212 | Ga0114129_102552122 | 162 |
| 186 | 3300009176 | Ga0105242_10588065 | Ga0105242_105880652 | 162 |
| 187 | 3300009177 | Ga0105248_10011812 | Ga0105248_100118126 | 162 |
| 188 | 3300009177 | Ga0105248_11406967 | Ga0105248_114069671 | 162 |
| 189 | 3300013297 | Ga0157378_10010601 | Ga0157378_100106016 | 162 |
| 190 | 3300014969 | Ga0157376_10553873 | Ga0157376_105538732 | 162 |
| 191 | 3300025928 | Ga0207700_10333277 | Ga0207700_103332772 | 162 |
| 192 | 3300025934 | Ga0207686_10498455 | Ga0207686_104984552 | 162 |
| 193 | 3300025938 | Ga0207704_10174758 | Ga0207704_101747582 | 162 |
| 194 | 3300025941 | Ga0207711_10017308 | Ga0207711_100173082 | 162 |
| 195 | 3300025941 | Ga0207711_10899476 | Ga0207711_108994762 | 162 |
| 196 | 3300025941 | Ga0207711_10939045 | Ga0207711_109390452 | 162 |
| 197 | 3300028379 | Ga0268266_10209645 | Ga0268266_102096451 | 162 |
| 198 | 3300031995 | Ga0307409_101876234 | Ga0307409_1018762341 | 162 |
| 199 | 3300035086 | Ga0373934_0042570 | Ga0373934_0042570_135_650 | 162 |
| 200 | 3300035120 | Ga0373957_0094351 | Ga0373957_0094351_363_878 | 162 |
| 201 | 3300035171 | Ga0373946_0107666 | Ga0373946_0107666_468_983 | 162 |
| 202 | 3300035695 | Ga0373927_0218911 | Ga0373927_0218911_51_566 | 162 |
| 203 | 3300035724 | Ga0373933_0158261 | Ga0373933_0158261_319_834 | 162 |
| 204 | 3300036401 | Ga0373937_0039250 | Ga0373937_0039250_1335_1850 | 162 |
| 205 | 3300036401 | Ga0373937_0873030 | Ga0373937_0873030_276_770 | 162 |
| 206 | 3300037068 | Ga0373925_0137218 | Ga0373925_0137218_599_1114 | 162 |
| 207 | 3300039450 | Ga0436363_0585404 | Ga0436363_0585404_178_672 | 162 |
| 208 | 3300046459 | Ga0495629_0088814 | Ga0495629_0088814_278_793 | 162 |
| 209 | 3300046517 | Ga0495630_0497332 | Ga0495630_0497332_226_741 | 162 |
| 210 | 3300046543 | Ga0495645_0473144 | Ga0495645_0473144_104_619 | 162 |
| 211 | 3300046642 | Ga0495634_0068214 | Ga0495634_0068214_1431_1925 | 162 |
| 212 | 3300046679 | Ga0495623_0031919 | Ga0495623_0031919_526_1041 | 162 |
| 213 | 3300046684 | Ga0495669_0504288 | Ga0495669_0504288_61_555 | 162 |
| 214 | 3300047321 | Ga0495676_0417748 | Ga0495676_0417748_121_615 | 162 |
| 215 | 3300050507 | nmdc:mga05p37_137575_c1 | nmdc:mga05p37_137575_c1_2313_2807 | 162 |
| 216 | 3300050510 | nmdc:mga06r32_1437932_c1 | nmdc:mga06r32_1437932_c1_70_564 | 162 |
| 217 | 3300050514 | nmdc:mga08x19_803569_c1 | nmdc:mga08x19_803569_c1_93_587 | 162 |
| 218 | 3300005335 | Ga0070666_10734973 | Ga0070666_107349731 | 163 |
| 219 | 3300005444 | Ga0070694_100963429 | Ga0070694_1009634292 | 163 |
| 220 | 3300005466 | Ga0070685_10275614 | Ga0070685_102756142 | 163 |
| 221 | 3300005549 | Ga0070704_100310949 | Ga0070704_1003109492 | 163 |
| 222 | 3300005841 | Ga0068863_101385447 | Ga0068863_1013854471 | 163 |
| 223 | 3300005841 | Ga0068863_101673793 | Ga0068863_1016737931 | 163 |
| 224 | 3300006358 | Ga0068871_100073686 | Ga0068871_1000736863 | 163 |
| 225 | 3300006871 | Ga0075434_100719973 | Ga0075434_1007199732 | 163 |
| 226 | 3300006881 | Ga0068865_100640234 | Ga0068865_1006402342 | 163 |
| 227 | 3300006931 | Ga0097620_101220627 | Ga0097620_1012206272 | 163 |
| 228 | 3300009098 | Ga0105245_10334890 | Ga0105245_103348902 | 163 |
| 229 | 3300009148 | Ga0105243_10728622 | Ga0105243_107286222 | 163 |
| 230 | 3300009176 | Ga0105242_10044981 | Ga0105242_100449813 | 163 |
| 231 | 3300009177 | Ga0105248_10428598 | Ga0105248_104285981 | 163 |
| 232 | 3300011119 | Ga0105246_11064717 | Ga0105246_110647172 | 163 |
| 233 | 3300013308 | Ga0157375_10123341 | Ga0157375_101233412 | 163 |
| 234 | 3300014968 | Ga0157379_10722673 | Ga0157379_107226732 | 163 |
| 235 | 3300014969 | Ga0157376_10078321 | Ga0157376_100783213 | 163 |
| 236 | 3300025927 | Ga0207687_10356272 | Ga0207687_103562722 | 163 |
| 237 | 3300025931 | Ga0207644_10364043 | Ga0207644_103640432 | 163 |
| 238 | 3300025941 | Ga0207711_10816202 | Ga0207711_108162022 | 163 |
| 239 | 3300026041 | Ga0207639_11204216 | Ga0207639_112042161 | 163 |
| 240 | 3300026088 | Ga0207641_10904875 | Ga0207641_109048751 | 163 |
| 241 | 3300026118 | Ga0207675_101042357 | Ga0207675_1010423572 | 163 |
| 242 | 3300035111 | Ga0373923_0158116 | Ga0373923_0158116_174_668 | 163 |
| 243 | 3300044684 | Ga0466966_0288715 | Ga0466966_0288715_314_811 | 163 |
| 244 | 3300046477 | Ga0495664_0061549 | Ga0495664_0061549_1712_2206 | 163 |
| 245 | 3300046491 | Ga0495584_0064230 | Ga0495584_0064230_797_1306 | 163 |
| 246 | 3300046525 | Ga0495663_0219331 | Ga0495663_0219331_100_609 | 163 |
| 247 | 3300046537 | Ga0495598_0063592 | Ga0495598_0063592_254_859 | 163 |
| 248 | 3300046543 | Ga0495645_0003622 | Ga0495645_0003622_215_709 | 163 |
| 249 | 3300046642 | Ga0495634_0194521 | Ga0495634_0194521_498_992 | 163 |
| 250 | 3300046648 | Ga0495611_0373619 | Ga0495611_0373619_89_598 | 163 |
| 251 | 3300046675 | Ga0495657_0072447 | Ga0495657_0072447_1013_1507 | 163 |
| 252 | 3300046678 | Ga0495599_0118390 | Ga0495599_0118390_636_1130 | 163 |
| 253 | 3300046689 | Ga0495613_0448082 | Ga0495613_0448082_28_522 | 163 |
| 254 | 3300047471 | Ga0495684_0245418 | Ga0495684_0245418_149_643 | 163 |
| 255 | 3300048907 | Ga0496104_0608405 | Ga0496104_0608405_348_845 | 163 |
| 256 | 3300048917 | Ga0496114_0671444 | Ga0496114_0671444_201_698 | 163 |
| 257 | 3300049592 | Ga0501076_0507548 | Ga0501076_0507548_27_521 | 163 |
| 258 | 3300049824 | Ga0501045_1131598 | Ga0501045_1131598_52_546 | 163 |
| 259 | 3300050512 | nmdc:mga0n895_148619_c1 | nmdc:mga0n895_148619_c1_84_578 | 163 |
| 260 | 3300053077 | Ga0495601_0204544 | Ga0495601_0204544_158_652 | 163 |
| 261 | 3300053085 | Ga0495619_0015732 | Ga0495619_0015732_3516_4010 | 163 |
| 262 | iso_pu_bacteria | 2881644220 | 2881646290 | 163 |
| 263 | 3300005341 | Ga0070691_10659441 | Ga0070691_106594411 | 164 |
| 264 | 3300005444 | Ga0070694_100802873 | Ga0070694_1008028732 | 164 |
| 265 | 3300005536 | Ga0070697_100061942 | Ga0070697_1000619422 | 164 |
| 266 | 3300014326 | Ga0157380_10017015 | Ga0157380_100170155 | 164 |
| 267 | 3300017792 | Ga0163161_10539744 | Ga0163161_105397442 | 164 |
| 268 | 3300025908 | Ga0207643_10198778 | Ga0207643_101987782 | 164 |
| 269 | 3300025935 | Ga0207709_10231311 | Ga0207709_102313112 | 164 |
| 270 | 3300025944 | Ga0207661_10096409 | Ga0207661_100964093 | 164 |
| 271 | 3300026095 | Ga0207676_10392450 | Ga0207676_103924503 | 164 |
| 272 | 3300026142 | Ga0207698_10174534 | Ga0207698_101745343 | 164 |
| 273 | 3300031548 | Ga0307408_100064860 | Ga0307408_1000648603 | 164 |
| 274 | 3300031852 | Ga0307410_10479250 | Ga0307410_104792502 | 164 |
| 275 | 3300031995 | Ga0307409_100078951 | Ga0307409_1000789513 | 164 |
| 276 | 3300032002 | Ga0307416_100486321 | Ga0307416_1004863212 | 164 |
| 277 | 3300032126 | Ga0307415_100185628 | Ga0307415_1001856282 | 164 |
| 278 | 3300035172 | Ga0373955_0173817 | Ga0373955_0173817_558_1058 | 164 |
| 279 | 3300047320 | Ga0495672_0463122 | Ga0495672_0463122_57_557 | 164 |
| 280 | 3300048905 | Ga0496102_1303648 | Ga0496102_1303648_33_533 | 164 |
| 281 | 3300048912 | Ga0496109_0384312 | Ga0496109_0384312_428_928 | 164 |
| 282 | 3300049521 | Ga0501298_097940 | Ga0501298_097940_133_633 | 164 |
| 283 | 3300005290 | Ga0065712_10528120 | Ga0065712_105281201 | 165 |
| 284 | 3300005329 | Ga0070683_100636737 | Ga0070683_1006367372 | 165 |
| 285 | 3300005345 | Ga0070692_10029173 | Ga0070692_100291733 | 165 |
| 286 | 3300005355 | Ga0070671_100690822 | Ga0070671_1006908222 | 165 |
| 287 | 3300005364 | Ga0070673_100791974 | Ga0070673_1007919742 | 165 |
| 288 | 3300005456 | Ga0070678_100644799 | Ga0070678_1006447992 | 165 |
| 289 | 3300005535 | Ga0070684_100488072 | Ga0070684_1004880722 | 165 |
| 290 | 3300005536 | Ga0070697_100352231 | Ga0070697_1003522312 | 165 |
| 291 | 3300005543 | Ga0070672_100385337 | Ga0070672_1003853372 | 165 |
| 292 | 3300005564 | Ga0070664_100091525 | Ga0070664_1000915252 | 165 |
| 293 | 3300006163 | Ga0070715_10216154 | Ga0070715_102161541 | 165 |
| 294 | 3300006871 | Ga0075434_100427078 | Ga0075434_1004270782 | 165 |
| 295 | 3300013308 | Ga0157375_11315551 | Ga0157375_113155511 | 165 |
| 296 | 3300025940 | Ga0207691_10749443 | Ga0207691_107494432 | 165 |
| 297 | 3300025945 | Ga0207679_10957186 | Ga0207679_109571862 | 165 |
| 298 | 3300025960 | Ga0207651_10303233 | Ga0207651_103032332 | 165 |
| 299 | 3300025986 | Ga0207658_10622769 | Ga0207658_106227692 | 165 |
| 300 | 3300026023 | Ga0207677_11349562 | Ga0207677_113495621 | 165 |
| 301 | 3300026041 | Ga0207639_11092448 | Ga0207639_110924482 | 165 |
| 302 | 3300026121 | Ga0207683_10631476 | Ga0207683_106314762 | 165 |
| 303 | 3300037068 | Ga0373925_0131189 | Ga0373925_0131189_685_1200 | 165 |
| 304 | 3300046475 | Ga0495639_0357297 | Ga0495639_0357297_123_626 | 165 |
| 305 | 3300046525 | Ga0495663_0227689 | Ga0495663_0227689_80_613 | 165 |
| 306 | 3300046684 | Ga0495669_0428356 | Ga0495669_0428356_14_547 | 165 |
| 307 | 3300047318 | Ga0495636_0119356 | Ga0495636_0119356_221_754 | 165 |
| 308 | 3300047445 | Ga0495677_0083043 | Ga0495677_0083043_204_737 | 165 |
| 309 | 3300050513 | nmdc:mga0rr50_866586_c1 | nmdc:mga0rr50_866586_c1_121_636 | 165 |
| 310 | 3300005290 | Ga0065712_10122688 | Ga0065712_101226881 | 166 |
| 311 | 3300005293 | Ga0065715_10772688 | Ga0065715_107726881 | 166 |
| 312 | 3300005329 | Ga0070683_101919745 | Ga0070683_1019197451 | 166 |
| 313 | 3300005331 | Ga0070670_100034911 | Ga0070670_1000349114 | 166 |
| 314 | 3300005334 | Ga0068869_100297635 | Ga0068869_1002976352 | 166 |
| 315 | 3300005335 | Ga0070666_10124473 | Ga0070666_101244732 | 166 |
| 316 | 3300005338 | Ga0068868_100229300 | Ga0068868_1002293002 | 166 |
| 317 | 3300005354 | Ga0070675_100397355 | Ga0070675_1003973551 | 166 |
| 318 | 3300005355 | Ga0070671_100141250 | Ga0070671_1001412502 | 166 |
| 319 | 3300005356 | Ga0070674_100817027 | Ga0070674_1008170272 | 166 |
| 320 | 3300005367 | Ga0070667_100316293 | Ga0070667_1003162932 | 166 |
| 321 | 3300005444 | Ga0070694_100298533 | Ga0070694_1002985332 | 166 |
| 322 | 3300005445 | Ga0070708_100988463 | Ga0070708_1009884631 | 166 |
| 323 | 3300005459 | Ga0068867_100056439 | Ga0068867_1000564393 | 166 |
| 324 | 3300005543 | Ga0070672_100931825 | Ga0070672_1009318252 | 166 |
| 325 | 3300005544 | Ga0070686_100163142 | Ga0070686_1001631422 | 166 |
| 326 | 3300005548 | Ga0070665_100080194 | Ga0070665_1000801943 | 166 |
| 327 | 3300005719 | Ga0068861_100844527 | Ga0068861_1008445272 | 166 |
| 328 | 3300006173 | Ga0070716_100605158 | Ga0070716_1006051582 | 166 |
| 329 | 3300006175 | Ga0070712_100154776 | Ga0070712_1001547761 | 166 |
| 330 | 3300006844 | Ga0075428_100001276 | Ga0075428_1000012761 | 166 |
| 331 | 3300006846 | Ga0075430_100514456 | Ga0075430_1005144562 | 166 |
| 332 | 3300006847 | Ga0075431_100059822 | Ga0075431_1000598224 | 166 |
| 333 | 3300006847 | Ga0075431_100137060 | Ga0075431_1001370603 | 166 |
| 334 | 3300006847 | Ga0075431_100518399 | Ga0075431_1005183991 | 166 |
| 335 | 3300006880 | Ga0075429_100012788 | Ga0075429_1000127882 | 166 |
| 336 | 3300009147 | Ga0114129_10102673 | Ga0114129_101026731 | 166 |
| 337 | 3300009176 | Ga0105242_10012262 | Ga0105242_100122625 | 166 |
| 338 | 3300009177 | Ga0105248_10027169 | Ga0105248_1002716910 | 166 |
| 339 | 3300009551 | Ga0105238_10185539 | Ga0105238_101855392 | 166 |
| 340 | 3300013296 | Ga0157374_10322002 | Ga0157374_103220022 | 166 |
| 341 | 3300013297 | Ga0157378_10131292 | Ga0157378_101312924 | 166 |
| 342 | 3300014325 | Ga0163163_10607746 | Ga0163163_106077461 | 166 |
| 343 | 3300014326 | Ga0157380_10239949 | Ga0157380_102399493 | 166 |
| 344 | 3300014969 | Ga0157376_10313027 | Ga0157376_103130272 | 166 |
| 345 | 3300025899 | Ga0207642_10141684 | Ga0207642_101416842 | 166 |
| 346 | 3300025903 | Ga0207680_10128853 | Ga0207680_101288532 | 166 |
| 347 | 3300025903 | Ga0207680_10131982 | Ga0207680_101319821 | 166 |
| 348 | 3300025916 | Ga0207663_10292878 | Ga0207663_102928781 | 166 |
| 349 | 3300025925 | Ga0207650_10024820 | Ga0207650_100248204 | 166 |
| 350 | 3300025933 | Ga0207706_10335720 | Ga0207706_103357202 | 166 |
| 351 | 3300025934 | Ga0207686_10007851 | Ga0207686_100078513 | 166 |
| 352 | 3300025937 | Ga0207669_10629163 | Ga0207669_106291631 | 166 |
| 353 | 3300025941 | Ga0207711_10149630 | Ga0207711_101496302 | 166 |
| 354 | 3300025942 | Ga0207689_10296107 | Ga0207689_102961072 | 166 |
| 355 | 3300025944 | Ga0207661_11739329 | Ga0207661_117393291 | 166 |
| 356 | 3300025986 | Ga0207658_10829681 | Ga0207658_108296812 | 166 |
| 357 | 3300026023 | Ga0207677_10115288 | Ga0207677_101152882 | 166 |
| 358 | 3300026023 | Ga0207677_10359074 | Ga0207677_103590742 | 166 |
| 359 | 3300026089 | Ga0207648_10023589 | Ga0207648_100235894 | 166 |
| 360 | 3300026089 | Ga0207648_10151575 | Ga0207648_101515752 | 166 |
| 361 | 3300026118 | Ga0207675_100892257 | Ga0207675_1008922572 | 166 |
| 362 | 3300028379 | Ga0268266_10205547 | Ga0268266_102055472 | 166 |
| 363 | 3300028380 | Ga0268265_10911425 | Ga0268265_109114251 | 166 |
| 364 | 3300035086 | Ga0373934_0027268 | Ga0373934_0027268_1281_1787 | 166 |
| 365 | 3300035089 | Ga0373944_0276315 | Ga0373944_0276315_29_535 | 166 |
| 366 | 3300035111 | Ga0373923_0022324 | Ga0373923_0022324_920_1426 | 166 |
| 367 | 3300035113 | Ga0373936_0056302 | Ga0373936_0056302_684_1190 | 166 |
| 368 | 3300035113 | Ga0373936_0186355 | Ga0373936_0186355_216_722 | 166 |
| 369 | 3300035170 | Ga0373943_0007046 | Ga0373943_0007046_2379_2885 | 166 |
| 370 | 3300035171 | Ga0373946_0004137 | Ga0373946_0004137_803_1309 | 166 |
| 371 | 3300035172 | Ga0373955_0396382 | Ga0373955_0396382_72_578 | 166 |
| 372 | 3300035410 | Ga0373924_0011752 | Ga0373924_0011752_704_1210 | 166 |
| 373 | 3300035692 | Ga0373935_0068402 | Ga0373935_0068402_747_1253 | 166 |
| 374 | 3300036401 | Ga0373937_0172127 | Ga0373937_0172127_1154_1660 | 166 |
| 375 | 3300037068 | Ga0373925_0116779 | Ga0373925_0116779_409_915 | 166 |
| 376 | 3300041463 | Ga0451804_0801631 | Ga0451804_0801631_43_549 | 166 |
| 377 | 3300041512 | Ga0451853_2201637 | Ga0451853_2201637_21_527 | 166 |
| 378 | 3300045049 | Ga0466959_0588410 | Ga0466959_0588410_150_656 | 166 |
| 379 | 3300046684 | Ga0495669_0002615 | Ga0495669_0002615_3161_3667 | 166 |
| 380 | 3300048903 | Ga0496100_0048123 | Ga0496100_0048123_1927_2433 | 166 |
| 381 | 3300048904 | Ga0496101_0001189 | Ga0496101_0001189_11055_11624 | 166 |
| 382 | 3300048907 | Ga0496104_0229309 | Ga0496104_0229309_154_660 | 166 |
| 383 | 3300048910 | Ga0496107_0195514 | Ga0496107_0195514_849_1418 | 166 |
| 384 | 3300048917 | Ga0496114_0000423 | Ga0496114_0000423_2891_3460 | 166 |
| 385 | 3300048917 | Ga0496114_0949513 | Ga0496114_0949513_26_532 | 166 |
| 386 | 3300049578 | Ga0501042_0000065 | Ga0501042_0000065_14318_14842 | 166 |
| 387 | 3300050507 | nmdc:mga05p37_84224_c1 | nmdc:mga05p37_84224_c1_80_592 | 166 |
| 388 | 3300050508 | nmdc:mga09592_8416_c1 | nmdc:mga09592_8416_c1_5448_5960 | 166 |
| 389 | 3300050509 | nmdc:mga0qj67_578069_c1 | nmdc:mga0qj67_578069_c1_44_556 | 166 |
| 390 | 3300050510 | nmdc:mga06r32_15063_c1 | nmdc:mga06r32_15063_c1_4403_4915 | 166 |
| 391 | 3300050510 | nmdc:mga06r32_189927_c1 | nmdc:mga06r32_189927_c1_536_1042 | 166 |
| 392 | 3300005290 | Ga0065712_10004822 | Ga0065712_100048223 | 167 |
| 393 | 3300005290 | Ga0065712_10097465 | Ga0065712_100974652 | 167 |
| 394 | 3300005293 | Ga0065715_10256818 | Ga0065715_102568182 | 167 |
| 395 | 3300005295 | Ga0065707_10457655 | Ga0065707_104576552 | 167 |
| 396 | 3300005327 | Ga0070658_11561338 | Ga0070658_115613381 | 167 |
| 397 | 3300005329 | Ga0070683_100028567 | Ga0070683_1000285674 | 167 |
| 398 | 3300005329 | Ga0070683_100037387 | Ga0070683_1000373875 | 167 |
| 399 | 3300005330 | Ga0070690_100987079 | Ga0070690_1009870791 | 167 |
| 400 | 3300005331 | Ga0070670_100012431 | Ga0070670_1000124313 | 167 |
| 401 | 3300005333 | Ga0070677_10158599 | Ga0070677_101585992 | 167 |
| 402 | 3300005336 | Ga0070680_100267546 | Ga0070680_1002675461 | 167 |
| 403 | 3300005338 | Ga0068868_100723500 | Ga0068868_1007235002 | 167 |
| 404 | 3300005340 | Ga0070689_100088433 | Ga0070689_1000884331 | 167 |
| 405 | 3300005345 | Ga0070692_10023802 | Ga0070692_100238022 | 167 |
| 406 | 3300005356 | Ga0070674_101294150 | Ga0070674_1012941502 | 167 |
| 407 | 3300005364 | Ga0070673_100509190 | Ga0070673_1005091902 | 167 |
| 408 | 3300005434 | Ga0070709_10176931 | Ga0070709_101769312 | 167 |
| 409 | 3300005434 | Ga0070709_10178635 | Ga0070709_101786352 | 167 |
| 410 | 3300005435 | Ga0070714_100071194 | Ga0070714_1000711942 | 167 |
| 411 | 3300005436 | Ga0070713_100096486 | Ga0070713_1000964862 | 167 |
| 412 | 3300005436 | Ga0070713_100103707 | Ga0070713_1001037072 | 167 |
| 413 | 3300005436 | Ga0070713_100214365 | Ga0070713_1002143652 | 167 |
| 414 | 3300005436 | Ga0070713_101405073 | Ga0070713_1014050732 | 167 |
| 415 | 3300005437 | Ga0070710_10025665 | Ga0070710_100256651 | 167 |
| 416 | 3300005438 | Ga0070701_10393739 | Ga0070701_103937391 | 167 |
| 417 | 3300005439 | Ga0070711_100019524 | Ga0070711_1000195242 | 167 |
| 418 | 3300005439 | Ga0070711_100367297 | Ga0070711_1003672972 | 167 |
| 419 | 3300005440 | Ga0070705_100144025 | Ga0070705_1001440252 | 167 |
| 420 | 3300005444 | Ga0070694_100132349 | Ga0070694_1001323492 | 167 |
| 421 | 3300005458 | Ga0070681_10199585 | Ga0070681_101995852 | 167 |
| 422 | 3300005458 | Ga0070681_10235379 | Ga0070681_102353792 | 167 |
| 423 | 3300005458 | Ga0070681_10497643 | Ga0070681_104976432 | 167 |
| 424 | 3300005458 | Ga0070681_10982140 | Ga0070681_109821402 | 167 |
| 425 | 3300005459 | Ga0068867_100507684 | Ga0068867_1005076842 | 167 |
| 426 | 3300005471 | Ga0070698_100001371 | Ga0070698_1000013718 | 167 |
| 427 | 3300005518 | Ga0070699_100000912 | Ga0070699_10000091215 | 167 |
| 428 | 3300005530 | Ga0070679_101104079 | Ga0070679_1011040791 | 167 |
| 429 | 3300005535 | Ga0070684_100006317 | Ga0070684_1000063179 | 167 |
| 430 | 3300005539 | Ga0068853_100044977 | Ga0068853_1000449772 | 167 |
| 431 | 3300005539 | Ga0068853_100083918 | Ga0068853_1000839182 | 167 |
| 432 | 3300005539 | Ga0068853_100884379 | Ga0068853_1008843792 | 167 |
| 433 | 3300005543 | Ga0070672_100309139 | Ga0070672_1003091392 | 167 |
| 434 | 3300005544 | Ga0070686_100076723 | Ga0070686_1000767231 | 167 |
| 435 | 3300005546 | Ga0070696_100046884 | Ga0070696_1000468842 | 167 |
| 436 | 3300005547 | Ga0070693_100020383 | Ga0070693_1000203833 | 167 |
| 437 | 3300005547 | Ga0070693_100119505 | Ga0070693_1001195052 | 167 |
| 438 | 3300005547 | Ga0070693_100851487 | Ga0070693_1008514871 | 167 |
| 439 | 3300005549 | Ga0070704_100549664 | Ga0070704_1005496642 | 167 |
| 440 | 3300005563 | Ga0068855_100475390 | Ga0068855_1004753902 | 167 |
| 441 | 3300005563 | Ga0068855_100693483 | Ga0068855_1006934832 | 167 |
| 442 | 3300005564 | Ga0070664_100172395 | Ga0070664_1001723953 | 167 |
| 443 | 3300005578 | Ga0068854_100067182 | Ga0068854_1000671822 | 167 |
| 444 | 3300005614 | Ga0068856_100120159 | Ga0068856_1001201593 | 167 |
| 445 | 3300005615 | Ga0070702_100475743 | Ga0070702_1004757431 | 167 |
| 446 | 3300005616 | Ga0068852_100093651 | Ga0068852_1000936512 | 167 |
| 447 | 3300005616 | Ga0068852_101760386 | Ga0068852_1017603861 | 167 |
| 448 | 3300005617 | Ga0068859_100451967 | Ga0068859_1004519672 | 167 |
| 449 | 3300005618 | Ga0068864_100149664 | Ga0068864_1001496642 | 167 |
| 450 | 3300005834 | Ga0068851_10119275 | Ga0068851_101192752 | 167 |
| 451 | 3300005843 | Ga0068860_101388001 | Ga0068860_1013880012 | 167 |
| 452 | 3300005844 | Ga0068862_100344980 | Ga0068862_1003449802 | 167 |
| 453 | 3300005985 | Ga0081539_10081756 | Ga0081539_100817563 | 167 |
| 454 | 3300006028 | Ga0070717_10070235 | Ga0070717_100702353 | 167 |
| 455 | 3300006028 | Ga0070717_10227176 | Ga0070717_102271762 | 167 |
| 456 | 3300006028 | Ga0070717_10634191 | Ga0070717_106341912 | 167 |
| 457 | 3300006163 | Ga0070715_10015083 | Ga0070715_100150832 | 167 |
| 458 | 3300006163 | Ga0070715_10249609 | Ga0070715_102496092 | 167 |
| 459 | 3300006163 | Ga0070715_10528596 | Ga0070715_105285961 | 167 |
| 460 | 3300006175 | Ga0070712_100019700 | Ga0070712_1000197002 | 167 |
| 461 | 3300006175 | Ga0070712_100737142 | Ga0070712_1007371422 | 167 |
| 462 | 3300006358 | Ga0068871_100116449 | Ga0068871_1001164493 | 167 |
| 463 | 3300006846 | Ga0075430_100003017 | Ga0075430_1000030178 | 167 |
| 464 | 3300006847 | Ga0075431_100006823 | Ga0075431_10000682314 | 167 |
| 465 | 3300006847 | Ga0075431_100010900 | Ga0075431_1000109007 | 167 |
| 466 | 3300006871 | Ga0075434_100255507 | Ga0075434_1002555072 | 167 |
| 467 | 3300006880 | Ga0075429_100001340 | Ga0075429_10000134014 | 167 |
| 468 | 3300006914 | Ga0075436_100646460 | Ga0075436_1006464602 | 167 |
| 469 | 3300006931 | Ga0097620_100451924 | Ga0097620_1004519242 | 167 |
| 470 | 3300007076 | Ga0075435_100015367 | Ga0075435_1000153675 | 167 |
| 471 | 3300007788 | Ga0099795_10004644 | Ga0099795_100046444 | 167 |
| 472 | 3300009093 | Ga0105240_10178259 | Ga0105240_101782592 | 167 |
| 473 | 3300009094 | Ga0111539_10023669 | Ga0111539_100236693 | 167 |
| 474 | 3300009098 | Ga0105245_10051163 | Ga0105245_100511634 | 167 |
| 475 | 3300009098 | Ga0105245_10510738 | Ga0105245_105107382 | 167 |
| 476 | 3300009147 | Ga0114129_10021791 | Ga0114129_100217912 | 167 |
| 477 | 3300009147 | Ga0114129_10040478 | Ga0114129_100404788 | 167 |
| 478 | 3300009174 | Ga0105241_10087408 | Ga0105241_100874083 | 167 |
| 479 | 3300009545 | Ga0105237_10265025 | Ga0105237_102650252 | 167 |
| 480 | 3300009545 | Ga0105237_10515783 | Ga0105237_105157832 | 167 |
| 481 | 3300009551 | Ga0105238_10008383 | Ga0105238_100083839 | 167 |
| 482 | 3300009551 | Ga0105238_10040699 | Ga0105238_100406995 | 167 |
| 483 | 3300009551 | Ga0105238_10731453 | Ga0105238_107314532 | 167 |
| 484 | 3300009553 | Ga0105249_10204558 | Ga0105249_102045582 | 167 |
| 485 | 3300010159 | Ga0099796_10005759 | Ga0099796_100057592 | 167 |
| 486 | 3300010375 | Ga0105239_10079529 | Ga0105239_100795292 | 167 |
| 487 | 3300010375 | Ga0105239_10190258 | Ga0105239_101902582 | 167 |
| 488 | 3300010375 | Ga0105239_10345322 | Ga0105239_103453222 | 167 |
| 489 | 3300013105 | Ga0157369_10030006 | Ga0157369_100300062 | 167 |
| 490 | 3300013105 | Ga0157369_10201990 | Ga0157369_102019903 | 167 |
| 491 | 3300013105 | Ga0157369_11639597 | Ga0157369_116395972 | 167 |
| 492 | 3300013296 | Ga0157374_10109340 | Ga0157374_101093402 | 167 |
| 493 | 3300013296 | Ga0157374_10138644 | Ga0157374_101386442 | 167 |
| 494 | 3300013296 | Ga0157374_11532744 | Ga0157374_115327441 | 167 |
| 495 | 3300013297 | Ga0157378_10264794 | Ga0157378_102647942 | 167 |
| 496 | 3300013306 | Ga0163162_10523793 | Ga0163162_105237932 | 167 |
| 497 | 3300013307 | Ga0157372_10386304 | Ga0157372_103863042 | 167 |
| 498 | 3300013308 | Ga0157375_10916427 | Ga0157375_109164272 | 167 |
| 499 | 3300014325 | Ga0163163_10020746 | Ga0163163_100207463 | 167 |
| 500 | 3300014326 | Ga0157380_10096165 | Ga0157380_100961653 | 167 |
| 501 | 3300014326 | Ga0157380_10546512 | Ga0157380_105465122 | 167 |
| 502 | 3300014969 | Ga0157376_10337512 | Ga0157376_103375122 | 167 |
| 503 | 3300022467 | Ga0224712_10277304 | Ga0224712_102773042 | 167 |
| 504 | 3300025321 | Ga0207656_10316035 | Ga0207656_103160351 | 167 |
| 505 | 3300025893 | Ga0207682_10074944 | Ga0207682_100749441 | 167 |
| 506 | 3300025905 | Ga0207685_10162133 | Ga0207685_101621331 | 167 |
| 507 | 3300025906 | Ga0207699_10072542 | Ga0207699_100725421 | 167 |
| 508 | 3300025906 | Ga0207699_10546861 | Ga0207699_105468612 | 167 |
| 509 | 3300025911 | Ga0207654_10046467 | Ga0207654_100464672 | 167 |
| 510 | 3300025912 | Ga0207707_10120830 | Ga0207707_101208302 | 167 |
| 511 | 3300025912 | Ga0207707_10395319 | Ga0207707_103953192 | 167 |
| 512 | 3300025912 | Ga0207707_10526993 | Ga0207707_105269931 | 167 |
| 513 | 3300025912 | Ga0207707_10767414 | Ga0207707_107674142 | 167 |
| 514 | 3300025913 | Ga0207695_10229148 | Ga0207695_102291482 | 167 |
| 515 | 3300025913 | Ga0207695_11125106 | Ga0207695_111251062 | 167 |
| 516 | 3300025915 | Ga0207693_10022733 | Ga0207693_100227335 | 167 |
| 517 | 3300025915 | Ga0207693_10035419 | Ga0207693_100354194 | 167 |
| 518 | 3300025915 | Ga0207693_10142549 | Ga0207693_101425492 | 167 |
| 519 | 3300025916 | Ga0207663_10000828 | Ga0207663_100008289 | 167 |
| 520 | 3300025916 | Ga0207663_10344079 | Ga0207663_103440792 | 167 |
| 521 | 3300025917 | Ga0207660_10179365 | Ga0207660_101793652 | 167 |
| 522 | 3300025918 | Ga0207662_10319344 | Ga0207662_103193441 | 167 |
| 523 | 3300025920 | Ga0207649_10299408 | Ga0207649_102994082 | 167 |
| 524 | 3300025921 | Ga0207652_10102288 | Ga0207652_101022882 | 167 |
| 525 | 3300025924 | Ga0207694_10049897 | Ga0207694_100498972 | 167 |
| 526 | 3300025924 | Ga0207694_10547227 | Ga0207694_105472272 | 167 |
| 527 | 3300025925 | Ga0207650_10005494 | Ga0207650_100054948 | 167 |
| 528 | 3300025927 | Ga0207687_10022884 | Ga0207687_100228842 | 167 |
| 529 | 3300025927 | Ga0207687_10266071 | Ga0207687_102660712 | 167 |
| 530 | 3300025928 | Ga0207700_10014728 | Ga0207700_100147283 | 167 |
| 531 | 3300025928 | Ga0207700_10177709 | Ga0207700_101777093 | 167 |
| 532 | 3300025928 | Ga0207700_10221299 | Ga0207700_102212992 | 167 |
| 533 | 3300025928 | Ga0207700_10416768 | Ga0207700_104167682 | 167 |
| 534 | 3300025929 | Ga0207664_10528688 | Ga0207664_105286882 | 167 |
| 535 | 3300025929 | Ga0207664_11076146 | Ga0207664_110761462 | 167 |
| 536 | 3300025933 | Ga0207706_10573845 | Ga0207706_105738451 | 167 |
| 537 | 3300025939 | Ga0207665_10000626 | Ga0207665_1000062618 | 167 |
| 538 | 3300025944 | Ga0207661_10009719 | Ga0207661_100097195 | 167 |
| 539 | 3300025944 | Ga0207661_10111269 | Ga0207661_101112694 | 167 |
| 540 | 3300025945 | Ga0207679_10267621 | Ga0207679_102676211 | 167 |
| 541 | 3300025949 | Ga0207667_10015602 | Ga0207667_100156022 | 167 |
| 542 | 3300025981 | Ga0207640_10063962 | Ga0207640_100639622 | 167 |
| 543 | 3300026023 | Ga0207677_10050514 | Ga0207677_100505144 | 167 |
| 544 | 3300026041 | Ga0207639_10038425 | Ga0207639_100384252 | 167 |
| 545 | 3300026041 | Ga0207639_10977129 | Ga0207639_109771291 | 167 |
| 546 | 3300026078 | Ga0207702_10211242 | Ga0207702_102112422 | 167 |
| 547 | 3300026078 | Ga0207702_10807045 | Ga0207702_108070452 | 167 |
| 548 | 3300026095 | Ga0207676_10341671 | Ga0207676_103416713 | 167 |
| 549 | 3300026116 | Ga0207674_10591185 | Ga0207674_105911852 | 167 |
| 550 | 3300026142 | Ga0207698_10105280 | Ga0207698_101052803 | 167 |
| 551 | 3300027907 | Ga0207428_10072328 | Ga0207428_100723283 | 167 |
| 552 | 3300028380 | Ga0268265_10065702 | Ga0268265_100657022 | 167 |
| 553 | 3300028380 | Ga0268265_10792415 | Ga0268265_107924152 | 167 |
| 554 | 3300028800 | Ga0265338_10218335 | Ga0265338_102183352 | 167 |
| 555 | 3300031852 | Ga0307410_10804391 | Ga0307410_108043911 | 167 |
| 556 | 3300035083 | Ga0373926_0028655 | Ga0373926_0028655_901_1410 | 167 |
| 557 | 3300035083 | Ga0373926_0178215 | Ga0373926_0178215_290_799 | 167 |
| 558 | 3300035111 | Ga0373923_0047672 | Ga0373923_0047672_366_875 | 167 |
| 559 | 3300035111 | Ga0373923_0266204 | Ga0373923_0266204_201_710 | 167 |
| 560 | 3300035113 | Ga0373936_0030441 | Ga0373936_0030441_480_989 | 167 |
| 561 | 3300035113 | Ga0373936_0105594 | Ga0373936_0105594_565_1074 | 167 |
| 562 | 3300035116 | Ga0373945_0009552 | Ga0373945_0009552_1150_1659 | 167 |
| 563 | 3300035119 | Ga0373956_0116751 | Ga0373956_0116751_386_895 | 167 |
| 564 | 3300035119 | Ga0373956_0434182 | Ga0373956_0434182_19_528 | 167 |
| 565 | 3300035120 | Ga0373957_0038393 | Ga0373957_0038393_1128_1637 | 167 |
| 566 | 3300035120 | Ga0373957_0278113 | Ga0373957_0278113_105_614 | 167 |
| 567 | 3300035170 | Ga0373943_0047983 | Ga0373943_0047983_1047_1556 | 167 |
| 568 | 3300035171 | Ga0373946_0013092 | Ga0373946_0013092_1869_2378 | 167 |
| 569 | 3300035172 | Ga0373955_0064576 | Ga0373955_0064576_975_1484 | 167 |
| 570 | 3300035172 | Ga0373955_0304219 | Ga0373955_0304219_116_625 | 167 |
| 571 | 3300035410 | Ga0373924_0000041 | Ga0373924_0000041_19024_19533 | 167 |
| 572 | 3300035410 | Ga0373924_0036807 | Ga0373924_0036807_646_1155 | 167 |
| 573 | 3300035410 | Ga0373924_0063026 | Ga0373924_0063026_687_1196 | 167 |
| 574 | 3300035692 | Ga0373935_0089341 | Ga0373935_0089341_695_1204 | 167 |
| 575 | 3300035692 | Ga0373935_0153931 | Ga0373935_0153931_592_1101 | 167 |
| 576 | 3300035692 | Ga0373935_0359397 | Ga0373935_0359397_148_657 | 167 |
| 577 | 3300035692 | Ga0373935_0448184 | Ga0373935_0448184_182_691 | 167 |
| 578 | 3300035695 | Ga0373927_0013234 | Ga0373927_0013234_3686_4195 | 167 |
| 579 | 3300035695 | Ga0373927_0170508 | Ga0373927_0170508_901_1410 | 167 |
| 580 | 3300035695 | Ga0373927_0248601 | Ga0373927_0248601_268_777 | 167 |
| 581 | 3300035725 | Ga0373947_0061841 | Ga0373947_0061841_944_1453 | 167 |
| 582 | 3300035725 | Ga0373947_0158447 | Ga0373947_0158447_640_1149 | 167 |
| 583 | 3300036401 | Ga0373937_0000225 | Ga0373937_0000225_17527_18036 | 167 |
| 584 | 3300036401 | Ga0373937_0080180 | Ga0373937_0080180_1640_2149 | 167 |
| 585 | 3300036401 | Ga0373937_1053935 | Ga0373937_1053935_221_730 | 167 |
| 586 | 3300037068 | Ga0373925_0136692 | Ga0373925_0136692_756_1265 | 167 |
| 587 | 3300037068 | Ga0373925_0137595 | Ga0373925_0137595_980_1489 | 167 |
| 588 | 3300037068 | Ga0373925_0217947 | Ga0373925_0217947_440_949 | 167 |
| 589 | 3300037068 | Ga0373925_0352874 | Ga0373925_0352874_232_741 | 167 |
| 590 | 3300042993 | Ga0439440_0046891 | Ga0439440_0046891_161_670 | 167 |
| 591 | 3300044842 | Ga0466957_0001629 | Ga0466957_0001629_6055_6561 | 167 |
| 592 | 3300045051 | Ga0451576_0161658 | Ga0451576_0161658_1215_1718 | 167 |
| 593 | 3300046455 | Ga0495603_0071185 | Ga0495603_0071185_1515_2018 | 167 |
| 594 | 3300046461 | Ga0495641_0330210 | Ga0495641_0330210_50_589 | 167 |
| 595 | 3300046462 | Ga0495651_0138202 | Ga0495651_0138202_296_805 | 167 |
| 596 | 3300046462 | Ga0495651_0187782 | Ga0495651_0187782_781_1290 | 167 |
| 597 | 3300046472 | Ga0495580_0097457 | Ga0495580_0097457_862_1371 | 167 |
| 598 | 3300046472 | Ga0495580_0159876 | Ga0495580_0159876_36_545 | 167 |
| 599 | 3300046472 | Ga0495580_0353544 | Ga0495580_0353544_154_663 | 167 |
| 600 | 3300046475 | Ga0495639_0393636 | Ga0495639_0393636_152_661 | 167 |
| 601 | 3300046476 | Ga0495662_0089095 | Ga0495662_0089095_17_526 | 167 |
| 602 | 3300046477 | Ga0495664_0131016 | Ga0495664_0131016_175_684 | 167 |
| 603 | 3300046499 | Ga0495594_0015489 | Ga0495594_0015489_898_1437 | 167 |
| 604 | 3300046511 | Ga0495608_0027317 | Ga0495608_0027317_657_1166 | 167 |
| 605 | 3300046516 | Ga0495628_0009875 | Ga0495628_0009875_3611_4120 | 167 |
| 606 | 3300046516 | Ga0495628_0202433 | Ga0495628_0202433_397_906 | 167 |
| 607 | 3300046517 | Ga0495630_0135724 | Ga0495630_0135724_875_1384 | 167 |
| 608 | 3300046517 | Ga0495630_0889861 | Ga0495630_0889861_35_544 | 167 |
| 609 | 3300046526 | Ga0495666_0049957 | Ga0495666_0049957_989_1498 | 167 |
| 610 | 3300046529 | Ga0495652_0855663 | Ga0495652_0855663_15_524 | 167 |
| 611 | 3300046536 | Ga0495587_0042909 | Ga0495587_0042909_1394_1903 | 167 |
| 612 | 3300046537 | Ga0495598_0027076 | Ga0495598_0027076_303_806 | 167 |
| 613 | 3300046537 | Ga0495598_0044648 | Ga0495598_0044648_245_754 | 167 |
| 614 | 3300046543 | Ga0495645_0027947 | Ga0495645_0027947_1190_1699 | 167 |
| 615 | 3300046559 | Ga0495667_0011701 | Ga0495667_0011701_2125_2634 | 167 |
| 616 | 3300046559 | Ga0495667_0188617 | Ga0495667_0188617_440_949 | 167 |
| 617 | 3300046615 | Ga0495656_0571089 | Ga0495656_0571089_12_515 | 167 |
| 618 | 3300046642 | Ga0495634_0037869 | Ga0495634_0037869_2166_2675 | 167 |
| 619 | 3300046663 | Ga0495635_0328675 | Ga0495635_0328675_71_580 | 167 |
| 620 | 3300046664 | Ga0495659_0051084 | Ga0495659_0051084_669_1172 | 167 |
| 621 | 3300046675 | Ga0495657_0183160 | Ga0495657_0183160_594_1103 | 167 |
| 622 | 3300046679 | Ga0495623_0029854 | Ga0495623_0029854_318_827 | 167 |
| 623 | 3300046681 | Ga0495647_0192779 | Ga0495647_0192779_369_878 | 167 |
| 624 | 3300046683 | Ga0495658_0032165 | Ga0495658_0032165_965_1504 | 167 |
| 625 | 3300046689 | Ga0495613_0000156 | Ga0495613_0000156_8630_9139 | 167 |
| 626 | 3300046689 | Ga0495613_0432559 | Ga0495613_0432559_192_701 | 167 |
| 627 | 3300046690 | Ga0495624_0068516 | Ga0495624_0068516_1221_1730 | 167 |
| 628 | 3300047315 | Ga0495581_0215726 | Ga0495581_0215726_349_888 | 167 |
| 629 | 3300047318 | Ga0495636_0139853 | Ga0495636_0139853_293_796 | 167 |
| 630 | 3300047319 | Ga0495674_0098386 | Ga0495674_0098386_1489_1998 | 167 |
| 631 | 3300047321 | Ga0495676_0515794 | Ga0495676_0515794_64_603 | 167 |
| 632 | 3300047444 | Ga0495675_0191871 | Ga0495675_0191871_307_816 | 167 |
| 633 | 3300047444 | Ga0495675_0294825 | Ga0495675_0294825_338_847 | 167 |
| 634 | 3300047471 | Ga0495684_0000087 | Ga0495684_0000087_25170_25679 | 167 |
| 635 | 3300047471 | Ga0495684_0568826 | Ga0495684_0568826_113_622 | 167 |
| 636 | 3300048088 | Ga0495602_0207059 | Ga0495602_0207059_807_1316 | 167 |
| 637 | 3300048088 | Ga0495602_0305317 | Ga0495602_0305317_249_758 | 167 |
| 638 | 3300048905 | Ga0496102_0012504 | Ga0496102_0012504_2006_2515 | 167 |
| 639 | 3300048908 | Ga0496105_0028973 | Ga0496105_0028973_616_1125 | 167 |
| 640 | 3300048913 | Ga0496110_0011808 | Ga0496110_0011808_5632_6141 | 167 |
| 641 | 3300048914 | Ga0496111_0009322 | Ga0496111_0009322_4254_4763 | 167 |
| 642 | 3300048915 | Ga0496112_0047672 | Ga0496112_0047672_2345_2854 | 167 |
| 643 | 3300048916 | Ga0496113_0002200 | Ga0496113_0002200_834_1343 | 167 |
| 644 | 3300048916 | Ga0496113_0255507 | Ga0496113_0255507_57_566 | 167 |
| 645 | 3300048917 | Ga0496114_1132759 | Ga0496114_1132759_44_553 | 167 |
| 646 | 3300049591 | Ga0501075_1111933 | Ga0501075_1111933_58_567 | 167 |
| 647 | 3300050507 | nmdc:mga05p37_163934_c1 | nmdc:mga05p37_163934_c1_209_718 | 167 |
| 648 | 3300050507 | nmdc:mga05p37_5997_c1 | nmdc:mga05p37_5997_c1_6937_7440 | 167 |
| 649 | 3300050508 | nmdc:mga09592_1063_c1 | nmdc:mga09592_1063_c1_12570_13079 | 167 |
| 650 | 3300050508 | nmdc:mga09592_363863_c1 | nmdc:mga09592_363863_c1_612_1121 | 167 |
| 651 | 3300050509 | nmdc:mga0qj67_1322_c1 | nmdc:mga0qj67_1322_c1_4373_4882 | 167 |
| 652 | 3300050509 | nmdc:mga0qj67_71883_c1 | nmdc:mga0qj67_71883_c1_180_689 | 167 |
| 653 | 3300050510 | nmdc:mga06r32_6362_c1 | nmdc:mga06r32_6362_c1_816_1325 | 167 |
| 654 | 3300050511 | nmdc:mga08y16_416073_c1 | nmdc:mga08y16_416073_c1_424_933 | 167 |
| 655 | 3300050512 | nmdc:mga0n895_47985_c1 | nmdc:mga0n895_47985_c1_3065_3568 | 167 |
| 656 | 3300050513 | nmdc:mga0rr50_37823_c1 | nmdc:mga0rr50_37823_c1_2687_3190 | 167 |
| 657 | 3300050513 | nmdc:mga0rr50_595873_c1 | nmdc:mga0rr50_595873_c1_209_718 | 167 |
| 658 | 3300050515 | nmdc:mga0a205_91983_c1 | nmdc:mga0a205_91983_c1_2062_2571 | 167 |
| 659 | 3300053077 | Ga0495601_0017354 | Ga0495601_0017354_923_1432 | 167 |
| 660 | 3300053077 | Ga0495601_0027605 | Ga0495601_0027605_1220_1729 | 167 |
| 661 | 3300053077 | Ga0495601_0068658 | Ga0495601_0068658_815_1324 | 167 |
| 662 | 3300053085 | Ga0495619_0005404 | Ga0495619_0005404_3524_4033 | 167 |
| 663 | 3300003203 | JGI25406J46586_10002299 | JGI25406J46586_100022999 | 168 |
| 664 | 3300005344 | Ga0070661_100956963 | Ga0070661_1009569631 | 168 |
| 665 | 3300005353 | Ga0070669_100060029 | Ga0070669_1000600292 | 168 |
| 666 | 3300005354 | Ga0070675_100027446 | Ga0070675_1000274466 | 168 |
| 667 | 3300005366 | Ga0070659_100853036 | Ga0070659_1008530362 | 168 |
| 668 | 3300005434 | Ga0070709_10082442 | Ga0070709_100824422 | 168 |
| 669 | 3300005436 | Ga0070713_100012499 | Ga0070713_1000124996 | 168 |
| 670 | 3300005441 | Ga0070700_101121135 | Ga0070700_1011211351 | 168 |
| 671 | 3300005467 | Ga0070706_101417025 | Ga0070706_1014170252 | 168 |
| 672 | 3300005468 | Ga0070707_100085229 | Ga0070707_1000852293 | 168 |
| 673 | 3300005536 | Ga0070697_100523006 | Ga0070697_1005230062 | 168 |
| 674 | 3300005545 | Ga0070695_100555299 | Ga0070695_1005552992 | 168 |
| 675 | 3300005549 | Ga0070704_100678714 | Ga0070704_1006787142 | 168 |
| 676 | 3300005844 | Ga0068862_100078368 | Ga0068862_1000783682 | 168 |
| 677 | 3300005985 | Ga0081539_10000034 | Ga0081539_10000034249 | 168 |
| 678 | 3300006846 | Ga0075430_100010836 | Ga0075430_1000108364 | 168 |
| 679 | 3300006852 | Ga0075433_10000445 | Ga0075433_100004452 | 168 |
| 680 | 3300006852 | Ga0075433_10017052 | Ga0075433_100170524 | 168 |
| 681 | 3300006871 | Ga0075434_100000579 | Ga0075434_1000005793 | 168 |
| 682 | 3300006871 | Ga0075434_100001041 | Ga0075434_10000104122 | 168 |
| 683 | 3300006880 | Ga0075429_100139220 | Ga0075429_1001392202 | 168 |
| 684 | 3300007076 | Ga0075435_100013525 | Ga0075435_1000135256 | 168 |
| 685 | 3300009098 | Ga0105245_10007977 | Ga0105245_100079773 | 168 |
| 686 | 3300009101 | Ga0105247_10246143 | Ga0105247_102461432 | 168 |
| 687 | 3300009147 | Ga0114129_10039575 | Ga0114129_100395755 | 168 |
| 688 | 3300009147 | Ga0114129_10103944 | Ga0114129_101039442 | 168 |
| 689 | 3300009147 | Ga0114129_11409622 | Ga0114129_114096222 | 168 |
| 690 | 3300013296 | Ga0157374_10028827 | Ga0157374_100288273 | 168 |
| 691 | 3300013297 | Ga0157378_10030110 | Ga0157378_100301104 | 168 |
| 692 | 3300013308 | Ga0157375_12337496 | Ga0157375_123374961 | 168 |
| 693 | 3300014325 | Ga0163163_11452316 | Ga0163163_114523161 | 168 |
| 694 | 3300014326 | Ga0157380_10143336 | Ga0157380_101433362 | 168 |
| 695 | 3300014968 | Ga0157379_11218164 | Ga0157379_112181641 | 168 |
| 696 | 3300025900 | Ga0207710_10099750 | Ga0207710_100997501 | 168 |
| 697 | 3300025922 | Ga0207646_10037481 | Ga0207646_100374813 | 168 |
| 698 | 3300025923 | Ga0207681_10320463 | Ga0207681_103204632 | 168 |
| 699 | 3300025926 | Ga0207659_10152347 | Ga0207659_101523472 | 168 |
| 700 | 3300025928 | Ga0207700_10034412 | Ga0207700_100344123 | 168 |
| 701 | 3300025961 | Ga0207712_11460866 | Ga0207712_114608661 | 168 |
| 702 | 3300026075 | Ga0207708_10308962 | Ga0207708_103089622 | 168 |
| 703 | 3300026095 | Ga0207676_10416992 | Ga0207676_104169922 | 168 |
| 704 | 3300027907 | Ga0207428_10000592 | Ga0207428_1000059222 | 168 |
| 705 | 3300028380 | Ga0268265_10577665 | Ga0268265_105776651 | 168 |
| 706 | 3300031090 | Ga0265760_10012496 | Ga0265760_100124962 | 168 |
| 707 | 3300035088 | Ga0373940_0218115 | Ga0373940_0218115_12_524 | 168 |
| 708 | 3300035092 | Ga0373952_0042898 | Ga0373952_0042898_485_997 | 168 |
| 709 | 3300035172 | Ga0373955_0128687 | Ga0373955_0128687_587_1099 | 168 |
| 710 | 3300035692 | Ga0373935_0040333 | Ga0373935_0040333_943_1455 | 168 |
| 711 | 3300035725 | Ga0373947_0077498 | Ga0373947_0077498_1483_1995 | 168 |
| 712 | 3300036401 | Ga0373937_0007134 | Ga0373937_0007134_8778_9290 | 168 |
| 713 | 3300036401 | Ga0373937_0565703 | Ga0373937_0565703_90_602 | 168 |
| 714 | 3300045051 | Ga0451576_0025141 | Ga0451576_0025141_5690_6196 | 168 |
| 715 | 3300045051 | Ga0451576_0748290 | Ga0451576_0748290_102_614 | 168 |
| 716 | 3300046454 | Ga0495592_0017680 | Ga0495592_0017680_3897_4409 | 168 |
| 717 | 3300046454 | Ga0495592_0021436 | Ga0495592_0021436_1809_2321 | 168 |
| 718 | 3300046454 | Ga0495592_0084794 | Ga0495592_0084794_379_891 | 168 |
| 719 | 3300046462 | Ga0495651_0000793 | Ga0495651_0000793_6458_6970 | 168 |
| 720 | 3300046462 | Ga0495651_0071311 | Ga0495651_0071311_715_1227 | 168 |
| 721 | 3300046463 | Ga0495653_0005283 | Ga0495653_0005283_1248_1760 | 168 |
| 722 | 3300046463 | Ga0495653_0020914 | Ga0495653_0020914_4066_4578 | 168 |
| 723 | 3300046472 | Ga0495580_0061699 | Ga0495580_0061699_1350_1862 | 168 |
| 724 | 3300046477 | Ga0495664_0009759 | Ga0495664_0009759_3652_4164 | 168 |
| 725 | 3300046477 | Ga0495664_0018376 | Ga0495664_0018376_2434_2946 | 168 |
| 726 | 3300046511 | Ga0495608_0007214 | Ga0495608_0007214_4030_4542 | 168 |
| 727 | 3300046514 | Ga0495618_0011523 | Ga0495618_0011523_3361_3873 | 168 |
| 728 | 3300046514 | Ga0495618_0013469 | Ga0495618_0013469_3403_3915 | 168 |
| 729 | 3300046516 | Ga0495628_0000589 | Ga0495628_0000589_5759_6271 | 168 |
| 730 | 3300046516 | Ga0495628_0016860 | Ga0495628_0016860_1288_1800 | 168 |
| 731 | 3300046516 | Ga0495628_0611960 | Ga0495628_0611960_179_691 | 168 |
| 732 | 3300046517 | Ga0495630_0409126 | Ga0495630_0409126_271_783 | 168 |
| 733 | 3300046526 | Ga0495666_0025290 | Ga0495666_0025290_1396_1908 | 168 |
| 734 | 3300046529 | Ga0495652_0022761 | Ga0495652_0022761_2644_3156 | 168 |
| 735 | 3300046529 | Ga0495652_0162009 | Ga0495652_0162009_598_1110 | 168 |
| 736 | 3300046531 | Ga0495665_0002320 | Ga0495665_0002320_1377_1889 | 168 |
| 737 | 3300046533 | Ga0495640_0159480 | Ga0495640_0159480_82_594 | 168 |
| 738 | 3300046535 | Ga0495586_0004213 | Ga0495586_0004213_1370_1882 | 168 |
| 739 | 3300046536 | Ga0495587_0000591 | Ga0495587_0000591_15688_16200 | 168 |
| 740 | 3300046536 | Ga0495587_0059774 | Ga0495587_0059774_1002_1514 | 168 |
| 741 | 3300046539 | Ga0495621_0104714 | Ga0495621_0104714_308_820 | 168 |
| 742 | 3300046543 | Ga0495645_0008699 | Ga0495645_0008699_5782_6294 | 168 |
| 743 | 3300046543 | Ga0495645_0054607 | Ga0495645_0054607_2072_2584 | 168 |
| 744 | 3300046558 | Ga0495633_0281219 | Ga0495633_0281219_25_531 | 168 |
| 745 | 3300046559 | Ga0495667_0006598 | Ga0495667_0006598_3589_4101 | 168 |
| 746 | 3300046642 | Ga0495634_0008578 | Ga0495634_0008578_5818_6330 | 168 |
| 747 | 3300046675 | Ga0495657_0024342 | Ga0495657_0024342_3549_4061 | 168 |
| 748 | 3300046675 | Ga0495657_0024569 | Ga0495657_0024569_1477_1989 | 168 |
| 749 | 3300046678 | Ga0495599_0003547 | Ga0495599_0003547_3323_3835 | 168 |
| 750 | 3300046678 | Ga0495599_0042389 | Ga0495599_0042389_73_585 | 168 |
| 751 | 3300046679 | Ga0495623_0103436 | Ga0495623_0103436_978_1490 | 168 |
| 752 | 3300046680 | Ga0495646_0161395 | Ga0495646_0161395_478_990 | 168 |
| 753 | 3300046680 | Ga0495646_0170695 | Ga0495646_0170695_206_718 | 168 |
| 754 | 3300046689 | Ga0495613_0021516 | Ga0495613_0021516_2868_3380 | 168 |
| 755 | 3300046689 | Ga0495613_0188182 | Ga0495613_0188182_331_843 | 168 |
| 756 | 3300046690 | Ga0495624_0016974 | Ga0495624_0016974_1397_1909 | 168 |
| 757 | 3300046690 | Ga0495624_0179141 | Ga0495624_0179141_310_822 | 168 |
| 758 | 3300046809 | Ga0495600_0002070 | Ga0495600_0002070_4622_5134 | 168 |
| 759 | 3300047317 | Ga0495604_0000323 | Ga0495604_0000323_3597_4109 | 168 |
| 760 | 3300047317 | Ga0495604_0118638 | Ga0495604_0118638_1389_1901 | 168 |
| 761 | 3300047318 | Ga0495636_0011820 | Ga0495636_0011820_99_605 | 168 |
| 762 | 3300047319 | Ga0495674_0010221 | Ga0495674_0010221_3344_3856 | 168 |
| 763 | 3300047319 | Ga0495674_0067517 | Ga0495674_0067517_218_730 | 168 |
| 764 | 3300047322 | Ga0495680_0010538 | Ga0495680_0010538_5221_5733 | 168 |
| 765 | 3300047322 | Ga0495680_0030111 | Ga0495680_0030111_1815_2327 | 168 |
| 766 | 3300047444 | Ga0495675_0000155 | Ga0495675_0000155_47197_47709 | 168 |
| 767 | 3300047444 | Ga0495675_0060996 | Ga0495675_0060996_1385_1897 | 168 |
| 768 | 3300047471 | Ga0495684_0005550 | Ga0495684_0005550_5894_6406 | 168 |
| 769 | 3300047471 | Ga0495684_0076211 | Ga0495684_0076211_623_1135 | 168 |
| 770 | 3300047673 | Ga0495593_0036992 | Ga0495593_0036992_802_1314 | 168 |
| 771 | 3300048088 | Ga0495602_0062770 | Ga0495602_0062770_1398_1910 | 168 |
| 772 | 3300048089 | Ga0495614_0031678 | Ga0495614_0031678_1357_1869 | 168 |
| 773 | 3300048915 | Ga0496112_1179273 | Ga0496112_1179273_152_664 | 168 |
| 774 | 3300050507 | nmdc:mga05p37_155458_c1 | nmdc:mga05p37_155458_c1_613_1125 | 168 |
| 775 | 3300050507 | nmdc:mga05p37_321894_c1 | nmdc:mga05p37_321894_c1_839_1351 | 168 |
| 776 | 3300050508 | nmdc:mga09592_252203_c1 | nmdc:mga09592_252203_c1_467_979 | 168 |
| 777 | 3300050509 | nmdc:mga0qj67_143396_c1 | nmdc:mga0qj67_143396_c1_380_892 | 168 |
| 778 | 3300050511 | nmdc:mga08y16_2706_c1 | nmdc:mga08y16_2706_c1_66_578 | 168 |
| 779 | 3300050512 | nmdc:mga0n895_37063_c1 | nmdc:mga0n895_37063_c1_824_1336 | 168 |
| 780 | 3300050512 | nmdc:mga0n895_574_c1 | nmdc:mga0n895_574_c1_24245_24757 | 168 |
| 781 | 3300050512 | nmdc:mga0n895_876126_c1 | nmdc:mga0n895_876126_c1_218_730 | 168 |
| 782 | 3300050513 | nmdc:mga0rr50_85758_c1 | nmdc:mga0rr50_85758_c1_1190_1702 | 168 |
| 783 | 3300050515 | nmdc:mga0a205_5377_c1 | nmdc:mga0a205_5377_c1_8356_8868 | 168 |
| 784 | 3300050515 | nmdc:mga0a205_813_c1 | nmdc:mga0a205_813_c1_24373_24885 | 168 |
| 785 | 3300053077 | Ga0495601_0762754 | Ga0495601_0762754_23_535 | 168 |
| 786 | 3300053078 | Ga0495612_0022792 | Ga0495612_0022792_582_1094 | 168 |
| 787 | 3300053085 | Ga0495619_0040752 | Ga0495619_0040752_1250_1762 | 168 |
| 788 | 3300002076 | JGI24749J21850_1027340 | JGI24749J21850_10273402 | 169 |
| 789 | 3300005290 | Ga0065712_10410678 | Ga0065712_104106781 | 169 |
| 790 | 3300005293 | Ga0065715_10159844 | Ga0065715_101598442 | 169 |
| 791 | 3300005330 | Ga0070690_100062327 | Ga0070690_1000623273 | 169 |
| 792 | 3300005338 | Ga0068868_101392715 | Ga0068868_1013927151 | 169 |
| 793 | 3300005340 | Ga0070689_100058884 | Ga0070689_1000588842 | 169 |
| 794 | 3300005354 | Ga0070675_100052580 | Ga0070675_1000525803 | 169 |
| 795 | 3300005354 | Ga0070675_100399743 | Ga0070675_1003997432 | 169 |
| 796 | 3300005364 | Ga0070673_100025830 | Ga0070673_1000258302 | 169 |
| 797 | 3300005365 | Ga0070688_100020555 | Ga0070688_1000205552 | 169 |
| 798 | 3300005367 | Ga0070667_101425437 | Ga0070667_1014254371 | 169 |
| 799 | 3300005438 | Ga0070701_10113992 | Ga0070701_101139921 | 169 |
| 800 | 3300005466 | Ga0070685_10087372 | Ga0070685_100873722 | 169 |
| 801 | 3300005466 | Ga0070685_10105691 | Ga0070685_101056912 | 169 |
| 802 | 3300005543 | Ga0070672_100142431 | Ga0070672_1001424313 | 169 |
| 803 | 3300005617 | Ga0068859_100120800 | Ga0068859_1001208003 | 169 |
| 804 | 3300005618 | Ga0068864_100362662 | Ga0068864_1003626622 | 169 |
| 805 | 3300005842 | Ga0068858_100007327 | Ga0068858_1000073278 | 169 |
| 806 | 3300006931 | Ga0097620_100120800 | Ga0097620_1001208003 | 169 |
| 807 | 3300009094 | Ga0111539_10003598 | Ga0111539_1000359812 | 169 |
| 808 | 3300009177 | Ga0105248_10281528 | Ga0105248_102815283 | 169 |
| 809 | 3300013296 | Ga0157374_11747112 | Ga0157374_117471121 | 169 |
| 810 | 3300013308 | Ga0157375_10181881 | Ga0157375_101818813 | 169 |
| 811 | 3300025903 | Ga0207680_10394754 | Ga0207680_103947542 | 169 |
| 812 | 3300025907 | Ga0207645_10184593 | Ga0207645_101845932 | 169 |
| 813 | 3300025918 | Ga0207662_10299272 | Ga0207662_102992722 | 169 |
| 814 | 3300025923 | Ga0207681_10036611 | Ga0207681_100366112 | 169 |
| 815 | 3300025926 | Ga0207659_10001772 | Ga0207659_100017727 | 169 |
| 816 | 3300025931 | Ga0207644_10088321 | Ga0207644_100883212 | 169 |
| 817 | 3300025933 | Ga0207706_10245894 | Ga0207706_102458942 | 169 |
| 818 | 3300025936 | Ga0207670_10039200 | Ga0207670_100392004 | 169 |
| 819 | 3300025960 | Ga0207651_10010667 | Ga0207651_100106673 | 169 |
| 820 | 3300025972 | Ga0207668_11037298 | Ga0207668_110372981 | 169 |
| 821 | 3300026035 | Ga0207703_10007003 | Ga0207703_100070034 | 169 |
| 822 | 3300026121 | Ga0207683_10070792 | Ga0207683_100707923 | 169 |
| 823 | 3300027907 | Ga0207428_10023427 | Ga0207428_100234272 | 169 |
| 824 | 3300028381 | Ga0268264_10014737 | Ga0268264_100147377 | 169 |
| 825 | 3300031548 | Ga0307408_101186574 | Ga0307408_1011865741 | 169 |
| 826 | 3300031824 | Ga0307413_10012320 | Ga0307413_100123202 | 169 |
| 827 | 3300031852 | Ga0307410_10019421 | Ga0307410_100194212 | 169 |
| 828 | 3300031852 | Ga0307410_10111737 | Ga0307410_101117372 | 169 |
| 829 | 3300031903 | Ga0307407_10009690 | Ga0307407_100096904 | 169 |
| 830 | 3300031995 | Ga0307409_100021343 | Ga0307409_1000213432 | 169 |
| 831 | 3300032002 | Ga0307416_100008751 | Ga0307416_1000087515 | 169 |
| 832 | 3300032004 | Ga0307414_10275647 | Ga0307414_102756472 | 169 |
| 833 | 3300032005 | Ga0307411_10037452 | Ga0307411_100374522 | 169 |
| 834 | 3300032126 | Ga0307415_100011854 | Ga0307415_1000118543 | 169 |
| 835 | 3300042131 | Ga0450894_036407 | Ga0450894_036407_58_573 | 169 |
| 836 | 3300042435 | Ga0439434_0071865 | Ga0439434_0071865_379_894 | 169 |
| 837 | 3300046664 | Ga0495659_0004711 | Ga0495659_0004711_3105_3626 | 169 |
| 838 | 3300049577 | Ga0501041_0787920 | Ga0501041_0787920_46_561 | 169 |
| 839 | 3300049583 | Ga0501067_0222968 | Ga0501067_0222968_470_1009 | 169 |
| 840 | 3300050511 | nmdc:mga08y16_43741_c1 | nmdc:mga08y16_43741_c1_3020_3535 | 169 |
| 841 | 3300003758 | Ga0055532_1000335 | Ga0055532_100033510 | 170 |
| 842 | 3300006844 | Ga0075428_100017144 | Ga0075428_1000171445 | 170 |
| 843 | 3300006852 | Ga0075433_10044841 | Ga0075433_100448416 | 170 |
| 844 | 3300006871 | Ga0075434_100067337 | Ga0075434_1000673374 | 170 |
| 845 | 3300006871 | Ga0075434_100271569 | Ga0075434_1002715692 | 170 |
| 846 | 3300006914 | Ga0075436_100420698 | Ga0075436_1004206981 | 170 |
| 847 | 3300009094 | Ga0111539_10655651 | Ga0111539_106556512 | 170 |
| 848 | 3300009147 | Ga0114129_10008065 | Ga0114129_100080658 | 170 |
| 849 | 3300009147 | Ga0114129_10644060 | Ga0114129_106440602 | 170 |
| 850 | 3300025229 | Ga0209147_100155 | Ga0209147_10015572 | 170 |
| 851 | 3300025917 | Ga0207660_10632512 | Ga0207660_106325122 | 170 |
| 852 | 3300046525 | Ga0495663_0040409 | Ga0495663_0040409_171_683 | 170 |
| 853 | 3300046528 | Ga0495642_0092654 | Ga0495642_0092654_623_1135 | 170 |
| 854 | 3300046537 | Ga0495598_0078498 | Ga0495598_0078498_75_587 | 170 |
| 855 | 3300046539 | Ga0495621_0002713 | Ga0495621_0002713_733_1245 | 170 |
| 856 | 3300046664 | Ga0495659_0032273 | Ga0495659_0032273_1174_1686 | 170 |
| 857 | 3300050507 | nmdc:mga05p37_8871_c1 | nmdc:mga05p37_8871_c1_9492_10016 | 170 |
| 858 | 3300050508 | nmdc:mga09592_17640_c1 | nmdc:mga09592_17640_c1_4246_4770 | 170 |
| 859 | 3300050512 | nmdc:mga0n895_108215_c1 | nmdc:mga0n895_108215_c1_429_953 | 170 |
| 860 | 3300050515 | nmdc:mga0a205_58744_c1 | nmdc:mga0a205_58744_c1_1472_1996 | 170 |
| 861 | 2162886007 | SwRhRL2b_contig_2333552 | SwRhRL2b_0441.00004480 | 171 |
| 862 | 3300005289 | Ga0065704_10005291 | Ga0065704_100052912 | 171 |
| 863 | 3300005295 | Ga0065707_10112237 | Ga0065707_101122373 | 171 |
| 864 | 3300005331 | Ga0070670_100074814 | Ga0070670_1000748143 | 171 |
| 865 | 3300005334 | Ga0068869_100298008 | Ga0068869_1002980082 | 171 |
| 866 | 3300005340 | Ga0070689_100068765 | Ga0070689_1000687652 | 171 |
| 867 | 3300005347 | Ga0070668_100083742 | Ga0070668_1000837422 | 171 |
| 868 | 3300005353 | Ga0070669_100006800 | Ga0070669_1000068007 | 171 |
| 869 | 3300005354 | Ga0070675_100513487 | Ga0070675_1005134872 | 171 |
| 870 | 3300005355 | Ga0070671_100010405 | Ga0070671_1000104054 | 171 |
| 871 | 3300005364 | Ga0070673_100074718 | Ga0070673_1000747183 | 171 |
| 872 | 3300005364 | Ga0070673_100205036 | Ga0070673_1002050362 | 171 |
| 873 | 3300005364 | Ga0070673_100295045 | Ga0070673_1002950452 | 171 |
| 874 | 3300005365 | Ga0070688_100013824 | Ga0070688_1000138244 | 171 |
| 875 | 3300005438 | Ga0070701_10154658 | Ga0070701_101546582 | 171 |
| 876 | 3300005440 | Ga0070705_100008138 | Ga0070705_1000081383 | 171 |
| 877 | 3300005441 | Ga0070700_100060103 | Ga0070700_1000601032 | 171 |
| 878 | 3300005444 | Ga0070694_100000734 | Ga0070694_10000073415 | 171 |
| 879 | 3300005444 | Ga0070694_100001223 | Ga0070694_1000012233 | 171 |
| 880 | 3300005457 | Ga0070662_100046004 | Ga0070662_1000460042 | 171 |
| 881 | 3300005457 | Ga0070662_100075719 | Ga0070662_1000757192 | 171 |
| 882 | 3300005458 | Ga0070681_10024842 | Ga0070681_100248424 | 171 |
| 883 | 3300005459 | Ga0068867_100003655 | Ga0068867_1000036558 | 171 |
| 884 | 3300005471 | Ga0070698_100014372 | Ga0070698_1000143724 | 171 |
| 885 | 3300005471 | Ga0070698_100021898 | Ga0070698_1000218985 | 171 |
| 886 | 3300005530 | Ga0070679_100055706 | Ga0070679_1000557063 | 171 |
| 887 | 3300005543 | Ga0070672_100411979 | Ga0070672_1004119792 | 171 |
| 888 | 3300005544 | Ga0070686_100100383 | Ga0070686_1001003832 | 171 |
| 889 | 3300005545 | Ga0070695_100004284 | Ga0070695_1000042841 | 171 |
| 890 | 3300005546 | Ga0070696_100008858 | Ga0070696_1000088586 | 171 |
| 891 | 3300005549 | Ga0070704_100003478 | Ga0070704_1000034788 | 171 |
| 892 | 3300005549 | Ga0070704_100035596 | Ga0070704_1000355962 | 171 |
| 893 | 3300005564 | Ga0070664_100027979 | Ga0070664_1000279792 | 171 |
| 894 | 3300005577 | Ga0068857_100037232 | Ga0068857_1000372324 | 171 |
| 895 | 3300005577 | Ga0068857_100074413 | Ga0068857_1000744132 | 171 |
| 896 | 3300005615 | Ga0070702_100205270 | Ga0070702_1002052702 | 171 |
| 897 | 3300005719 | Ga0068861_100003935 | Ga0068861_1000039358 | 171 |
| 898 | 3300005719 | Ga0068861_100084987 | Ga0068861_1000849872 | 171 |
| 899 | 3300005840 | Ga0068870_10002012 | Ga0068870_100020123 | 171 |
| 900 | 3300005841 | Ga0068863_100055817 | Ga0068863_1000558172 | 171 |
| 901 | 3300005841 | Ga0068863_100108057 | Ga0068863_1001080572 | 171 |
| 902 | 3300005843 | Ga0068860_100118951 | Ga0068860_1001189513 | 171 |
| 903 | 3300005844 | Ga0068862_100000603 | Ga0068862_10000060329 | 171 |
| 904 | 3300006237 | Ga0097621_100435050 | Ga0097621_1004350502 | 171 |
| 905 | 3300006844 | Ga0075428_100237921 | Ga0075428_1002379212 | 171 |
| 906 | 3300006852 | Ga0075433_10733640 | Ga0075433_107336401 | 171 |
| 907 | 3300006871 | Ga0075434_100001436 | Ga0075434_1000014364 | 171 |
| 908 | 3300006871 | Ga0075434_100510589 | Ga0075434_1005105892 | 171 |
| 909 | 3300007076 | Ga0075435_100043537 | Ga0075435_1000435374 | 171 |
| 910 | 3300007076 | Ga0075435_100127534 | Ga0075435_1001275343 | 171 |
| 911 | 3300007076 | Ga0075435_100379246 | Ga0075435_1003792462 | 171 |
| 912 | 3300009094 | Ga0111539_10046561 | Ga0111539_100465614 | 171 |
| 913 | 3300009094 | Ga0111539_11046726 | Ga0111539_110467262 | 171 |
| 914 | 3300009147 | Ga0114129_10752145 | Ga0114129_107521452 | 171 |
| 915 | 3300009148 | Ga0105243_10067131 | Ga0105243_100671312 | 171 |
| 916 | 3300009148 | Ga0105243_10154629 | Ga0105243_101546292 | 171 |
| 917 | 3300009176 | Ga0105242_10954246 | Ga0105242_109542461 | 171 |
| 918 | 3300009553 | Ga0105249_10017654 | Ga0105249_100176543 | 171 |
| 919 | 3300011119 | Ga0105246_10293055 | Ga0105246_102930552 | 171 |
| 920 | 3300011119 | Ga0105246_10736608 | Ga0105246_107366082 | 171 |
| 921 | 3300013297 | Ga0157378_10665819 | Ga0157378_106658192 | 171 |
| 922 | 3300013308 | Ga0157375_10008416 | Ga0157375_100084166 | 171 |
| 923 | 3300014326 | Ga0157380_10085509 | Ga0157380_100855093 | 171 |
| 924 | 3300014745 | Ga0157377_10055537 | Ga0157377_100555372 | 171 |
| 925 | 3300014969 | Ga0157376_10166998 | Ga0157376_101669982 | 171 |
| 926 | 3300025885 | Ga0207653_10013702 | Ga0207653_100137022 | 171 |
| 927 | 3300025904 | Ga0207647_10113090 | Ga0207647_101130902 | 171 |
| 928 | 3300025907 | Ga0207645_10069063 | Ga0207645_100690631 | 171 |
| 929 | 3300025908 | Ga0207643_10003460 | Ga0207643_100034605 | 171 |
| 930 | 3300025912 | Ga0207707_10585552 | Ga0207707_105855521 | 171 |
| 931 | 3300025918 | Ga0207662_10032509 | Ga0207662_100325093 | 171 |
| 932 | 3300025923 | Ga0207681_10002902 | Ga0207681_100029025 | 171 |
| 933 | 3300025926 | Ga0207659_10060150 | Ga0207659_100601502 | 171 |
| 934 | 3300025931 | Ga0207644_10249988 | Ga0207644_102499881 | 171 |
| 935 | 3300025933 | Ga0207706_10018920 | Ga0207706_100189203 | 171 |
| 936 | 3300025933 | Ga0207706_10082533 | Ga0207706_100825332 | 171 |
| 937 | 3300025935 | Ga0207709_10074584 | Ga0207709_100745843 | 171 |
| 938 | 3300025936 | Ga0207670_10088977 | Ga0207670_100889772 | 171 |
| 939 | 3300025940 | Ga0207691_10052371 | Ga0207691_100523713 | 171 |
| 940 | 3300025940 | Ga0207691_10129364 | Ga0207691_101293642 | 171 |
| 941 | 3300025940 | Ga0207691_10216292 | Ga0207691_102162922 | 171 |
| 942 | 3300025942 | Ga0207689_10118929 | Ga0207689_101189292 | 171 |
| 943 | 3300025942 | Ga0207689_10719748 | Ga0207689_107197482 | 171 |
| 944 | 3300025942 | Ga0207689_10751458 | Ga0207689_107514581 | 171 |
| 945 | 3300025945 | Ga0207679_10085404 | Ga0207679_100854042 | 171 |
| 946 | 3300025960 | Ga0207651_10176693 | Ga0207651_101766932 | 171 |
| 947 | 3300025961 | Ga0207712_10003929 | Ga0207712_100039295 | 171 |
| 948 | 3300025972 | Ga0207668_10068691 | Ga0207668_100686912 | 171 |
| 949 | 3300026075 | Ga0207708_10021795 | Ga0207708_100217953 | 171 |
| 950 | 3300026088 | Ga0207641_10179142 | Ga0207641_101791422 | 171 |
| 951 | 3300026088 | Ga0207641_10188463 | Ga0207641_101884632 | 171 |
| 952 | 3300026088 | Ga0207641_11019404 | Ga0207641_110194042 | 171 |
| 953 | 3300026089 | Ga0207648_10005118 | Ga0207648_100051183 | 171 |
| 954 | 3300026089 | Ga0207648_10146600 | Ga0207648_101466001 | 171 |
| 955 | 3300026095 | Ga0207676_10074704 | Ga0207676_100747042 | 171 |
| 956 | 3300026095 | Ga0207676_10090926 | Ga0207676_100909262 | 171 |
| 957 | 3300026116 | Ga0207674_10019767 | Ga0207674_100197674 | 171 |
| 958 | 3300026116 | Ga0207674_10044070 | Ga0207674_100440703 | 171 |
| 959 | 3300026118 | Ga0207675_100008364 | Ga0207675_1000083643 | 171 |
| 960 | 3300026118 | Ga0207675_100625221 | Ga0207675_1006252212 | 171 |
| 961 | 3300027907 | Ga0207428_10003760 | Ga0207428_1000376013 | 171 |
| 962 | 3300028380 | Ga0268265_10000485 | Ga0268265_100004853 | 171 |
| 963 | 3300028381 | Ga0268264_10135905 | Ga0268264_101359052 | 171 |
| 964 | 3300028381 | Ga0268264_10618231 | Ga0268264_106182311 | 171 |
| 965 | 3300031852 | Ga0307410_10986862 | Ga0307410_109868622 | 171 |
| 966 | 3300031901 | Ga0307406_10255865 | Ga0307406_102558652 | 171 |
| 967 | 3300032002 | Ga0307416_100185490 | Ga0307416_1001854902 | 171 |
| 968 | 3300032005 | Ga0307411_10172656 | Ga0307411_101726562 | 171 |
| 969 | 3300034819 | Ga0373958_0073464 | Ga0373958_0073464_57_572 | 171 |
| 970 | 3300035088 | Ga0373940_0094211 | Ga0373940_0094211_216_731 | 171 |
| 971 | 3300035090 | Ga0373949_0008199 | Ga0373949_0008199_1567_2082 | 171 |
| 972 | 3300035114 | Ga0373939_0030314 | Ga0373939_0030314_191_706 | 171 |
| 973 | 3300035115 | Ga0373941_0059681 | Ga0373941_0059681_420_935 | 171 |
| 974 | 3300035691 | Ga0373931_0125985 | Ga0373931_0125985_776_1291 | 171 |
| 975 | 3300045051 | Ga0451576_0076152 | Ga0451576_0076152_393_938 | 171 |
| 976 | 3300045051 | Ga0451576_0224161 | Ga0451576_0224161_1144_1659 | 171 |
| 977 | 3300046455 | Ga0495603_0032738 | Ga0495603_0032738_466_999 | 171 |
| 978 | 3300046475 | Ga0495639_0290905 | Ga0495639_0290905_277_792 | 171 |
| 979 | 3300046491 | Ga0495584_0242924 | Ga0495584_0242924_103_618 | 171 |
| 980 | 3300046499 | Ga0495594_0051213 | Ga0495594_0051213_320_853 | 171 |
| 981 | 3300046522 | Ga0495643_0021593 | Ga0495643_0021593_1164_1685 | 171 |
| 982 | 3300046538 | Ga0495609_0131346 | Ga0495609_0131346_140_673 | 171 |
| 983 | 3300046539 | Ga0495621_0004604 | Ga0495621_0004604_1147_1662 | 171 |
| 984 | 3300046664 | Ga0495659_0128011 | Ga0495659_0128011_23_556 | 171 |
| 985 | 3300046664 | Ga0495659_0170127 | Ga0495659_0170127_17_550 | 171 |
| 986 | 3300046674 | Ga0495588_0002399 | Ga0495588_0002399_55_588 | 171 |
| 987 | 3300046684 | Ga0495669_0016533 | Ga0495669_0016533_45_578 | 171 |
| 988 | 3300047445 | Ga0495677_0280225 | Ga0495677_0280225_107_640 | 171 |
| 989 | 3300048909 | Ga0496106_0860708 | Ga0496106_0860708_108_623 | 171 |
| 990 | 3300050507 | nmdc:mga05p37_48721_c1 | nmdc:mga05p37_48721_c1_4565_5080 | 171 |
| 991 | 3300050511 | nmdc:mga08y16_247020_c1 | nmdc:mga08y16_247020_c1_623_1138 | 171 |
| 992 | 3300050511 | nmdc:mga08y16_96564_c1 | nmdc:mga08y16_96564_c1_623_1138 | 171 |
| 993 | 3300050512 | nmdc:mga0n895_1115874_c1 | nmdc:mga0n895_1115874_c1_75_590 | 171 |
| 994 | 3300050512 | nmdc:mga0n895_119371_c1 | nmdc:mga0n895_119371_c1_177_692 | 171 |
| 995 | 3300050512 | nmdc:mga0n895_379842_c1 | nmdc:mga0n895_379842_c1_262_795 | 171 |
| 996 | 3300050512 | nmdc:mga0n895_7430_c1 | nmdc:mga0n895_7430_c1_219_752 | 171 |
| 997 | 3300050513 | nmdc:mga0rr50_1039101_c1 | nmdc:mga0rr50_1039101_c1_38_571 | 171 |
| 998 | 3300050513 | nmdc:mga0rr50_1173164_c1 | nmdc:mga0rr50_1173164_c1_73_606 | 171 |
| 999 | 3300050513 | nmdc:mga0rr50_35177_c1 | nmdc:mga0rr50_35177_c1_2961_3494 | 171 |
| 1000 | 3300050515 | nmdc:mga0a205_150611_c1 | nmdc:mga0a205_150611_c1_1516_2049 | 171 |
| 1001 | iso_pu_bacteria | 2816332186 | 2816864103 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sh3-assembly1.cif.gz_B | crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder | 0.8908 | 106 | 145 |
| 3exz-assembly1.cif.gz_A | crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. | 0.878 | 9 | 153 |
| 2bi0-assembly1.cif.gz_A | rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold | 0.878 | 9 | 158 |
| 4ffu-assembly2.cif.gz_K | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.8758 | 10 | 152 |
| 4e3e-assembly1.cif.gz_A | crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl | 0.8641 | 9 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9157 | 1 | 153 | 3.10.129.10 |
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8876 | 1 | 153 | 3.10.129.10 |
| 2bi0A01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8842 | 9 | 152 | 3.10.129.10 |
| af_Q9FJI2_19_158_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8769 | 15 | 152 | 3.10.129.10 |
| 4ffuK00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.871 | 10 | 152 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0Y720-F1-model_v4 | Dehydratase | 0.9749 | 10 | 156 |
GO:0016829
|
| AF-A0A6I1JB25-F1-model_v4 | MaoC domain-containing protein dehydratase | 0.9728 | 9 | 154 |
|
| AF-A0A534T6U4-F1-model_v4 | MaoC family dehydratase | 0.9721 | 10 | 153 |
|
| AF-A0A382H3A6-F1-model_v4 | Uncharacterized protein | 0.9719 | 10 | 156 |
GO:0016829
|
| AF-A0A2S6TKS2-F1-model_v4 | Mesaconyl-CoA hydratase (EC 4.2.1.148) | 0.9706 | 10 | 156 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar