F487885

General Info

Members Datasets Scaffolds Average Seq Length
1001 363 999 168

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100802873|Ga0070694_1008028732
Length 165
Sequence MPVKEGWTGRVYEDFEVGDIYQHPLGRTVLPVDNSWFTLLSQNTNPIHFDRHYAAQTEFGQPLVNSTLTLALVVGLTVSDISQNAVNLGWDEVRLPAPVFEGDTIYAQTEVLSTRDSGSRPSMGIVEIRTTGFKQDGTVVMTFRRTILVYRRGQAPVRPTPTIKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
3 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 2.6
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2333552 2162886007 Bacteria 914
2 JGI24749J21850_1027340 3300002076 Bacteria 814
3 JGI25406J46586_10002299 3300003203 Bacteria 9016
4 Ga0055532_1000335 3300003758 Bacteria 25726
5 Ga0065704_10005291 3300005289 Bacteria 5665
6 Ga0065712_10004822 3300005290 Bacteria 3908
7 Ga0065712_10097465 3300005290 Bacteria 2150
8 Ga0065712_10122688 3300005290 Bacteria 1648
9 Ga0065712_10410678 3300005290 Bacteria 722
10 Ga0065712_10528120 3300005290 Bacteria 631
11 Ga0065715_10159844 3300005293 Bacteria 1640
12 Ga0065715_10256818 3300005293 Bacteria 1150
13 Ga0065715_10750698 3300005293 Unclassified 630
14 Ga0065715_10772688 3300005293 Bacteria 621
15 Ga0065707_10112237 3300005295 Unclassified 2367
16 Ga0065707_10457655 3300005295 Bacteria 794
17 Ga0070658_11561338 3300005327 Bacteria 572
18 Ga0070683_100028567 3300005329 Bacteria 5041
19 Ga0070683_100037387 3300005329 Bacteria 4444
20 Ga0070683_100281589 3300005329 Bacteria 1582
21 Ga0070683_100636737 3300005329 Bacteria 1021
22 Ga0070683_101919745 3300005329 Bacteria 569
23 Ga0070690_100062327 3300005330 Bacteria 2405
24 Ga0070690_100798290 3300005330 Unclassified 732
25 Ga0070690_100987079 3300005330 Bacteria 663
26 Ga0070670_100012431 3300005331 Bacteria 7286
27 Ga0070670_100034911 3300005331 Bacteria 4328
28 Ga0070670_100074814 3300005331 Unclassified 2910
29 Ga0070670_101451578 3300005331 Bacteria 629
30 Ga0070677_10158599 3300005333 Bacteria 1060
31 Ga0068869_100297635 3300005334 Bacteria 1302
32 Ga0068869_100298008 3300005334 Bacteria 1301
33 Ga0070666_10124473 3300005335 Bacteria 1789
34 Ga0070666_10734973 3300005335 Bacteria 725
35 Ga0070680_100267546 3300005336 Bacteria 1447
36 Ga0068868_100229300 3300005338 Unclassified 1557
37 Ga0068868_100723500 3300005338 Unclassified 892
38 Ga0068868_101392715 3300005338 Bacteria 654
39 Ga0070689_100058884 3300005340 Bacteria 2984
40 Ga0070689_100068765 3300005340 Bacteria 2762
41 Ga0070689_100088433 3300005340 Bacteria 2438
42 Ga0070691_10659441 3300005341 Bacteria 624
43 Ga0070687_100061165 3300005343 Bacteria 1990
44 Ga0070687_100196382 3300005343 Bacteria 1219
45 Ga0070687_100197999 3300005343 Bacteria 1215
46 Ga0070661_100956963 3300005344 Bacteria 709
47 Ga0070692_10023802 3300005345 Bacteria 3004
48 Ga0070692_10029173 3300005345 Bacteria 2748
49 Ga0070668_100083742 3300005347 Bacteria 2504
50 Ga0070669_100006800 3300005353 Bacteria 8226
51 Ga0070669_100060029 3300005353 Bacteria 2793
52 Ga0070669_100471062 3300005353 Bacteria 1038
53 Ga0070675_100027446 3300005354 Bacteria 4573
54 Ga0070675_100052580 3300005354 Bacteria 3349
55 Ga0070675_100397355 3300005354 Bacteria 1229
56 Ga0070675_100399743 3300005354 Bacteria 1225
57 Ga0070675_100513487 3300005354 Bacteria 1081
58 Ga0070671_100010405 3300005355 Bacteria 7460
59 Ga0070671_100141250 3300005355 Bacteria 2032
60 Ga0070671_100690822 3300005355 Bacteria 885
61 Ga0070674_100817027 3300005356 Bacteria 806
62 Ga0070674_101294150 3300005356 Bacteria 650
63 Ga0070673_100025830 3300005364 Bacteria 4329
64 Ga0070673_100074718 3300005364 Bacteria 2732
65 Ga0070673_100095316 3300005364 Bacteria 2441
66 Ga0070673_100205036 3300005364 Bacteria 1700
67 Ga0070673_100295045 3300005364 Unclassified 1426
68 Ga0070673_100509190 3300005364 Unclassified 1090
69 Ga0070673_100791974 3300005364 Bacteria 875
70 Ga0070688_100013824 3300005365 Bacteria 4565
71 Ga0070688_100020555 3300005365 Bacteria 3840
72 Ga0070659_100853036 3300005366 Bacteria 794
73 Ga0070667_100316293 3300005367 Bacteria 1408
74 Ga0070667_101425437 3300005367 Bacteria 650
75 Ga0070709_10082442 3300005434 Bacteria 2101
76 Ga0070709_10176931 3300005434 Bacteria 1495
77 Ga0070709_10178635 3300005434 Bacteria 1489
78 Ga0070714_100071194 3300005435 Bacteria 3006
79 Ga0070713_100008727 3300005436 Bacteria 7210
80 Ga0070713_100012499 3300005436 Bacteria 6230
81 Ga0070713_100096486 3300005436 Bacteria 2552
82 Ga0070713_100103707 3300005436 Bacteria 2468
83 Ga0070713_100214365 3300005436 Bacteria 1745
84 Ga0070713_101405073 3300005436 Bacteria 677
85 Ga0070710_10025665 3300005437 Bacteria 3122
86 Ga0070701_10040427 3300005438 Bacteria 2370
87 Ga0070701_10113992 3300005438 Bacteria 1514
88 Ga0070701_10154658 3300005438 Unclassified 1323
89 Ga0070701_10393739 3300005438 Bacteria 876
90 Ga0070711_100019524 3300005439 Bacteria 4349
91 Ga0070711_100367297 3300005439 Bacteria 1160
92 Ga0070705_100008138 3300005440 Bacteria 5186
93 Ga0070705_100061747 3300005440 Bacteria 2228
94 Ga0070705_100144025 3300005440 Bacteria 1572
95 Ga0070700_100060103 3300005441 Bacteria 2395
96 Ga0070700_101121135 3300005441 Unclassified 653
97 Ga0070694_100000734 3300005444 Bacteria 18310
98 Ga0070694_100001223 3300005444 Bacteria 14829
99 Ga0070694_100044903 3300005444 Bacteria 2959
100 Ga0070694_100132349 3300005444 Bacteria 1803
101 Ga0070694_100298533 3300005444 Bacteria 1234
102 Ga0070694_100802873 3300005444 Bacteria 772
103 Ga0070694_100963429 3300005444 Bacteria 707
104 Ga0070708_100988463 3300005445 Bacteria 789
105 Ga0070678_100644799 3300005456 Bacteria 949
106 Ga0070662_100046004 3300005457 Unclassified 3134
107 Ga0070662_100060308 3300005457 Bacteria 2766
108 Ga0070662_100075719 3300005457 Bacteria 2493
109 Ga0070681_10024842 3300005458 Bacteria 6028
110 Ga0070681_10199585 3300005458 Bacteria 1919
111 Ga0070681_10235379 3300005458 Bacteria 1745
112 Ga0070681_10497643 3300005458 Unclassified 1132
113 Ga0070681_10982140 3300005458 Bacteria 764
114 Ga0070681_11178390 3300005458 Bacteria 688
115 Ga0070681_11347782 3300005458 Bacteria 637
116 Ga0068867_100003655 3300005459 Bacteria 10823
117 Ga0068867_100056439 3300005459 Bacteria 2906
118 Ga0068867_100507684 3300005459 Bacteria 1037
119 Ga0068867_101752232 3300005459 Bacteria 583
120 Ga0070685_10087372 3300005466 Bacteria 1881
121 Ga0070685_10105691 3300005466 Bacteria 1726
122 Ga0070685_10275614 3300005466 Bacteria 1124
123 Ga0070706_101417025 3300005467 Bacteria 636
124 Ga0070707_100007200 3300005468 Bacteria 10318
125 Ga0070707_100080166 3300005468 Bacteria 3151
126 Ga0070707_100085229 3300005468 Bacteria 3054
127 Ga0070707_100316489 3300005468 Bacteria 1517
128 Ga0070707_100723962 3300005468 Bacteria 958
129 Ga0070698_100001371 3300005471 Bacteria 27083
130 Ga0070698_100014372 3300005471 Bacteria 8363
131 Ga0070698_100021898 3300005471 Bacteria 6692
132 Ga0070699_100000912 3300005518 Bacteria 27543
133 Ga0070699_100788126 3300005518 Bacteria 870
134 Ga0070679_100055706 3300005530 Bacteria 3938
135 Ga0070679_101104079 3300005530 Unclassified 738
136 Ga0070679_101126194 3300005530 Bacteria 730
137 Ga0070684_100006317 3300005535 Bacteria 9156
138 Ga0070684_100238927 3300005535 Bacteria 1659
139 Ga0070684_100488072 3300005535 Bacteria 1140
140 Ga0070697_100061942 3300005536 Bacteria 3052
141 Ga0070697_100352231 3300005536 Bacteria 1272
142 Ga0070697_100523006 3300005536 Bacteria 1039
143 Ga0068853_100044977 3300005539 Bacteria 3780
144 Ga0068853_100083918 3300005539 Bacteria 2791
145 Ga0068853_100884379 3300005539 Bacteria 857
146 Ga0070672_100142431 3300005543 Bacteria 1978
147 Ga0070672_100309139 3300005543 Unclassified 1341
148 Ga0070672_100385337 3300005543 Bacteria 1199
149 Ga0070672_100411979 3300005543 Unclassified 1160
150 Ga0070672_100931825 3300005543 Unclassified 768
151 Ga0070672_101265810 3300005543 Bacteria 658
152 Ga0070672_101723492 3300005543 Unclassified 563
153 Ga0070686_100026526 3300005544 Bacteria 3498
154 Ga0070686_100076723 3300005544 Bacteria 2202
155 Ga0070686_100100383 3300005544 Bacteria 1954
156 Ga0070686_100163142 3300005544 Unclassified 1571
157 Ga0070686_100440496 3300005544 Bacteria 999
158 Ga0070686_100494399 3300005544 Bacteria 948
159 Ga0070695_100004284 3300005545 Bacteria 8347
160 Ga0070695_100005772 3300005545 Bacteria 7293
161 Ga0070695_100127042 3300005545 Bacteria 1752
162 Ga0070695_100555299 3300005545 Bacteria 896
163 Ga0070696_100005384 3300005546 Bacteria 8536
164 Ga0070696_100006916 3300005546 Bacteria 7573
165 Ga0070696_100008858 3300005546 Bacteria 6730
166 Ga0070696_100046884 3300005546 Bacteria 2998
167 Ga0070693_100020383 3300005547 Bacteria 3495
168 Ga0070693_100119505 3300005547 Bacteria 1632
169 Ga0070693_100851487 3300005547 Bacteria 680
170 Ga0070665_100080194 3300005548 Bacteria 3269
171 Ga0070665_100673562 3300005548 Unclassified 1047
172 Ga0070704_100001828 3300005549 Bacteria 11724
173 Ga0070704_100003478 3300005549 Bacteria 9042
174 Ga0070704_100035596 3300005549 Bacteria 3385
175 Ga0070704_100310949 3300005549 Bacteria 1316
176 Ga0070704_100549664 3300005549 Bacteria 1009
177 Ga0070704_100678714 3300005549 Bacteria 912
178 Ga0068855_100475390 3300005563 Bacteria 1361
179 Ga0068855_100693483 3300005563 Bacteria 1090
180 Ga0070664_100027979 3300005564 Bacteria 4689
181 Ga0070664_100091525 3300005564 Bacteria 2632
182 Ga0070664_100172395 3300005564 Bacteria 1920
183 Ga0068857_100037232 3300005577 Bacteria 4309
184 Ga0068857_100074413 3300005577 Bacteria 3026
185 Ga0068854_100011869 3300005578 Bacteria 5689
186 Ga0068854_100067182 3300005578 Bacteria 2611
187 Ga0068854_100763491 3300005578 Bacteria 840
188 Ga0068856_100120159 3300005614 Bacteria 2629
189 Ga0070702_100205270 3300005615 Bacteria 1307
190 Ga0070702_100475743 3300005615 Bacteria 912
191 Ga0068852_100093651 3300005616 Bacteria 2693
192 Ga0068852_101760386 3300005616 Unclassified 642
193 Ga0068859_100120800 3300005617 Bacteria 2687
194 Ga0068859_100451967 3300005617 Bacteria 1381
195 Ga0068864_100149664 3300005618 Bacteria 2113
196 Ga0068864_100362662 3300005618 Bacteria 1370
197 Ga0068861_100003935 3300005719 Bacteria 9932
198 Ga0068861_100033182 3300005719 Bacteria 3806
199 Ga0068861_100051200 3300005719 Bacteria 3134
200 Ga0068861_100084987 3300005719 Bacteria 2485
201 Ga0068861_100844527 3300005719 Unclassified 863
202 Ga0068851_10119275 3300005834 Bacteria 1416
203 Ga0068870_10002012 3300005840 Bacteria 8402
204 Ga0068863_100055817 3300005841 Bacteria 3740
205 Ga0068863_100108057 3300005841 Bacteria 2648
206 Ga0068863_101385447 3300005841 Bacteria 711
207 Ga0068863_101673793 3300005841 Unclassified 646
208 Ga0068858_100007327 3300005842 Bacteria 10678
209 Ga0068860_100118951 3300005843 Bacteria 2529
210 Ga0068860_100420304 3300005843 Bacteria 1325
211 Ga0068860_101388001 3300005843 Bacteria 724
212 Ga0068860_101670818 3300005843 Bacteria 659
213 Ga0068862_100000603 3300005844 Bacteria 37377
214 Ga0068862_100078368 3300005844 Bacteria 2863
215 Ga0068862_100344980 3300005844 Bacteria 1380
216 Ga0081539_10000034 3300005985 Bacteria 307597
217 Ga0081539_10081756 3300005985 Bacteria 1695
218 Ga0070717_10070235 3300006028 Bacteria 2918
219 Ga0070717_10227176 3300006028 Unclassified 1642
220 Ga0070717_10634191 3300006028 Bacteria 970
221 Ga0075432_10154696 3300006058 Unclassified 883
222 Ga0070715_10015083 3300006163 Bacteria 2875
223 Ga0070715_10216154 3300006163 Bacteria 983
224 Ga0070715_10249609 3300006163 Unclassified 927
225 Ga0070715_10528596 3300006163 Bacteria 680
226 Ga0070716_100041278 3300006173 Bacteria 2570
227 Ga0070716_100605158 3300006173 Bacteria 825
228 Ga0070712_100019700 3300006175 Bacteria 4405
229 Ga0070712_100154776 3300006175 Bacteria 1764
230 Ga0070712_100737142 3300006175 Bacteria 842
231 Ga0097621_100003000 3300006237 Bacteria 11595
232 Ga0097621_100435050 3300006237 Bacteria 1179
233 Ga0068871_100005784 3300006358 Bacteria 8686
234 Ga0068871_100073686 3300006358 Bacteria 2815
235 Ga0068871_100116449 3300006358 Bacteria 2253
236 Ga0075428_100001276 3300006844 Bacteria 26863
237 Ga0075428_100017144 3300006844 Bacteria 8001
238 Ga0075428_100237921 3300006844 Unclassified 1965
239 Ga0075428_100603093 3300006844 Bacteria 1173
240 Ga0075428_100734863 3300006844 Bacteria 1051
241 Ga0075428_100748144 3300006844 Bacteria 1040
242 Ga0075430_100003017 3300006846 Bacteria 14089
243 Ga0075430_100010836 3300006846 Bacteria 7723
244 Ga0075430_100514456 3300006846 Bacteria 988
245 Ga0075431_100006823 3300006847 Bacteria 11341
246 Ga0075431_100010900 3300006847 Bacteria 9144
247 Ga0075431_100059822 3300006847 Bacteria 3931
248 Ga0075431_100137060 3300006847 Bacteria 2523
249 Ga0075431_100518399 3300006847 Bacteria 1182
250 Ga0075433_10000445 3300006852 Bacteria 26756
251 Ga0075433_10017052 3300006852 Bacteria 6004
252 Ga0075433_10044841 3300006852 Bacteria 3842
253 Ga0075433_10131072 3300006852 Bacteria 2227
254 Ga0075433_10733640 3300006852 Bacteria 864
255 Ga0075434_100000026 3300006871 Bacteria 68165
256 Ga0075434_100000579 3300006871 Bacteria 28227
257 Ga0075434_100001041 3300006871 Bacteria 22625
258 Ga0075434_100001436 3300006871 Bacteria 20006
259 Ga0075434_100066668 3300006871 Bacteria 3586
260 Ga0075434_100067337 3300006871 Bacteria 3567
261 Ga0075434_100255507 3300006871 Bacteria 1771
262 Ga0075434_100271569 3300006871 Bacteria 1715
263 Ga0075434_100427078 3300006871 Bacteria 1346
264 Ga0075434_100510589 3300006871 Bacteria 1223
265 Ga0075434_100719973 3300006871 Bacteria 1015
266 Ga0075429_100001340 3300006880 Bacteria 20116
267 Ga0075429_100012788 3300006880 Bacteria 7280
268 Ga0075429_100046300 3300006880 Unclassified 3785
269 Ga0075429_100139220 3300006880 Bacteria 2124
270 Ga0068865_100026112 3300006881 Bacteria 3848
271 Ga0068865_100640234 3300006881 Unclassified 902
272 Ga0075436_100000600 3300006914 Bacteria 23619
273 Ga0075436_100420698 3300006914 Bacteria 970
274 Ga0075436_100646460 3300006914 Bacteria 781
275 Ga0097620_100120800 3300006931 Bacteria 2687
276 Ga0097620_100451924 3300006931 Bacteria 1381
277 Ga0097620_101220627 3300006931 Bacteria 828
278 Ga0075435_100000017 3300007076 Bacteria 99666
279 Ga0075435_100004530 3300007076 Bacteria 9555
280 Ga0075435_100013525 3300007076 Bacteria 6074
281 Ga0075435_100015367 3300007076 Bacteria 5753
282 Ga0075435_100043537 3300007076 Bacteria 3593
283 Ga0075435_100127534 3300007076 Bacteria 2127
284 Ga0075435_100379246 3300007076 Bacteria 1215
285 Ga0099795_10004644 3300007788 Bacteria 3570
286 Ga0105240_10178259 3300009093 Bacteria 2510
287 Ga0111539_10003598 3300009094 Bacteria 20431
288 Ga0111539_10023669 3300009094 Bacteria 7546
289 Ga0111539_10035363 3300009094 Bacteria 6049
290 Ga0111539_10046561 3300009094 Bacteria 5187
291 Ga0111539_10655651 3300009094 Bacteria 1222
292 Ga0111539_11046726 3300009094 Bacteria 949
293 Ga0105245_10007977 3300009098 Bacteria 9257
294 Ga0105245_10051163 3300009098 Bacteria 3704
295 Ga0105245_10334890 3300009098 Unclassified 1495
296 Ga0105245_10510738 3300009098 Bacteria 1219
297 Ga0105247_10246143 3300009101 Bacteria 1220
298 Ga0114129_10008065 3300009147 Bacteria 15007
299 Ga0114129_10021791 3300009147 Bacteria 9096
300 Ga0114129_10039575 3300009147 Bacteria 6647
301 Ga0114129_10040478 3300009147 Bacteria 6569
302 Ga0114129_10091939 3300009147 Bacteria 4203
303 Ga0114129_10102673 3300009147 Bacteria 3954
304 Ga0114129_10103944 3300009147 Bacteria 3926
305 Ga0114129_10255212 3300009147 Bacteria 2352
306 Ga0114129_10644060 3300009147 Bacteria 1368
307 Ga0114129_10752145 3300009147 Bacteria 1248
308 Ga0114129_11409622 3300009147 Unclassified 859
309 Ga0105243_10015301 3300009148 Bacteria 5804
310 Ga0105243_10067131 3300009148 Unclassified 2887
311 Ga0105243_10154629 3300009148 Bacteria 1971
312 Ga0105243_10355420 3300009148 Bacteria 1347
313 Ga0105243_10728622 3300009148 Unclassified 970
314 Ga0105243_11184013 3300009148 Unclassified 776
315 Ga0105241_10087408 3300009174 Bacteria 2454
316 Ga0105241_10228887 3300009174 Unclassified 1566
317 Ga0105241_10674781 3300009174 Bacteria 941
318 Ga0105242_10012262 3300009176 Bacteria 6597
319 Ga0105242_10044981 3300009176 Bacteria 3576
320 Ga0105242_10400747 3300009176 Unclassified 1280
321 Ga0105242_10588065 3300009176 Bacteria 1073
322 Ga0105242_10954246 3300009176 Bacteria 862
323 Ga0105248_10011812 3300009177 Bacteria 9634
324 Ga0105248_10027169 3300009177 Bacteria 6366
325 Ga0105248_10274840 3300009177 Bacteria 1897
326 Ga0105248_10281528 3300009177 Bacteria 1872
327 Ga0105248_10360827 3300009177 Bacteria 1636
328 Ga0105248_10428598 3300009177 Unclassified 1490
329 Ga0105248_11406967 3300009177 Bacteria 789
330 Ga0105237_10265025 3300009545 Bacteria 1721
331 Ga0105237_10515783 3300009545 Unclassified 1202
332 Ga0105238_10008383 3300009551 Bacteria 10339
333 Ga0105238_10040699 3300009551 Bacteria 4709
334 Ga0105238_10185539 3300009551 Unclassified 2056
335 Ga0105238_10731453 3300009551 Bacteria 1003
336 Ga0105249_10017654 3300009553 Bacteria 6337
337 Ga0105249_10204558 3300009553 Bacteria 1934
338 Ga0105249_12222284 3300009553 Unclassified 621
339 Ga0099796_10005759 3300010159 Bacteria 3117
340 Ga0105239_10079529 3300010375 Bacteria 3607
341 Ga0105239_10190258 3300010375 Bacteria 2297
342 Ga0105239_10345322 3300010375 Bacteria 1680
343 Ga0105246_10293055 3300011119 Bacteria 1310
344 Ga0105246_10736608 3300011119 Bacteria 868
345 Ga0105246_11064717 3300011119 Bacteria 736
346 Ga0157369_10030006 3300013105 Bacteria 6000
347 Ga0157369_10201990 3300013105 Unclassified 2086
348 Ga0157369_11639597 3300013105 Bacteria 654
349 Ga0157374_10028827 3300013296 Bacteria 5019
350 Ga0157374_10109340 3300013296 Bacteria 2657
351 Ga0157374_10138644 3300013296 Bacteria 2360
352 Ga0157374_10322002 3300013296 Unclassified 1532
353 Ga0157374_11532744 3300013296 Unclassified 690
354 Ga0157374_11747112 3300013296 Bacteria 647
355 Ga0157378_10010601 3300013297 Bacteria 8055
356 Ga0157378_10030110 3300013297 Bacteria 4795
357 Ga0157378_10131292 3300013297 Bacteria 2319
358 Ga0157378_10264794 3300013297 Bacteria 1651
359 Ga0157378_10665819 3300013297 Bacteria 1058
360 Ga0163162_10523793 3300013306 Bacteria 1315
361 Ga0157372_10386304 3300013307 Bacteria 1631
362 Ga0157372_11156966 3300013307 Bacteria 894
363 Ga0157375_10008416 3300013308 Bacteria 9035
364 Ga0157375_10123341 3300013308 Bacteria 2703
365 Ga0157375_10181881 3300013308 Bacteria 2254
366 Ga0157375_10916427 3300013308 Bacteria 1020
367 Ga0157375_11315551 3300013308 Bacteria 850
368 Ga0157375_12337496 3300013308 Archaea 637
369 Ga0163163_10020746 3300014325 Bacteria 6193
370 Ga0163163_10607746 3300014325 Bacteria 1157
371 Ga0163163_11452316 3300014325 Bacteria 747
372 Ga0157380_10017015 3300014326 Bacteria 5371
373 Ga0157380_10085509 3300014326 Bacteria 2588
374 Ga0157380_10096165 3300014326 Bacteria 2455
375 Ga0157380_10143336 3300014326 Unclassified 2056
376 Ga0157380_10239949 3300014326 Bacteria 1633
377 Ga0157380_10546512 3300014326 Bacteria 1135
378 Ga0157380_10675744 3300014326 Bacteria 1034
379 Ga0157377_10055537 3300014745 Bacteria 2246
380 Ga0157379_10722673 3300014968 Bacteria 936
381 Ga0157379_11218164 3300014968 Unclassified 724
382 Ga0157376_10022962 3300014969 Bacteria 4873
383 Ga0157376_10078321 3300014969 Unclassified 2830
384 Ga0157376_10166998 3300014969 Bacteria 2000
385 Ga0157376_10313027 3300014969 Bacteria 1490
386 Ga0157376_10337512 3300014969 Bacteria 1438
387 Ga0157376_10553873 3300014969 Bacteria 1138
388 Ga0163161_10539744 3300017792 Bacteria 954
389 Ga0224712_10277304 3300022467 Unclassified 780
390 Ga0209147_100155 3300025229 Bacteria 93839
391 Ga0207656_10316035 3300025321 Unclassified 775
392 Ga0207653_10013702 3300025885 Bacteria 2540
393 Ga0207682_10074944 3300025893 Bacteria 1440
394 Ga0207642_10141684 3300025899 Bacteria 1268
395 Ga0207710_10099750 3300025900 Bacteria 1368
396 Ga0207688_10343944 3300025901 Bacteria 918
397 Ga0207680_10128853 3300025903 Bacteria 1665
398 Ga0207680_10131982 3300025903 Bacteria 1647
399 Ga0207680_10258693 3300025903 Unclassified 1204
400 Ga0207680_10394754 3300025903 Bacteria 977
401 Ga0207647_10113090 3300025904 Bacteria 1604
402 Ga0207685_10162133 3300025905 Bacteria 1022
403 Ga0207699_10072542 3300025906 Bacteria 2109
404 Ga0207699_10546861 3300025906 Bacteria 839
405 Ga0207699_10655034 3300025906 Bacteria 767
406 Ga0207645_10006229 3300025907 Bacteria 8572
407 Ga0207645_10069063 3300025907 Bacteria 2260
408 Ga0207645_10184593 3300025907 Bacteria 1369
409 Ga0207643_10003460 3300025908 Bacteria 8498
410 Ga0207643_10198778 3300025908 Bacteria 1220
411 Ga0207654_10046467 3300025911 Bacteria 2476
412 Ga0207654_10157655 3300025911 Unclassified 1463
413 Ga0207654_10622809 3300025911 Bacteria 771
414 Ga0207707_10120830 3300025912 Bacteria 2290
415 Ga0207707_10395319 3300025912 Unclassified 1187
416 Ga0207707_10526993 3300025912 Bacteria 1006
417 Ga0207707_10585552 3300025912 Bacteria 945
418 Ga0207707_10764527 3300025912 Bacteria 807
419 Ga0207707_10767414 3300025912 Bacteria 805
420 Ga0207695_10229148 3300025913 Unclassified 1763
421 Ga0207695_11125106 3300025913 Bacteria 665
422 Ga0207693_10022733 3300025915 Bacteria 4981
423 Ga0207693_10035419 3300025915 Bacteria 3936
424 Ga0207693_10142549 3300025915 Bacteria 1884
425 Ga0207663_10000828 3300025916 Bacteria 13994
426 Ga0207663_10292878 3300025916 Bacteria 1213
427 Ga0207663_10344079 3300025916 Bacteria 1127
428 Ga0207660_10179365 3300025917 Bacteria 1644
429 Ga0207660_10632512 3300025917 Bacteria 872
430 Ga0207662_10032509 3300025918 Bacteria 3038
431 Ga0207662_10144066 3300025918 Bacteria 1511
432 Ga0207662_10234207 3300025918 Bacteria 1200
433 Ga0207662_10299272 3300025918 Bacteria 1069
434 Ga0207662_10319344 3300025918 Bacteria 1036
435 Ga0207649_10299408 3300025920 Bacteria 1175
436 Ga0207652_10102288 3300025921 Bacteria 2532
437 Ga0207652_10346605 3300025921 Bacteria 1341
438 Ga0207646_10011093 3300025922 Bacteria 8748
439 Ga0207646_10037481 3300025922 Bacteria 4371
440 Ga0207646_10055712 3300025922 Bacteria 3534
441 Ga0207681_10002902 3300025923 Bacteria 10837
442 Ga0207681_10005270 3300025923 Bacteria 7942
443 Ga0207681_10036611 3300025923 Bacteria 3239
444 Ga0207681_10320463 3300025923 Bacteria 1232
445 Ga0207694_10049897 3300025924 Bacteria 3240
446 Ga0207694_10547227 3300025924 Bacteria 971
447 Ga0207650_10005494 3300025925 Bacteria 8651
448 Ga0207650_10024820 3300025925 Bacteria 4266
449 Ga0207650_11169813 3300025925 Bacteria 655
450 Ga0207659_10001772 3300025926 Bacteria 12765
451 Ga0207659_10060150 3300025926 Bacteria 2733
452 Ga0207659_10152347 3300025926 Bacteria 1807
453 Ga0207687_10022884 3300025927 Bacteria 4161
454 Ga0207687_10266071 3300025927 Bacteria 1369
455 Ga0207687_10356272 3300025927 Unclassified 1193
456 Ga0207700_10014728 3300025928 Bacteria 5133
457 Ga0207700_10034412 3300025928 Bacteria 3637
458 Ga0207700_10177709 3300025928 Bacteria 1780
459 Ga0207700_10221299 3300025928 Bacteria 1605
460 Ga0207700_10333277 3300025928 Bacteria 1317
461 Ga0207700_10416768 3300025928 Bacteria 1179
462 Ga0207664_10528688 3300025929 Bacteria 1057
463 Ga0207664_11076146 3300025929 Unclassified 719
464 Ga0207644_10088321 3300025931 Bacteria 2306
465 Ga0207644_10249988 3300025931 Bacteria 1414
466 Ga0207644_10364043 3300025931 Bacteria 1177
467 Ga0207706_10018920 3300025933 Bacteria 6193
468 Ga0207706_10082533 3300025933 Bacteria 2825
469 Ga0207706_10083758 3300025933 Bacteria 2804
470 Ga0207706_10245894 3300025933 Unclassified 1563
471 Ga0207706_10335720 3300025933 Bacteria 1315
472 Ga0207706_10573845 3300025933 Bacteria 970
473 Ga0207686_10007851 3300025934 Bacteria 5752
474 Ga0207686_10498455 3300025934 Bacteria 944
475 Ga0207709_10025110 3300025935 Bacteria 3409
476 Ga0207709_10074584 3300025935 Bacteria 2165
477 Ga0207709_10231311 3300025935 Bacteria 1339
478 Ga0207670_10039200 3300025936 Bacteria 3101
479 Ga0207670_10088977 3300025936 Bacteria 2179
480 Ga0207669_10629163 3300025937 Bacteria 875
481 Ga0207704_10008010 3300025938 Bacteria 5026
482 Ga0207704_10174758 3300025938 Unclassified 1545
483 Ga0207665_10000626 3300025939 Bacteria 23678
484 Ga0207665_10084466 3300025939 Bacteria 2191
485 Ga0207691_10052371 3300025940 Bacteria 3728
486 Ga0207691_10129364 3300025940 Bacteria 2231
487 Ga0207691_10216292 3300025940 Bacteria 1663
488 Ga0207691_10650470 3300025940 Bacteria 891
489 Ga0207691_10749443 3300025940 Bacteria 822
490 Ga0207711_10017308 3300025941 Bacteria 5989
491 Ga0207711_10149630 3300025941 Unclassified 2106
492 Ga0207711_10816202 3300025941 Unclassified 868
493 Ga0207711_10899476 3300025941 Bacteria 823
494 Ga0207711_10939045 3300025941 Bacteria 804
495 Ga0207711_11445836 3300025941 Unclassified 630
496 Ga0207689_10118929 3300025942 Bacteria 2173
497 Ga0207689_10296107 3300025942 Bacteria 1341
498 Ga0207689_10719748 3300025942 Unclassified 842
499 Ga0207689_10751458 3300025942 Bacteria 823
500 Ga0207661_10009719 3300025944 Bacteria 6905
501 Ga0207661_10096409 3300025944 Bacteria 2475
502 Ga0207661_10111269 3300025944 Bacteria 2317
503 Ga0207661_10215033 3300025944 Bacteria 1696
504 Ga0207661_11739329 3300025944 Bacteria 569
505 Ga0207679_10085404 3300025945 Unclassified 2424
506 Ga0207679_10267621 3300025945 Bacteria 1460
507 Ga0207679_10957186 3300025945 Bacteria 784
508 Ga0207667_10015602 3300025949 Bacteria 8618
509 Ga0207667_10175771 3300025949 Bacteria 2200
510 Ga0207651_10010667 3300025960 Bacteria 5104
511 Ga0207651_10108689 3300025960 Bacteria 2076
512 Ga0207651_10120737 3300025960 Bacteria 1987
513 Ga0207651_10176693 3300025960 Bacteria 1689
514 Ga0207651_10303233 3300025960 Bacteria 1329
515 Ga0207712_10003929 3300025961 Bacteria 9393
516 Ga0207712_11460866 3300025961 Bacteria 612
517 Ga0207668_10068691 3300025972 Bacteria 2520
518 Ga0207668_11037298 3300025972 Bacteria 734
519 Ga0207640_10063962 3300025981 Bacteria 2447
520 Ga0207658_10622769 3300025986 Bacteria 971
521 Ga0207658_10829681 3300025986 Bacteria 840
522 Ga0207677_10050514 3300026023 Bacteria 2813
523 Ga0207677_10115288 3300026023 Bacteria 2010
524 Ga0207677_10359074 3300026023 Unclassified 1223
525 Ga0207677_11349562 3300026023 Bacteria 656
526 Ga0207703_10007003 3300026035 Bacteria 8971
527 Ga0207639_10038425 3300026041 Bacteria 3560
528 Ga0207639_10977129 3300026041 Bacteria 793
529 Ga0207639_11092448 3300026041 Unclassified 748
530 Ga0207639_11204216 3300026041 Unclassified 711
531 Ga0207708_10021795 3300026075 Bacteria 4834
532 Ga0207708_10308962 3300026075 Bacteria 1288
533 Ga0207702_10211242 3300026078 Bacteria 1804
534 Ga0207702_10807045 3300026078 Bacteria 928
535 Ga0207641_10179142 3300026088 Bacteria 1940
536 Ga0207641_10188463 3300026088 Bacteria 1894
537 Ga0207641_10904875 3300026088 Bacteria 876
538 Ga0207641_11019404 3300026088 Bacteria 825
539 Ga0207648_10005118 3300026089 Bacteria 13285
540 Ga0207648_10023589 3300026089 Bacteria 5509
541 Ga0207648_10146600 3300026089 Bacteria 2082
542 Ga0207648_10151575 3300026089 Bacteria 2046
543 Ga0207648_11265020 3300026089 Unclassified 693
544 Ga0207676_10074704 3300026095 Bacteria 2732
545 Ga0207676_10090926 3300026095 Bacteria 2506
546 Ga0207676_10341671 3300026095 Bacteria 1381
547 Ga0207676_10392450 3300026095 Bacteria 1295
548 Ga0207676_10416992 3300026095 Bacteria 1258
549 Ga0207674_10019767 3300026116 Bacteria 7288
550 Ga0207674_10044070 3300026116 Bacteria 4598
551 Ga0207674_10591185 3300026116 Bacteria 1072
552 Ga0207675_100005677 3300026118 Bacteria 11941
553 Ga0207675_100008364 3300026118 Bacteria 9751
554 Ga0207675_100580755 3300026118 Bacteria 1122
555 Ga0207675_100625221 3300026118 Unclassified 1081
556 Ga0207675_100892257 3300026118 Unclassified 905
557 Ga0207675_101042357 3300026118 Bacteria 837
558 Ga0207683_10070792 3300026121 Bacteria 3082
559 Ga0207683_10631476 3300026121 Bacteria 992
560 Ga0207698_10105280 3300026142 Bacteria 2350
561 Ga0207698_10174534 3300026142 Bacteria 1896
562 Ga0207428_10000592 3300027907 Bacteria 42773
563 Ga0207428_10003760 3300027907 Bacteria 14571
564 Ga0207428_10023427 3300027907 Bacteria 5192
565 Ga0207428_10028470 3300027907 Bacteria 4642
566 Ga0207428_10072328 3300027907 Bacteria 2707
567 Ga0268266_10205547 3300028379 Bacteria 1804
568 Ga0268266_10209645 3300028379 Bacteria 1786
569 Ga0268265_10000485 3300028380 Bacteria 41537
570 Ga0268265_10065702 3300028380 Bacteria 2801
571 Ga0268265_10577665 3300028380 Unclassified 1071
572 Ga0268265_10792415 3300028380 Bacteria 923
573 Ga0268265_10911425 3300028380 Bacteria 864
574 Ga0268264_10014737 3300028381 Bacteria 6423
575 Ga0268264_10135905 3300028381 Bacteria 2186
576 Ga0268264_10329927 3300028381 Bacteria 1445
577 Ga0268264_10483655 3300028381 Bacteria 1205
578 Ga0268264_10618231 3300028381 Bacteria 1069
579 Ga0268264_11639279 3300028381 Bacteria 654
580 Ga0265336_10026712 3300028666 Bacteria 1813
581 Ga0265338_10218335 3300028800 Bacteria 1426
582 Ga0265760_10012496 3300031090 Bacteria 2428
583 Ga0265320_10111172 3300031240 Bacteria 1255
584 Ga0307408_100064860 3300031548 Bacteria 2677
585 Ga0307408_101186574 3300031548 Bacteria 711
586 Ga0307413_10012320 3300031824 Bacteria 4252
587 Ga0307410_10019421 3300031852 Bacteria 4134
588 Ga0307410_10111737 3300031852 Bacteria 1978
589 Ga0307410_10479250 3300031852 Bacteria 1020
590 Ga0307410_10804391 3300031852 Bacteria 800
591 Ga0307410_10986862 3300031852 Bacteria 726
592 Ga0307406_10255865 3300031901 Bacteria 1322
593 Ga0307407_10009690 3300031903 Bacteria 4500
594 Ga0307409_100021343 3300031995 Bacteria 4438
595 Ga0307409_100078951 3300031995 Bacteria 2650
596 Ga0307409_101876234 3300031995 Bacteria 629
597 Ga0307416_100008751 3300032002 Bacteria 6559
598 Ga0307416_100185490 3300032002 Bacteria 1955
599 Ga0307416_100486321 3300032002 Bacteria 1295
600 Ga0307414_10275647 3300032004 Bacteria 1411
601 Ga0307411_10037452 3300032005 Bacteria 3050
602 Ga0307411_10172656 3300032005 Bacteria 1632
603 Ga0307415_100011854 3300032126 Bacteria 5013
604 Ga0307415_100185628 3300032126 Bacteria 1636
605 Ga0307507_10051799 3300033179 Bacteria 3945
606 Ga0373948_0000724 3300034817 Bacteria 4300
607 Ga0373950_0003632 3300034818 Bacteria 2219
608 Ga0373958_0026305 3300034819 Unclassified 1113
609 Ga0373958_0073464 3300034819 Bacteria 763
610 Ga0373959_0005256 3300034820 Bacteria 2119
611 Ga0373938_0035439 3300034957 Unclassified 1088
612 Ga0373926_0028655 3300035083 Bacteria 1955
613 Ga0373926_0178215 3300035083 Bacteria 814
614 Ga0373928_0000662 3300035084 Bacteria 6779
615 Ga0373929_0003363 3300035085 Bacteria 2886
616 Ga0373934_0027268 3300035086 Bacteria 2219
617 Ga0373934_0042570 3300035086 Bacteria 1794
618 Ga0373940_0050848 3300035088 Unclassified 1164
619 Ga0373940_0094211 3300035088 Bacteria 901
620 Ga0373940_0218115 3300035088 Bacteria 633
621 Ga0373944_0276315 3300035089 Bacteria 625
622 Ga0373949_0001792 3300035090 Bacteria 5886
623 Ga0373949_0008199 3300035090 Bacteria 2289
624 Ga0373951_0009750 3300035091 Bacteria 2159
625 Ga0373952_0000417 3300035092 Bacteria 7342
626 Ga0373952_0042898 3300035092 Bacteria 1052
627 Ga0373923_0022324 3300035111 Bacteria 2481
628 Ga0373923_0047672 3300035111 Bacteria 1787
629 Ga0373923_0158116 3300035111 Bacteria 1033
630 Ga0373923_0266204 3300035111 Bacteria 805
631 Ga0373932_0002200 3300035112 Bacteria 5030
632 Ga0373936_0030441 3300035113 Bacteria 2128
633 Ga0373936_0056302 3300035113 Bacteria 1598
634 Ga0373936_0105594 3300035113 Bacteria 1192
635 Ga0373936_0186355 3300035113 Unclassified 912
636 Ga0373939_0000394 3300035114 Bacteria 11029
637 Ga0373939_0030314 3300035114 Bacteria 1555
638 Ga0373939_0204986 3300035114 Bacteria 748
639 Ga0373941_0003864 3300035115 Bacteria 3431
640 Ga0373941_0059681 3300035115 Bacteria 1238
641 Ga0373945_0009552 3300035116 Bacteria 3180
642 Ga0373956_0116751 3300035119 Bacteria 1245
643 Ga0373956_0434182 3300035119 Bacteria 627
644 Ga0373957_0038393 3300035120 Bacteria 1793
645 Ga0373957_0094351 3300035120 Bacteria 1192
646 Ga0373957_0278113 3300035120 Bacteria 707
647 Ga0373960_0000197 3300035121 Bacteria 10990
648 Ga0373943_0007046 3300035170 Bacteria 5044
649 Ga0373943_0047983 3300035170 Bacteria 2090
650 Ga0373946_0004137 3300035171 Bacteria 5167
651 Ga0373946_0013092 3300035171 Bacteria 3112
652 Ga0373946_0107666 3300035171 Bacteria 1258
653 Ga0373955_0064576 3300035172 Bacteria 2030
654 Ga0373955_0128687 3300035172 Bacteria 1477
655 Ga0373955_0173817 3300035172 Bacteria 1276
656 Ga0373955_0304219 3300035172 Unclassified 962
657 Ga0373955_0396382 3300035172 Bacteria 838
658 Ga0373942_0055043 3300035207 Unclassified 1125
659 Ga0373961_0001941 3300035241 Bacteria 5604
660 Ga0373962_0266447 3300035242 Unclassified 599
661 Ga0373924_0000041 3300035410 Bacteria 33035
662 Ga0373924_0011752 3300035410 Bacteria 3257
663 Ga0373924_0036807 3300035410 Bacteria 1990
664 Ga0373924_0063026 3300035410 Bacteria 1554
665 Ga0373931_0000978 3300035691 Bacteria 12094
666 Ga0373931_0125985 3300035691 Bacteria 1469
667 Ga0373935_0040333 3300035692 Unclassified 2930
668 Ga0373935_0068402 3300035692 Bacteria 2285
669 Ga0373935_0089341 3300035692 Bacteria 2014
670 Ga0373935_0153931 3300035692 Bacteria 1562
671 Ga0373935_0359397 3300035692 Bacteria 1039
672 Ga0373935_0448184 3300035692 Bacteria 932
673 Ga0373935_0575852 3300035692 Bacteria 822
674 Ga0373927_0013234 3300035695 Bacteria 5485
675 Ga0373927_0170508 3300035695 Unclassified 1426
676 Ga0373927_0218911 3300035695 Bacteria 1251
677 Ga0373927_0248601 3300035695 Bacteria 1169
678 Ga0373933_0158261 3300035724 Bacteria 1438
679 Ga0373947_0061841 3300035725 Bacteria 2276
680 Ga0373947_0077498 3300035725 Unclassified 2050
681 Ga0373947_0158447 3300035725 Bacteria 1462
682 Ga0373947_0429958 3300035725 Bacteria 893
683 Ga0373937_0000225 3300036401 Bacteria 54909
684 Ga0373937_0007134 3300036401 Bacteria 9656
685 Ga0373937_0039250 3300036401 Bacteria 4315
686 Ga0373937_0080180 3300036401 Bacteria 3018
687 Ga0373937_0172127 3300036401 Bacteria 2032
688 Ga0373937_0565703 3300036401 Bacteria 1080
689 Ga0373937_0873030 3300036401 Bacteria 848
690 Ga0373937_1053935 3300036401 Bacteria 762
691 Ga0373925_0116779 3300037068 Bacteria 2067
692 Ga0373925_0131189 3300037068 Bacteria 1954
693 Ga0373925_0136692 3300037068 Bacteria 1915
694 Ga0373925_0137218 3300037068 Bacteria 1912
695 Ga0373925_0137595 3300037068 Bacteria 1909
696 Ga0373925_0217947 3300037068 Bacteria 1522
697 Ga0373925_0352874 3300037068 Bacteria 1194
698 Ga0436363_0585404 3300039450 Bacteria 898
699 Ga0451804_0801631 3300041463 Bacteria 932
700 Ga0451853_2201637 3300041512 Bacteria 662
701 Ga0450894_036407 3300042131 Bacteria 698
702 Ga0439434_0071865 3300042435 Bacteria 1090
703 Ga0439440_0046891 3300042993 Bacteria 1069
704 Ga0466965_0100620 3300044683 Bacteria 1478
705 Ga0466965_0185679 3300044683 Bacteria 1098
706 Ga0466966_0288715 3300044684 Bacteria 986
707 Ga0466963_0018760 3300044694 Bacteria 4330
708 Ga0466963_0072065 3300044694 Bacteria 2326
709 Ga0466963_0255292 3300044694 Bacteria 1230
710 Ga0466964_0152633 3300044706 Bacteria 1072
711 Ga0466971_0217146 3300044719 Bacteria 905
712 Ga0466971_0327091 3300044719 Bacteria 739
713 Ga0466957_0001629 3300044842 Bacteria 11776
714 Ga0466957_0040962 3300044842 Bacteria 2800
715 Ga0466960_0080692 3300044901 Bacteria 1639
716 Ga0466959_0588410 3300045049 Unclassified 749
717 Ga0451576_0009698 3300045051 Bacteria 11138
718 Ga0451576_0025141 3300045051 Bacteria 6420
719 Ga0451576_0076152 3300045051 Bacteria 3492
720 Ga0451576_0161658 3300045051 Bacteria 2337
721 Ga0451576_0224161 3300045051 Bacteria 1963
722 Ga0451576_0748290 3300045051 Bacteria 1027
723 Ga0451576_0843756 3300045051 Unclassified 962
724 Ga0466958_0175530 3300045836 Bacteria 1358
725 Ga0466958_0176816 3300045836 Bacteria 1353
726 Ga0466967_0004769 3300045976 Bacteria 9234
727 Ga0466967_0227640 3300045976 Bacteria 1774
728 Ga0495592_0017680 3300046454 Bacteria 5418
729 Ga0495592_0021436 3300046454 Bacteria 4914
730 Ga0495592_0084794 3300046454 Bacteria 2285
731 Ga0495592_0444128 3300046454 Bacteria 814
732 Ga0495603_0032738 3300046455 Bacteria 3127
733 Ga0495603_0071185 3300046455 Bacteria 2044
734 Ga0495629_0088814 3300046459 Bacteria 2156
735 Ga0495641_0330210 3300046461 Bacteria 688
736 Ga0495651_0000793 3300046462 Bacteria 24515
737 Ga0495651_0071311 3300046462 Unclassified 2641
738 Ga0495651_0138202 3300046462 Bacteria 1770
739 Ga0495651_0187782 3300046462 Bacteria 1457
740 Ga0495653_0005283 3300046463 Bacteria 10507
741 Ga0495653_0020914 3300046463 Bacteria 5301
742 Ga0495580_0061699 3300046472 Unclassified 2631
743 Ga0495580_0097457 3300046472 Bacteria 2045
744 Ga0495580_0159876 3300046472 Bacteria 1559
745 Ga0495580_0353544 3300046472 Bacteria 995
746 Ga0495639_0025762 3300046475 Bacteria 2595
747 Ga0495639_0290905 3300046475 Bacteria 813
748 Ga0495639_0357297 3300046475 Bacteria 734
749 Ga0495639_0393636 3300046475 Bacteria 699
750 Ga0495662_0089095 3300046476 Bacteria 1503
751 Ga0495664_0009759 3300046477 Bacteria 5380
752 Ga0495664_0018376 3300046477 Bacteria 4004
753 Ga0495664_0061549 3300046477 Unclassified 2235
754 Ga0495664_0131016 3300046477 Bacteria 1518
755 Ga0495584_0064230 3300046491 Unclassified 1845
756 Ga0495584_0242924 3300046491 Bacteria 916
757 Ga0495594_0015489 3300046499 Bacteria 4006
758 Ga0495594_0051213 3300046499 Bacteria 2272
759 Ga0495608_0007214 3300046511 Bacteria 7863
760 Ga0495608_0027317 3300046511 Bacteria 3883
761 Ga0495618_0011523 3300046514 Bacteria 5364
762 Ga0495618_0013469 3300046514 Bacteria 4974
763 Ga0495628_0000589 3300046516 Bacteria 33428
764 Ga0495628_0009875 3300046516 Bacteria 8128
765 Ga0495628_0016860 3300046516 Bacteria 6088
766 Ga0495628_0202433 3300046516 Bacteria 1495
767 Ga0495628_0611960 3300046516 Bacteria 777
768 Ga0495630_0135724 3300046517 Bacteria 1869
769 Ga0495630_0409126 3300046517 Bacteria 1039
770 Ga0495630_0497332 3300046517 Bacteria 935
771 Ga0495630_0889861 3300046517 Bacteria 678
772 Ga0495643_0021593 3300046522 Bacteria 3691
773 Ga0495663_0040409 3300046525 Bacteria 1416
774 Ga0495663_0219331 3300046525 Bacteria 668
775 Ga0495663_0227689 3300046525 Bacteria 657
776 Ga0495666_0025290 3300046526 Unclassified 2932
777 Ga0495666_0049957 3300046526 Bacteria 2011
778 Ga0495642_0092654 3300046528 Bacteria 1280
779 Ga0495652_0022761 3300046529 Bacteria 5560
780 Ga0495652_0162009 3300046529 Bacteria 1735
781 Ga0495652_0603033 3300046529 Bacteria 749
782 Ga0495652_0855663 3300046529 Bacteria 602
783 Ga0495665_0002320 3300046531 Bacteria 10280
784 Ga0495640_0159480 3300046533 Bacteria 1446
785 Ga0495586_0004213 3300046535 Bacteria 7703
786 Ga0495586_0184352 3300046535 Bacteria 1181
787 Ga0495587_0000591 3300046536 Bacteria 24874
788 Ga0495587_0042909 3300046536 Bacteria 2695
789 Ga0495587_0059774 3300046536 Unclassified 2236
790 Ga0495598_0027076 3300046537 Bacteria 1578
791 Ga0495598_0044648 3300046537 Bacteria 1310
792 Ga0495598_0063592 3300046537 Bacteria 1145
793 Ga0495598_0067860 3300046537 Bacteria 1116
794 Ga0495598_0078498 3300046537 Bacteria 1054
795 Ga0495609_0131346 3300046538 Bacteria 1072
796 Ga0495621_0002713 3300046539 Bacteria 4799
797 Ga0495621_0004604 3300046539 Bacteria 3896
798 Ga0495621_0104714 3300046539 Unclassified 1080
799 Ga0495645_0003622 3300046543 Bacteria 10486
800 Ga0495645_0008699 3300046543 Bacteria 7089
801 Ga0495645_0027947 3300046543 Bacteria 4097
802 Ga0495645_0054607 3300046543 Bacteria 2902
803 Ga0495645_0473144 3300046543 Bacteria 787
804 Ga0495633_0281219 3300046558 Bacteria 757
805 Ga0495667_0006598 3300046559 Bacteria 7878
806 Ga0495667_0011701 3300046559 Bacteria 5941
807 Ga0495667_0188617 3300046559 Bacteria 1322
808 Ga0495656_0571089 3300046615 Unclassified 604
809 Ga0495634_0008578 3300046642 Bacteria 7589
810 Ga0495634_0037869 3300046642 Bacteria 3293
811 Ga0495634_0068214 3300046642 Bacteria 2350
812 Ga0495634_0194521 3300046642 Bacteria 1263
813 Ga0495611_0373619 3300046648 Unclassified 653
814 Ga0495635_0328675 3300046663 Bacteria 1022
815 Ga0495659_0004711 3300046664 Bacteria 4293
816 Ga0495659_0032273 3300046664 Bacteria 1832
817 Ga0495659_0051084 3300046664 Bacteria 1505
818 Ga0495659_0128011 3300046664 Bacteria 1005
819 Ga0495659_0170127 3300046664 Bacteria 883
820 Ga0495588_0002399 3300046674 Bacteria 8011
821 Ga0495657_0024342 3300046675 Unclassified 4314
822 Ga0495657_0024569 3300046675 Bacteria 4290
823 Ga0495657_0072447 3300046675 Bacteria 2247
824 Ga0495657_0183160 3300046675 Bacteria 1284
825 Ga0495599_0003547 3300046678 Bacteria 9137
826 Ga0495599_0042389 3300046678 Bacteria 2856
827 Ga0495599_0118390 3300046678 Bacteria 1647
828 Ga0495623_0029854 3300046679 Bacteria 3508
829 Ga0495623_0031919 3300046679 Bacteria 3386
830 Ga0495623_0103436 3300046679 Bacteria 1733
831 Ga0495646_0161395 3300046680 Unclassified 1240
832 Ga0495646_0170695 3300046680 Bacteria 1199
833 Ga0495647_0130578 3300046681 Bacteria 1064
834 Ga0495647_0192779 3300046681 Bacteria 891
835 Ga0495658_0032165 3300046683 Bacteria 2863
836 Ga0495669_0002615 3300046684 Bacteria 7366
837 Ga0495669_0016533 3300046684 Bacteria 3161
838 Ga0495669_0428356 3300046684 Bacteria 642
839 Ga0495669_0504288 3300046684 Bacteria 588
840 Ga0495613_0000156 3300046689 Bacteria 66824
841 Ga0495613_0021516 3300046689 Bacteria 4806
842 Ga0495613_0188182 3300046689 Bacteria 1460
843 Ga0495613_0432559 3300046689 Unclassified 894
844 Ga0495613_0448082 3300046689 Bacteria 875
845 Ga0495624_0016974 3300046690 Bacteria 4894
846 Ga0495624_0068516 3300046690 Bacteria 2212
847 Ga0495624_0179141 3300046690 Bacteria 1292
848 Ga0495600_0002070 3300046809 Bacteria 11320
849 Ga0495581_0050388 3300047315 Bacteria 2405
850 Ga0495581_0215726 3300047315 Bacteria 1122
851 Ga0495604_0000323 3300047317 Bacteria 42953
852 Ga0495604_0118638 3300047317 Unclassified 1917
853 Ga0495636_0011820 3300047318 Bacteria 3458
854 Ga0495636_0119356 3300047318 Bacteria 1165
855 Ga0495636_0139853 3300047318 Bacteria 1081
856 Ga0495674_0010221 3300047319 Bacteria 8886
857 Ga0495674_0067517 3300047319 Bacteria 3098
858 Ga0495674_0098386 3300047319 Bacteria 2491
859 Ga0495672_0463122 3300047320 Bacteria 569
860 Ga0495676_0417748 3300047321 Bacteria 888
861 Ga0495676_0515794 3300047321 Bacteria 783
862 Ga0495680_0010538 3300047322 Bacteria 8251
863 Ga0495680_0030111 3300047322 Bacteria 4436
864 Ga0495675_0000155 3300047444 Bacteria 48300
865 Ga0495675_0060996 3300047444 Bacteria 2389
866 Ga0495675_0191871 3300047444 Bacteria 1247
867 Ga0495675_0294825 3300047444 Bacteria 964
868 Ga0495677_0083043 3300047445 Bacteria 1202
869 Ga0495677_0280225 3300047445 Bacteria 654
870 Ga0495684_0000087 3300047471 Bacteria 64920
871 Ga0495684_0005550 3300047471 Bacteria 9830
872 Ga0495684_0076211 3300047471 Bacteria 2547
873 Ga0495684_0245418 3300047471 Bacteria 1305
874 Ga0495684_0568826 3300047471 Bacteria 769
875 Ga0495593_0036992 3300047673 Unclassified 2643
876 Ga0495602_0062770 3300048088 Unclassified 3222
877 Ga0495602_0207059 3300048088 Bacteria 1492
878 Ga0495602_0305317 3300048088 Bacteria 1163
879 Ga0495614_0031678 3300048089 Bacteria 2276
880 Ga0496100_0048123 3300048903 Bacteria 2751
881 Ga0496101_0001189 3300048904 Bacteria 15572
882 Ga0496102_0012504 3300048905 Bacteria 7350
883 Ga0496102_0107251 3300048905 Bacteria 2601
884 Ga0496102_1303648 3300048905 Bacteria 645
885 Ga0496104_0229309 3300048907 Bacteria 1769
886 Ga0496104_0608405 3300048907 Unclassified 1003
887 Ga0496105_0028973 3300048908 Bacteria 4530
888 Ga0496106_0135530 3300048909 Bacteria 1934
889 Ga0496106_0860708 3300048909 Bacteria 717
890 Ga0496107_0195514 3300048910 Unclassified 1503
891 Ga0496109_0384312 3300048912 Bacteria 1326
892 Ga0496109_0763318 3300048912 Bacteria 905
893 Ga0496110_0011808 3300048913 Bacteria 7170
894 Ga0496111_0009322 3300048914 Bacteria 6546
895 Ga0496112_0047672 3300048915 Bacteria 4203
896 Ga0496112_0184625 3300048915 Bacteria 2049
897 Ga0496112_1179273 3300048915 Bacteria 683
898 Ga0496113_0002200 3300048916 Bacteria 11247
899 Ga0496113_0255507 3300048916 Bacteria 1399
900 Ga0496114_0000423 3300048917 Bacteria 31229
901 Ga0496114_0201737 3300048917 Bacteria 1742
902 Ga0496114_0671444 3300048917 Unclassified 910
903 Ga0496114_0949513 3300048917 Unclassified 742
904 Ga0496114_1132759 3300048917 Bacteria 668
905 Ga0501298_097940 3300049521 Bacteria 665
906 Ga0501036_0136070 3300049572 Bacteria 2074
907 Ga0501040_0220223 3300049576 Bacteria 1350
908 Ga0501041_0787920 3300049577 Bacteria 609
909 Ga0501042_0000065 3300049578 Bacteria 38092
910 Ga0501046_0812071 3300049580 Bacteria 655
911 Ga0501048_0097980 3300049582 Bacteria 2069
912 Ga0501067_0222968 3300049583 Bacteria 1050
913 Ga0501069_0233699 3300049585 Bacteria 1071
914 Ga0501072_0483151 3300049588 Bacteria 980
915 Ga0501075_0315948 3300049591 Bacteria 1190
916 Ga0501075_1111933 3300049591 Bacteria 600
917 Ga0501076_0192654 3300049592 Bacteria 1664
918 Ga0501076_0507548 3300049592 Bacteria 994
919 Ga0501079_0553431 3300049741 Bacteria 905
920 Ga0501081_0070945 3300049743 Bacteria 2428
921 Ga0501045_0076771 3300049824 Bacteria 2462
922 Ga0501045_1131598 3300049824 Bacteria 572
923 nmdc:mga06z11_658198_c1 3300050494 Bacteria 638
924 nmdc:mga05p37_137575_c1 3300050507 Unclassified 2994
925 nmdc:mga05p37_155458_c1 3300050507 Bacteria 2795
926 nmdc:mga05p37_163934_c1 3300050507 Bacteria 2713
927 nmdc:mga05p37_321894_c1 3300050507 Bacteria 1830
928 nmdc:mga05p37_336272_c1 3300050507 Unclassified 1782
929 nmdc:mga05p37_48721_c1 3300050507 Bacteria 5210
930 nmdc:mga05p37_54751_c1 3300050507 Bacteria 4908
931 nmdc:mga05p37_5997_c1 3300050507 Bacteria 14305
932 nmdc:mga05p37_84224_c1 3300050507 Bacteria 3917
933 nmdc:mga05p37_8871_c1 3300050507 Bacteria 11878
934 nmdc:mga09592_1063_c1 3300050508 Bacteria 21797
935 nmdc:mga09592_17640_c1 3300050508 Bacteria 5850
936 nmdc:mga09592_252203_c1 3300050508 Bacteria 1530
937 nmdc:mga09592_363863_c1 3300050508 Bacteria 1251
938 nmdc:mga09592_450245_c1 3300050508 Bacteria 1111
939 nmdc:mga09592_8416_c1 3300050508 Bacteria 8386
940 nmdc:mga0qj67_1322_c1 3300050509 Bacteria 12051
941 nmdc:mga0qj67_143396_c1 3300050509 Bacteria 1937
942 nmdc:mga0qj67_578069_c1 3300050509 Bacteria 900
943 nmdc:mga0qj67_71883_c1 3300050509 Bacteria 2761
944 nmdc:mga06r32_1437932_c1 3300050510 Unclassified 631
945 nmdc:mga06r32_143805_c1 3300050510 Bacteria 2362
946 nmdc:mga06r32_15063_c1 3300050510 Bacteria 7022
947 nmdc:mga06r32_189927_c1 3300050510 Bacteria 2042
948 nmdc:mga06r32_6362_c1 3300050510 Bacteria 10613
949 nmdc:mga08y16_247020_c1 3300050511 Bacteria 1844
950 nmdc:mga08y16_26870_c1 3300050511 Bacteria 6066
951 nmdc:mga08y16_2706_c1 3300050511 Bacteria 18192
952 nmdc:mga08y16_416073_c1 3300050511 Bacteria 1374
953 nmdc:mga08y16_43741_c1 3300050511 Bacteria 4694
954 nmdc:mga08y16_96564_c1 3300050511 Bacteria 3078
955 nmdc:mga0n895_108215_c1 3300050512 Unclassified 2794
956 nmdc:mga0n895_1115874_c1 3300050512 Bacteria 766
957 nmdc:mga0n895_119371_c1 3300050512 Unclassified 2658
958 nmdc:mga0n895_148619_c1 3300050512 Bacteria 2372
959 nmdc:mga0n895_37063_c1 3300050512 Bacteria 4714
960 nmdc:mga0n895_379842_c1 3300050512 Bacteria 1430
961 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
962 nmdc:mga0n895_38297_c1 3300050512 Bacteria 4644
963 nmdc:mga0n895_47985_c1 3300050512 Bacteria 4178
964 nmdc:mga0n895_574_c1 3300050512 Bacteria 25246
965 nmdc:mga0n895_7430_c1 3300050512 Bacteria 9402
966 nmdc:mga0n895_876126_c1 3300050512 Bacteria 884
967 nmdc:mga0rr50_1039101_c1 3300050513 Bacteria 698
968 nmdc:mga0rr50_1173164_c1 3300050513 Bacteria 653
969 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
970 nmdc:mga0rr50_1724_c1 3300050513 Bacteria 12052
971 nmdc:mga0rr50_35177_c1 3300050513 Bacteria 3595
972 nmdc:mga0rr50_37823_c1 3300050513 Bacteria 3487
973 nmdc:mga0rr50_595873_c1 3300050513 Bacteria 942
974 nmdc:mga0rr50_694666_c1 3300050513 Unclassified 868
975 nmdc:mga0rr50_85758_c1 3300050513 Bacteria 2441
976 nmdc:mga0rr50_866586_c1 3300050513 Bacteria 770
977 nmdc:mga08x19_111707_c1 3300050514 Bacteria 1824
978 nmdc:mga08x19_170913_c1 3300050514 Bacteria 1480
979 nmdc:mga08x19_275_c1 3300050514 Bacteria 38855
980 nmdc:mga08x19_803569_c1 3300050514 Bacteria 668
981 nmdc:mga0a205_150611_c1 3300050515 Unclassified 2226
982 nmdc:mga0a205_169318_c1 3300050515 Unclassified 2080
983 nmdc:mga0a205_5377_c1 3300050515 Bacteria 11544
984 nmdc:mga0a205_58744_c1 3300050515 Bacteria 3715
985 nmdc:mga0a205_813_c1 3300050515 Bacteria 25396
986 nmdc:mga0a205_91983_c1 3300050515 Bacteria 2931
987 Ga0495601_0017354 3300053077 Bacteria 4368
988 Ga0495601_0027605 3300053077 Bacteria 3510
989 Ga0495601_0068658 3300053077 Bacteria 2259
990 Ga0495601_0204544 3300053077 Bacteria 1290
991 Ga0495601_0762754 3300053077 Bacteria 615
992 Ga0495612_0022792 3300053078 Bacteria 2510
993 Ga0495619_0005404 3300053085 Bacteria 8095
994 Ga0495619_0015732 3300053085 Bacteria 4790
995 Ga0495619_0040752 3300053085 Bacteria 3036
996 Ga0495619_0206099 3300053085 Bacteria 1361
997 Ga0501082_0262091 3300060353 Bacteria 1504
998 Ga0466962_0017687 3300061719 Bacteria 3432
999 Ga0466962_0144677 3300061719 Bacteria 1152

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100007200 Ga0070707_1000072008 157
2 3300005468 Ga0070707_100080166 Ga0070707_1000801662 157
3 3300005518 Ga0070699_100788126 Ga0070699_1007881261 157
4 3300005544 Ga0070686_100440496 Ga0070686_1004404961 157
5 3300006173 Ga0070716_100041278 Ga0070716_1000412783 157
6 3300006871 Ga0075434_100000026 Ga0075434_10000002642 157
7 3300006871 Ga0075434_100066668 Ga0075434_1000666682 157
8 3300006914 Ga0075436_100000600 Ga0075436_10000060019 157
9 3300007076 Ga0075435_100000017 Ga0075435_10000001751 157
10 3300025922 Ga0207646_10011093 Ga0207646_100110937 157
11 3300025922 Ga0207646_10055712 Ga0207646_100557122 157
12 3300025939 Ga0207665_10084466 Ga0207665_100844662 157
13 3300044901 Ga0466960_0080692 Ga0466960_0080692_904_1386 157
14 3300048912 Ga0496109_0763318 Ga0496109_0763318_351_830 157
15 3300050512 nmdc:mga0n895_37_c1 nmdc:mga0n895_37_c1_29615_30091 157
16 3300050513 nmdc:mga0rr50_14_c1 nmdc:mga0rr50_14_c1_97396_97872 157
17 3300050514 nmdc:mga08x19_275_c1 nmdc:mga08x19_275_c1_18599_19075 157
18 3300005293 Ga0065715_10750698 Ga0065715_107506982 158
19 3300005330 Ga0070690_100798290 Ga0070690_1007982902 158
20 3300005331 Ga0070670_101451578 Ga0070670_1014515781 158
21 3300005343 Ga0070687_100061165 Ga0070687_1000611651 158
22 3300005457 Ga0070662_100060308 Ga0070662_1000603082 158
23 3300005459 Ga0068867_101752232 Ga0068867_1017522321 158
24 3300005543 Ga0070672_101723492 Ga0070672_1017234921 158
25 3300005545 Ga0070695_100127042 Ga0070695_1001270422 158
26 3300005719 Ga0068861_100051200 Ga0068861_1000512003 158
27 3300005843 Ga0068860_100420304 Ga0068860_1004203042 158
28 3300006844 Ga0075428_100748144 Ga0075428_1007481442 158
29 3300009094 Ga0111539_10035363 Ga0111539_100353635 158
30 3300009148 Ga0105243_11184013 Ga0105243_111840131 158
31 3300009177 Ga0105248_10274840 Ga0105248_102748402 158
32 3300025901 Ga0207688_10343944 Ga0207688_103439441 158
33 3300025906 Ga0207699_10655034 Ga0207699_106550342 158
34 3300025918 Ga0207662_10234207 Ga0207662_102342072 158
35 3300025925 Ga0207650_11169813 Ga0207650_111698131 158
36 3300025933 Ga0207706_10083758 Ga0207706_100837582 158
37 3300025949 Ga0207667_10175771 Ga0207667_101757712 158
38 3300025960 Ga0207651_10120737 Ga0207651_101207372 158
39 3300026118 Ga0207675_100580755 Ga0207675_1005807552 158
40 3300027907 Ga0207428_10028470 Ga0207428_100284702 158
41 3300028381 Ga0268264_10329927 Ga0268264_103299272 158
42 3300028381 Ga0268264_10483655 Ga0268264_104836552 158
43 3300035242 Ga0373962_0266447 Ga0373962_0266447_82_564 158
44 3300035725 Ga0373947_0429958 Ga0373947_0429958_76_555 158
45 3300044719 Ga0466971_0327091 Ga0466971_0327091_155_640 158
46 3300046537 Ga0495598_0067860 Ga0495598_0067860_138_620 158
47 3300050511 nmdc:mga08y16_26870_c1 nmdc:mga08y16_26870_c1_1008_1490 158
48 3300050514 nmdc:mga08x19_111707_c1 nmdc:mga08x19_111707_c1_127_609 158
49 3300005329 Ga0070683_100281589 Ga0070683_1002815892 159
50 3300005458 Ga0070681_11347782 Ga0070681_113477822 159
51 3300005468 Ga0070707_100723962 Ga0070707_1007239622 159
52 3300005535 Ga0070684_100238927 Ga0070684_1002389272 159
53 3300009553 Ga0105249_12222284 Ga0105249_122222842 159
54 3300025944 Ga0207661_10215033 Ga0207661_102150332 159
55 3300044683 Ga0466965_0100620 Ga0466965_0100620_391_879 159
56 3300044683 Ga0466965_0185679 Ga0466965_0185679_415_903 159
57 3300044694 Ga0466963_0018760 Ga0466963_0018760_1992_2480 159
58 3300044694 Ga0466963_0072065 Ga0466963_0072065_327_815 159
59 3300044694 Ga0466963_0255292 Ga0466963_0255292_339_848 159
60 3300044706 Ga0466964_0152633 Ga0466964_0152633_527_1015 159
61 3300044719 Ga0466971_0217146 Ga0466971_0217146_388_876 159
62 3300044842 Ga0466957_0040962 Ga0466957_0040962_794_1282 159
63 3300045836 Ga0466958_0175530 Ga0466958_0175530_627_1115 159
64 3300045836 Ga0466958_0176816 Ga0466958_0176816_244_732 159
65 3300045976 Ga0466967_0004769 Ga0466967_0004769_1106_1615 159
66 3300045976 Ga0466967_0227640 Ga0466967_0227640_882_1370 159
67 3300048915 Ga0496112_0184625 Ga0496112_0184625_818_1306 159
68 3300048917 Ga0496114_0201737 Ga0496114_0201737_1130_1615 159
69 3300061719 Ga0466962_0017687 Ga0466962_0017687_211_699 159
70 3300061719 Ga0466962_0144677 Ga0466962_0144677_604_1092 159
71 3300005343 Ga0070687_100196382 Ga0070687_1001963821 160
72 3300005343 Ga0070687_100197999 Ga0070687_1001979992 160
73 3300005353 Ga0070669_100471062 Ga0070669_1004710622 160
74 3300005364 Ga0070673_100095316 Ga0070673_1000953163 160
75 3300005438 Ga0070701_10040427 Ga0070701_100404272 160
76 3300005440 Ga0070705_100061747 Ga0070705_1000617473 160
77 3300005444 Ga0070694_100044903 Ga0070694_1000449033 160
78 3300005543 Ga0070672_101265810 Ga0070672_1012658101 160
79 3300005544 Ga0070686_100026526 Ga0070686_1000265263 160
80 3300005544 Ga0070686_100494399 Ga0070686_1004943992 160
81 3300005545 Ga0070695_100005772 Ga0070695_1000057724 160
82 3300005546 Ga0070696_100005384 Ga0070696_1000053846 160
83 3300005546 Ga0070696_100006916 Ga0070696_1000069163 160
84 3300005549 Ga0070704_100001828 Ga0070704_1000018284 160
85 3300005578 Ga0068854_100011869 Ga0068854_1000118695 160
86 3300005719 Ga0068861_100033182 Ga0068861_1000331823 160
87 3300005843 Ga0068860_101670818 Ga0068860_1016708181 160
88 3300006881 Ga0068865_100026112 Ga0068865_1000261122 160
89 3300007076 Ga0075435_100004530 Ga0075435_1000045303 160
90 3300009148 Ga0105243_10015301 Ga0105243_100153015 160
91 3300009148 Ga0105243_10355420 Ga0105243_103554201 160
92 3300009174 Ga0105241_10228887 Ga0105241_102288872 160
93 3300009174 Ga0105241_10674781 Ga0105241_106747812 160
94 3300009176 Ga0105242_10400747 Ga0105242_104007472 160
95 3300009177 Ga0105248_10360827 Ga0105248_103608272 160
96 3300025903 Ga0207680_10258693 Ga0207680_102586932 160
97 3300025907 Ga0207645_10006229 Ga0207645_100062299 160
98 3300025911 Ga0207654_10157655 Ga0207654_101576552 160
99 3300025911 Ga0207654_10622809 Ga0207654_106228092 160
100 3300025918 Ga0207662_10144066 Ga0207662_101440661 160
101 3300025923 Ga0207681_10005270 Ga0207681_100052706 160
102 3300025935 Ga0207709_10025110 Ga0207709_100251103 160
103 3300025938 Ga0207704_10008010 Ga0207704_100080104 160
104 3300025940 Ga0207691_10650470 Ga0207691_106504701 160
105 3300025941 Ga0207711_11445836 Ga0207711_114458361 160
106 3300025960 Ga0207651_10108689 Ga0207651_101086892 160
107 3300026118 Ga0207675_100005677 Ga0207675_1000056775 160
108 3300028381 Ga0268264_11639279 Ga0268264_116392791 160
109 3300034817 Ga0373948_0000724 Ga0373948_0000724_136_624 160
110 3300034818 Ga0373950_0003632 Ga0373950_0003632_810_1298 160
111 3300034819 Ga0373958_0026305 Ga0373958_0026305_376_864 160
112 3300034820 Ga0373959_0005256 Ga0373959_0005256_363_851 160
113 3300034957 Ga0373938_0035439 Ga0373938_0035439_455_943 160
114 3300035084 Ga0373928_0000662 Ga0373928_0000662_1335_1823 160
115 3300035085 Ga0373929_0003363 Ga0373929_0003363_521_1009 160
116 3300035088 Ga0373940_0050848 Ga0373940_0050848_156_644 160
117 3300035090 Ga0373949_0001792 Ga0373949_0001792_4939_5427 160
118 3300035091 Ga0373951_0009750 Ga0373951_0009750_649_1137 160
119 3300035092 Ga0373952_0000417 Ga0373952_0000417_1358_1846 160
120 3300035112 Ga0373932_0002200 Ga0373932_0002200_2826_3314 160
121 3300035114 Ga0373939_0000394 Ga0373939_0000394_9592_10080 160
122 3300035115 Ga0373941_0003864 Ga0373941_0003864_1224_1712 160
123 3300035121 Ga0373960_0000197 Ga0373960_0000197_130_618 160
124 3300035207 Ga0373942_0055043 Ga0373942_0055043_237_725 160
125 3300035241 Ga0373961_0001941 Ga0373961_0001941_1160_1648 160
126 3300035691 Ga0373931_0000978 Ga0373931_0000978_654_1142 160
127 3300045051 Ga0451576_0009698 Ga0451576_0009698_6333_6821 160
128 3300045051 Ga0451576_0843756 Ga0451576_0843756_351_836 160
129 3300046454 Ga0495592_0444128 Ga0495592_0444128_48_554 160
130 3300046529 Ga0495652_0603033 Ga0495652_0603033_99_605 160
131 3300048905 Ga0496102_0107251 Ga0496102_0107251_1104_1592 160
132 3300048909 Ga0496106_0135530 Ga0496106_0135530_298_786 160
133 3300050512 nmdc:mga0n895_38297_c1 nmdc:mga0n895_38297_c1_263_751 160
134 3300050513 nmdc:mga0rr50_1724_c1 nmdc:mga0rr50_1724_c1_10175_10663 160
135 3300050514 nmdc:mga08x19_170913_c1 nmdc:mga08x19_170913_c1_588_1076 160
136 3300053085 Ga0495619_0206099 Ga0495619_0206099_725_1231 160
137 3300005458 Ga0070681_11178390 Ga0070681_111783901 161
138 3300005468 Ga0070707_100316489 Ga0070707_1003164892 161
139 3300005530 Ga0070679_101126194 Ga0070679_1011261942 161
140 3300006058 Ga0075432_10154696 Ga0075432_101546962 161
141 3300006237 Ga0097621_100003000 Ga0097621_1000030007 161
142 3300006358 Ga0068871_100005784 Ga0068871_1000057847 161
143 3300006844 Ga0075428_100603093 Ga0075428_1006030932 161
144 3300006880 Ga0075429_100046300 Ga0075429_1000463003 161
145 3300009147 Ga0114129_10091939 Ga0114129_100919393 161
146 3300013307 Ga0157372_11156966 Ga0157372_111569662 161
147 3300014326 Ga0157380_10675744 Ga0157380_106757442 161
148 3300014969 Ga0157376_10022962 Ga0157376_100229622 161
149 3300025912 Ga0207707_10764527 Ga0207707_107645272 161
150 3300025921 Ga0207652_10346605 Ga0207652_103466052 161
151 3300026089 Ga0207648_11265020 Ga0207648_112650202 161
152 3300028666 Ga0265336_10026712 Ga0265336_100267122 161
153 3300031240 Ga0265320_10111172 Ga0265320_101111722 161
154 3300033179 Ga0307507_10051799 Ga0307507_100517993 161
155 3300035114 Ga0373939_0204986 Ga0373939_0204986_211_702 161
156 3300035692 Ga0373935_0575852 Ga0373935_0575852_172_663 161
157 3300046475 Ga0495639_0025762 Ga0495639_0025762_944_1435 161
158 3300046535 Ga0495586_0184352 Ga0495586_0184352_467_958 161
159 3300046681 Ga0495647_0130578 Ga0495647_0130578_529_1020 161
160 3300047315 Ga0495581_0050388 Ga0495581_0050388_1740_2231 161
161 3300049572 Ga0501036_0136070 Ga0501036_0136070_1009_1569 161
162 3300049576 Ga0501040_0220223 Ga0501040_0220223_751_1311 161
163 3300049580 Ga0501046_0812071 Ga0501046_0812071_77_637 161
164 3300049582 Ga0501048_0097980 Ga0501048_0097980_1456_2016 161
165 3300049585 Ga0501069_0233699 Ga0501069_0233699_263_823 161
166 3300049588 Ga0501072_0483151 Ga0501072_0483151_32_592 161
167 3300049591 Ga0501075_0315948 Ga0501075_0315948_432_992 161
168 3300049592 Ga0501076_0192654 Ga0501076_0192654_882_1442 161
169 3300049741 Ga0501079_0553431 Ga0501079_0553431_114_674 161
170 3300049743 Ga0501081_0070945 Ga0501081_0070945_1771_2331 161
171 3300049824 Ga0501045_0076771 Ga0501045_0076771_755_1315 161
172 3300050494 nmdc:mga06z11_658198_c1 nmdc:mga06z11_658198_c1_64_558 161
173 3300050507 nmdc:mga05p37_336272_c1 nmdc:mga05p37_336272_c1_1148_1639 161
174 3300050507 nmdc:mga05p37_54751_c1 nmdc:mga05p37_54751_c1_1394_1885 161
175 3300050508 nmdc:mga09592_450245_c1 nmdc:mga09592_450245_c1_557_1048 161
176 3300050510 nmdc:mga06r32_143805_c1 nmdc:mga06r32_143805_c1_98_589 161
177 3300050513 nmdc:mga0rr50_694666_c1 nmdc:mga0rr50_694666_c1_10_501 161
178 3300050515 nmdc:mga0a205_169318_c1 nmdc:mga0a205_169318_c1_102_593 161
179 3300060353 Ga0501082_0262091 Ga0501082_0262091_313_873 161
180 3300005436 Ga0070713_100008727 Ga0070713_1000087275 162
181 3300005548 Ga0070665_100673562 Ga0070665_1006735622 162
182 3300005578 Ga0068854_100763491 Ga0068854_1007634912 162
183 3300006844 Ga0075428_100734863 Ga0075428_1007348632 162
184 3300006852 Ga0075433_10131072 Ga0075433_101310722 162
185 3300009147 Ga0114129_10255212 Ga0114129_102552122 162
186 3300009176 Ga0105242_10588065 Ga0105242_105880652 162
187 3300009177 Ga0105248_10011812 Ga0105248_100118126 162
188 3300009177 Ga0105248_11406967 Ga0105248_114069671 162
189 3300013297 Ga0157378_10010601 Ga0157378_100106016 162
190 3300014969 Ga0157376_10553873 Ga0157376_105538732 162
191 3300025928 Ga0207700_10333277 Ga0207700_103332772 162
192 3300025934 Ga0207686_10498455 Ga0207686_104984552 162
193 3300025938 Ga0207704_10174758 Ga0207704_101747582 162
194 3300025941 Ga0207711_10017308 Ga0207711_100173082 162
195 3300025941 Ga0207711_10899476 Ga0207711_108994762 162
196 3300025941 Ga0207711_10939045 Ga0207711_109390452 162
197 3300028379 Ga0268266_10209645 Ga0268266_102096451 162
198 3300031995 Ga0307409_101876234 Ga0307409_1018762341 162
199 3300035086 Ga0373934_0042570 Ga0373934_0042570_135_650 162
200 3300035120 Ga0373957_0094351 Ga0373957_0094351_363_878 162
201 3300035171 Ga0373946_0107666 Ga0373946_0107666_468_983 162
202 3300035695 Ga0373927_0218911 Ga0373927_0218911_51_566 162
203 3300035724 Ga0373933_0158261 Ga0373933_0158261_319_834 162
204 3300036401 Ga0373937_0039250 Ga0373937_0039250_1335_1850 162
205 3300036401 Ga0373937_0873030 Ga0373937_0873030_276_770 162
206 3300037068 Ga0373925_0137218 Ga0373925_0137218_599_1114 162
207 3300039450 Ga0436363_0585404 Ga0436363_0585404_178_672 162
208 3300046459 Ga0495629_0088814 Ga0495629_0088814_278_793 162
209 3300046517 Ga0495630_0497332 Ga0495630_0497332_226_741 162
210 3300046543 Ga0495645_0473144 Ga0495645_0473144_104_619 162
211 3300046642 Ga0495634_0068214 Ga0495634_0068214_1431_1925 162
212 3300046679 Ga0495623_0031919 Ga0495623_0031919_526_1041 162
213 3300046684 Ga0495669_0504288 Ga0495669_0504288_61_555 162
214 3300047321 Ga0495676_0417748 Ga0495676_0417748_121_615 162
215 3300050507 nmdc:mga05p37_137575_c1 nmdc:mga05p37_137575_c1_2313_2807 162
216 3300050510 nmdc:mga06r32_1437932_c1 nmdc:mga06r32_1437932_c1_70_564 162
217 3300050514 nmdc:mga08x19_803569_c1 nmdc:mga08x19_803569_c1_93_587 162
218 3300005335 Ga0070666_10734973 Ga0070666_107349731 163
219 3300005444 Ga0070694_100963429 Ga0070694_1009634292 163
220 3300005466 Ga0070685_10275614 Ga0070685_102756142 163
221 3300005549 Ga0070704_100310949 Ga0070704_1003109492 163
222 3300005841 Ga0068863_101385447 Ga0068863_1013854471 163
223 3300005841 Ga0068863_101673793 Ga0068863_1016737931 163
224 3300006358 Ga0068871_100073686 Ga0068871_1000736863 163
225 3300006871 Ga0075434_100719973 Ga0075434_1007199732 163
226 3300006881 Ga0068865_100640234 Ga0068865_1006402342 163
227 3300006931 Ga0097620_101220627 Ga0097620_1012206272 163
228 3300009098 Ga0105245_10334890 Ga0105245_103348902 163
229 3300009148 Ga0105243_10728622 Ga0105243_107286222 163
230 3300009176 Ga0105242_10044981 Ga0105242_100449813 163
231 3300009177 Ga0105248_10428598 Ga0105248_104285981 163
232 3300011119 Ga0105246_11064717 Ga0105246_110647172 163
233 3300013308 Ga0157375_10123341 Ga0157375_101233412 163
234 3300014968 Ga0157379_10722673 Ga0157379_107226732 163
235 3300014969 Ga0157376_10078321 Ga0157376_100783213 163
236 3300025927 Ga0207687_10356272 Ga0207687_103562722 163
237 3300025931 Ga0207644_10364043 Ga0207644_103640432 163
238 3300025941 Ga0207711_10816202 Ga0207711_108162022 163
239 3300026041 Ga0207639_11204216 Ga0207639_112042161 163
240 3300026088 Ga0207641_10904875 Ga0207641_109048751 163
241 3300026118 Ga0207675_101042357 Ga0207675_1010423572 163
242 3300035111 Ga0373923_0158116 Ga0373923_0158116_174_668 163
243 3300044684 Ga0466966_0288715 Ga0466966_0288715_314_811 163
244 3300046477 Ga0495664_0061549 Ga0495664_0061549_1712_2206 163
245 3300046491 Ga0495584_0064230 Ga0495584_0064230_797_1306 163
246 3300046525 Ga0495663_0219331 Ga0495663_0219331_100_609 163
247 3300046537 Ga0495598_0063592 Ga0495598_0063592_254_859 163
248 3300046543 Ga0495645_0003622 Ga0495645_0003622_215_709 163
249 3300046642 Ga0495634_0194521 Ga0495634_0194521_498_992 163
250 3300046648 Ga0495611_0373619 Ga0495611_0373619_89_598 163
251 3300046675 Ga0495657_0072447 Ga0495657_0072447_1013_1507 163
252 3300046678 Ga0495599_0118390 Ga0495599_0118390_636_1130 163
253 3300046689 Ga0495613_0448082 Ga0495613_0448082_28_522 163
254 3300047471 Ga0495684_0245418 Ga0495684_0245418_149_643 163
255 3300048907 Ga0496104_0608405 Ga0496104_0608405_348_845 163
256 3300048917 Ga0496114_0671444 Ga0496114_0671444_201_698 163
257 3300049592 Ga0501076_0507548 Ga0501076_0507548_27_521 163
258 3300049824 Ga0501045_1131598 Ga0501045_1131598_52_546 163
259 3300050512 nmdc:mga0n895_148619_c1 nmdc:mga0n895_148619_c1_84_578 163
260 3300053077 Ga0495601_0204544 Ga0495601_0204544_158_652 163
261 3300053085 Ga0495619_0015732 Ga0495619_0015732_3516_4010 163
262 iso_pu_bacteria 2881644220 2881646290 163
263 3300005341 Ga0070691_10659441 Ga0070691_106594411 164
264 3300005444 Ga0070694_100802873 Ga0070694_1008028732 164
265 3300005536 Ga0070697_100061942 Ga0070697_1000619422 164
266 3300014326 Ga0157380_10017015 Ga0157380_100170155 164
267 3300017792 Ga0163161_10539744 Ga0163161_105397442 164
268 3300025908 Ga0207643_10198778 Ga0207643_101987782 164
269 3300025935 Ga0207709_10231311 Ga0207709_102313112 164
270 3300025944 Ga0207661_10096409 Ga0207661_100964093 164
271 3300026095 Ga0207676_10392450 Ga0207676_103924503 164
272 3300026142 Ga0207698_10174534 Ga0207698_101745343 164
273 3300031548 Ga0307408_100064860 Ga0307408_1000648603 164
274 3300031852 Ga0307410_10479250 Ga0307410_104792502 164
275 3300031995 Ga0307409_100078951 Ga0307409_1000789513 164
276 3300032002 Ga0307416_100486321 Ga0307416_1004863212 164
277 3300032126 Ga0307415_100185628 Ga0307415_1001856282 164
278 3300035172 Ga0373955_0173817 Ga0373955_0173817_558_1058 164
279 3300047320 Ga0495672_0463122 Ga0495672_0463122_57_557 164
280 3300048905 Ga0496102_1303648 Ga0496102_1303648_33_533 164
281 3300048912 Ga0496109_0384312 Ga0496109_0384312_428_928 164
282 3300049521 Ga0501298_097940 Ga0501298_097940_133_633 164
283 3300005290 Ga0065712_10528120 Ga0065712_105281201 165
284 3300005329 Ga0070683_100636737 Ga0070683_1006367372 165
285 3300005345 Ga0070692_10029173 Ga0070692_100291733 165
286 3300005355 Ga0070671_100690822 Ga0070671_1006908222 165
287 3300005364 Ga0070673_100791974 Ga0070673_1007919742 165
288 3300005456 Ga0070678_100644799 Ga0070678_1006447992 165
289 3300005535 Ga0070684_100488072 Ga0070684_1004880722 165
290 3300005536 Ga0070697_100352231 Ga0070697_1003522312 165
291 3300005543 Ga0070672_100385337 Ga0070672_1003853372 165
292 3300005564 Ga0070664_100091525 Ga0070664_1000915252 165
293 3300006163 Ga0070715_10216154 Ga0070715_102161541 165
294 3300006871 Ga0075434_100427078 Ga0075434_1004270782 165
295 3300013308 Ga0157375_11315551 Ga0157375_113155511 165
296 3300025940 Ga0207691_10749443 Ga0207691_107494432 165
297 3300025945 Ga0207679_10957186 Ga0207679_109571862 165
298 3300025960 Ga0207651_10303233 Ga0207651_103032332 165
299 3300025986 Ga0207658_10622769 Ga0207658_106227692 165
300 3300026023 Ga0207677_11349562 Ga0207677_113495621 165
301 3300026041 Ga0207639_11092448 Ga0207639_110924482 165
302 3300026121 Ga0207683_10631476 Ga0207683_106314762 165
303 3300037068 Ga0373925_0131189 Ga0373925_0131189_685_1200 165
304 3300046475 Ga0495639_0357297 Ga0495639_0357297_123_626 165
305 3300046525 Ga0495663_0227689 Ga0495663_0227689_80_613 165
306 3300046684 Ga0495669_0428356 Ga0495669_0428356_14_547 165
307 3300047318 Ga0495636_0119356 Ga0495636_0119356_221_754 165
308 3300047445 Ga0495677_0083043 Ga0495677_0083043_204_737 165
309 3300050513 nmdc:mga0rr50_866586_c1 nmdc:mga0rr50_866586_c1_121_636 165
310 3300005290 Ga0065712_10122688 Ga0065712_101226881 166
311 3300005293 Ga0065715_10772688 Ga0065715_107726881 166
312 3300005329 Ga0070683_101919745 Ga0070683_1019197451 166
313 3300005331 Ga0070670_100034911 Ga0070670_1000349114 166
314 3300005334 Ga0068869_100297635 Ga0068869_1002976352 166
315 3300005335 Ga0070666_10124473 Ga0070666_101244732 166
316 3300005338 Ga0068868_100229300 Ga0068868_1002293002 166
317 3300005354 Ga0070675_100397355 Ga0070675_1003973551 166
318 3300005355 Ga0070671_100141250 Ga0070671_1001412502 166
319 3300005356 Ga0070674_100817027 Ga0070674_1008170272 166
320 3300005367 Ga0070667_100316293 Ga0070667_1003162932 166
321 3300005444 Ga0070694_100298533 Ga0070694_1002985332 166
322 3300005445 Ga0070708_100988463 Ga0070708_1009884631 166
323 3300005459 Ga0068867_100056439 Ga0068867_1000564393 166
324 3300005543 Ga0070672_100931825 Ga0070672_1009318252 166
325 3300005544 Ga0070686_100163142 Ga0070686_1001631422 166
326 3300005548 Ga0070665_100080194 Ga0070665_1000801943 166
327 3300005719 Ga0068861_100844527 Ga0068861_1008445272 166
328 3300006173 Ga0070716_100605158 Ga0070716_1006051582 166
329 3300006175 Ga0070712_100154776 Ga0070712_1001547761 166
330 3300006844 Ga0075428_100001276 Ga0075428_1000012761 166
331 3300006846 Ga0075430_100514456 Ga0075430_1005144562 166
332 3300006847 Ga0075431_100059822 Ga0075431_1000598224 166
333 3300006847 Ga0075431_100137060 Ga0075431_1001370603 166
334 3300006847 Ga0075431_100518399 Ga0075431_1005183991 166
335 3300006880 Ga0075429_100012788 Ga0075429_1000127882 166
336 3300009147 Ga0114129_10102673 Ga0114129_101026731 166
337 3300009176 Ga0105242_10012262 Ga0105242_100122625 166
338 3300009177 Ga0105248_10027169 Ga0105248_1002716910 166
339 3300009551 Ga0105238_10185539 Ga0105238_101855392 166
340 3300013296 Ga0157374_10322002 Ga0157374_103220022 166
341 3300013297 Ga0157378_10131292 Ga0157378_101312924 166
342 3300014325 Ga0163163_10607746 Ga0163163_106077461 166
343 3300014326 Ga0157380_10239949 Ga0157380_102399493 166
344 3300014969 Ga0157376_10313027 Ga0157376_103130272 166
345 3300025899 Ga0207642_10141684 Ga0207642_101416842 166
346 3300025903 Ga0207680_10128853 Ga0207680_101288532 166
347 3300025903 Ga0207680_10131982 Ga0207680_101319821 166
348 3300025916 Ga0207663_10292878 Ga0207663_102928781 166
349 3300025925 Ga0207650_10024820 Ga0207650_100248204 166
350 3300025933 Ga0207706_10335720 Ga0207706_103357202 166
351 3300025934 Ga0207686_10007851 Ga0207686_100078513 166
352 3300025937 Ga0207669_10629163 Ga0207669_106291631 166
353 3300025941 Ga0207711_10149630 Ga0207711_101496302 166
354 3300025942 Ga0207689_10296107 Ga0207689_102961072 166
355 3300025944 Ga0207661_11739329 Ga0207661_117393291 166
356 3300025986 Ga0207658_10829681 Ga0207658_108296812 166
357 3300026023 Ga0207677_10115288 Ga0207677_101152882 166
358 3300026023 Ga0207677_10359074 Ga0207677_103590742 166
359 3300026089 Ga0207648_10023589 Ga0207648_100235894 166
360 3300026089 Ga0207648_10151575 Ga0207648_101515752 166
361 3300026118 Ga0207675_100892257 Ga0207675_1008922572 166
362 3300028379 Ga0268266_10205547 Ga0268266_102055472 166
363 3300028380 Ga0268265_10911425 Ga0268265_109114251 166
364 3300035086 Ga0373934_0027268 Ga0373934_0027268_1281_1787 166
365 3300035089 Ga0373944_0276315 Ga0373944_0276315_29_535 166
366 3300035111 Ga0373923_0022324 Ga0373923_0022324_920_1426 166
367 3300035113 Ga0373936_0056302 Ga0373936_0056302_684_1190 166
368 3300035113 Ga0373936_0186355 Ga0373936_0186355_216_722 166
369 3300035170 Ga0373943_0007046 Ga0373943_0007046_2379_2885 166
370 3300035171 Ga0373946_0004137 Ga0373946_0004137_803_1309 166
371 3300035172 Ga0373955_0396382 Ga0373955_0396382_72_578 166
372 3300035410 Ga0373924_0011752 Ga0373924_0011752_704_1210 166
373 3300035692 Ga0373935_0068402 Ga0373935_0068402_747_1253 166
374 3300036401 Ga0373937_0172127 Ga0373937_0172127_1154_1660 166
375 3300037068 Ga0373925_0116779 Ga0373925_0116779_409_915 166
376 3300041463 Ga0451804_0801631 Ga0451804_0801631_43_549 166
377 3300041512 Ga0451853_2201637 Ga0451853_2201637_21_527 166
378 3300045049 Ga0466959_0588410 Ga0466959_0588410_150_656 166
379 3300046684 Ga0495669_0002615 Ga0495669_0002615_3161_3667 166
380 3300048903 Ga0496100_0048123 Ga0496100_0048123_1927_2433 166
381 3300048904 Ga0496101_0001189 Ga0496101_0001189_11055_11624 166
382 3300048907 Ga0496104_0229309 Ga0496104_0229309_154_660 166
383 3300048910 Ga0496107_0195514 Ga0496107_0195514_849_1418 166
384 3300048917 Ga0496114_0000423 Ga0496114_0000423_2891_3460 166
385 3300048917 Ga0496114_0949513 Ga0496114_0949513_26_532 166
386 3300049578 Ga0501042_0000065 Ga0501042_0000065_14318_14842 166
387 3300050507 nmdc:mga05p37_84224_c1 nmdc:mga05p37_84224_c1_80_592 166
388 3300050508 nmdc:mga09592_8416_c1 nmdc:mga09592_8416_c1_5448_5960 166
389 3300050509 nmdc:mga0qj67_578069_c1 nmdc:mga0qj67_578069_c1_44_556 166
390 3300050510 nmdc:mga06r32_15063_c1 nmdc:mga06r32_15063_c1_4403_4915 166
391 3300050510 nmdc:mga06r32_189927_c1 nmdc:mga06r32_189927_c1_536_1042 166
392 3300005290 Ga0065712_10004822 Ga0065712_100048223 167
393 3300005290 Ga0065712_10097465 Ga0065712_100974652 167
394 3300005293 Ga0065715_10256818 Ga0065715_102568182 167
395 3300005295 Ga0065707_10457655 Ga0065707_104576552 167
396 3300005327 Ga0070658_11561338 Ga0070658_115613381 167
397 3300005329 Ga0070683_100028567 Ga0070683_1000285674 167
398 3300005329 Ga0070683_100037387 Ga0070683_1000373875 167
399 3300005330 Ga0070690_100987079 Ga0070690_1009870791 167
400 3300005331 Ga0070670_100012431 Ga0070670_1000124313 167
401 3300005333 Ga0070677_10158599 Ga0070677_101585992 167
402 3300005336 Ga0070680_100267546 Ga0070680_1002675461 167
403 3300005338 Ga0068868_100723500 Ga0068868_1007235002 167
404 3300005340 Ga0070689_100088433 Ga0070689_1000884331 167
405 3300005345 Ga0070692_10023802 Ga0070692_100238022 167
406 3300005356 Ga0070674_101294150 Ga0070674_1012941502 167
407 3300005364 Ga0070673_100509190 Ga0070673_1005091902 167
408 3300005434 Ga0070709_10176931 Ga0070709_101769312 167
409 3300005434 Ga0070709_10178635 Ga0070709_101786352 167
410 3300005435 Ga0070714_100071194 Ga0070714_1000711942 167
411 3300005436 Ga0070713_100096486 Ga0070713_1000964862 167
412 3300005436 Ga0070713_100103707 Ga0070713_1001037072 167
413 3300005436 Ga0070713_100214365 Ga0070713_1002143652 167
414 3300005436 Ga0070713_101405073 Ga0070713_1014050732 167
415 3300005437 Ga0070710_10025665 Ga0070710_100256651 167
416 3300005438 Ga0070701_10393739 Ga0070701_103937391 167
417 3300005439 Ga0070711_100019524 Ga0070711_1000195242 167
418 3300005439 Ga0070711_100367297 Ga0070711_1003672972 167
419 3300005440 Ga0070705_100144025 Ga0070705_1001440252 167
420 3300005444 Ga0070694_100132349 Ga0070694_1001323492 167
421 3300005458 Ga0070681_10199585 Ga0070681_101995852 167
422 3300005458 Ga0070681_10235379 Ga0070681_102353792 167
423 3300005458 Ga0070681_10497643 Ga0070681_104976432 167
424 3300005458 Ga0070681_10982140 Ga0070681_109821402 167
425 3300005459 Ga0068867_100507684 Ga0068867_1005076842 167
426 3300005471 Ga0070698_100001371 Ga0070698_1000013718 167
427 3300005518 Ga0070699_100000912 Ga0070699_10000091215 167
428 3300005530 Ga0070679_101104079 Ga0070679_1011040791 167
429 3300005535 Ga0070684_100006317 Ga0070684_1000063179 167
430 3300005539 Ga0068853_100044977 Ga0068853_1000449772 167
431 3300005539 Ga0068853_100083918 Ga0068853_1000839182 167
432 3300005539 Ga0068853_100884379 Ga0068853_1008843792 167
433 3300005543 Ga0070672_100309139 Ga0070672_1003091392 167
434 3300005544 Ga0070686_100076723 Ga0070686_1000767231 167
435 3300005546 Ga0070696_100046884 Ga0070696_1000468842 167
436 3300005547 Ga0070693_100020383 Ga0070693_1000203833 167
437 3300005547 Ga0070693_100119505 Ga0070693_1001195052 167
438 3300005547 Ga0070693_100851487 Ga0070693_1008514871 167
439 3300005549 Ga0070704_100549664 Ga0070704_1005496642 167
440 3300005563 Ga0068855_100475390 Ga0068855_1004753902 167
441 3300005563 Ga0068855_100693483 Ga0068855_1006934832 167
442 3300005564 Ga0070664_100172395 Ga0070664_1001723953 167
443 3300005578 Ga0068854_100067182 Ga0068854_1000671822 167
444 3300005614 Ga0068856_100120159 Ga0068856_1001201593 167
445 3300005615 Ga0070702_100475743 Ga0070702_1004757431 167
446 3300005616 Ga0068852_100093651 Ga0068852_1000936512 167
447 3300005616 Ga0068852_101760386 Ga0068852_1017603861 167
448 3300005617 Ga0068859_100451967 Ga0068859_1004519672 167
449 3300005618 Ga0068864_100149664 Ga0068864_1001496642 167
450 3300005834 Ga0068851_10119275 Ga0068851_101192752 167
451 3300005843 Ga0068860_101388001 Ga0068860_1013880012 167
452 3300005844 Ga0068862_100344980 Ga0068862_1003449802 167
453 3300005985 Ga0081539_10081756 Ga0081539_100817563 167
454 3300006028 Ga0070717_10070235 Ga0070717_100702353 167
455 3300006028 Ga0070717_10227176 Ga0070717_102271762 167
456 3300006028 Ga0070717_10634191 Ga0070717_106341912 167
457 3300006163 Ga0070715_10015083 Ga0070715_100150832 167
458 3300006163 Ga0070715_10249609 Ga0070715_102496092 167
459 3300006163 Ga0070715_10528596 Ga0070715_105285961 167
460 3300006175 Ga0070712_100019700 Ga0070712_1000197002 167
461 3300006175 Ga0070712_100737142 Ga0070712_1007371422 167
462 3300006358 Ga0068871_100116449 Ga0068871_1001164493 167
463 3300006846 Ga0075430_100003017 Ga0075430_1000030178 167
464 3300006847 Ga0075431_100006823 Ga0075431_10000682314 167
465 3300006847 Ga0075431_100010900 Ga0075431_1000109007 167
466 3300006871 Ga0075434_100255507 Ga0075434_1002555072 167
467 3300006880 Ga0075429_100001340 Ga0075429_10000134014 167
468 3300006914 Ga0075436_100646460 Ga0075436_1006464602 167
469 3300006931 Ga0097620_100451924 Ga0097620_1004519242 167
470 3300007076 Ga0075435_100015367 Ga0075435_1000153675 167
471 3300007788 Ga0099795_10004644 Ga0099795_100046444 167
472 3300009093 Ga0105240_10178259 Ga0105240_101782592 167
473 3300009094 Ga0111539_10023669 Ga0111539_100236693 167
474 3300009098 Ga0105245_10051163 Ga0105245_100511634 167
475 3300009098 Ga0105245_10510738 Ga0105245_105107382 167
476 3300009147 Ga0114129_10021791 Ga0114129_100217912 167
477 3300009147 Ga0114129_10040478 Ga0114129_100404788 167
478 3300009174 Ga0105241_10087408 Ga0105241_100874083 167
479 3300009545 Ga0105237_10265025 Ga0105237_102650252 167
480 3300009545 Ga0105237_10515783 Ga0105237_105157832 167
481 3300009551 Ga0105238_10008383 Ga0105238_100083839 167
482 3300009551 Ga0105238_10040699 Ga0105238_100406995 167
483 3300009551 Ga0105238_10731453 Ga0105238_107314532 167
484 3300009553 Ga0105249_10204558 Ga0105249_102045582 167
485 3300010159 Ga0099796_10005759 Ga0099796_100057592 167
486 3300010375 Ga0105239_10079529 Ga0105239_100795292 167
487 3300010375 Ga0105239_10190258 Ga0105239_101902582 167
488 3300010375 Ga0105239_10345322 Ga0105239_103453222 167
489 3300013105 Ga0157369_10030006 Ga0157369_100300062 167
490 3300013105 Ga0157369_10201990 Ga0157369_102019903 167
491 3300013105 Ga0157369_11639597 Ga0157369_116395972 167
492 3300013296 Ga0157374_10109340 Ga0157374_101093402 167
493 3300013296 Ga0157374_10138644 Ga0157374_101386442 167
494 3300013296 Ga0157374_11532744 Ga0157374_115327441 167
495 3300013297 Ga0157378_10264794 Ga0157378_102647942 167
496 3300013306 Ga0163162_10523793 Ga0163162_105237932 167
497 3300013307 Ga0157372_10386304 Ga0157372_103863042 167
498 3300013308 Ga0157375_10916427 Ga0157375_109164272 167
499 3300014325 Ga0163163_10020746 Ga0163163_100207463 167
500 3300014326 Ga0157380_10096165 Ga0157380_100961653 167
501 3300014326 Ga0157380_10546512 Ga0157380_105465122 167
502 3300014969 Ga0157376_10337512 Ga0157376_103375122 167
503 3300022467 Ga0224712_10277304 Ga0224712_102773042 167
504 3300025321 Ga0207656_10316035 Ga0207656_103160351 167
505 3300025893 Ga0207682_10074944 Ga0207682_100749441 167
506 3300025905 Ga0207685_10162133 Ga0207685_101621331 167
507 3300025906 Ga0207699_10072542 Ga0207699_100725421 167
508 3300025906 Ga0207699_10546861 Ga0207699_105468612 167
509 3300025911 Ga0207654_10046467 Ga0207654_100464672 167
510 3300025912 Ga0207707_10120830 Ga0207707_101208302 167
511 3300025912 Ga0207707_10395319 Ga0207707_103953192 167
512 3300025912 Ga0207707_10526993 Ga0207707_105269931 167
513 3300025912 Ga0207707_10767414 Ga0207707_107674142 167
514 3300025913 Ga0207695_10229148 Ga0207695_102291482 167
515 3300025913 Ga0207695_11125106 Ga0207695_111251062 167
516 3300025915 Ga0207693_10022733 Ga0207693_100227335 167
517 3300025915 Ga0207693_10035419 Ga0207693_100354194 167
518 3300025915 Ga0207693_10142549 Ga0207693_101425492 167
519 3300025916 Ga0207663_10000828 Ga0207663_100008289 167
520 3300025916 Ga0207663_10344079 Ga0207663_103440792 167
521 3300025917 Ga0207660_10179365 Ga0207660_101793652 167
522 3300025918 Ga0207662_10319344 Ga0207662_103193441 167
523 3300025920 Ga0207649_10299408 Ga0207649_102994082 167
524 3300025921 Ga0207652_10102288 Ga0207652_101022882 167
525 3300025924 Ga0207694_10049897 Ga0207694_100498972 167
526 3300025924 Ga0207694_10547227 Ga0207694_105472272 167
527 3300025925 Ga0207650_10005494 Ga0207650_100054948 167
528 3300025927 Ga0207687_10022884 Ga0207687_100228842 167
529 3300025927 Ga0207687_10266071 Ga0207687_102660712 167
530 3300025928 Ga0207700_10014728 Ga0207700_100147283 167
531 3300025928 Ga0207700_10177709 Ga0207700_101777093 167
532 3300025928 Ga0207700_10221299 Ga0207700_102212992 167
533 3300025928 Ga0207700_10416768 Ga0207700_104167682 167
534 3300025929 Ga0207664_10528688 Ga0207664_105286882 167
535 3300025929 Ga0207664_11076146 Ga0207664_110761462 167
536 3300025933 Ga0207706_10573845 Ga0207706_105738451 167
537 3300025939 Ga0207665_10000626 Ga0207665_1000062618 167
538 3300025944 Ga0207661_10009719 Ga0207661_100097195 167
539 3300025944 Ga0207661_10111269 Ga0207661_101112694 167
540 3300025945 Ga0207679_10267621 Ga0207679_102676211 167
541 3300025949 Ga0207667_10015602 Ga0207667_100156022 167
542 3300025981 Ga0207640_10063962 Ga0207640_100639622 167
543 3300026023 Ga0207677_10050514 Ga0207677_100505144 167
544 3300026041 Ga0207639_10038425 Ga0207639_100384252 167
545 3300026041 Ga0207639_10977129 Ga0207639_109771291 167
546 3300026078 Ga0207702_10211242 Ga0207702_102112422 167
547 3300026078 Ga0207702_10807045 Ga0207702_108070452 167
548 3300026095 Ga0207676_10341671 Ga0207676_103416713 167
549 3300026116 Ga0207674_10591185 Ga0207674_105911852 167
550 3300026142 Ga0207698_10105280 Ga0207698_101052803 167
551 3300027907 Ga0207428_10072328 Ga0207428_100723283 167
552 3300028380 Ga0268265_10065702 Ga0268265_100657022 167
553 3300028380 Ga0268265_10792415 Ga0268265_107924152 167
554 3300028800 Ga0265338_10218335 Ga0265338_102183352 167
555 3300031852 Ga0307410_10804391 Ga0307410_108043911 167
556 3300035083 Ga0373926_0028655 Ga0373926_0028655_901_1410 167
557 3300035083 Ga0373926_0178215 Ga0373926_0178215_290_799 167
558 3300035111 Ga0373923_0047672 Ga0373923_0047672_366_875 167
559 3300035111 Ga0373923_0266204 Ga0373923_0266204_201_710 167
560 3300035113 Ga0373936_0030441 Ga0373936_0030441_480_989 167
561 3300035113 Ga0373936_0105594 Ga0373936_0105594_565_1074 167
562 3300035116 Ga0373945_0009552 Ga0373945_0009552_1150_1659 167
563 3300035119 Ga0373956_0116751 Ga0373956_0116751_386_895 167
564 3300035119 Ga0373956_0434182 Ga0373956_0434182_19_528 167
565 3300035120 Ga0373957_0038393 Ga0373957_0038393_1128_1637 167
566 3300035120 Ga0373957_0278113 Ga0373957_0278113_105_614 167
567 3300035170 Ga0373943_0047983 Ga0373943_0047983_1047_1556 167
568 3300035171 Ga0373946_0013092 Ga0373946_0013092_1869_2378 167
569 3300035172 Ga0373955_0064576 Ga0373955_0064576_975_1484 167
570 3300035172 Ga0373955_0304219 Ga0373955_0304219_116_625 167
571 3300035410 Ga0373924_0000041 Ga0373924_0000041_19024_19533 167
572 3300035410 Ga0373924_0036807 Ga0373924_0036807_646_1155 167
573 3300035410 Ga0373924_0063026 Ga0373924_0063026_687_1196 167
574 3300035692 Ga0373935_0089341 Ga0373935_0089341_695_1204 167
575 3300035692 Ga0373935_0153931 Ga0373935_0153931_592_1101 167
576 3300035692 Ga0373935_0359397 Ga0373935_0359397_148_657 167
577 3300035692 Ga0373935_0448184 Ga0373935_0448184_182_691 167
578 3300035695 Ga0373927_0013234 Ga0373927_0013234_3686_4195 167
579 3300035695 Ga0373927_0170508 Ga0373927_0170508_901_1410 167
580 3300035695 Ga0373927_0248601 Ga0373927_0248601_268_777 167
581 3300035725 Ga0373947_0061841 Ga0373947_0061841_944_1453 167
582 3300035725 Ga0373947_0158447 Ga0373947_0158447_640_1149 167
583 3300036401 Ga0373937_0000225 Ga0373937_0000225_17527_18036 167
584 3300036401 Ga0373937_0080180 Ga0373937_0080180_1640_2149 167
585 3300036401 Ga0373937_1053935 Ga0373937_1053935_221_730 167
586 3300037068 Ga0373925_0136692 Ga0373925_0136692_756_1265 167
587 3300037068 Ga0373925_0137595 Ga0373925_0137595_980_1489 167
588 3300037068 Ga0373925_0217947 Ga0373925_0217947_440_949 167
589 3300037068 Ga0373925_0352874 Ga0373925_0352874_232_741 167
590 3300042993 Ga0439440_0046891 Ga0439440_0046891_161_670 167
591 3300044842 Ga0466957_0001629 Ga0466957_0001629_6055_6561 167
592 3300045051 Ga0451576_0161658 Ga0451576_0161658_1215_1718 167
593 3300046455 Ga0495603_0071185 Ga0495603_0071185_1515_2018 167
594 3300046461 Ga0495641_0330210 Ga0495641_0330210_50_589 167
595 3300046462 Ga0495651_0138202 Ga0495651_0138202_296_805 167
596 3300046462 Ga0495651_0187782 Ga0495651_0187782_781_1290 167
597 3300046472 Ga0495580_0097457 Ga0495580_0097457_862_1371 167
598 3300046472 Ga0495580_0159876 Ga0495580_0159876_36_545 167
599 3300046472 Ga0495580_0353544 Ga0495580_0353544_154_663 167
600 3300046475 Ga0495639_0393636 Ga0495639_0393636_152_661 167
601 3300046476 Ga0495662_0089095 Ga0495662_0089095_17_526 167
602 3300046477 Ga0495664_0131016 Ga0495664_0131016_175_684 167
603 3300046499 Ga0495594_0015489 Ga0495594_0015489_898_1437 167
604 3300046511 Ga0495608_0027317 Ga0495608_0027317_657_1166 167
605 3300046516 Ga0495628_0009875 Ga0495628_0009875_3611_4120 167
606 3300046516 Ga0495628_0202433 Ga0495628_0202433_397_906 167
607 3300046517 Ga0495630_0135724 Ga0495630_0135724_875_1384 167
608 3300046517 Ga0495630_0889861 Ga0495630_0889861_35_544 167
609 3300046526 Ga0495666_0049957 Ga0495666_0049957_989_1498 167
610 3300046529 Ga0495652_0855663 Ga0495652_0855663_15_524 167
611 3300046536 Ga0495587_0042909 Ga0495587_0042909_1394_1903 167
612 3300046537 Ga0495598_0027076 Ga0495598_0027076_303_806 167
613 3300046537 Ga0495598_0044648 Ga0495598_0044648_245_754 167
614 3300046543 Ga0495645_0027947 Ga0495645_0027947_1190_1699 167
615 3300046559 Ga0495667_0011701 Ga0495667_0011701_2125_2634 167
616 3300046559 Ga0495667_0188617 Ga0495667_0188617_440_949 167
617 3300046615 Ga0495656_0571089 Ga0495656_0571089_12_515 167
618 3300046642 Ga0495634_0037869 Ga0495634_0037869_2166_2675 167
619 3300046663 Ga0495635_0328675 Ga0495635_0328675_71_580 167
620 3300046664 Ga0495659_0051084 Ga0495659_0051084_669_1172 167
621 3300046675 Ga0495657_0183160 Ga0495657_0183160_594_1103 167
622 3300046679 Ga0495623_0029854 Ga0495623_0029854_318_827 167
623 3300046681 Ga0495647_0192779 Ga0495647_0192779_369_878 167
624 3300046683 Ga0495658_0032165 Ga0495658_0032165_965_1504 167
625 3300046689 Ga0495613_0000156 Ga0495613_0000156_8630_9139 167
626 3300046689 Ga0495613_0432559 Ga0495613_0432559_192_701 167
627 3300046690 Ga0495624_0068516 Ga0495624_0068516_1221_1730 167
628 3300047315 Ga0495581_0215726 Ga0495581_0215726_349_888 167
629 3300047318 Ga0495636_0139853 Ga0495636_0139853_293_796 167
630 3300047319 Ga0495674_0098386 Ga0495674_0098386_1489_1998 167
631 3300047321 Ga0495676_0515794 Ga0495676_0515794_64_603 167
632 3300047444 Ga0495675_0191871 Ga0495675_0191871_307_816 167
633 3300047444 Ga0495675_0294825 Ga0495675_0294825_338_847 167
634 3300047471 Ga0495684_0000087 Ga0495684_0000087_25170_25679 167
635 3300047471 Ga0495684_0568826 Ga0495684_0568826_113_622 167
636 3300048088 Ga0495602_0207059 Ga0495602_0207059_807_1316 167
637 3300048088 Ga0495602_0305317 Ga0495602_0305317_249_758 167
638 3300048905 Ga0496102_0012504 Ga0496102_0012504_2006_2515 167
639 3300048908 Ga0496105_0028973 Ga0496105_0028973_616_1125 167
640 3300048913 Ga0496110_0011808 Ga0496110_0011808_5632_6141 167
641 3300048914 Ga0496111_0009322 Ga0496111_0009322_4254_4763 167
642 3300048915 Ga0496112_0047672 Ga0496112_0047672_2345_2854 167
643 3300048916 Ga0496113_0002200 Ga0496113_0002200_834_1343 167
644 3300048916 Ga0496113_0255507 Ga0496113_0255507_57_566 167
645 3300048917 Ga0496114_1132759 Ga0496114_1132759_44_553 167
646 3300049591 Ga0501075_1111933 Ga0501075_1111933_58_567 167
647 3300050507 nmdc:mga05p37_163934_c1 nmdc:mga05p37_163934_c1_209_718 167
648 3300050507 nmdc:mga05p37_5997_c1 nmdc:mga05p37_5997_c1_6937_7440 167
649 3300050508 nmdc:mga09592_1063_c1 nmdc:mga09592_1063_c1_12570_13079 167
650 3300050508 nmdc:mga09592_363863_c1 nmdc:mga09592_363863_c1_612_1121 167
651 3300050509 nmdc:mga0qj67_1322_c1 nmdc:mga0qj67_1322_c1_4373_4882 167
652 3300050509 nmdc:mga0qj67_71883_c1 nmdc:mga0qj67_71883_c1_180_689 167
653 3300050510 nmdc:mga06r32_6362_c1 nmdc:mga06r32_6362_c1_816_1325 167
654 3300050511 nmdc:mga08y16_416073_c1 nmdc:mga08y16_416073_c1_424_933 167
655 3300050512 nmdc:mga0n895_47985_c1 nmdc:mga0n895_47985_c1_3065_3568 167
656 3300050513 nmdc:mga0rr50_37823_c1 nmdc:mga0rr50_37823_c1_2687_3190 167
657 3300050513 nmdc:mga0rr50_595873_c1 nmdc:mga0rr50_595873_c1_209_718 167
658 3300050515 nmdc:mga0a205_91983_c1 nmdc:mga0a205_91983_c1_2062_2571 167
659 3300053077 Ga0495601_0017354 Ga0495601_0017354_923_1432 167
660 3300053077 Ga0495601_0027605 Ga0495601_0027605_1220_1729 167
661 3300053077 Ga0495601_0068658 Ga0495601_0068658_815_1324 167
662 3300053085 Ga0495619_0005404 Ga0495619_0005404_3524_4033 167
663 3300003203 JGI25406J46586_10002299 JGI25406J46586_100022999 168
664 3300005344 Ga0070661_100956963 Ga0070661_1009569631 168
665 3300005353 Ga0070669_100060029 Ga0070669_1000600292 168
666 3300005354 Ga0070675_100027446 Ga0070675_1000274466 168
667 3300005366 Ga0070659_100853036 Ga0070659_1008530362 168
668 3300005434 Ga0070709_10082442 Ga0070709_100824422 168
669 3300005436 Ga0070713_100012499 Ga0070713_1000124996 168
670 3300005441 Ga0070700_101121135 Ga0070700_1011211351 168
671 3300005467 Ga0070706_101417025 Ga0070706_1014170252 168
672 3300005468 Ga0070707_100085229 Ga0070707_1000852293 168
673 3300005536 Ga0070697_100523006 Ga0070697_1005230062 168
674 3300005545 Ga0070695_100555299 Ga0070695_1005552992 168
675 3300005549 Ga0070704_100678714 Ga0070704_1006787142 168
676 3300005844 Ga0068862_100078368 Ga0068862_1000783682 168
677 3300005985 Ga0081539_10000034 Ga0081539_10000034249 168
678 3300006846 Ga0075430_100010836 Ga0075430_1000108364 168
679 3300006852 Ga0075433_10000445 Ga0075433_100004452 168
680 3300006852 Ga0075433_10017052 Ga0075433_100170524 168
681 3300006871 Ga0075434_100000579 Ga0075434_1000005793 168
682 3300006871 Ga0075434_100001041 Ga0075434_10000104122 168
683 3300006880 Ga0075429_100139220 Ga0075429_1001392202 168
684 3300007076 Ga0075435_100013525 Ga0075435_1000135256 168
685 3300009098 Ga0105245_10007977 Ga0105245_100079773 168
686 3300009101 Ga0105247_10246143 Ga0105247_102461432 168
687 3300009147 Ga0114129_10039575 Ga0114129_100395755 168
688 3300009147 Ga0114129_10103944 Ga0114129_101039442 168
689 3300009147 Ga0114129_11409622 Ga0114129_114096222 168
690 3300013296 Ga0157374_10028827 Ga0157374_100288273 168
691 3300013297 Ga0157378_10030110 Ga0157378_100301104 168
692 3300013308 Ga0157375_12337496 Ga0157375_123374961 168
693 3300014325 Ga0163163_11452316 Ga0163163_114523161 168
694 3300014326 Ga0157380_10143336 Ga0157380_101433362 168
695 3300014968 Ga0157379_11218164 Ga0157379_112181641 168
696 3300025900 Ga0207710_10099750 Ga0207710_100997501 168
697 3300025922 Ga0207646_10037481 Ga0207646_100374813 168
698 3300025923 Ga0207681_10320463 Ga0207681_103204632 168
699 3300025926 Ga0207659_10152347 Ga0207659_101523472 168
700 3300025928 Ga0207700_10034412 Ga0207700_100344123 168
701 3300025961 Ga0207712_11460866 Ga0207712_114608661 168
702 3300026075 Ga0207708_10308962 Ga0207708_103089622 168
703 3300026095 Ga0207676_10416992 Ga0207676_104169922 168
704 3300027907 Ga0207428_10000592 Ga0207428_1000059222 168
705 3300028380 Ga0268265_10577665 Ga0268265_105776651 168
706 3300031090 Ga0265760_10012496 Ga0265760_100124962 168
707 3300035088 Ga0373940_0218115 Ga0373940_0218115_12_524 168
708 3300035092 Ga0373952_0042898 Ga0373952_0042898_485_997 168
709 3300035172 Ga0373955_0128687 Ga0373955_0128687_587_1099 168
710 3300035692 Ga0373935_0040333 Ga0373935_0040333_943_1455 168
711 3300035725 Ga0373947_0077498 Ga0373947_0077498_1483_1995 168
712 3300036401 Ga0373937_0007134 Ga0373937_0007134_8778_9290 168
713 3300036401 Ga0373937_0565703 Ga0373937_0565703_90_602 168
714 3300045051 Ga0451576_0025141 Ga0451576_0025141_5690_6196 168
715 3300045051 Ga0451576_0748290 Ga0451576_0748290_102_614 168
716 3300046454 Ga0495592_0017680 Ga0495592_0017680_3897_4409 168
717 3300046454 Ga0495592_0021436 Ga0495592_0021436_1809_2321 168
718 3300046454 Ga0495592_0084794 Ga0495592_0084794_379_891 168
719 3300046462 Ga0495651_0000793 Ga0495651_0000793_6458_6970 168
720 3300046462 Ga0495651_0071311 Ga0495651_0071311_715_1227 168
721 3300046463 Ga0495653_0005283 Ga0495653_0005283_1248_1760 168
722 3300046463 Ga0495653_0020914 Ga0495653_0020914_4066_4578 168
723 3300046472 Ga0495580_0061699 Ga0495580_0061699_1350_1862 168
724 3300046477 Ga0495664_0009759 Ga0495664_0009759_3652_4164 168
725 3300046477 Ga0495664_0018376 Ga0495664_0018376_2434_2946 168
726 3300046511 Ga0495608_0007214 Ga0495608_0007214_4030_4542 168
727 3300046514 Ga0495618_0011523 Ga0495618_0011523_3361_3873 168
728 3300046514 Ga0495618_0013469 Ga0495618_0013469_3403_3915 168
729 3300046516 Ga0495628_0000589 Ga0495628_0000589_5759_6271 168
730 3300046516 Ga0495628_0016860 Ga0495628_0016860_1288_1800 168
731 3300046516 Ga0495628_0611960 Ga0495628_0611960_179_691 168
732 3300046517 Ga0495630_0409126 Ga0495630_0409126_271_783 168
733 3300046526 Ga0495666_0025290 Ga0495666_0025290_1396_1908 168
734 3300046529 Ga0495652_0022761 Ga0495652_0022761_2644_3156 168
735 3300046529 Ga0495652_0162009 Ga0495652_0162009_598_1110 168
736 3300046531 Ga0495665_0002320 Ga0495665_0002320_1377_1889 168
737 3300046533 Ga0495640_0159480 Ga0495640_0159480_82_594 168
738 3300046535 Ga0495586_0004213 Ga0495586_0004213_1370_1882 168
739 3300046536 Ga0495587_0000591 Ga0495587_0000591_15688_16200 168
740 3300046536 Ga0495587_0059774 Ga0495587_0059774_1002_1514 168
741 3300046539 Ga0495621_0104714 Ga0495621_0104714_308_820 168
742 3300046543 Ga0495645_0008699 Ga0495645_0008699_5782_6294 168
743 3300046543 Ga0495645_0054607 Ga0495645_0054607_2072_2584 168
744 3300046558 Ga0495633_0281219 Ga0495633_0281219_25_531 168
745 3300046559 Ga0495667_0006598 Ga0495667_0006598_3589_4101 168
746 3300046642 Ga0495634_0008578 Ga0495634_0008578_5818_6330 168
747 3300046675 Ga0495657_0024342 Ga0495657_0024342_3549_4061 168
748 3300046675 Ga0495657_0024569 Ga0495657_0024569_1477_1989 168
749 3300046678 Ga0495599_0003547 Ga0495599_0003547_3323_3835 168
750 3300046678 Ga0495599_0042389 Ga0495599_0042389_73_585 168
751 3300046679 Ga0495623_0103436 Ga0495623_0103436_978_1490 168
752 3300046680 Ga0495646_0161395 Ga0495646_0161395_478_990 168
753 3300046680 Ga0495646_0170695 Ga0495646_0170695_206_718 168
754 3300046689 Ga0495613_0021516 Ga0495613_0021516_2868_3380 168
755 3300046689 Ga0495613_0188182 Ga0495613_0188182_331_843 168
756 3300046690 Ga0495624_0016974 Ga0495624_0016974_1397_1909 168
757 3300046690 Ga0495624_0179141 Ga0495624_0179141_310_822 168
758 3300046809 Ga0495600_0002070 Ga0495600_0002070_4622_5134 168
759 3300047317 Ga0495604_0000323 Ga0495604_0000323_3597_4109 168
760 3300047317 Ga0495604_0118638 Ga0495604_0118638_1389_1901 168
761 3300047318 Ga0495636_0011820 Ga0495636_0011820_99_605 168
762 3300047319 Ga0495674_0010221 Ga0495674_0010221_3344_3856 168
763 3300047319 Ga0495674_0067517 Ga0495674_0067517_218_730 168
764 3300047322 Ga0495680_0010538 Ga0495680_0010538_5221_5733 168
765 3300047322 Ga0495680_0030111 Ga0495680_0030111_1815_2327 168
766 3300047444 Ga0495675_0000155 Ga0495675_0000155_47197_47709 168
767 3300047444 Ga0495675_0060996 Ga0495675_0060996_1385_1897 168
768 3300047471 Ga0495684_0005550 Ga0495684_0005550_5894_6406 168
769 3300047471 Ga0495684_0076211 Ga0495684_0076211_623_1135 168
770 3300047673 Ga0495593_0036992 Ga0495593_0036992_802_1314 168
771 3300048088 Ga0495602_0062770 Ga0495602_0062770_1398_1910 168
772 3300048089 Ga0495614_0031678 Ga0495614_0031678_1357_1869 168
773 3300048915 Ga0496112_1179273 Ga0496112_1179273_152_664 168
774 3300050507 nmdc:mga05p37_155458_c1 nmdc:mga05p37_155458_c1_613_1125 168
775 3300050507 nmdc:mga05p37_321894_c1 nmdc:mga05p37_321894_c1_839_1351 168
776 3300050508 nmdc:mga09592_252203_c1 nmdc:mga09592_252203_c1_467_979 168
777 3300050509 nmdc:mga0qj67_143396_c1 nmdc:mga0qj67_143396_c1_380_892 168
778 3300050511 nmdc:mga08y16_2706_c1 nmdc:mga08y16_2706_c1_66_578 168
779 3300050512 nmdc:mga0n895_37063_c1 nmdc:mga0n895_37063_c1_824_1336 168
780 3300050512 nmdc:mga0n895_574_c1 nmdc:mga0n895_574_c1_24245_24757 168
781 3300050512 nmdc:mga0n895_876126_c1 nmdc:mga0n895_876126_c1_218_730 168
782 3300050513 nmdc:mga0rr50_85758_c1 nmdc:mga0rr50_85758_c1_1190_1702 168
783 3300050515 nmdc:mga0a205_5377_c1 nmdc:mga0a205_5377_c1_8356_8868 168
784 3300050515 nmdc:mga0a205_813_c1 nmdc:mga0a205_813_c1_24373_24885 168
785 3300053077 Ga0495601_0762754 Ga0495601_0762754_23_535 168
786 3300053078 Ga0495612_0022792 Ga0495612_0022792_582_1094 168
787 3300053085 Ga0495619_0040752 Ga0495619_0040752_1250_1762 168
788 3300002076 JGI24749J21850_1027340 JGI24749J21850_10273402 169
789 3300005290 Ga0065712_10410678 Ga0065712_104106781 169
790 3300005293 Ga0065715_10159844 Ga0065715_101598442 169
791 3300005330 Ga0070690_100062327 Ga0070690_1000623273 169
792 3300005338 Ga0068868_101392715 Ga0068868_1013927151 169
793 3300005340 Ga0070689_100058884 Ga0070689_1000588842 169
794 3300005354 Ga0070675_100052580 Ga0070675_1000525803 169
795 3300005354 Ga0070675_100399743 Ga0070675_1003997432 169
796 3300005364 Ga0070673_100025830 Ga0070673_1000258302 169
797 3300005365 Ga0070688_100020555 Ga0070688_1000205552 169
798 3300005367 Ga0070667_101425437 Ga0070667_1014254371 169
799 3300005438 Ga0070701_10113992 Ga0070701_101139921 169
800 3300005466 Ga0070685_10087372 Ga0070685_100873722 169
801 3300005466 Ga0070685_10105691 Ga0070685_101056912 169
802 3300005543 Ga0070672_100142431 Ga0070672_1001424313 169
803 3300005617 Ga0068859_100120800 Ga0068859_1001208003 169
804 3300005618 Ga0068864_100362662 Ga0068864_1003626622 169
805 3300005842 Ga0068858_100007327 Ga0068858_1000073278 169
806 3300006931 Ga0097620_100120800 Ga0097620_1001208003 169
807 3300009094 Ga0111539_10003598 Ga0111539_1000359812 169
808 3300009177 Ga0105248_10281528 Ga0105248_102815283 169
809 3300013296 Ga0157374_11747112 Ga0157374_117471121 169
810 3300013308 Ga0157375_10181881 Ga0157375_101818813 169
811 3300025903 Ga0207680_10394754 Ga0207680_103947542 169
812 3300025907 Ga0207645_10184593 Ga0207645_101845932 169
813 3300025918 Ga0207662_10299272 Ga0207662_102992722 169
814 3300025923 Ga0207681_10036611 Ga0207681_100366112 169
815 3300025926 Ga0207659_10001772 Ga0207659_100017727 169
816 3300025931 Ga0207644_10088321 Ga0207644_100883212 169
817 3300025933 Ga0207706_10245894 Ga0207706_102458942 169
818 3300025936 Ga0207670_10039200 Ga0207670_100392004 169
819 3300025960 Ga0207651_10010667 Ga0207651_100106673 169
820 3300025972 Ga0207668_11037298 Ga0207668_110372981 169
821 3300026035 Ga0207703_10007003 Ga0207703_100070034 169
822 3300026121 Ga0207683_10070792 Ga0207683_100707923 169
823 3300027907 Ga0207428_10023427 Ga0207428_100234272 169
824 3300028381 Ga0268264_10014737 Ga0268264_100147377 169
825 3300031548 Ga0307408_101186574 Ga0307408_1011865741 169
826 3300031824 Ga0307413_10012320 Ga0307413_100123202 169
827 3300031852 Ga0307410_10019421 Ga0307410_100194212 169
828 3300031852 Ga0307410_10111737 Ga0307410_101117372 169
829 3300031903 Ga0307407_10009690 Ga0307407_100096904 169
830 3300031995 Ga0307409_100021343 Ga0307409_1000213432 169
831 3300032002 Ga0307416_100008751 Ga0307416_1000087515 169
832 3300032004 Ga0307414_10275647 Ga0307414_102756472 169
833 3300032005 Ga0307411_10037452 Ga0307411_100374522 169
834 3300032126 Ga0307415_100011854 Ga0307415_1000118543 169
835 3300042131 Ga0450894_036407 Ga0450894_036407_58_573 169
836 3300042435 Ga0439434_0071865 Ga0439434_0071865_379_894 169
837 3300046664 Ga0495659_0004711 Ga0495659_0004711_3105_3626 169
838 3300049577 Ga0501041_0787920 Ga0501041_0787920_46_561 169
839 3300049583 Ga0501067_0222968 Ga0501067_0222968_470_1009 169
840 3300050511 nmdc:mga08y16_43741_c1 nmdc:mga08y16_43741_c1_3020_3535 169
841 3300003758 Ga0055532_1000335 Ga0055532_100033510 170
842 3300006844 Ga0075428_100017144 Ga0075428_1000171445 170
843 3300006852 Ga0075433_10044841 Ga0075433_100448416 170
844 3300006871 Ga0075434_100067337 Ga0075434_1000673374 170
845 3300006871 Ga0075434_100271569 Ga0075434_1002715692 170
846 3300006914 Ga0075436_100420698 Ga0075436_1004206981 170
847 3300009094 Ga0111539_10655651 Ga0111539_106556512 170
848 3300009147 Ga0114129_10008065 Ga0114129_100080658 170
849 3300009147 Ga0114129_10644060 Ga0114129_106440602 170
850 3300025229 Ga0209147_100155 Ga0209147_10015572 170
851 3300025917 Ga0207660_10632512 Ga0207660_106325122 170
852 3300046525 Ga0495663_0040409 Ga0495663_0040409_171_683 170
853 3300046528 Ga0495642_0092654 Ga0495642_0092654_623_1135 170
854 3300046537 Ga0495598_0078498 Ga0495598_0078498_75_587 170
855 3300046539 Ga0495621_0002713 Ga0495621_0002713_733_1245 170
856 3300046664 Ga0495659_0032273 Ga0495659_0032273_1174_1686 170
857 3300050507 nmdc:mga05p37_8871_c1 nmdc:mga05p37_8871_c1_9492_10016 170
858 3300050508 nmdc:mga09592_17640_c1 nmdc:mga09592_17640_c1_4246_4770 170
859 3300050512 nmdc:mga0n895_108215_c1 nmdc:mga0n895_108215_c1_429_953 170
860 3300050515 nmdc:mga0a205_58744_c1 nmdc:mga0a205_58744_c1_1472_1996 170
861 2162886007 SwRhRL2b_contig_2333552 SwRhRL2b_0441.00004480 171
862 3300005289 Ga0065704_10005291 Ga0065704_100052912 171
863 3300005295 Ga0065707_10112237 Ga0065707_101122373 171
864 3300005331 Ga0070670_100074814 Ga0070670_1000748143 171
865 3300005334 Ga0068869_100298008 Ga0068869_1002980082 171
866 3300005340 Ga0070689_100068765 Ga0070689_1000687652 171
867 3300005347 Ga0070668_100083742 Ga0070668_1000837422 171
868 3300005353 Ga0070669_100006800 Ga0070669_1000068007 171
869 3300005354 Ga0070675_100513487 Ga0070675_1005134872 171
870 3300005355 Ga0070671_100010405 Ga0070671_1000104054 171
871 3300005364 Ga0070673_100074718 Ga0070673_1000747183 171
872 3300005364 Ga0070673_100205036 Ga0070673_1002050362 171
873 3300005364 Ga0070673_100295045 Ga0070673_1002950452 171
874 3300005365 Ga0070688_100013824 Ga0070688_1000138244 171
875 3300005438 Ga0070701_10154658 Ga0070701_101546582 171
876 3300005440 Ga0070705_100008138 Ga0070705_1000081383 171
877 3300005441 Ga0070700_100060103 Ga0070700_1000601032 171
878 3300005444 Ga0070694_100000734 Ga0070694_10000073415 171
879 3300005444 Ga0070694_100001223 Ga0070694_1000012233 171
880 3300005457 Ga0070662_100046004 Ga0070662_1000460042 171
881 3300005457 Ga0070662_100075719 Ga0070662_1000757192 171
882 3300005458 Ga0070681_10024842 Ga0070681_100248424 171
883 3300005459 Ga0068867_100003655 Ga0068867_1000036558 171
884 3300005471 Ga0070698_100014372 Ga0070698_1000143724 171
885 3300005471 Ga0070698_100021898 Ga0070698_1000218985 171
886 3300005530 Ga0070679_100055706 Ga0070679_1000557063 171
887 3300005543 Ga0070672_100411979 Ga0070672_1004119792 171
888 3300005544 Ga0070686_100100383 Ga0070686_1001003832 171
889 3300005545 Ga0070695_100004284 Ga0070695_1000042841 171
890 3300005546 Ga0070696_100008858 Ga0070696_1000088586 171
891 3300005549 Ga0070704_100003478 Ga0070704_1000034788 171
892 3300005549 Ga0070704_100035596 Ga0070704_1000355962 171
893 3300005564 Ga0070664_100027979 Ga0070664_1000279792 171
894 3300005577 Ga0068857_100037232 Ga0068857_1000372324 171
895 3300005577 Ga0068857_100074413 Ga0068857_1000744132 171
896 3300005615 Ga0070702_100205270 Ga0070702_1002052702 171
897 3300005719 Ga0068861_100003935 Ga0068861_1000039358 171
898 3300005719 Ga0068861_100084987 Ga0068861_1000849872 171
899 3300005840 Ga0068870_10002012 Ga0068870_100020123 171
900 3300005841 Ga0068863_100055817 Ga0068863_1000558172 171
901 3300005841 Ga0068863_100108057 Ga0068863_1001080572 171
902 3300005843 Ga0068860_100118951 Ga0068860_1001189513 171
903 3300005844 Ga0068862_100000603 Ga0068862_10000060329 171
904 3300006237 Ga0097621_100435050 Ga0097621_1004350502 171
905 3300006844 Ga0075428_100237921 Ga0075428_1002379212 171
906 3300006852 Ga0075433_10733640 Ga0075433_107336401 171
907 3300006871 Ga0075434_100001436 Ga0075434_1000014364 171
908 3300006871 Ga0075434_100510589 Ga0075434_1005105892 171
909 3300007076 Ga0075435_100043537 Ga0075435_1000435374 171
910 3300007076 Ga0075435_100127534 Ga0075435_1001275343 171
911 3300007076 Ga0075435_100379246 Ga0075435_1003792462 171
912 3300009094 Ga0111539_10046561 Ga0111539_100465614 171
913 3300009094 Ga0111539_11046726 Ga0111539_110467262 171
914 3300009147 Ga0114129_10752145 Ga0114129_107521452 171
915 3300009148 Ga0105243_10067131 Ga0105243_100671312 171
916 3300009148 Ga0105243_10154629 Ga0105243_101546292 171
917 3300009176 Ga0105242_10954246 Ga0105242_109542461 171
918 3300009553 Ga0105249_10017654 Ga0105249_100176543 171
919 3300011119 Ga0105246_10293055 Ga0105246_102930552 171
920 3300011119 Ga0105246_10736608 Ga0105246_107366082 171
921 3300013297 Ga0157378_10665819 Ga0157378_106658192 171
922 3300013308 Ga0157375_10008416 Ga0157375_100084166 171
923 3300014326 Ga0157380_10085509 Ga0157380_100855093 171
924 3300014745 Ga0157377_10055537 Ga0157377_100555372 171
925 3300014969 Ga0157376_10166998 Ga0157376_101669982 171
926 3300025885 Ga0207653_10013702 Ga0207653_100137022 171
927 3300025904 Ga0207647_10113090 Ga0207647_101130902 171
928 3300025907 Ga0207645_10069063 Ga0207645_100690631 171
929 3300025908 Ga0207643_10003460 Ga0207643_100034605 171
930 3300025912 Ga0207707_10585552 Ga0207707_105855521 171
931 3300025918 Ga0207662_10032509 Ga0207662_100325093 171
932 3300025923 Ga0207681_10002902 Ga0207681_100029025 171
933 3300025926 Ga0207659_10060150 Ga0207659_100601502 171
934 3300025931 Ga0207644_10249988 Ga0207644_102499881 171
935 3300025933 Ga0207706_10018920 Ga0207706_100189203 171
936 3300025933 Ga0207706_10082533 Ga0207706_100825332 171
937 3300025935 Ga0207709_10074584 Ga0207709_100745843 171
938 3300025936 Ga0207670_10088977 Ga0207670_100889772 171
939 3300025940 Ga0207691_10052371 Ga0207691_100523713 171
940 3300025940 Ga0207691_10129364 Ga0207691_101293642 171
941 3300025940 Ga0207691_10216292 Ga0207691_102162922 171
942 3300025942 Ga0207689_10118929 Ga0207689_101189292 171
943 3300025942 Ga0207689_10719748 Ga0207689_107197482 171
944 3300025942 Ga0207689_10751458 Ga0207689_107514581 171
945 3300025945 Ga0207679_10085404 Ga0207679_100854042 171
946 3300025960 Ga0207651_10176693 Ga0207651_101766932 171
947 3300025961 Ga0207712_10003929 Ga0207712_100039295 171
948 3300025972 Ga0207668_10068691 Ga0207668_100686912 171
949 3300026075 Ga0207708_10021795 Ga0207708_100217953 171
950 3300026088 Ga0207641_10179142 Ga0207641_101791422 171
951 3300026088 Ga0207641_10188463 Ga0207641_101884632 171
952 3300026088 Ga0207641_11019404 Ga0207641_110194042 171
953 3300026089 Ga0207648_10005118 Ga0207648_100051183 171
954 3300026089 Ga0207648_10146600 Ga0207648_101466001 171
955 3300026095 Ga0207676_10074704 Ga0207676_100747042 171
956 3300026095 Ga0207676_10090926 Ga0207676_100909262 171
957 3300026116 Ga0207674_10019767 Ga0207674_100197674 171
958 3300026116 Ga0207674_10044070 Ga0207674_100440703 171
959 3300026118 Ga0207675_100008364 Ga0207675_1000083643 171
960 3300026118 Ga0207675_100625221 Ga0207675_1006252212 171
961 3300027907 Ga0207428_10003760 Ga0207428_1000376013 171
962 3300028380 Ga0268265_10000485 Ga0268265_100004853 171
963 3300028381 Ga0268264_10135905 Ga0268264_101359052 171
964 3300028381 Ga0268264_10618231 Ga0268264_106182311 171
965 3300031852 Ga0307410_10986862 Ga0307410_109868622 171
966 3300031901 Ga0307406_10255865 Ga0307406_102558652 171
967 3300032002 Ga0307416_100185490 Ga0307416_1001854902 171
968 3300032005 Ga0307411_10172656 Ga0307411_101726562 171
969 3300034819 Ga0373958_0073464 Ga0373958_0073464_57_572 171
970 3300035088 Ga0373940_0094211 Ga0373940_0094211_216_731 171
971 3300035090 Ga0373949_0008199 Ga0373949_0008199_1567_2082 171
972 3300035114 Ga0373939_0030314 Ga0373939_0030314_191_706 171
973 3300035115 Ga0373941_0059681 Ga0373941_0059681_420_935 171
974 3300035691 Ga0373931_0125985 Ga0373931_0125985_776_1291 171
975 3300045051 Ga0451576_0076152 Ga0451576_0076152_393_938 171
976 3300045051 Ga0451576_0224161 Ga0451576_0224161_1144_1659 171
977 3300046455 Ga0495603_0032738 Ga0495603_0032738_466_999 171
978 3300046475 Ga0495639_0290905 Ga0495639_0290905_277_792 171
979 3300046491 Ga0495584_0242924 Ga0495584_0242924_103_618 171
980 3300046499 Ga0495594_0051213 Ga0495594_0051213_320_853 171
981 3300046522 Ga0495643_0021593 Ga0495643_0021593_1164_1685 171
982 3300046538 Ga0495609_0131346 Ga0495609_0131346_140_673 171
983 3300046539 Ga0495621_0004604 Ga0495621_0004604_1147_1662 171
984 3300046664 Ga0495659_0128011 Ga0495659_0128011_23_556 171
985 3300046664 Ga0495659_0170127 Ga0495659_0170127_17_550 171
986 3300046674 Ga0495588_0002399 Ga0495588_0002399_55_588 171
987 3300046684 Ga0495669_0016533 Ga0495669_0016533_45_578 171
988 3300047445 Ga0495677_0280225 Ga0495677_0280225_107_640 171
989 3300048909 Ga0496106_0860708 Ga0496106_0860708_108_623 171
990 3300050507 nmdc:mga05p37_48721_c1 nmdc:mga05p37_48721_c1_4565_5080 171
991 3300050511 nmdc:mga08y16_247020_c1 nmdc:mga08y16_247020_c1_623_1138 171
992 3300050511 nmdc:mga08y16_96564_c1 nmdc:mga08y16_96564_c1_623_1138 171
993 3300050512 nmdc:mga0n895_1115874_c1 nmdc:mga0n895_1115874_c1_75_590 171
994 3300050512 nmdc:mga0n895_119371_c1 nmdc:mga0n895_119371_c1_177_692 171
995 3300050512 nmdc:mga0n895_379842_c1 nmdc:mga0n895_379842_c1_262_795 171
996 3300050512 nmdc:mga0n895_7430_c1 nmdc:mga0n895_7430_c1_219_752 171
997 3300050513 nmdc:mga0rr50_1039101_c1 nmdc:mga0rr50_1039101_c1_38_571 171
998 3300050513 nmdc:mga0rr50_1173164_c1 nmdc:mga0rr50_1173164_c1_73_606 171
999 3300050513 nmdc:mga0rr50_35177_c1 nmdc:mga0rr50_35177_c1_2961_3494 171
1000 3300050515 nmdc:mga0a205_150611_c1 nmdc:mga0a205_150611_c1_1516_2049 171
1001 iso_pu_bacteria 2816332186 2816864103 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

3

159

0.94

PF01575

MaoC_dehydratas

MaoC like domain

14

132

0.9

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

35

143

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sh3-assembly1.cif.gz_B crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder 0.8908 106 145
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.878 9 153
2bi0-assembly1.cif.gz_A rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold 0.878 9 158
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8758 10 152
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.8641 9 164
ID Description Score Start End Superfamily
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9157 1 153 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8876 1 153 3.10.129.10
2bi0A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8842 9 152 3.10.129.10
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8769 15 152 3.10.129.10
4ffuK00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.871 10 152 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2E0Y720-F1-model_v4 Dehydratase 0.9749 10 156 GO:0016829
AF-A0A6I1JB25-F1-model_v4 MaoC domain-containing protein dehydratase 0.9728 9 154
AF-A0A534T6U4-F1-model_v4 MaoC family dehydratase 0.9721 10 153
AF-A0A382H3A6-F1-model_v4 Uncharacterized protein 0.9719 10 156 GO:0016829
AF-A0A2S6TKS2-F1-model_v4 Mesaconyl-CoA hydratase (EC 4.2.1.148) 0.9706 10 156 GO:0016829

Feature Viewer

pLDDT pTM Quality
91.42 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map