F487794

General Info

Members Datasets Scaffolds Average Seq Length
997 460 899 258

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10014055|Ga0081539_100140552
Length 294
Sequence VCHGCAERRAALPSALVTTLPPAEEPSPDTGRRADEAAAVTDAAGAPKDGLRDDHREEYQQGPVTLRGRLVPPTTTDQRLLDSRGPTDWVHSDPWRVLRIQSEFVEGFGALAELGPAVSVFGSARTRRDHPDWALGESLGAALARAGFAVITGGGPGAMAATNKGAIEAGGVSVGLGIELPFEQGINEWVNLAVNFRYFFARKTMFVKYAQGFVVLPGGFGTLDELFEALVLVQTKKVTSFPIVLLGTSYWGGLLEWARGPLLERGMVGARDLDLIRVTDDVAFAAEDDAGKAL

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221561 Nocardioides sp. Root151 Isolate Unclassified
8 2643221590 Nocardioides sp. Root682 Isolate Unclassified
9 2643221613 Oerskovia sp. Root22 Isolate Unclassified
10 2643221615 Nocardioides sp. Root224 Isolate Unclassified
11 2643221641 Nocardioides sp. Root122 Isolate Unclassified
12 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
13 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
14 2643221679 Angustibacter sp. Root456 Isolate Unclassified
15 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
18 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
19 2643221696 Nocardioides sp. Root140 Isolate Unclassified
20 2643221711 Terrabacter sp. Root85 Isolate Unclassified
21 2643221721 Oerskovia sp. Root918 Isolate Unclassified
22 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
23 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
24 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
25 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
26 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
27 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
28 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
29 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
30 2739367898 Nocardioides sp. CF479 Isolate Unclassified
31 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
32 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
33 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
34 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
35 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
36 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
37 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
38 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
39 2808606394 Promicromonospora sp. C35 Isolate Unclassified
40 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
41 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
42 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
43 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
44 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
45 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
46 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
47 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
48 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
49 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
50 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
51 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
52 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
53 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
54 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
55 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
56 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
57 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
58 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
59 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
60 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
61 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
62 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
63 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
64 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
65 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
66 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
67 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
68 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
69 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
70 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
71 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
72 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
73 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
74 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
75 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
76 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
77 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
78 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
79 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
80 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
81 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
82 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
83 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
84 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
85 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
86 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
87 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
88 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
89 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
90 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
91 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
100 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
101 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
102 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
110 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
111 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
112 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
113 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
114 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
115 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
116 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
123 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
124 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
125 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
126 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
129 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
138 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
139 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
140 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
141 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
142 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
143 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
144 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
152 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
153 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
183 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
186 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
238 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
239 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
240 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
241 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
245 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
250 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
251 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
259 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
260 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
261 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
282 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
283 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
284 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
287 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
323 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
394 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
417 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
428 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
433 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
438 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
439 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
440 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
441 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
442 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
445 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
446 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
449 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
450 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
451 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
452 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
453 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
454 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
455 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
456 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
457 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
458 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
459 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
460 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.67
Metatranscriptomes 0.5
Isolates 9.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 5.52
Nodule 0.1
Rhizoplane 6.72
Rhizosphere 79.54
Stem 0
Stem Tuber 0.1
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029076 3300001979 Bacteria 1819
2 JGI24737J22298_10079755 3300001990 Bacteria 974
3 JGI24743J22301_10011899 3300001991 Bacteria 1575
4 Ga0007423J48922_100135 3300003285 Bacteria 7860
5 Ga0007423J48922_100136 3300003285 Bacteria 7298
6 Ga0070658_10258407 3300005327 Bacteria 1479
7 Ga0070658_10410682 3300005327 Bacteria 1163
8 Ga0070683_100000566 3300005329 Bacteria 26326
9 Ga0070683_100028278 3300005329 Bacteria 5066
10 Ga0070683_100076950 3300005329 Bacteria 3120
11 Ga0070683_100142803 3300005329 Bacteria 2268
12 Ga0070683_100350193 3300005329 Bacteria 1406
13 Ga0070683_100483772 3300005329 Bacteria 1182
14 Ga0070683_100640632 3300005329 Bacteria 1017
15 Ga0068869_100036317 3300005334 Bacteria 3499
16 Ga0070680_100006434 3300005336 Bacteria 8926
17 Ga0070682_100110682 3300005337 Bacteria 1830
18 Ga0070682_100135192 3300005337 Bacteria 1674
19 Ga0070682_100201841 3300005337 Bacteria 1403
20 Ga0068868_100085485 3300005338 Bacteria 2535
21 Ga0068868_100316406 3300005338 Bacteria 1329
22 Ga0070660_100027131 3300005339 Bacteria 4272
23 Ga0070660_100051362 3300005339 Bacteria 3175
24 Ga0070689_100337479 3300005340 Bacteria 1262
25 Ga0070691_10048738 3300005341 Bacteria 2017
26 Ga0070687_100114578 3300005343 Bacteria 1532
27 Ga0070692_10117298 3300005345 Bacteria 1480
28 Ga0070692_10349687 3300005345 Bacteria 918
29 Ga0070668_100103590 3300005347 Bacteria 2257
30 Ga0070675_100095762 3300005354 Bacteria 2493
31 Ga0070674_100015450 3300005356 Bacteria 4765
32 Ga0070674_100075935 3300005356 Bacteria 2388
33 Ga0070673_100182403 3300005364 Bacteria 1798
34 Ga0070659_100024836 3300005366 Bacteria 4597
35 Ga0070659_100027577 3300005366 Bacteria 4378
36 Ga0070659_100215024 3300005366 Bacteria 1585
37 Ga0070667_100650584 3300005367 Bacteria 973
38 Ga0070709_10120178 3300005434 Bacteria 1779
39 Ga0070709_10153756 3300005434 Bacteria 1593
40 Ga0070714_100032019 3300005435 Bacteria 4390
41 Ga0070714_100075811 3300005435 Bacteria 2919
42 Ga0070713_100048185 3300005436 Bacteria 3507
43 Ga0070710_10000110 3300005437 Bacteria 38306
44 Ga0070710_10029562 3300005437 Bacteria 2941
45 Ga0070701_10001057 3300005438 Bacteria 10046
46 Ga0070705_100012269 3300005440 Bacteria 4352
47 Ga0070694_100622994 3300005444 Bacteria 871
48 Ga0070708_100492719 3300005445 Bacteria 1156
49 Ga0070663_100002222 3300005455 Bacteria 10869
50 Ga0070678_100053128 3300005456 Bacteria 2945
51 Ga0070678_100061042 3300005456 Bacteria 2778
52 Ga0070678_100165237 3300005456 Bacteria 1797
53 Ga0070678_100170146 3300005456 Bacteria 1774
54 Ga0070681_10036203 3300005458 Bacteria 4957
55 Ga0068867_100026319 3300005459 Bacteria 4176
56 Ga0070685_10074406 3300005466 Bacteria 2021
57 Ga0070685_10156467 3300005466 Bacteria 1449
58 Ga0070707_100049564 3300005468 Bacteria 4026
59 Ga0070707_100174553 3300005468 Bacteria 2094
60 Ga0070698_100003056 3300005471 Bacteria 18446
61 Ga0070699_100037534 3300005518 Bacteria 4194
62 Ga0070679_100066386 3300005530 Bacteria 3596
63 Ga0070679_100216410 3300005530 Bacteria 1878
64 Ga0070679_100334782 3300005530 Bacteria 1462
65 Ga0070679_100379240 3300005530 Bacteria 1361
66 Ga0070679_100461587 3300005530 Bacteria 1215
67 Ga0070684_100001014 3300005535 Bacteria 20027
68 Ga0070684_100054076 3300005535 Bacteria 3497
69 Ga0070672_100024021 3300005543 Bacteria 4497
70 Ga0070696_100005324 3300005546 Bacteria 8585
71 Ga0070693_100133991 3300005547 Bacteria 1552
72 Ga0070665_100164425 3300005548 Bacteria 2221
73 Ga0070665_100168244 3300005548 Bacteria 2194
74 Ga0070664_100081383 3300005564 Bacteria 2791
75 Ga0070664_100129421 3300005564 Bacteria 2217
76 Ga0070664_100317684 3300005564 Bacteria 1410
77 Ga0068854_100069905 3300005578 Bacteria 2565
78 Ga0068856_100017536 3300005614 Bacteria 6938
79 Ga0068856_100031077 3300005614 Bacteria 5223
80 Ga0068856_100246752 3300005614 Bacteria 1801
81 Ga0070702_100000741 3300005615 Bacteria 12358
82 Ga0070702_100000931 3300005615 Bacteria 11456
83 Ga0070702_100029423 3300005615 Bacteria 2987
84 Ga0068852_100011817 3300005616 Bacteria 6596
85 Ga0068852_100068923 3300005616 Bacteria 3098
86 Ga0068852_100266927 3300005616 Bacteria 1645
87 Ga0068852_100546788 3300005616 Bacteria 1158
88 Ga0068859_100251991 3300005617 Bacteria 1856
89 Ga0068864_100119532 3300005618 Bacteria 2354
90 Ga0068864_100136908 3300005618 Bacteria 2206
91 Ga0068864_100407077 3300005618 Bacteria 1294
92 Ga0068866_10226109 3300005718 Bacteria 1132
93 Ga0068861_100033624 3300005719 Bacteria 3784
94 Ga0068861_100518072 3300005719 Bacteria 1081
95 Ga0068870_10010542 3300005840 Bacteria 4252
96 Ga0068858_100016437 3300005842 Bacteria 6949
97 Ga0068858_100540732 3300005842 Bacteria 1127
98 Ga0068860_100571832 3300005843 Bacteria 1134
99 Ga0068862_100298310 3300005844 Bacteria 1482
100 Ga0081539_10010027 3300005985 Bacteria 7794
101 Ga0081539_10010892 3300005985 Bacteria 7302
102 Ga0081539_10014055 3300005985 Bacteria 5958
103 Ga0075365_10009383 3300006038 Bacteria 5620
104 Ga0075365_10010178 3300006038 Bacteria 5461
105 Ga0075365_10018920 3300006038 Bacteria 4242
106 Ga0075365_10057867 3300006038 Bacteria 2579
107 Ga0075365_10086891 3300006038 Bacteria 2126
108 Ga0075365_10128931 3300006038 Bacteria 1749
109 Ga0075365_10149006 3300006038 Bacteria 1627
110 Ga0075365_10184371 3300006038 Bacteria 1460
111 Ga0075363_100037738 3300006048 Bacteria 2538
112 Ga0075363_100090449 3300006048 Bacteria 1684
113 Ga0075363_100216318 3300006048 Bacteria 1097
114 Ga0075363_100240959 3300006048 Bacteria 1039
115 Ga0075364_10027189 3300006051 Bacteria 3653
116 Ga0075364_10031896 3300006051 Bacteria 3385
117 Ga0075364_10035531 3300006051 Bacteria 3220
118 Ga0075364_10081762 3300006051 Bacteria 2136
119 Ga0075367_10017570 3300006178 Bacteria 3929
120 Ga0097621_100107429 3300006237 Bacteria 2355
121 Ga0097621_100243176 3300006237 Bacteria 1574
122 Ga0075370_10008645 3300006353 Bacteria 5248
123 Ga0075370_10102880 3300006353 Bacteria 1654
124 Ga0068871_100557115 3300006358 Bacteria 1039
125 Ga0075428_100237322 3300006844 Bacteria 1968
126 Ga0075431_100064291 3300006847 Bacteria 3788
127 Ga0075434_100664633 3300006871 Bacteria 1060
128 Ga0075429_100426041 3300006880 Bacteria 1162
129 Ga0068865_100005761 3300006881 Bacteria 7531
130 Ga0068865_100280703 3300006881 Bacteria 1326
131 Ga0097620_100251979 3300006931 Bacteria 1856
132 Ga0105244_10101074 3300009036 Bacteria 1410
133 Ga0111539_10064576 3300009094 Bacteria 4329
134 Ga0105245_10008971 3300009098 Bacteria 8723
135 Ga0105245_10092041 3300009098 Bacteria 2792
136 Ga0105245_10137952 3300009098 Bacteria 2294
137 Ga0105245_10618801 3300009098 Bacteria 1111
138 Ga0114129_10118769 3300009147 Bacteria 3642
139 Ga0105243_10005375 3300009148 Bacteria 9994
140 Ga0105243_10006666 3300009148 Bacteria 8917
141 Ga0105243_10298971 3300009148 Bacteria 1458
142 Ga0105243_10331836 3300009148 Bacteria 1389
143 Ga0105243_10781684 3300009148 Bacteria 939
144 Ga0105242_10140022 3300009176 Bacteria 2098
145 Ga0105237_10286426 3300009545 Bacteria 1650
146 Ga0105238_10040721 3300009551 Bacteria 4707
147 Ga0105238_10465709 3300009551 Bacteria 1262
148 Ga0105029_100937 3300009984 Bacteria 1704
149 Ga0105239_10389235 3300010375 Bacteria 1577
150 Ga0105239_10534251 3300010375 Bacteria 1335
151 Ga0105239_10545572 3300010375 Bacteria 1320
152 Ga0105246_10000393 3300011119 Bacteria 23439
153 Ga0105246_10023835 3300011119 Bacteria 3966
154 Ga0105246_10344269 3300011119 Bacteria 1219
155 Ga0157371_10395019 3300013102 Bacteria 1011
156 Ga0157369_10056458 3300013105 Bacteria 4237
157 Ga0157369_10285744 3300013105 Bacteria 1718
158 Ga0157369_10326345 3300013105 Bacteria 1595
159 Ga0157374_10793707 3300013296 Bacteria 962
160 Ga0157378_10059704 3300013297 Bacteria 3403
161 Ga0157378_10830299 3300013297 Bacteria 951
162 Ga0157378_10930033 3300013297 Bacteria 901
163 Ga0163162_10020330 3300013306 Bacteria 6522
164 Ga0157372_10002293 3300013307 Bacteria 20744
165 Ga0157372_10205429 3300013307 Bacteria 2282
166 Ga0157375_10031138 3300013308 Bacteria 5037
167 Ga0157375_10054232 3300013308 Bacteria 3948
168 Ga0157375_10115648 3300013308 Bacteria 2785
169 Ga0157375_10151110 3300013308 Bacteria 2458
170 Ga0157375_10242375 3300013308 Bacteria 1962
171 Ga0157375_10745323 3300013308 Bacteria 1131
172 Ga0163163_10052960 3300014325 Bacteria 4005
173 Ga0163163_10117504 3300014325 Bacteria 2691
174 Ga0163163_10315058 3300014325 Bacteria 1618
175 Ga0157380_10021716 3300014326 Bacteria 4819
176 Ga0157380_10071601 3300014326 Bacteria 2805
177 Ga0157380_10644057 3300014326 Bacteria 1056
178 Ga0182008_10130389 3300014497 Bacteria 1253
179 Ga0182008_10180851 3300014497 Bacteria 1067
180 Ga0157377_10026123 3300014745 Bacteria 3122
181 Ga0157377_10091425 3300014745 Bacteria 1798
182 Ga0157379_10026044 3300014968 Bacteria 5202
183 Ga0157379_10215891 3300014968 Bacteria 1737
184 Ga0157376_10351081 3300014969 Bacteria 1411
185 Ga0183367_1002 3300015688 Bacteria 1101531
186 Ga0206356_10646937 3300020070 Bacteria 2495
187 Ga0206353_11333670 3300020082 Bacteria 10459
188 Ga0206353_11505532 3300020082 Bacteria 1941
189 Ga0213875_10003530 3300021388 Bacteria 8890
190 Ga0228598_1014053 3300024227 Bacteria 1584
191 Ga0207697_10076111 3300025315 Bacteria 1410
192 Ga0207692_10002246 3300025898 Bacteria 7391
193 Ga0207688_10006708 3300025901 Bacteria 6263
194 Ga0207688_10034271 3300025901 Bacteria 2811
195 Ga0207688_10057596 3300025901 Bacteria 2185
196 Ga0207647_10226559 3300025904 Bacteria 1076
197 Ga0207699_10053315 3300025906 Bacteria 2397
198 Ga0207699_10217962 3300025906 Bacteria 1301
199 Ga0207643_10002261 3300025908 Bacteria 10497
200 Ga0207705_10016121 3300025909 Bacteria 5362
201 Ga0207705_10155486 3300025909 Bacteria 1715
202 Ga0207684_10349341 3300025910 Bacteria 1273
203 Ga0207654_10111480 3300025911 Bacteria 1703
204 Ga0207707_10016421 3300025912 Bacteria 6458
205 Ga0207693_10116707 3300025915 Bacteria 2096
206 Ga0207663_10025992 3300025916 Bacteria 3393
207 Ga0207663_10219202 3300025916 Bacteria 1383
208 Ga0207660_10031096 3300025917 Bacteria 3673
209 Ga0207662_10013839 3300025918 Bacteria 4516
210 Ga0207657_10022465 3300025919 Bacteria 5900
211 Ga0207657_10066348 3300025919 Bacteria 3072
212 Ga0207652_10025250 3300025921 Bacteria 4937
213 Ga0207652_10171755 3300025921 Bacteria 1945
214 Ga0207652_10492914 3300025921 Bacteria 1103
215 Ga0207646_10113058 3300025922 Bacteria 2437
216 Ga0207694_10049511 3300025924 Bacteria 3253
217 Ga0207659_10086876 3300025926 Bacteria 2327
218 Ga0207687_10051896 3300025927 Bacteria 2860
219 Ga0207687_10437597 3300025927 Bacteria 1082
220 Ga0207664_10003068 3300025929 Bacteria 11095
221 Ga0207664_10019581 3300025929 Bacteria 5004
222 Ga0207664_10162938 3300025929 Bacteria 1903
223 Ga0207690_10161719 3300025932 Bacteria 1670
224 Ga0207686_10212637 3300025934 Bacteria 1391
225 Ga0207709_10180390 3300025935 Bacteria 1491
226 Ga0207709_10294594 3300025935 Bacteria 1204
227 Ga0207669_10036827 3300025937 Bacteria 2800
228 Ga0207669_10216814 3300025937 Bacteria 1401
229 Ga0207704_10021494 3300025938 Bacteria 3439
230 Ga0207704_10037911 3300025938 Bacteria 2789
231 Ga0207665_10041270 3300025939 Bacteria 3080
232 Ga0207665_10208681 3300025939 Bacteria 1426
233 Ga0207691_10035517 3300025940 Bacteria 4625
234 Ga0207691_10144276 3300025940 Bacteria 2097
235 Ga0207711_10401917 3300025941 Bacteria 1273
236 Ga0207661_10079084 3300025944 Bacteria 2709
237 Ga0207661_10081310 3300025944 Bacteria 2676
238 Ga0207661_10111775 3300025944 Bacteria 2312
239 Ga0207661_10279966 3300025944 Bacteria 1490
240 Ga0207679_10166170 3300025945 Bacteria 1812
241 Ga0207679_10318695 3300025945 Bacteria 1345
242 Ga0207712_10087117 3300025961 Bacteria 2289
243 Ga0207640_10041090 3300025981 Bacteria 2939
244 Ga0207677_10185977 3300026023 Bacteria 1638
245 Ga0207677_10249208 3300026023 Bacteria 1441
246 Ga0207703_10022437 3300026035 Bacteria 4951
247 Ga0207703_10045242 3300026035 Bacteria 3540
248 Ga0207639_10006559 3300026041 Bacteria 7913
249 Ga0207639_10059592 3300026041 Bacteria 2941
250 Ga0207678_10358847 3300026067 Bacteria 1257
251 Ga0207678_10458816 3300026067 Bacteria 1108
252 Ga0207708_10000689 3300026075 Bacteria 25629
253 Ga0207702_10024539 3300026078 Bacteria 5003
254 Ga0207702_10045767 3300026078 Bacteria 3681
255 Ga0207702_10160619 3300026078 Bacteria 2052
256 Ga0207702_10454666 3300026078 Bacteria 1243
257 Ga0207641_10041488 3300026088 Bacteria 3857
258 Ga0207648_10008420 3300026089 Bacteria 9989
259 Ga0207676_10127813 3300026095 Bacteria 2155
260 Ga0207676_10166098 3300026095 Bacteria 1918
261 Ga0207676_10282510 3300026095 Bacteria 1508
262 Ga0207674_10452659 3300026116 Bacteria 1241
263 Ga0207675_100001638 3300026118 Bacteria 22449
264 Ga0207675_100460576 3300026118 Bacteria 1261
265 Ga0207698_10049931 3300026142 Bacteria 3188
266 Ga0207698_10089796 3300026142 Bacteria 2511
267 Ga0207698_10123641 3300026142 Bacteria 2195
268 Ga0209371_1028786 3300027312 Bacteria 1234
269 Ga0209813_10005281 3300027866 Bacteria 3126
270 Ga0268266_10221566 3300028379 Bacteria 1739
271 Ga0268266_10222265 3300028379 Bacteria 1737
272 Ga0268264_10000943 3300028381 Bacteria 30160
273 Ga0265338_10005476 3300028800 Bacteria 16562
274 Ga0316176_1032343 3300030732 Bacteria 5890
275 Ga0314311_1097076 3300030733 Bacteria 6104
276 Ga0316179_1081360 3300030734 Bacteria 1087
277 Ga0316180_1110667 3300030736 Bacteria 1933
278 Ga0316181_1123477 3300030744 Bacteria 2212
279 Ga0307513_10000392 3300031456 Bacteria 63905
280 Ga0307513_10172807 3300031456 Bacteria 2036
281 Ga0307408_100026929 3300031548 Bacteria 3956
282 Ga0316575_10000183 3300031665 Bacteria 16320
283 Ga0316575_10005262 3300031665 Bacteria 4607
284 Ga0316579_10000576 3300031691 Bacteria 12273
285 Ga0316579_10003042 3300031691 Bacteria 6457
286 Ga0316576_10000409 3300031727 Bacteria 19808
287 Ga0316576_10005178 3300031727 Bacteria 7923
288 Ga0316576_10009982 3300031727 Bacteria 6149
289 Ga0316578_10001788 3300031728 Bacteria 9023
290 Ga0316578_10003110 3300031728 Bacteria 7496
291 Ga0316578_10024171 3300031728 Bacteria 3407
292 Ga0307405_10049052 3300031731 Bacteria 2608
293 Ga0316577_10034039 3300031733 Bacteria 2847
294 Ga0307413_10076057 3300031824 Bacteria 2133
295 Ga0307410_10011079 3300031852 Bacteria 5141
296 Ga0307410_10095476 3300031852 Bacteria 2120
297 Ga0307410_10125735 3300031852 Bacteria 1877
298 Ga0307410_10183114 3300031852 Bacteria 1587
299 Ga0307410_10445094 3300031852 Bacteria 1056
300 Ga0307406_10060614 3300031901 Bacteria 2441
301 Ga0307406_10143334 3300031901 Bacteria 1695
302 Ga0307407_10066021 3300031903 Bacteria 2133
303 Ga0307409_100021234 3300031995 Bacteria 4448
304 Ga0307409_100038947 3300031995 Bacteria 3522
305 Ga0307409_100148061 3300031995 Bacteria 2034
306 Ga0307409_100154020 3300031995 Bacteria 2000
307 Ga0307409_100201796 3300031995 Bacteria 1780
308 Ga0307409_100346439 3300031995 Bacteria 1400
309 Ga0307409_100385299 3300031995 Bacteria 1334
310 Ga0307409_100536586 3300031995 Bacteria 1146
311 Ga0307416_100003285 3300032002 Bacteria 9454
312 Ga0307416_100113291 3300032002 Bacteria 2396
313 Ga0307416_100143194 3300032002 Bacteria 2177
314 Ga0307416_100460214 3300032002 Bacteria 1327
315 Ga0307416_100513845 3300032002 Bacteria 1265
316 Ga0307416_100603629 3300032002 Bacteria 1177
317 Ga0307414_10277056 3300032004 Bacteria 1408
318 Ga0307415_100081535 3300032126 Bacteria 2311
319 Ga0307415_100239418 3300032126 Bacteria 1467
320 Ga0307415_100266557 3300032126 Bacteria 1401
321 Ga0307415_100279912 3300032126 Bacteria 1371
322 Ga0316585_10002960 3300032137 Bacteria 4638
323 Ga0316580_10008578 3300032139 Bacteria 3063
324 Ga0307507_10085453 3300033179 Bacteria 2744
325 Ga0373934_0151833 3300035086 Bacteria 949
326 Ga0373956_0171815 3300035119 Bacteria 1023
327 Ga0373955_0048265 3300035172 Bacteria 2308
328 Ga0316574_0023602 3300035398 Bacteria 3673
329 Ga0316574_0031574 3300035398 Bacteria 3213
330 Ga0316574_0034648 3300035398 Bacteria 3079
331 Ga0316574_0418525 3300035398 Bacteria 842
332 Ga0373924_0002250 3300035410 Bacteria 6480
333 Ga0373935_0017081 3300035692 Bacteria 4396
334 Ga0373933_0004233 3300035724 Bacteria 7906
335 Ga0373947_0291097 3300035725 Bacteria 1087
336 Ga0373937_0027294 3300036401 Bacteria 5163
337 Ga0373937_0273255 3300036401 Bacteria 1595
338 Ga0316582_0003824 3300036647 Bacteria 7481
339 Ga0316582_0069766 3300036647 Bacteria 2272
340 Ga0316584_0001201 3300036712 Bacteria 15333
341 Ga0316584_0039385 3300036712 Bacteria 3518
342 Ga0316584_0096972 3300036712 Bacteria 2207
343 Ga0316584_0191619 3300036712 Bacteria 1511
344 Ga0373925_0032460 3300037068 Bacteria 3843
345 Ga0373925_0038674 3300037068 Bacteria 3528
346 Ga0395899_0035350 3300037312 Bacteria 3751
347 Ga0395899_0037638 3300037312 Bacteria 3627
348 Ga0395900_0043272 3300037418 Bacteria 4641
349 Ga0395900_0115423 3300037418 Bacteria 2755
350 Ga0395898_0085701 3300037466 Bacteria 3036
351 Ga0395898_0085821 3300037466 Bacteria 3034
352 Ga0395905_0034806 3300037471 Bacteria 4730
353 Ga0395905_0039406 3300037471 Bacteria 4433
354 Ga0395905_0058695 3300037471 Bacteria 3598
355 Ga0436364_0296067 3300037853 Bacteria 138817
356 Ga0436364_0727896 3300037853 Bacteria 5101
357 Ga0436364_1546160 3300037853 Bacteria 10365
358 Ga0395901_0051827 3300038443 Bacteria 4266
359 Ga0395901_0105385 3300038443 Bacteria 2959
360 Ga0395901_0133437 3300038443 Bacteria 2609
361 Ga0395901_0156945 3300038443 Bacteria 2390
362 Ga0395901_0164650 3300038443 Bacteria 2328
363 Ga0395901_0583044 3300038443 Bacteria 1130
364 Ga0395901_0823490 3300038443 Bacteria 915
365 Ga0436365_1354692 3300039437 Bacteria 4700
366 Ga0436363_1570492 3300039450 Bacteria 1075
367 Ga0439447_032416 3300041407 Bacteria 1306
368 Ga0439461_0002938 3300041410 Bacteria 2768
369 Ga0451797_0676472 3300041453 Bacteria 995
370 Ga0451833_0752021 3300041491 Bacteria 17993
371 Ga0451837_0479937 3300041494 Bacteria 3942
372 Ga0439431_0029799 3300041997 Bacteria 1349
373 Ga0439442_012315 3300042002 Bacteria 1748
374 Ga0439449_0002264 3300042007 Bacteria 7565
375 Ga0450907_003560 3300042146 Bacteria 2770
376 Ga0439446_0053129 3300042156 Bacteria 1213
377 Ga0439434_0085695 3300042435 Bacteria 1004
378 Ga0466969_0001083 3300044656 Bacteria 14730
379 Ga0466969_0006586 3300044656 Bacteria 6175
380 Ga0466965_0002838 3300044683 Bacteria 7467
381 Ga0466965_0030135 3300044683 Bacteria 2642
382 Ga0466965_0071626 3300044683 Bacteria 1744
383 Ga0466966_0116967 3300044684 Bacteria 1640
384 Ga0466966_0163669 3300044684 Bacteria 1354
385 Ga0466961_0072814 3300044693 Bacteria 2179
386 Ga0466961_0093951 3300044693 Bacteria 1892
387 Ga0466961_0145608 3300044693 Bacteria 1481
388 Ga0466961_0202471 3300044693 Bacteria 1227
389 Ga0466963_0030436 3300044694 Bacteria 3483
390 Ga0466963_0044204 3300044694 Bacteria 2932
391 Ga0466963_0072424 3300044694 Bacteria 2321
392 Ga0466963_0242770 3300044694 Bacteria 1263
393 Ga0466964_0004033 3300044706 Bacteria 5398
394 Ga0466971_0012684 3300044719 Bacteria 3696
395 Ga0466971_0019727 3300044719 Bacteria 2995
396 Ga0466971_0074996 3300044719 Bacteria 1538
397 Ga0466970_0015639 3300044765 Bacteria 3905
398 Ga0466970_0090692 3300044765 Bacteria 1658
399 Ga0466970_0197086 3300044765 Bacteria 1120
400 Ga0466957_0017810 3300044842 Bacteria 4167
401 Ga0466957_0029833 3300044842 Bacteria 3254
402 Ga0466957_0070608 3300044842 Bacteria 2158
403 Ga0466957_0308144 3300044842 Bacteria 1065
404 Ga0466960_0012672 3300044901 Bacteria 3565
405 Ga0466960_0032218 3300044901 Bacteria 2425
406 Ga0466960_0040839 3300044901 Bacteria 2195
407 Ga0466960_0070580 3300044901 Bacteria 1738
408 Ga0466960_0231615 3300044901 Bacteria 1020
409 Ga0466960_0248867 3300044901 Bacteria 986
410 Ga0466959_0101188 3300045049 Bacteria 2063
411 Ga0466959_0144489 3300045049 Bacteria 1679
412 Ga0466958_0067667 3300045836 Bacteria 2182
413 Ga0466958_0233149 3300045836 Bacteria 1175
414 Ga0466967_0009681 3300045976 Bacteria 7170
415 Ga0466967_0011278 3300045976 Bacteria 6756
416 Ga0466967_0018422 3300045976 Bacteria 5579
417 Ga0466967_0100982 3300045976 Bacteria 2636
418 Ga0466967_0214143 3300045976 Bacteria 1828
419 Ga0466967_0234357 3300045976 Bacteria 1749
420 Ga0466967_0243462 3300045976 Bacteria 1716
421 Ga0466967_0469659 3300045976 Bacteria 1231
422 Ga0466967_0702501 3300045976 Bacteria 1002
423 Ga0495617_012050 3300046452 Bacteria 2949
424 Ga0495592_0002920 3300046454 Bacteria 12167
425 Ga0495592_0008325 3300046454 Bacteria 7781
426 Ga0495592_0029277 3300046454 Bacteria 4170
427 Ga0495592_0136449 3300046454 Bacteria 1710
428 Ga0495603_0001577 3300046455 Bacteria 13336
429 Ga0495603_0019833 3300046455 Bacteria 4071
430 Ga0495603_0040676 3300046455 Bacteria 2782
431 Ga0495603_0135198 3300046455 Bacteria 1435
432 Ga0495629_0001919 3300046459 Bacteria 16205
433 Ga0495629_0014235 3300046459 Bacteria 5728
434 Ga0495641_0085193 3300046461 Bacteria 1415
435 Ga0495651_0000665 3300046462 Bacteria 26668
436 Ga0495651_0004271 3300046462 Bacteria 10960
437 Ga0495651_0110843 3300046462 Bacteria 2029
438 Ga0495651_0325967 3300046462 Bacteria 1022
439 Ga0495653_0010781 3300046463 Bacteria 7484
440 Ga0495653_0027763 3300046463 Bacteria 4530
441 Ga0495653_0034150 3300046463 Bacteria 4026
442 Ga0495580_0175091 3300046472 Bacteria 1482
443 Ga0495582_0083357 3300046473 Bacteria 1777
444 Ga0495582_0142923 3300046473 Bacteria 1357
445 Ga0495605_0020240 3300046474 Bacteria 3538
446 Ga0495662_0014270 3300046476 Bacteria 3864
447 Ga0495662_0239766 3300046476 Bacteria 893
448 Ga0495664_0048940 3300046477 Bacteria 2509
449 Ga0495664_0096395 3300046477 Bacteria 1780
450 Ga0495594_0000151 3300046499 Bacteria 33013
451 Ga0495594_0026491 3300046499 Bacteria 3119
452 Ga0495594_0045499 3300046499 Bacteria 2409
453 Ga0495596_0105106 3300046500 Bacteria 1097
454 Ga0495607_0020151 3300046501 Bacteria 4220
455 Ga0495583_0095183 3300046506 Bacteria 1277
456 Ga0495608_0003307 3300046511 Bacteria 11525
457 Ga0495618_0023162 3300046514 Bacteria 3838
458 Ga0495618_0034383 3300046514 Bacteria 3178
459 Ga0495618_0175329 3300046514 Bacteria 1363
460 Ga0495628_0007504 3300046516 Bacteria 9434
461 Ga0495628_0031131 3300046516 Bacteria 4316
462 Ga0495630_0106817 3300046517 Bacteria 2120
463 Ga0495631_0005294 3300046518 Bacteria 6775
464 Ga0495643_0011246 3300046522 Bacteria 5463
465 Ga0495644_0154161 3300046523 Bacteria 880
466 Ga0495648_0084536 3300046524 Bacteria 1795
467 Ga0495666_0078869 3300046526 Bacteria 1559
468 Ga0495652_0002616 3300046529 Bacteria 18397
469 Ga0495652_0039977 3300046529 Bacteria 4054
470 Ga0495652_0059454 3300046529 Bacteria 3233
471 Ga0495652_0140665 3300046529 Bacteria 1898
472 Ga0495654_0012180 3300046530 Bacteria 4627
473 Ga0495665_0122317 3300046531 Bacteria 1363
474 Ga0495665_0224535 3300046531 Bacteria 971
475 Ga0495640_0007645 3300046533 Bacteria 8499
476 Ga0495640_0034425 3300046533 Bacteria 3591
477 Ga0495640_0074680 3300046533 Bacteria 2266
478 Ga0495640_0101787 3300046533 Bacteria 1885
479 Ga0495587_0009180 3300046536 Bacteria 6346
480 Ga0495587_0010134 3300046536 Bacteria 6012
481 Ga0495609_0010839 3300046538 Bacteria 4356
482 Ga0495645_0025816 3300046543 Bacteria 4265
483 Ga0495645_0100392 3300046543 Bacteria 2058
484 Ga0495622_0007706 3300046557 Bacteria 5001
485 Ga0495622_0065762 3300046557 Bacteria 1676
486 Ga0495633_0153934 3300046558 Bacteria 1061
487 Ga0495667_0005202 3300046559 Bacteria 8794
488 Ga0495667_0026915 3300046559 Bacteria 3876
489 Ga0495667_0032299 3300046559 Bacteria 3509
490 Ga0495634_0018599 3300046642 Bacteria 4943
491 Ga0495634_0050352 3300046642 Bacteria 2798
492 Ga0495634_0083921 3300046642 Bacteria 2078
493 Ga0495611_0017431 3300046648 Bacteria 3072
494 Ga0495625_0084278 3300046660 Bacteria 2207
495 Ga0495635_0016781 3300046663 Bacteria 5115
496 Ga0495635_0035773 3300046663 Bacteria 3443
497 Ga0495635_0105725 3300046663 Bacteria 1923
498 Ga0495635_0117563 3300046663 Bacteria 1814
499 Ga0495661_0016076 3300046665 Bacteria 4972
500 Ga0495588_0001826 3300046674 Bacteria 9071
501 Ga0495657_0004268 3300046675 Bacteria 11429
502 Ga0495657_0028878 3300046675 Bacteria 3894
503 Ga0495657_0038044 3300046675 Bacteria 3312
504 Ga0495657_0042687 3300046675 Bacteria 3094
505 Ga0495657_0069912 3300046675 Bacteria 2295
506 Ga0495599_0024734 3300046678 Bacteria 3755
507 Ga0495599_0045954 3300046678 Bacteria 2738
508 Ga0495623_0043076 3300046679 Bacteria 2873
509 Ga0495646_0016368 3300046680 Bacteria 4705
510 Ga0495658_0080241 3300046683 Bacteria 1913
511 Ga0495658_0128370 3300046683 Bacteria 1541
512 Ga0495613_0016791 3300046689 Bacteria 5451
513 Ga0495613_0098618 3300046689 Bacteria 2111
514 Ga0495613_0224238 3300046689 Bacteria 1318
515 Ga0495624_0231633 3300046690 Bacteria 1119
516 Ga0495589_0009062 3300046794 Bacteria 5173
517 Ga0495600_0026877 3300046809 Bacteria 3717
518 Ga0495600_0038154 3300046809 Bacteria 3125
519 Ga0495600_0069318 3300046809 Bacteria 2305
520 Ga0495600_0221531 3300046809 Bacteria 1210
521 Ga0495660_0087679 3300046810 Bacteria 1622
522 Ga0495581_0024327 3300047315 Bacteria 3510
523 Ga0495581_0164520 3300047315 Bacteria 1297
524 Ga0495604_0003408 3300047317 Bacteria 12673
525 Ga0495604_0018943 3300047317 Bacteria 5513
526 Ga0495604_0033209 3300047317 Bacteria 4085
527 Ga0495604_0048254 3300047317 Bacteria 3312
528 Ga0495604_0165878 3300047317 Bacteria 1557
529 Ga0495636_0002978 3300047318 Bacteria 6550
530 Ga0495674_0013538 3300047319 Bacteria 7666
531 Ga0495674_0066113 3300047319 Bacteria 3138
532 Ga0495676_0003601 3300047321 Bacteria 14057
533 Ga0495676_0016464 3300047321 Bacteria 6561
534 Ga0495676_0065560 3300047321 Bacteria 2818
535 Ga0495680_0016142 3300047322 Bacteria 6421
536 Ga0495680_0043165 3300047322 Bacteria 3572
537 Ga0495680_0049559 3300047322 Bacteria 3289
538 Ga0495680_0122562 3300047322 Bacteria 1918
539 Ga0495675_0006523 3300047444 Bacteria 7141
540 Ga0495675_0165320 3300047444 Bacteria 1361
541 Ga0495684_0006300 3300047471 Bacteria 9222
542 Ga0495684_0053522 3300047471 Bacteria 3080
543 Ga0495686_0119277 3300047472 Bacteria 1574
544 Ga0495593_0030748 3300047673 Bacteria 2936
545 Ga0495593_0098860 3300047673 Bacteria 1498
546 Ga0495602_0004314 3300048088 Bacteria 14810
547 Ga0495602_0105049 3300048088 Bacteria 2309
548 Ga0495614_0024349 3300048089 Bacteria 2613
549 Ga0495614_0039839 3300048089 Bacteria 2017
550 Ga0495626_0139000 3300048091 Bacteria 1031
551 Ga0496100_0013299 3300048903 Bacteria 4742
552 Ga0496100_0311592 3300048903 Bacteria 1180
553 Ga0496101_0203800 3300048904 Bacteria 1530
554 Ga0496102_0004007 3300048905 Bacteria 12473
555 Ga0496102_0004193 3300048905 Bacteria 12194
556 Ga0496102_0007250 3300048905 Bacteria 9463
557 Ga0496102_0012702 3300048905 Bacteria 7295
558 Ga0496102_0148972 3300048905 Bacteria 2198
559 Ga0496103_0008868 3300048906 Bacteria 5965
560 Ga0496103_0046744 3300048906 Bacteria 2673
561 Ga0496103_0071169 3300048906 Bacteria 2176
562 Ga0496103_0112927 3300048906 Bacteria 1727
563 Ga0496104_0031546 3300048907 Bacteria 4928
564 Ga0496104_0189401 3300048907 Bacteria 1968
565 Ga0496104_0237372 3300048907 Bacteria 1735
566 Ga0496105_0002880 3300048908 Bacteria 12606
567 Ga0496105_0020655 3300048908 Bacteria 5323
568 Ga0496105_0052519 3300048908 Bacteria 3366
569 Ga0496105_0117940 3300048908 Bacteria 2189
570 Ga0496105_0299843 3300048908 Bacteria 1292
571 Ga0496106_0005157 3300048909 Bacteria 9680
572 Ga0496106_0066893 3300048909 Bacteria 2738
573 Ga0496106_0170526 3300048909 Bacteria 1725
574 Ga0496107_0047983 3300048910 Bacteria 3075
575 Ga0496107_0052965 3300048910 Bacteria 2927
576 Ga0496107_0187439 3300048910 Bacteria 1537
577 Ga0496108_0013702 3300048911 Bacteria 6617
578 Ga0496108_0086002 3300048911 Bacteria 2669
579 Ga0496108_0087578 3300048911 Bacteria 2645
580 Ga0496108_0094294 3300048911 Bacteria 2548
581 Ga0496108_0101916 3300048911 Bacteria 2449
582 Ga0496108_0118414 3300048911 Bacteria 2270
583 Ga0496108_0144225 3300048911 Bacteria 2052
584 Ga0496108_0214374 3300048911 Bacteria 1672
585 Ga0496108_0306050 3300048911 Bacteria 1385
586 Ga0496108_0405611 3300048911 Bacteria 1190
587 Ga0496109_0019679 3300048912 Bacteria 5955
588 Ga0496109_0039334 3300048912 Bacteria 4280
589 Ga0496109_0054935 3300048912 Bacteria 3632
590 Ga0496109_0074084 3300048912 Bacteria 3129
591 Ga0496109_0106880 3300048912 Bacteria 2599
592 Ga0496109_0161633 3300048912 Bacteria 2098
593 Ga0496109_0563039 3300048912 Bacteria 1075
594 Ga0496110_0012282 3300048913 Bacteria 7039
595 Ga0496110_0052746 3300048913 Bacteria 3574
596 Ga0496110_0053852 3300048913 Bacteria 3538
597 Ga0496110_0077541 3300048913 Bacteria 2956
598 Ga0496110_0147815 3300048913 Bacteria 2126
599 Ga0496110_0207149 3300048913 Bacteria 1782
600 Ga0496111_0002891 3300048914 Bacteria 10485
601 Ga0496111_0023441 3300048914 Bacteria 4333
602 Ga0496111_0124503 3300048914 Bacteria 1905
603 Ga0496112_0183193 3300048915 Bacteria 2058
604 Ga0496112_0305872 3300048915 Bacteria 1535
605 Ga0496112_0805776 3300048915 Bacteria 864
606 Ga0496113_0108967 3300048916 Bacteria 2153
607 Ga0496113_0159140 3300048916 Bacteria 1785
608 Ga0496113_0258008 3300048916 Bacteria 1392
609 Ga0496113_0301320 3300048916 Bacteria 1283
610 Ga0496114_0006892 3300048917 Bacteria 8950
611 Ga0496114_0021605 3300048917 Bacteria 5237
612 Ga0496114_0074885 3300048917 Bacteria 2850
613 Ga0496114_0093372 3300048917 Bacteria 2558
614 Ga0496114_0101271 3300048917 Bacteria 2459
615 Ga0496114_0243599 3300048917 Bacteria 1581
616 Ga0496114_0327725 3300048917 Bacteria 1353
617 Ga0496117_0023817 3300048920 Bacteria 4862
618 Ga0496118_0052720 3300048921 Bacteria 3099
619 Ga0496119_0082293 3300048922 Bacteria 1852
620 Ga0496119_0161674 3300048922 Bacteria 1190
621 Ga0496120_0061349 3300048923 Bacteria 2099
622 Ga0496122_0001262 3300048925 Bacteria 42353
623 Ga0496122_0017612 3300048925 Bacteria 6664
624 Ga0496123_0000275 3300048926 Bacteria 101770
625 Ga0496124_0000370 3300048927 Bacteria 82276
626 Ga0496125_0000015 3300048928 Bacteria 516648
627 Ga0496125_0013536 3300048928 Bacteria 8015
628 Ga0496126_0029561 3300048929 Bacteria 5204
629 Ga0495678_052125 3300049459 Bacteria 1577
630 Ga0501031_0003380 3300049568 Bacteria 10250
631 Ga0501031_0003896 3300049568 Bacteria 9602
632 Ga0501031_0006724 3300049568 Bacteria 7501
633 Ga0501032_0003838 3300049569 Bacteria 11414
634 Ga0501032_0004262 3300049569 Bacteria 10804
635 Ga0501032_0005448 3300049569 Bacteria 9447
636 Ga0501032_0015172 3300049569 Bacteria 5440
637 Ga0501032_0029578 3300049569 Bacteria 3758
638 Ga0501032_0055463 3300049569 Bacteria 2666
639 Ga0501032_0328983 3300049569 Bacteria 986
640 Ga0501033_0001923 3300049570 Bacteria 18084
641 Ga0501033_0024436 3300049570 Bacteria 4558
642 Ga0501033_0035843 3300049570 Bacteria 3718
643 Ga0501033_0060798 3300049570 Bacteria 2785
644 Ga0501033_0081286 3300049570 Bacteria 2376
645 Ga0501033_0114811 3300049570 Bacteria 1957
646 Ga0501033_0116256 3300049570 Bacteria 1943
647 Ga0501033_0175770 3300049570 Bacteria 1536
648 Ga0501034_0007616 3300049571 Bacteria 11519
649 Ga0501034_0008253 3300049571 Bacteria 11024
650 Ga0501034_0039460 3300049571 Bacteria 4782
651 Ga0501034_0056934 3300049571 Bacteria 3932
652 Ga0501034_0067557 3300049571 Bacteria 3587
653 Ga0501034_0112269 3300049571 Bacteria 2716
654 Ga0501034_0136754 3300049571 Bacteria 2431
655 Ga0501034_0288559 3300049571 Bacteria 1579
656 Ga0501034_0433739 3300049571 Bacteria 1233
657 Ga0501036_0001242 3300049572 Bacteria 19500
658 Ga0501036_0003045 3300049572 Bacteria 13352
659 Ga0501036_0011239 3300049572 Bacteria 7407
660 Ga0501036_0022958 3300049572 Bacteria 5252
661 Ga0501036_0030091 3300049572 Bacteria 4587
662 Ga0501036_0030350 3300049572 Bacteria 4567
663 Ga0501036_0042857 3300049572 Bacteria 3831
664 Ga0501036_0066735 3300049572 Bacteria 3044
665 Ga0501036_0154174 3300049572 Bacteria 1938
666 Ga0501036_0216557 3300049572 Bacteria 1608
667 Ga0501037_0001359 3300049573 Bacteria 17961
668 Ga0501037_0003844 3300049573 Bacteria 10900
669 Ga0501037_0006882 3300049573 Bacteria 8305
670 Ga0501037_0097069 3300049573 Bacteria 2129
671 Ga0501037_0210466 3300049573 Bacteria 1371
672 Ga0501038_0002845 3300049574 Bacteria 16106
673 Ga0501038_0006481 3300049574 Bacteria 10833
674 Ga0501038_0007991 3300049574 Bacteria 9747
675 Ga0501038_0009638 3300049574 Bacteria 8859
676 Ga0501038_0012665 3300049574 Bacteria 7708
677 Ga0501038_0025481 3300049574 Bacteria 5271
678 Ga0501038_0040765 3300049574 Bacteria 4051
679 Ga0501038_0131945 3300049574 Bacteria 2050
680 Ga0501038_0142042 3300049574 Bacteria 1963
681 Ga0501039_0004050 3300049575 Bacteria 11011
682 Ga0501039_0005435 3300049575 Bacteria 9635
683 Ga0501039_0022756 3300049575 Bacteria 4808
684 Ga0501039_0028773 3300049575 Bacteria 4279
685 Ga0501039_0043383 3300049575 Bacteria 3474
686 Ga0501039_0045344 3300049575 Bacteria 3397
687 Ga0501039_0095609 3300049575 Bacteria 2316
688 Ga0501040_0000479 3300049576 Bacteria 23837
689 Ga0501040_0020387 3300049576 Bacteria 4417
690 Ga0501040_0052052 3300049576 Bacteria 2802
691 Ga0501040_0231154 3300049576 Bacteria 1317
692 Ga0501040_0281896 3300049576 Bacteria 1187
693 Ga0501041_0003948 3300049577 Bacteria 8556
694 Ga0501041_0008756 3300049577 Bacteria 5954
695 Ga0501041_0066301 3300049577 Bacteria 2212
696 Ga0501042_0000633 3300049578 Bacteria 18819
697 Ga0501042_0042602 3300049578 Bacteria 3232
698 Ga0501042_0054157 3300049578 Bacteria 2861
699 Ga0501042_0067361 3300049578 Bacteria 2559
700 Ga0501042_0289649 3300049578 Bacteria 1183
701 Ga0501042_0497511 3300049578 Bacteria 885
702 Ga0501043_0002310 3300049579 Bacteria 16147
703 Ga0501043_0004077 3300049579 Bacteria 11930
704 Ga0501043_0008709 3300049579 Bacteria 7983
705 Ga0501043_0011863 3300049579 Bacteria 6825
706 Ga0501043_0046991 3300049579 Bacteria 3393
707 Ga0501043_0061754 3300049579 Bacteria 2942
708 Ga0501043_0083188 3300049579 Bacteria 2516
709 Ga0501043_0103729 3300049579 Bacteria 2234
710 Ga0501046_0004091 3300049580 Bacteria 13295
711 Ga0501046_0005075 3300049580 Bacteria 11805
712 Ga0501046_0008983 3300049580 Bacteria 8675
713 Ga0501046_0023382 3300049580 Bacteria 5085
714 Ga0501046_0038015 3300049580 Bacteria 3865
715 Ga0501046_0055028 3300049580 Bacteria 3128
716 Ga0501046_0064304 3300049580 Bacteria 2864
717 Ga0501046_0134549 3300049580 Bacteria 1873
718 Ga0501047_0000064 3300049581 Bacteria 136110
719 Ga0501047_0003182 3300049581 Bacteria 15562
720 Ga0501047_0009853 3300049581 Bacteria 9029
721 Ga0501047_0018066 3300049581 Bacteria 6758
722 Ga0501047_0057957 3300049581 Bacteria 3743
723 Ga0501047_0066672 3300049581 Bacteria 3470
724 Ga0501047_0071537 3300049581 Bacteria 3338
725 Ga0501047_0074193 3300049581 Bacteria 3275
726 Ga0501047_0087557 3300049581 Bacteria 2992
727 Ga0501047_0099048 3300049581 Bacteria 2793
728 Ga0501047_0102429 3300049581 Bacteria 2742
729 Ga0501048_0001906 3300049582 Bacteria 15830
730 Ga0501048_0002851 3300049582 Bacteria 13195
731 Ga0501048_0002999 3300049582 Bacteria 12890
732 Ga0501048_0008708 3300049582 Bacteria 7649
733 Ga0501048_0103991 3300049582 Bacteria 2004
734 Ga0501048_0192033 3300049582 Bacteria 1447
735 Ga0501067_0005438 3300049583 Bacteria 7072
736 Ga0501067_0049980 3300049583 Bacteria 2317
737 Ga0501067_0050394 3300049583 Bacteria 2307
738 Ga0501068_0004581 3300049584 Bacteria 7518
739 Ga0501068_0007312 3300049584 Bacteria 6117
740 Ga0501068_0042383 3300049584 Bacteria 2737
741 Ga0501069_0037122 3300049585 Bacteria 2688
742 Ga0501069_0060520 3300049585 Bacteria 2114
743 Ga0501069_0131739 3300049585 Bacteria 1432
744 Ga0501069_0166426 3300049585 Bacteria 1271
745 Ga0501069_0195202 3300049585 Bacteria 1172
746 Ga0501069_0246116 3300049585 Bacteria 1043
747 Ga0501069_0285394 3300049585 Bacteria 966
748 Ga0501070_0000534 3300049586 Bacteria 34857
749 Ga0501070_0000826 3300049586 Bacteria 28120
750 Ga0501070_0009724 3300049586 Bacteria 8131
751 Ga0501070_0016316 3300049586 Bacteria 6237
752 Ga0501070_0026776 3300049586 Bacteria 4836
753 Ga0501070_0033719 3300049586 Bacteria 4284
754 Ga0501070_0061826 3300049586 Bacteria 3102
755 Ga0501070_0099778 3300049586 Bacteria 2402
756 Ga0501070_0185282 3300049586 Bacteria 1712
757 Ga0501070_0363699 3300049586 Bacteria 1173
758 Ga0501070_0508838 3300049586 Bacteria 967
759 Ga0501071_0006094 3300049587 Bacteria 7817
760 Ga0501071_0008338 3300049587 Bacteria 6845
761 Ga0501071_0009425 3300049587 Bacteria 6500
762 Ga0501071_0043939 3300049587 Bacteria 3205
763 Ga0501072_0001203 3300049588 Bacteria 19305
764 Ga0501072_0013712 3300049588 Bacteria 6205
765 Ga0501072_0167916 3300049588 Bacteria 1751
766 Ga0501072_0174638 3300049588 Bacteria 1714
767 Ga0501073_0014546 3300049589 Bacteria 5716
768 Ga0501073_0050176 3300049589 Bacteria 2925
769 Ga0501073_0051663 3300049589 Bacteria 2879
770 Ga0501073_0098988 3300049589 Bacteria 2025
771 Ga0501074_0008519 3300049590 Bacteria 7429
772 Ga0501074_0012926 3300049590 Bacteria 6069
773 Ga0501074_0013961 3300049590 Bacteria 5837
774 Ga0501074_0018526 3300049590 Bacteria 5058
775 Ga0501074_0024371 3300049590 Bacteria 4397
776 Ga0501074_0033786 3300049590 Bacteria 3708
777 Ga0501074_0073462 3300049590 Bacteria 2456
778 Ga0501075_0023383 3300049591 Bacteria 4525
779 Ga0501075_0025175 3300049591 Bacteria 4372
780 Ga0501075_0069104 3300049591 Bacteria 2669
781 Ga0501075_0232114 3300049591 Bacteria 1407
782 Ga0501076_0049581 3300049592 Bacteria 3321
783 Ga0501076_0055261 3300049592 Bacteria 3149
784 Ga0501076_0100255 3300049592 Bacteria 2333
785 Ga0501076_0208177 3300049592 Bacteria 1598
786 Ga0501076_0279083 3300049592 Bacteria 1369
787 Ga0501076_0552749 3300049592 Bacteria 949
788 Ga0501077_0007834 3300049593 Bacteria 6595
789 Ga0501077_0008911 3300049593 Bacteria 6225
790 Ga0501077_0009157 3300049593 Bacteria 6149
791 Ga0501077_0054018 3300049593 Bacteria 2551
792 Ga0501079_0020596 3300049741 Bacteria 5042
793 Ga0501079_0106969 3300049741 Bacteria 2171
794 Ga0501080_0005549 3300049742 Bacteria 11264
795 Ga0501080_0007553 3300049742 Bacteria 9826
796 Ga0501080_0010859 3300049742 Bacteria 8334
797 Ga0501080_0026351 3300049742 Bacteria 5402
798 Ga0501080_0037218 3300049742 Bacteria 4543
799 Ga0501080_0062281 3300049742 Bacteria 3472
800 Ga0501081_0012217 3300049743 Bacteria 5633
801 Ga0501083_0002149 3300049744 Bacteria 13523
802 Ga0501083_0009218 3300049744 Bacteria 6970
803 Ga0501083_0019194 3300049744 Bacteria 4761
804 Ga0501083_0169784 3300049744 Bacteria 1426
805 Ga0501083_0201075 3300049744 Bacteria 1299
806 Ga0501035_0003389 3300049822 Bacteria 15250
807 Ga0501035_0010126 3300049822 Bacteria 8750
808 Ga0501035_0018747 3300049822 Bacteria 6373
809 Ga0501035_0027087 3300049822 Bacteria 5240
810 Ga0501035_0033245 3300049822 Bacteria 4690
811 Ga0501035_0047426 3300049822 Bacteria 3856
812 Ga0501035_0051020 3300049822 Bacteria 3705
813 Ga0501035_0053049 3300049822 Bacteria 3627
814 Ga0501035_0065325 3300049822 Bacteria 3232
815 Ga0501035_0134255 3300049822 Bacteria 2155
816 Ga0501035_0175513 3300049822 Bacteria 1849
817 Ga0501035_0183065 3300049822 Bacteria 1804
818 Ga0501035_0225653 3300049822 Bacteria 1598
819 Ga0501035_0241605 3300049822 Bacteria 1536
820 Ga0501044_0005544 3300049823 Bacteria 14011
821 Ga0501044_0005672 3300049823 Bacteria 13838
822 Ga0501044_0009395 3300049823 Bacteria 10653
823 Ga0501044_0025281 3300049823 Bacteria 6293
824 Ga0501044_0059992 3300049823 Bacteria 3896
825 Ga0501044_0067638 3300049823 Bacteria 3639
826 Ga0501044_0068172 3300049823 Bacteria 3624
827 Ga0501044_0070980 3300049823 Bacteria 3542
828 Ga0501044_0078254 3300049823 Bacteria 3351
829 Ga0501044_0105849 3300049823 Bacteria 2825
830 Ga0501044_0342378 3300049823 Bacteria 1416
831 Ga0501045_0007317 3300049824 Bacteria 7671
832 Ga0501045_0048027 3300049824 Bacteria 3111
833 Ga0501045_0056735 3300049824 Bacteria 2865
834 Ga0501045_0098408 3300049824 Bacteria 2164
835 Ga0501045_0377572 3300049824 Bacteria 1055
836 nmdc:mga03n38_154977_c1 3300050490 Bacteria 1156
837 nmdc:mga03n38_60085_c1 3300050490 Bacteria 1727
838 nmdc:mga03n38_70869_c1 3300050490 Bacteria 1613
839 nmdc:mga03n38_7198_c1 3300050490 Bacteria 3922
840 nmdc:mga00v17_16960_c1 3300050491 Bacteria 4113
841 nmdc:mga00v17_188560_c1 3300050491 Bacteria 1331
842 nmdc:mga00v17_192624_c1 3300050491 Bacteria 1317
843 nmdc:mga00v17_3271_c1 3300050491 Bacteria 8353
844 nmdc:mga00v17_64148_c1 3300050491 Bacteria 2263
845 nmdc:mga0yw44_12213_c1 3300050492 Bacteria 4468
846 nmdc:mga0yw44_14753_c1 3300050492 Bacteria 4160
847 nmdc:mga0yw44_152175_c1 3300050492 Bacteria 1510
848 nmdc:mga0yw44_152605_c1 3300050492 Bacteria 1508
849 nmdc:mga0yw44_155062_c1 3300050492 Bacteria 1496
850 nmdc:mga0yw44_159895_c1 3300050492 Bacteria 1474
851 nmdc:mga0yw44_175534_c1 3300050492 Bacteria 1408
852 nmdc:mga0yw44_194933_c1 3300050492 Bacteria 1337
853 nmdc:mga0yw44_36358_c1 3300050492 Bacteria 2901
854 nmdc:mga0yw44_37079_c1 3300050492 Bacteria 2877
855 nmdc:mga0yw44_996_c1 3300050492 Bacteria 10819
856 nmdc:mga04h51_9121_c1 3300050495 Bacteria 2676
857 nmdc:mga07m45_107309_c1 3300050496 Bacteria 1606
858 nmdc:mga07m45_15000_c1 3300050496 Bacteria 4137
859 nmdc:mga07m45_153156_c1 3300050496 Bacteria 1337
860 nmdc:mga07m45_49574_c1 3300050496 Bacteria 2364
861 nmdc:mga07m45_88606_c1 3300050496 Bacteria 1771
862 nmdc:mga06r32_25_c5 3300050510 Bacteria 17189
863 nmdc:mga0rr50_193199_c1 3300050513 Bacteria 1669
864 Ga0495601_0021026 3300053077 Bacteria 3991
865 Ga0495601_0241111 3300053077 Bacteria 1180
866 Ga0495595_0057895 3300053084 Bacteria 1808
867 Ga0495619_0030545 3300053085 Bacteria 3488
868 Ga0495619_0100016 3300053085 Bacteria 1972
869 Ga0495619_0188569 3300053085 Bacteria 1427
870 Ga0500643_000240 3300053087 Bacteria 50980
871 Ga0500641_0002437 3300053096 Bacteria 6592
872 Ga0500556_0000182 3300053104 Bacteria 51372
873 Ga0500593_000495 3300053117 Bacteria 15558
874 Ga0500594_0007211 3300053118 Bacteria 2514
875 Ga0500559_0010136 3300053136 Bacteria 4054
876 Ga0500568_0018960 3300053139 Bacteria 3001
877 Ga0500568_0064578 3300053139 Bacteria 1410
878 Ga0500573_0005347 3300053140 Bacteria 6872
879 Ga0501084_0022848 3300054114 Bacteria 5218
880 Ga0501084_0045045 3300054114 Bacteria 3694
881 Ga0501084_0251915 3300054114 Bacteria 1490
882 Ga0501084_0633347 3300054114 Bacteria 903
883 Ga0590074_014999 3300059423 Bacteria 1313
884 Ga0501082_0015873 3300060353 Bacteria 6476
885 Ga0501082_0019033 3300060353 Bacteria 5916
886 Ga0501082_0096102 3300060353 Bacteria 2561
887 Ga0501082_0254891 3300060353 Bacteria 1526
888 Ga0466962_0003816 3300061719 Bacteria 7201
889 Ga0466962_0010555 3300061719 Bacteria 4443
890 Ga0466962_0032854 3300061719 Bacteria 2483
891 Ga0466962_0034456 3300061719 Bacteria 2423
892 Ga0466962_0051688 3300061719 Bacteria 1965
893 Ga0466962_0123782 3300061719 Bacteria 1249
894 Ga0466962_0170881 3300061719 Bacteria 1058
895 Ga0530510_0004958 3300061734 Bacteria 9194
896 Ga0530510_0011276 3300061734 Bacteria 6272
897 Ga0530510_0076967 3300061734 Bacteria 2425
898 Ga0530510_0087180 3300061734 Bacteria 2275
899 Ga0530510_0337886 3300061734 Bacteria 1130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0243462 Ga0466967_0243462_89_856 231
2 3300037471 Ga0395905_0034806 Ga0395905_0034806_2668_3549 232
3 3300005985 Ga0081539_10010892 Ga0081539_100108924 233
4 3300005985 Ga0081539_10014055 Ga0081539_100140552 233
5 3300038443 Ga0395901_0164650 Ga0395901_0164650_447_1328 234
6 iso_pu_bacteria 8055066027 8055073559 234
7 3300046683 Ga0495658_0080241 Ga0495658_0080241_789_1667 235
8 iso_pu_bacteria 2643221590 2643961627 235
9 3300005329 Ga0070683_100350193 Ga0070683_1003501932 236
10 3300005456 Ga0070678_100165237 Ga0070678_1001652372 236
11 3300005618 Ga0068864_100119532 Ga0068864_1001195322 236
12 3300005842 Ga0068858_100540732 Ga0068858_1005407322 236
13 3300006237 Ga0097621_100243176 Ga0097621_1002431762 236
14 3300006358 Ga0068871_100557115 Ga0068871_1005571152 236
15 3300009551 Ga0105238_10040721 Ga0105238_100407216 236
16 3300025911 Ga0207654_10111480 Ga0207654_101114803 236
17 3300025934 Ga0207686_10212637 Ga0207686_102126372 236
18 3300026078 Ga0207702_10160619 Ga0207702_101606192 236
19 3300026095 Ga0207676_10127813 Ga0207676_101278132 236
20 3300048912 Ga0496109_0161633 Ga0496109_0161633_748_1515 236
21 iso_pu_bacteria 2848551377 2848551961 236
22 iso_pu_bacteria 2867346516 2867349390 236
23 iso_pu_bacteria 3001889506 3001890696 236
24 iso_pu_bacteria 8033684223 8033691453 236
25 3300031548 Ga0307408_100026929 Ga0307408_1000269292 237
26 3300031824 Ga0307413_10076057 Ga0307413_100760572 237
27 3300031852 Ga0307410_10183114 Ga0307410_101831141 237
28 3300031901 Ga0307406_10143334 Ga0307406_101433342 237
29 3300032002 Ga0307416_100113291 Ga0307416_1001132913 237
30 3300032126 Ga0307415_100081535 Ga0307415_1000815352 237
31 3300048923 Ga0496120_0061349 Ga0496120_0061349_54_875 237
32 3300049571 Ga0501034_0039460 Ga0501034_0039460_942_1697 237
33 3300049571 Ga0501034_0067557 Ga0501034_0067557_1518_2273 237
34 iso_pu_bacteria 2643221961 2645720580 237
35 iso_pu_bacteria 2643221962 2645723595 237
36 iso_pu_bacteria 2767802112 2768646612 237
37 iso_pu_bacteria 2857481737 2857482722 237
38 iso_pu_bacteria 2883821847 2883825940 237
39 3300005337 Ga0070682_100201841 Ga0070682_1002018412 238
40 3300006051 Ga0075364_10027189 Ga0075364_100271893 238
41 3300041491 Ga0451833_0752021 Ga0451833_0752021_5394_6125 238
42 3300044901 Ga0466960_0040839 Ga0466960_0040839_47_856 238
43 3300046499 Ga0495594_0045499 Ga0495594_0045499_459_1271 238
44 3300046557 Ga0495622_0065762 Ga0495622_0065762_25_837 238
45 3300047321 Ga0495676_0065560 Ga0495676_0065560_134_1012 238
46 3300050491 nmdc:mga00v17_188560_c1 nmdc:mga00v17_188560_c1_92_832 238
47 3300050491 nmdc:mga00v17_3271_c1 nmdc:mga00v17_3271_c1_6016_6756 238
48 3300053096 Ga0500641_0002437 Ga0500641_0002437_1939_2667 238
49 iso_pu_bacteria 2643221679 2644445896 238
50 iso_pu_bacteria 2643221681 2644456158 238
51 iso_pu_bacteria 2818991318 2819426435 238
52 iso_pu_bacteria 2862290372 2862293900 238
53 iso_pu_bacteria 3006425503 3006430106 238
54 3300044694 Ga0466963_0242770 Ga0466963_0242770_107_835 239
55 3300044765 Ga0466970_0090692 Ga0466970_0090692_391_1119 239
56 3300045976 Ga0466967_0214143 Ga0466967_0214143_132_923 239
57 3300049569 Ga0501032_0029578 Ga0501032_0029578_1077_1898 239
58 3300049571 Ga0501034_0136754 Ga0501034_0136754_792_1613 239
59 3300049572 Ga0501036_0030350 Ga0501036_0030350_3047_3868 239
60 3300049574 Ga0501038_0025481 Ga0501038_0025481_1251_2072 239
61 3300049579 Ga0501043_0061754 Ga0501043_0061754_1292_2113 239
62 3300049580 Ga0501046_0004091 Ga0501046_0004091_2201_3022 239
63 3300049581 Ga0501047_0009853 Ga0501047_0009853_6014_6835 239
64 3300049582 Ga0501048_0103991 Ga0501048_0103991_876_1697 239
65 3300049583 Ga0501067_0050394 Ga0501067_0050394_1024_1845 239
66 3300049586 Ga0501070_0363699 Ga0501070_0363699_254_1075 239
67 3300049589 Ga0501073_0050176 Ga0501073_0050176_639_1460 239
68 3300049744 Ga0501083_0019194 Ga0501083_0019194_613_1434 239
69 3300049822 Ga0501035_0047426 Ga0501035_0047426_2526_3347 239
70 3300049823 Ga0501044_0009395 Ga0501044_0009395_854_1675 239
71 3300050496 nmdc:mga07m45_153156_c1 nmdc:mga07m45_153156_c1_255_1007 239
72 3300053118 Ga0500594_0007211 Ga0500594_0007211_1623_2447 239
73 3300061719 Ga0466962_0051688 Ga0466962_0051688_1152_1880 239
74 iso_pu_bacteria 2643221548 2643763778 239
75 iso_pu_bacteria 2643221613 2644082791 239
76 iso_pu_bacteria 2643221615 2644091639 239
77 iso_pu_bacteria 2643221657 2644321442 239
78 iso_pu_bacteria 2643221682 2644461786 239
79 iso_pu_bacteria 2643221711 2644607415 239
80 iso_pu_bacteria 2643221721 2644665746 239
81 iso_pu_bacteria 2811994882 2812373798 239
82 iso_pu_bacteria 2818991462 2819691341 239
83 iso_pu_bacteria 2818991469 2819729235 239
84 iso_pu_bacteria 2862705112 2862707004 239
85 iso_pu_bacteria 2884994152 2884994434 239
86 iso_pu_bacteria 2935890801 2935892547 239
87 iso_pu_bacteria 2990044586 2990048474 239
88 iso_pu_bacteria 2997451912 2997453299 239
89 iso_pu_bacteria 8008485437 8008491219 239
90 iso_pu_bacteria 8025478263 8025481595 239
91 iso_pu_bacteria 8025524527 8025530548 239
92 iso_pu_bacteria 8056447290 8056449849 239
93 iso_pu_bacteria 8056667051 8056668967 239
94 3300005456 Ga0070678_100061042 Ga0070678_1000610424 240
95 3300005466 Ga0070685_10074406 Ga0070685_100744062 240
96 3300005618 Ga0068864_100407077 Ga0068864_1004070772 240
97 3300005718 Ga0068866_10226109 Ga0068866_102261092 240
98 3300006038 Ga0075365_10009383 Ga0075365_100093832 240
99 3300006038 Ga0075365_10010178 Ga0075365_100101785 240
100 3300006038 Ga0075365_10018920 Ga0075365_100189205 240
101 3300006038 Ga0075365_10057867 Ga0075365_100578673 240
102 3300006038 Ga0075365_10086891 Ga0075365_100868914 240
103 3300006038 Ga0075365_10128931 Ga0075365_101289312 240
104 3300006038 Ga0075365_10184371 Ga0075365_101843712 240
105 3300006048 Ga0075363_100037738 Ga0075363_1000377383 240
106 3300006048 Ga0075363_100216318 Ga0075363_1002163182 240
107 3300006048 Ga0075363_100240959 Ga0075363_1002409591 240
108 3300006051 Ga0075364_10031896 Ga0075364_100318963 240
109 3300006051 Ga0075364_10035531 Ga0075364_100355313 240
110 3300006051 Ga0075364_10081762 Ga0075364_100817624 240
111 3300006178 Ga0075367_10017570 Ga0075367_100175703 240
112 3300006353 Ga0075370_10008645 Ga0075370_100086454 240
113 3300006353 Ga0075370_10102880 Ga0075370_101028802 240
114 3300009148 Ga0105243_10331836 Ga0105243_103318362 240
115 3300013308 Ga0157375_10242375 Ga0157375_102423752 240
116 3300014326 Ga0157380_10071601 Ga0157380_100716014 240
117 3300025901 Ga0207688_10057596 Ga0207688_100575964 240
118 3300025940 Ga0207691_10144276 Ga0207691_101442762 240
119 3300026095 Ga0207676_10282510 Ga0207676_102825102 240
120 3300027866 Ga0209813_10005281 Ga0209813_100052814 240
121 3300028379 Ga0268266_10222265 Ga0268266_102222651 240
122 3300028381 Ga0268264_10000943 Ga0268264_100009434 240
123 3300031852 Ga0307410_10445094 Ga0307410_104450942 240
124 3300031995 Ga0307409_100148061 Ga0307409_1001480613 240
125 3300031995 Ga0307409_100346439 Ga0307409_1003464392 240
126 3300032002 Ga0307416_100603629 Ga0307416_1006036292 240
127 3300032126 Ga0307415_100239418 Ga0307415_1002394183 240
128 3300038443 Ga0395901_0583044 Ga0395901_0583044_146_874 240
129 3300041407 Ga0439447_032416 Ga0439447_032416_28_798 240
130 3300042146 Ga0450907_003560 Ga0450907_003560_153_878 240
131 3300046500 Ga0495596_0105106 Ga0495596_0105106_259_1074 240
132 3300048913 Ga0496110_0052746 Ga0496110_0052746_1134_1874 240
133 3300048917 Ga0496114_0074885 Ga0496114_0074885_1412_2140 240
134 3300049568 Ga0501031_0003896 Ga0501031_0003896_4899_5717 240
135 3300049569 Ga0501032_0003838 Ga0501032_0003838_5595_6413 240
136 3300049569 Ga0501032_0015172 Ga0501032_0015172_701_1429 240
137 3300049570 Ga0501033_0035843 Ga0501033_0035843_1581_2399 240
138 3300049571 Ga0501034_0008253 Ga0501034_0008253_4844_5662 240
139 3300049572 Ga0501036_0001242 Ga0501036_0001242_10991_11719 240
140 3300049572 Ga0501036_0042857 Ga0501036_0042857_1694_2512 240
141 3300049573 Ga0501037_0001359 Ga0501037_0001359_14879_15607 240
142 3300049573 Ga0501037_0003844 Ga0501037_0003844_6197_7015 240
143 3300049574 Ga0501038_0002845 Ga0501038_0002845_14175_14903 240
144 3300049574 Ga0501038_0007991 Ga0501038_0007991_3567_4385 240
145 3300049575 Ga0501039_0005435 Ga0501039_0005435_8000_8728 240
146 3300049575 Ga0501039_0045344 Ga0501039_0045344_255_980 240
147 3300049576 Ga0501040_0020387 Ga0501040_0020387_2913_3638 240
148 3300049576 Ga0501040_0281896 Ga0501040_0281896_295_1023 240
149 3300049577 Ga0501041_0003948 Ga0501041_0003948_5373_6191 240
150 3300049578 Ga0501042_0054157 Ga0501042_0054157_1368_2096 240
151 3300049579 Ga0501043_0002310 Ga0501043_0002310_4502_5230 240
152 3300049579 Ga0501043_0004077 Ga0501043_0004077_5976_6794 240
153 3300049580 Ga0501046_0023382 Ga0501046_0023382_2574_3392 240
154 3300049580 Ga0501046_0055028 Ga0501046_0055028_1128_1856 240
155 3300049581 Ga0501047_0003182 Ga0501047_0003182_7480_8298 240
156 3300049581 Ga0501047_0018066 Ga0501047_0018066_4416_5144 240
157 3300049582 Ga0501048_0002999 Ga0501048_0002999_2087_2815 240
158 3300049582 Ga0501048_0008708 Ga0501048_0008708_1695_2513 240
159 3300049584 Ga0501068_0004581 Ga0501068_0004581_1487_2305 240
160 3300049585 Ga0501069_0037122 Ga0501069_0037122_1448_2266 240
161 3300049585 Ga0501069_0166426 Ga0501069_0166426_484_1212 240
162 3300049586 Ga0501070_0009724 Ga0501070_0009724_4957_5775 240
163 3300049586 Ga0501070_0026776 Ga0501070_0026776_3274_4002 240
164 3300049587 Ga0501071_0008338 Ga0501071_0008338_1069_1887 240
165 3300049587 Ga0501071_0043939 Ga0501071_0043939_168_893 240
166 3300049588 Ga0501072_0001203 Ga0501072_0001203_11032_11850 240
167 3300049588 Ga0501072_0167916 Ga0501072_0167916_453_1181 240
168 3300049589 Ga0501073_0014546 Ga0501073_0014546_1332_2150 240
169 3300049589 Ga0501073_0051663 Ga0501073_0051663_723_1451 240
170 3300049590 Ga0501074_0008519 Ga0501074_0008519_1448_2266 240
171 3300049591 Ga0501075_0025175 Ga0501075_0025175_923_1648 240
172 3300049591 Ga0501075_0232114 Ga0501075_0232114_653_1393 240
173 3300049592 Ga0501076_0055261 Ga0501076_0055261_2007_2732 240
174 3300049592 Ga0501076_0100255 Ga0501076_0100255_488_1306 240
175 3300049592 Ga0501076_0552749 Ga0501076_0552749_135_875 240
176 3300049593 Ga0501077_0008911 Ga0501077_0008911_461_1279 240
177 3300049742 Ga0501080_0007553 Ga0501080_0007553_1565_2383 240
178 3300049742 Ga0501080_0026351 Ga0501080_0026351_4119_4847 240
179 3300049744 Ga0501083_0002149 Ga0501083_0002149_11055_11873 240
180 3300049822 Ga0501035_0003389 Ga0501035_0003389_7389_8207 240
181 3300049822 Ga0501035_0018747 Ga0501035_0018747_4295_5023 240
182 3300049823 Ga0501044_0005544 Ga0501044_0005544_10694_11512 240
183 3300049823 Ga0501044_0068172 Ga0501044_0068172_1546_2274 240
184 3300049824 Ga0501045_0048027 Ga0501045_0048027_1483_2208 240
185 3300050490 nmdc:mga03n38_154977_c1 nmdc:mga03n38_154977_c1_42_767 240
186 3300050490 nmdc:mga03n38_70869_c1 nmdc:mga03n38_70869_c1_744_1481 240
187 3300050490 nmdc:mga03n38_7198_c1 nmdc:mga03n38_7198_c1_1630_2358 240
188 3300050491 nmdc:mga00v17_16960_c1 nmdc:mga00v17_16960_c1_3240_3965 240
189 3300050491 nmdc:mga00v17_192624_c1 nmdc:mga00v17_192624_c1_337_1062 240
190 3300050492 nmdc:mga0yw44_12213_c1 nmdc:mga0yw44_12213_c1_18_743 240
191 3300050492 nmdc:mga0yw44_14753_c1 nmdc:mga0yw44_14753_c1_1251_1976 240
192 3300050492 nmdc:mga0yw44_152605_c1 nmdc:mga0yw44_152605_c1_523_1248 240
193 3300050492 nmdc:mga0yw44_155062_c1 nmdc:mga0yw44_155062_c1_518_1243 240
194 3300050492 nmdc:mga0yw44_159895_c1 nmdc:mga0yw44_159895_c1_194_931 240
195 3300050492 nmdc:mga0yw44_194933_c1 nmdc:mga0yw44_194933_c1_71_796 240
196 3300050492 nmdc:mga0yw44_36358_c1 nmdc:mga0yw44_36358_c1_1282_2007 240
197 3300050492 nmdc:mga0yw44_37079_c1 nmdc:mga0yw44_37079_c1_347_1072 240
198 3300050492 nmdc:mga0yw44_996_c1 nmdc:mga0yw44_996_c1_4513_5253 240
199 3300050495 nmdc:mga04h51_9121_c1 nmdc:mga04h51_9121_c1_407_1132 240
200 3300050496 nmdc:mga07m45_15000_c1 nmdc:mga07m45_15000_c1_911_1648 240
201 3300050496 nmdc:mga07m45_49574_c1 nmdc:mga07m45_49574_c1_1412_2137 240
202 3300050496 nmdc:mga07m45_88606_c1 nmdc:mga07m45_88606_c1_686_1414 240
203 3300053140 Ga0500573_0005347 Ga0500573_0005347_5602_6336 240
204 3300054114 Ga0501084_0022848 Ga0501084_0022848_1475_2293 240
205 3300060353 Ga0501082_0015873 Ga0501082_0015873_4590_5408 240
206 3300061734 Ga0530510_0004958 Ga0530510_0004958_3451_4269 240
207 iso_pu_bacteria 2537561592 2537900313 240
208 iso_pu_bacteria 2554235005 2554256442 240
209 iso_pu_bacteria 2616644814 2616697062 240
210 iso_pu_bacteria 2643221678 2644439792 240
211 iso_pu_bacteria 2643221690 2644505120 240
212 iso_pu_bacteria 2643221694 2644527443 240
213 iso_pu_bacteria 2643221722 2644667489 240
214 iso_pu_bacteria 2738543034 2739366153 240
215 iso_pu_bacteria 2751185734 2753073276 240
216 iso_pu_bacteria 2795385470 2795779801 240
217 iso_pu_bacteria 2808606982 2811844682 240
218 iso_pu_bacteria 2818991458 2819665461 240
219 iso_pu_bacteria 2862281513 2862285004 240
220 iso_pu_bacteria 2862507626 2862513252 240
221 iso_pu_bacteria 2887443736 2887444491 240
222 iso_pu_bacteria 2912715099 2912717958 240
223 iso_pu_bacteria 2912723979 2912730385 240
224 iso_pu_bacteria 2946024296 2946026501 240
225 iso_pu_bacteria 3006493962 3006494827 240
226 iso_pu_bacteria 8008574985 8008577400 240
227 3300028800 Ga0265338_10005476 Ga0265338_100054769 241
228 3300046454 Ga0495592_0136449 Ga0495592_0136449_23_841 241
229 3300046455 Ga0495603_0001577 Ga0495603_0001577_5728_6477 241
230 3300046455 Ga0495603_0040676 Ga0495603_0040676_1678_2496 241
231 3300046459 Ga0495629_0001919 Ga0495629_0001919_7000_7749 241
232 3300046462 Ga0495651_0110843 Ga0495651_0110843_160_978 241
233 3300046499 Ga0495594_0000151 Ga0495594_0000151_22887_23636 241
234 3300046514 Ga0495618_0023162 Ga0495618_0023162_539_1357 241
235 3300046529 Ga0495652_0039977 Ga0495652_0039977_696_1514 241
236 3300046533 Ga0495640_0034425 Ga0495640_0034425_740_1558 241
237 3300046559 Ga0495667_0026915 Ga0495667_0026915_1385_2203 241
238 3300046642 Ga0495634_0018599 Ga0495634_0018599_1496_2314 241
239 3300046674 Ga0495588_0001826 Ga0495588_0001826_4587_5336 241
240 3300046675 Ga0495657_0042687 Ga0495657_0042687_329_1147 241
241 3300046689 Ga0495613_0016791 Ga0495613_0016791_2524_3342 241
242 3300046809 Ga0495600_0026877 Ga0495600_0026877_2805_3623 241
243 3300047315 Ga0495581_0024327 Ga0495581_0024327_986_1804 241
244 3300047317 Ga0495604_0048254 Ga0495604_0048254_2419_3237 241
245 3300047321 Ga0495676_0003601 Ga0495676_0003601_8018_8767 241
246 3300047321 Ga0495676_0016464 Ga0495676_0016464_2442_3260 241
247 3300048089 Ga0495614_0039839 Ga0495614_0039839_529_1278 241
248 3300048922 Ga0496119_0161674 Ga0496119_0161674_87_929 241
249 3300048925 Ga0496122_0017612 Ga0496122_0017612_3177_4034 241
250 3300048926 Ga0496123_0000275 Ga0496123_0000275_97750_98607 241
251 3300048927 Ga0496124_0000370 Ga0496124_0000370_32735_33592 241
252 3300048928 Ga0496125_0013536 Ga0496125_0013536_3190_4026 241
253 3300049569 Ga0501032_0004262 Ga0501032_0004262_6316_7158 241
254 3300049571 Ga0501034_0288559 Ga0501034_0288559_93_935 241
255 3300049572 Ga0501036_0022958 Ga0501036_0022958_3262_4104 241
256 3300049579 Ga0501043_0103729 Ga0501043_0103729_630_1472 241
257 3300049822 Ga0501035_0053049 Ga0501035_0053049_204_1046 241
258 3300049823 Ga0501044_0025281 Ga0501044_0025281_4821_5663 241
259 iso_pu_bacteria 8025413630 8025416483 241
260 iso_pu_bacteria 8054609563 8054610396 241
261 3300005329 Ga0070683_100483772 Ga0070683_1004837722 242
262 3300005564 Ga0070664_100081383 Ga0070664_1000813834 242
263 3300005616 Ga0068852_100546788 Ga0068852_1005467882 242
264 3300005719 Ga0068861_100518072 Ga0068861_1005180722 242
265 3300005985 Ga0081539_10010027 Ga0081539_100100277 242
266 3300006048 Ga0075363_100090449 Ga0075363_1000904492 242
267 3300009036 Ga0105244_10101074 Ga0105244_101010742 242
268 3300009098 Ga0105245_10137952 Ga0105245_101379523 242
269 3300009148 Ga0105243_10298971 Ga0105243_102989711 242
270 3300010375 Ga0105239_10389235 Ga0105239_103892352 242
271 3300011119 Ga0105246_10344269 Ga0105246_103442691 242
272 3300013308 Ga0157375_10031138 Ga0157375_100311385 242
273 3300014326 Ga0157380_10644057 Ga0157380_106440572 242
274 3300025904 Ga0207647_10226559 Ga0207647_102265592 242
275 3300025932 Ga0207690_10161719 Ga0207690_101617192 242
276 3300025945 Ga0207679_10166170 Ga0207679_101661703 242
277 3300025961 Ga0207712_10087117 Ga0207712_100871172 242
278 3300026067 Ga0207678_10358847 Ga0207678_103588472 242
279 3300026118 Ga0207675_100460576 Ga0207675_1004605762 242
280 3300031995 Ga0307409_100154020 Ga0307409_1001540202 242
281 3300046463 Ga0495653_0034150 Ga0495653_0034150_2744_3553 242
282 3300046473 Ga0495582_0142923 Ga0495582_0142923_54_863 242
283 3300046663 Ga0495635_0105725 Ga0495635_0105725_912_1721 242
284 3300046809 Ga0495600_0069318 Ga0495600_0069318_738_1511 242
285 3300046809 Ga0495600_0221531 Ga0495600_0221531_174_947 242
286 3300048903 Ga0496100_0013299 Ga0496100_0013299_422_1195 242
287 3300048903 Ga0496100_0311592 Ga0496100_0311592_229_1002 242
288 3300048904 Ga0496101_0203800 Ga0496101_0203800_62_835 242
289 3300048905 Ga0496102_0012702 Ga0496102_0012702_1917_2690 242
290 3300048906 Ga0496103_0046744 Ga0496103_0046744_1239_2012 242
291 3300048907 Ga0496104_0031546 Ga0496104_0031546_355_1128 242
292 3300048908 Ga0496105_0002880 Ga0496105_0002880_3670_4443 242
293 3300048908 Ga0496105_0020655 Ga0496105_0020655_2262_3104 242
294 3300048908 Ga0496105_0052519 Ga0496105_0052519_1124_1897 242
295 3300048908 Ga0496105_0117940 Ga0496105_0117940_1073_1846 242
296 3300048909 Ga0496106_0170526 Ga0496106_0170526_424_1266 242
297 3300048910 Ga0496107_0047983 Ga0496107_0047983_284_1057 242
298 3300048911 Ga0496108_0086002 Ga0496108_0086002_1450_2292 242
299 3300048911 Ga0496108_0087578 Ga0496108_0087578_1055_1828 242
300 3300048911 Ga0496108_0118414 Ga0496108_0118414_960_1769 242
301 3300048911 Ga0496108_0214374 Ga0496108_0214374_712_1476 242
302 3300048912 Ga0496109_0039334 Ga0496109_0039334_1622_2395 242
303 3300048912 Ga0496109_0054935 Ga0496109_0054935_1356_2198 242
304 3300048913 Ga0496110_0077541 Ga0496110_0077541_372_1214 242
305 3300048913 Ga0496110_0207149 Ga0496110_0207149_584_1357 242
306 3300048916 Ga0496113_0108967 Ga0496113_0108967_950_1792 242
307 3300048916 Ga0496113_0301320 Ga0496113_0301320_155_928 242
308 3300048917 Ga0496114_0006892 Ga0496114_0006892_3945_4718 242
309 3300048917 Ga0496114_0021605 Ga0496114_0021605_1261_2103 242
310 3300049580 Ga0501046_0038015 Ga0501046_0038015_70_888 242
311 3300049581 Ga0501047_0087557 Ga0501047_0087557_462_1280 242
312 3300049585 Ga0501069_0131739 Ga0501069_0131739_377_1126 242
313 3300049586 Ga0501070_0099778 Ga0501070_0099778_51_809 242
314 3300050491 nmdc:mga00v17_64148_c1 nmdc:mga00v17_64148_c1_138_881 242
315 3300050496 nmdc:mga07m45_107309_c1 nmdc:mga07m45_107309_c1_634_1377 242
316 3300053085 Ga0495619_0188569 Ga0495619_0188569_84_893 242
317 3300053087 Ga0500643_000240 Ga0500643_000240_45778_46539 242
318 3300053104 Ga0500556_0000182 Ga0500556_0000182_25549_26280 242
319 iso_pu_bacteria 2811994880 2812362278 242
320 iso_pu_bacteria 2837268691 2837270126 242
321 iso_pu_bacteria 2839986021 2839986978 242
322 iso_pu_bacteria 2855386786 2855389050 242
323 iso_pu_bacteria 2904765812 2904767313 242
324 iso_pu_bacteria 2904770941 2904774598 242
325 iso_pu_bacteria 2908811453 2908812963 242
326 iso_pu_bacteria 2919420072 2919424065 242
327 iso_pu_bacteria 2919432681 2919436483 242
328 3300005334 Ga0068869_100036317 Ga0068869_1000363173 243
329 3300005345 Ga0070692_10349687 Ga0070692_103496871 243
330 3300005367 Ga0070667_100650584 Ga0070667_1006505842 243
331 3300005440 Ga0070705_100012269 Ga0070705_1000122695 243
332 3300005456 Ga0070678_100170146 Ga0070678_1001701461 243
333 3300005615 Ga0070702_100000931 Ga0070702_1000009318 243
334 3300009148 Ga0105243_10005375 Ga0105243_100053753 243
335 3300009148 Ga0105243_10781684 Ga0105243_107816842 243
336 3300013297 Ga0157378_10059704 Ga0157378_100597043 243
337 3300013308 Ga0157375_10151110 Ga0157375_101511104 243
338 3300015688 Ga0183367_1002 Ga0183367_1002288 243
339 3300027312 Ga0209371_1028786 Ga0209371_10287862 243
340 3300030734 Ga0316179_1081360 Ga0316179_10813602 243
341 3300030744 Ga0316181_1123477 Ga0316181_11234772 243
342 3300031665 Ga0316575_10000183 Ga0316575_1000018320 243
343 3300031691 Ga0316579_10000576 Ga0316579_100005762 243
344 3300031727 Ga0316576_10005178 Ga0316576_100051788 243
345 3300031728 Ga0316578_10001788 Ga0316578_100017888 243
346 3300031995 Ga0307409_100536586 Ga0307409_1005365862 243
347 3300035398 Ga0316574_0034648 Ga0316574_0034648_547_1308 243
348 3300036712 Ga0316584_0001201 Ga0316584_0001201_2890_3651 243
349 3300038443 Ga0395901_0105385 Ga0395901_0105385_1901_2794 243
350 3300041453 Ga0451797_0676472 Ga0451797_0676472_89_847 243
351 3300041494 Ga0451837_0479937 Ga0451837_0479937_3040_3798 243
352 3300042007 Ga0439449_0002264 Ga0439449_0002264_3147_3905 243
353 3300044683 Ga0466965_0071626 Ga0466965_0071626_968_1717 243
354 3300044684 Ga0466966_0163669 Ga0466966_0163669_79_840 243
355 3300044693 Ga0466961_0202471 Ga0466961_0202471_385_1146 243
356 3300044694 Ga0466963_0030436 Ga0466963_0030436_412_1170 243
357 3300044719 Ga0466971_0074996 Ga0466971_0074996_347_1105 243
358 3300044842 Ga0466957_0070608 Ga0466957_0070608_32_790 243
359 3300044901 Ga0466960_0012672 Ga0466960_0012672_1271_2032 243
360 3300045976 Ga0466967_0009681 Ga0466967_0009681_2066_2824 243
361 3300045976 Ga0466967_0234357 Ga0466967_0234357_46_804 243
362 3300045976 Ga0466967_0702501 Ga0466967_0702501_210_968 243
363 3300046452 Ga0495617_012050 Ga0495617_012050_2049_2807 243
364 3300046454 Ga0495592_0029277 Ga0495592_0029277_1759_2517 243
365 3300046455 Ga0495603_0019833 Ga0495603_0019833_3221_3979 243
366 3300046459 Ga0495629_0014235 Ga0495629_0014235_4390_5148 243
367 3300046462 Ga0495651_0325967 Ga0495651_0325967_177_935 243
368 3300046472 Ga0495580_0175091 Ga0495580_0175091_525_1283 243
369 3300046474 Ga0495605_0020240 Ga0495605_0020240_1854_2612 243
370 3300046476 Ga0495662_0239766 Ga0495662_0239766_95_853 243
371 3300046477 Ga0495664_0048940 Ga0495664_0048940_667_1425 243
372 3300046499 Ga0495594_0026491 Ga0495594_0026491_2160_2918 243
373 3300046501 Ga0495607_0020151 Ga0495607_0020151_663_1421 243
374 3300046506 Ga0495583_0095183 Ga0495583_0095183_24_782 243
375 3300046514 Ga0495618_0175329 Ga0495618_0175329_356_1114 243
376 3300046516 Ga0495628_0031131 Ga0495628_0031131_631_1389 243
377 3300046518 Ga0495631_0005294 Ga0495631_0005294_2395_3153 243
378 3300046522 Ga0495643_0011246 Ga0495643_0011246_2695_3453 243
379 3300046523 Ga0495644_0154161 Ga0495644_0154161_86_844 243
380 3300046524 Ga0495648_0084536 Ga0495648_0084536_131_889 243
381 3300046526 Ga0495666_0078869 Ga0495666_0078869_546_1304 243
382 3300046529 Ga0495652_0140665 Ga0495652_0140665_560_1318 243
383 3300046530 Ga0495654_0012180 Ga0495654_0012180_1630_2388 243
384 3300046531 Ga0495665_0224535 Ga0495665_0224535_149_907 243
385 3300046533 Ga0495640_0007645 Ga0495640_0007645_7416_8174 243
386 3300046533 Ga0495640_0101787 Ga0495640_0101787_118_927 243
387 3300046538 Ga0495609_0010839 Ga0495609_0010839_3099_3857 243
388 3300046557 Ga0495622_0007706 Ga0495622_0007706_1089_1847 243
389 3300046558 Ga0495633_0153934 Ga0495633_0153934_116_874 243
390 3300046642 Ga0495634_0050352 Ga0495634_0050352_1108_1866 243
391 3300046648 Ga0495611_0017431 Ga0495611_0017431_461_1219 243
392 3300046660 Ga0495625_0084278 Ga0495625_0084278_1306_2064 243
393 3300046663 Ga0495635_0117563 Ga0495635_0117563_38_796 243
394 3300046665 Ga0495661_0016076 Ga0495661_0016076_2013_2771 243
395 3300046675 Ga0495657_0038044 Ga0495657_0038044_1455_2213 243
396 3300046675 Ga0495657_0069912 Ga0495657_0069912_276_1034 243
397 3300046689 Ga0495613_0098618 Ga0495613_0098618_751_1509 243
398 3300046689 Ga0495613_0224238 Ga0495613_0224238_249_1007 243
399 3300046690 Ga0495624_0231633 Ga0495624_0231633_289_1047 243
400 3300046794 Ga0495589_0009062 Ga0495589_0009062_2692_3450 243
401 3300046810 Ga0495660_0087679 Ga0495660_0087679_409_1167 243
402 3300047317 Ga0495604_0018943 Ga0495604_0018943_2399_3208 243
403 3300047317 Ga0495604_0165878 Ga0495604_0165878_276_1034 243
404 3300047318 Ga0495636_0002978 Ga0495636_0002978_5469_6227 243
405 3300047322 Ga0495680_0043165 Ga0495680_0043165_2315_3073 243
406 3300047471 Ga0495684_0053522 Ga0495684_0053522_1657_2415 243
407 3300047472 Ga0495686_0119277 Ga0495686_0119277_347_1105 243
408 3300047673 Ga0495593_0030748 Ga0495593_0030748_1102_1860 243
409 3300048089 Ga0495614_0024349 Ga0495614_0024349_1483_2241 243
410 3300048091 Ga0495626_0139000 Ga0495626_0139000_82_840 243
411 3300048911 Ga0496108_0405611 Ga0496108_0405611_97_855 243
412 3300048914 Ga0496111_0023441 Ga0496111_0023441_2407_3228 243
413 3300048915 Ga0496112_0305872 Ga0496112_0305872_307_1092 243
414 3300048916 Ga0496113_0159140 Ga0496113_0159140_465_1250 243
415 3300048917 Ga0496114_0093372 Ga0496114_0093372_896_1693 243
416 3300048917 Ga0496114_0327725 Ga0496114_0327725_376_1134 243
417 3300048929 Ga0496126_0029561 Ga0496126_0029561_101_937 243
418 3300049459 Ga0495678_052125 Ga0495678_052125_132_890 243
419 3300049568 Ga0501031_0006724 Ga0501031_0006724_3938_4696 243
420 3300049569 Ga0501032_0005448 Ga0501032_0005448_2553_3311 243
421 3300049570 Ga0501033_0001923 Ga0501033_0001923_13290_14048 243
422 3300049570 Ga0501033_0024436 Ga0501033_0024436_2074_2832 243
423 3300049570 Ga0501033_0081286 Ga0501033_0081286_674_1432 243
424 3300049570 Ga0501033_0116256 Ga0501033_0116256_791_1618 243
425 3300049570 Ga0501033_0175770 Ga0501033_0175770_60_818 243
426 3300049571 Ga0501034_0007616 Ga0501034_0007616_6343_7101 243
427 3300049571 Ga0501034_0056934 Ga0501034_0056934_761_1597 243
428 3300049571 Ga0501034_0433739 Ga0501034_0433739_199_1026 243
429 3300049572 Ga0501036_0003045 Ga0501036_0003045_11799_12557 243
430 3300049572 Ga0501036_0030091 Ga0501036_0030091_2098_2856 243
431 3300049572 Ga0501036_0216557 Ga0501036_0216557_791_1549 243
432 3300049573 Ga0501037_0006882 Ga0501037_0006882_2623_3381 243
433 3300049574 Ga0501038_0006481 Ga0501038_0006481_9047_9805 243
434 3300049574 Ga0501038_0012665 Ga0501038_0012665_4905_5732 243
435 3300049575 Ga0501039_0043383 Ga0501039_0043383_633_1391 243
436 3300049578 Ga0501042_0067361 Ga0501042_0067361_99_857 243
437 3300049578 Ga0501042_0497511 Ga0501042_0497511_10_768 243
438 3300049579 Ga0501043_0008709 Ga0501043_0008709_3566_4324 243
439 3300049579 Ga0501043_0011863 Ga0501043_0011863_496_1254 243
440 3300049580 Ga0501046_0005075 Ga0501046_0005075_6663_7421 243
441 3300049581 Ga0501047_0057957 Ga0501047_0057957_244_1002 243
442 3300049581 Ga0501047_0066672 Ga0501047_0066672_2028_2855 243
443 3300049581 Ga0501047_0099048 Ga0501047_0099048_1958_2716 243
444 3300049581 Ga0501047_0102429 Ga0501047_0102429_1262_2020 243
445 3300049582 Ga0501048_0001906 Ga0501048_0001906_6290_7048 243
446 3300049585 Ga0501069_0060520 Ga0501069_0060520_590_1348 243
447 3300049585 Ga0501069_0246116 Ga0501069_0246116_186_929 243
448 3300049586 Ga0501070_0000534 Ga0501070_0000534_12148_12906 243
449 3300049589 Ga0501073_0098988 Ga0501073_0098988_551_1309 243
450 3300049590 Ga0501074_0013961 Ga0501074_0013961_1558_2316 243
451 3300049744 Ga0501083_0169784 Ga0501083_0169784_585_1343 243
452 3300049822 Ga0501035_0010126 Ga0501035_0010126_3522_4280 243
453 3300049822 Ga0501035_0033245 Ga0501035_0033245_3218_3976 243
454 3300049822 Ga0501035_0051020 Ga0501035_0051020_1869_2696 243
455 3300049822 Ga0501035_0183065 Ga0501035_0183065_10_768 243
456 3300049822 Ga0501035_0225653 Ga0501035_0225653_576_1334 243
457 3300049823 Ga0501044_0005672 Ga0501044_0005672_4477_5235 243
458 3300049823 Ga0501044_0059992 Ga0501044_0059992_2384_3142 243
459 3300049823 Ga0501044_0105849 Ga0501044_0105849_1606_2433 243
460 3300049824 Ga0501045_0056735 Ga0501045_0056735_1137_1895 243
461 3300053139 Ga0500568_0064578 Ga0500568_0064578_484_1338 243
462 3300061719 Ga0466962_0003816 Ga0466962_0003816_3021_3779 243
463 3300061719 Ga0466962_0123782 Ga0466962_0123782_350_1111 243
464 iso_pu_bacteria 2731639228 2731908189 243
465 iso_pu_bacteria 2738541272 2738693167 243
466 iso_pu_bacteria 2738543027 2739323258 243
467 iso_pu_bacteria 2739367654 2739607867 243
468 iso_pu_bacteria 2739367898 2740166446 243
469 iso_pu_bacteria 2758568621 2760621921 243
470 iso_pu_bacteria 2795385472 2795791544 243
471 iso_pu_bacteria 2799112218 2799185488 243
472 iso_pu_bacteria 2808606394 2809026763 243
473 iso_pu_bacteria 2835188231 2835189939 243
474 iso_pu_bacteria 2891326441 2891328197 243
475 iso_pu_bacteria 2932431166 2932433856 243
476 iso_pu_bacteria 3006321560 3006323891 243
477 iso_pu_bacteria 8056579771 8056580856 243
478 3300005327 Ga0070658_10258407 Ga0070658_102584072 244
479 3300005347 Ga0070668_100103590 Ga0070668_1001035902 244
480 3300005471 Ga0070698_100003056 Ga0070698_1000030563 244
481 3300005530 Ga0070679_100334782 Ga0070679_1003347822 244
482 3300005530 Ga0070679_100379240 Ga0070679_1003792402 244
483 3300005546 Ga0070696_100005324 Ga0070696_1000053248 244
484 3300005564 Ga0070664_100317684 Ga0070664_1003176842 244
485 3300005616 Ga0068852_100266927 Ga0068852_1002669272 244
486 3300005843 Ga0068860_100571832 Ga0068860_1005718322 244
487 3300006844 Ga0075428_100237322 Ga0075428_1002373222 244
488 3300009098 Ga0105245_10618801 Ga0105245_106188012 244
489 3300009147 Ga0114129_10118769 Ga0114129_101187693 244
490 3300021388 Ga0213875_10003530 Ga0213875_100035308 244
491 3300025921 Ga0207652_10492914 Ga0207652_104929141 244
492 3300025924 Ga0207694_10049511 Ga0207694_100495112 244
493 3300026041 Ga0207639_10006559 Ga0207639_100065598 244
494 3300031731 Ga0307405_10049052 Ga0307405_100490521 244
495 3300031852 Ga0307410_10011079 Ga0307410_100110793 244
496 3300031852 Ga0307410_10095476 Ga0307410_100954762 244
497 3300031901 Ga0307406_10060614 Ga0307406_100606143 244
498 3300031995 Ga0307409_100021234 Ga0307409_1000212342 244
499 3300031995 Ga0307409_100038947 Ga0307409_1000389473 244
500 3300032002 Ga0307416_100003285 Ga0307416_1000032856 244
501 3300032002 Ga0307416_100460214 Ga0307416_1004602142 244
502 3300032126 Ga0307415_100266557 Ga0307415_1002665572 244
503 3300033179 Ga0307507_10085453 Ga0307507_100854532 244
504 3300037853 Ga0436364_0727896 Ga0436364_0727896_3227_4060 244
505 3300037853 Ga0436364_1546160 Ga0436364_1546160_3891_4655 244
506 3300044765 Ga0466970_0197086 Ga0466970_0197086_309_1061 244
507 3300045976 Ga0466967_0469659 Ga0466967_0469659_204_971 244
508 3300048911 Ga0496108_0094294 Ga0496108_0094294_1101_1877 244
509 3300049568 Ga0501031_0003380 Ga0501031_0003380_3325_4155 244
510 3300049570 Ga0501033_0114811 Ga0501033_0114811_187_996 244
511 3300049572 Ga0501036_0011239 Ga0501036_0011239_2505_3260 244
512 3300049574 Ga0501038_0142042 Ga0501038_0142042_986_1741 244
513 3300049575 Ga0501039_0004050 Ga0501039_0004050_5091_5846 244
514 3300049576 Ga0501040_0000479 Ga0501040_0000479_5149_5904 244
515 3300049576 Ga0501040_0231154 Ga0501040_0231154_433_1188 244
516 3300049577 Ga0501041_0008756 Ga0501041_0008756_4484_5239 244
517 3300049578 Ga0501042_0000633 Ga0501042_0000633_130_885 244
518 3300049578 Ga0501042_0289649 Ga0501042_0289649_41_880 244
519 3300049580 Ga0501046_0064304 Ga0501046_0064304_1179_1988 244
520 3300049581 Ga0501047_0000064 Ga0501047_0000064_65743_66582 244
521 3300049581 Ga0501047_0074193 Ga0501047_0074193_2418_3227 244
522 3300049582 Ga0501048_0002851 Ga0501048_0002851_8614_9369 244
523 3300049586 Ga0501070_0185282 Ga0501070_0185282_649_1404 244
524 3300049587 Ga0501071_0009425 Ga0501071_0009425_678_1433 244
525 3300049588 Ga0501072_0013712 Ga0501072_0013712_613_1368 244
526 3300049590 Ga0501074_0012926 Ga0501074_0012926_4387_5142 244
527 3300049591 Ga0501075_0023383 Ga0501075_0023383_2373_3128 244
528 3300049592 Ga0501076_0049581 Ga0501076_0049581_2397_3152 244
529 3300049593 Ga0501077_0007834 Ga0501077_0007834_3658_4413 244
530 3300049741 Ga0501079_0020596 Ga0501079_0020596_3025_3780 244
531 3300049742 Ga0501080_0037218 Ga0501080_0037218_696_1451 244
532 3300049822 Ga0501035_0241605 Ga0501035_0241605_682_1512 244
533 3300049823 Ga0501044_0070980 Ga0501044_0070980_1579_2388 244
534 3300049823 Ga0501044_0342378 Ga0501044_0342378_494_1333 244
535 3300049824 Ga0501045_0098408 Ga0501045_0098408_1264_2019 244
536 3300054114 Ga0501084_0251915 Ga0501084_0251915_174_929 244
537 3300061734 Ga0530510_0011276 Ga0530510_0011276_5219_5974 244
538 iso_pu_bacteria 2899370129 2899375041 244
539 3300001991 JGI24743J22301_10011899 JGI24743J22301_100118993 245
540 3300005329 Ga0070683_100028278 Ga0070683_1000282783 245
541 3300005337 Ga0070682_100110682 Ga0070682_1001106823 245
542 3300005343 Ga0070687_100114578 Ga0070687_1001145782 245
543 3300005354 Ga0070675_100095762 Ga0070675_1000957623 245
544 3300005356 Ga0070674_100015450 Ga0070674_1000154503 245
545 3300005364 Ga0070673_100182403 Ga0070673_1001824032 245
546 3300005366 Ga0070659_100024836 Ga0070659_1000248366 245
547 3300005438 Ga0070701_10001057 Ga0070701_100010573 245
548 3300005444 Ga0070694_100622994 Ga0070694_1006229941 245
549 3300005459 Ga0068867_100026319 Ga0068867_1000263193 245
550 3300005466 Ga0070685_10156467 Ga0070685_101564673 245
551 3300005518 Ga0070699_100037534 Ga0070699_1000375344 245
552 3300005535 Ga0070684_100054076 Ga0070684_1000540761 245
553 3300005543 Ga0070672_100024021 Ga0070672_1000240214 245
554 3300005578 Ga0068854_100069905 Ga0068854_1000699053 245
555 3300005615 Ga0070702_100000741 Ga0070702_10000074110 245
556 3300005616 Ga0068852_100011817 Ga0068852_1000118176 245
557 3300005719 Ga0068861_100033624 Ga0068861_1000336245 245
558 3300005840 Ga0068870_10010542 Ga0068870_100105422 245
559 3300006038 Ga0075365_10149006 Ga0075365_101490063 245
560 3300006847 Ga0075431_100064291 Ga0075431_1000642912 245
561 3300006880 Ga0075429_100426041 Ga0075429_1004260411 245
562 3300006881 Ga0068865_100005761 Ga0068865_1000057616 245
563 3300009094 Ga0111539_10064576 Ga0111539_100645762 245
564 3300009148 Ga0105243_10006666 Ga0105243_100066668 245
565 3300009176 Ga0105242_10140022 Ga0105242_101400222 245
566 3300013297 Ga0157378_10930033 Ga0157378_109300331 245
567 3300013307 Ga0157372_10205429 Ga0157372_102054294 245
568 3300014326 Ga0157380_10021716 Ga0157380_100217166 245
569 3300014745 Ga0157377_10026123 Ga0157377_100261233 245
570 3300025315 Ga0207697_10076111 Ga0207697_100761112 245
571 3300025901 Ga0207688_10006708 Ga0207688_100067087 245
572 3300025908 Ga0207643_10002261 Ga0207643_100022614 245
573 3300025918 Ga0207662_10013839 Ga0207662_100138392 245
574 3300025926 Ga0207659_10086876 Ga0207659_100868761 245
575 3300025935 Ga0207709_10180390 Ga0207709_101803902 245
576 3300025937 Ga0207669_10036827 Ga0207669_100368274 245
577 3300025938 Ga0207704_10037911 Ga0207704_100379115 245
578 3300025940 Ga0207691_10035517 Ga0207691_100355175 245
579 3300025944 Ga0207661_10279966 Ga0207661_102799663 245
580 3300025981 Ga0207640_10041090 Ga0207640_100410905 245
581 3300026023 Ga0207677_10185977 Ga0207677_101859773 245
582 3300026041 Ga0207639_10059592 Ga0207639_100595925 245
583 3300026075 Ga0207708_10000689 Ga0207708_100006898 245
584 3300026089 Ga0207648_10008420 Ga0207648_100084203 245
585 3300026118 Ga0207675_100001638 Ga0207675_1000016385 245
586 3300026142 Ga0207698_10049931 Ga0207698_100499313 245
587 3300026142 Ga0207698_10089796 Ga0207698_100897962 245
588 3300031665 Ga0316575_10005262 Ga0316575_100052624 245
589 3300031727 Ga0316576_10000409 Ga0316576_100004096 245
590 3300031728 Ga0316578_10003110 Ga0316578_100031109 245
591 3300031852 Ga0307410_10125735 Ga0307410_101257352 245
592 3300031995 Ga0307409_100385299 Ga0307409_1003852991 245
593 3300032137 Ga0316585_10002960 Ga0316585_100029602 245
594 3300036647 Ga0316582_0069766 Ga0316582_0069766_749_1540 245
595 3300036712 Ga0316584_0039385 Ga0316584_0039385_475_1266 245
596 3300037471 Ga0395905_0039406 Ga0395905_0039406_1585_2430 245
597 3300037853 Ga0436364_0296067 Ga0436364_0296067_23740_24531 245
598 3300038443 Ga0395901_0051827 Ga0395901_0051827_2673_3518 245
599 3300038443 Ga0395901_0156945 Ga0395901_0156945_540_1385 245
600 3300039437 Ga0436365_1354692 Ga0436365_1354692_3743_4534 245
601 3300042002 Ga0439442_012315 Ga0439442_012315_319_1119 245
602 3300044842 Ga0466957_0308144 Ga0466957_0308144_210_998 245
603 3300044901 Ga0466960_0070580 Ga0466960_0070580_498_1286 245
604 3300048905 Ga0496102_0148972 Ga0496102_0148972_1197_1961 245
605 3300048910 Ga0496107_0187439 Ga0496107_0187439_627_1391 245
606 3300049569 Ga0501032_0055463 Ga0501032_0055463_327_1178 245
607 3300049570 Ga0501033_0060798 Ga0501033_0060798_523_1374 245
608 3300049572 Ga0501036_0066735 Ga0501036_0066735_792_1643 245
609 3300049573 Ga0501037_0210466 Ga0501037_0210466_209_1060 245
610 3300049574 Ga0501038_0040765 Ga0501038_0040765_1266_2117 245
611 3300049575 Ga0501039_0095609 Ga0501039_0095609_1301_2152 245
612 3300049579 Ga0501043_0046991 Ga0501043_0046991_2095_2946 245
613 3300049579 Ga0501043_0083188 Ga0501043_0083188_304_1155 245
614 3300049581 Ga0501047_0071537 Ga0501047_0071537_293_1144 245
615 3300049583 Ga0501067_0049980 Ga0501067_0049980_530_1294 245
616 3300049586 Ga0501070_0061826 Ga0501070_0061826_660_1511 245
617 3300049822 Ga0501035_0027087 Ga0501035_0027087_1235_2086 245
618 3300049822 Ga0501035_0134255 Ga0501035_0134255_1285_2136 245
619 3300049823 Ga0501044_0078254 Ga0501044_0078254_1549_2400 245
620 3300050492 nmdc:mga0yw44_152175_c1 nmdc:mga0yw44_152175_c1_227_991 245
621 3300050492 nmdc:mga0yw44_175534_c1 nmdc:mga0yw44_175534_c1_403_1146 245
622 3300050510 nmdc:mga06r32_25_c5 nmdc:mga06r32_25_c5_2686_3453 245
623 3300053085 Ga0495619_0100016 Ga0495619_0100016_104_871 245
624 3300053117 Ga0500593_000495 Ga0500593_000495_5080_5823 245
625 3300053136 Ga0500559_0010136 Ga0500559_0010136_1934_2698 245
626 iso_pu_bacteria 2585427649 2586064174 245
627 iso_pu_bacteria 2643221561 2643823872 245
628 iso_pu_bacteria 2643221696 2644533148 245
629 iso_pu_bacteria 2758568522 2760304130 245
630 iso_pu_bacteria 2808606522 2809586579 245
631 iso_pu_bacteria 2866612099 2866618749 245
632 iso_pu_bacteria 2915768154 2915772472 245
633 iso_pu_bacteria 2919051321 2919052322 245
634 3300005329 Ga0070683_100076950 Ga0070683_1000769504 246
635 3300005329 Ga0070683_100142803 Ga0070683_1001428034 246
636 3300005338 Ga0068868_100085485 Ga0068868_1000854853 246
637 3300005338 Ga0068868_100316406 Ga0068868_1003164062 246
638 3300005340 Ga0070689_100337479 Ga0070689_1003374791 246
639 3300005341 Ga0070691_10048738 Ga0070691_100487382 246
640 3300005434 Ga0070709_10120178 Ga0070709_101201782 246
641 3300005434 Ga0070709_10153756 Ga0070709_101537562 246
642 3300005435 Ga0070714_100032019 Ga0070714_1000320193 246
643 3300005435 Ga0070714_100075811 Ga0070714_1000758113 246
644 3300005436 Ga0070713_100048185 Ga0070713_1000481853 246
645 3300005437 Ga0070710_10000110 Ga0070710_100001102 246
646 3300005437 Ga0070710_10029562 Ga0070710_100295622 246
647 3300005468 Ga0070707_100174553 Ga0070707_1001745532 246
648 3300005547 Ga0070693_100133991 Ga0070693_1001339911 246
649 3300005548 Ga0070665_100164425 Ga0070665_1001644253 246
650 3300005614 Ga0068856_100017536 Ga0068856_1000175364 246
651 3300005614 Ga0068856_100246752 Ga0068856_1002467523 246
652 3300005617 Ga0068859_100251991 Ga0068859_1002519912 246
653 3300006237 Ga0097621_100107429 Ga0097621_1001074292 246
654 3300006871 Ga0075434_100664633 Ga0075434_1006646332 246
655 3300006931 Ga0097620_100251979 Ga0097620_1002519792 246
656 3300009098 Ga0105245_10008971 Ga0105245_100089717 246
657 3300009098 Ga0105245_10092041 Ga0105245_100920414 246
658 3300009984 Ga0105029_100937 Ga0105029_1009372 246
659 3300010375 Ga0105239_10534251 Ga0105239_105342512 246
660 3300010375 Ga0105239_10545572 Ga0105239_105455722 246
661 3300013105 Ga0157369_10056458 Ga0157369_100564583 246
662 3300013105 Ga0157369_10285744 Ga0157369_102857442 246
663 3300014325 Ga0163163_10117504 Ga0163163_101175043 246
664 3300014968 Ga0157379_10215891 Ga0157379_102158912 246
665 3300025898 Ga0207692_10002246 Ga0207692_100022467 246
666 3300025906 Ga0207699_10053315 Ga0207699_100533152 246
667 3300025906 Ga0207699_10217962 Ga0207699_102179622 246
668 3300025915 Ga0207693_10116707 Ga0207693_101167071 246
669 3300025916 Ga0207663_10025992 Ga0207663_100259922 246
670 3300025916 Ga0207663_10219202 Ga0207663_102192021 246
671 3300025922 Ga0207646_10113058 Ga0207646_101130583 246
672 3300025927 Ga0207687_10051896 Ga0207687_100518964 246
673 3300025929 Ga0207664_10019581 Ga0207664_100195814 246
674 3300025939 Ga0207665_10041270 Ga0207665_100412704 246
675 3300025939 Ga0207665_10208681 Ga0207665_102086812 246
676 3300025941 Ga0207711_10401917 Ga0207711_104019172 246
677 3300025944 Ga0207661_10081310 Ga0207661_100813104 246
678 3300025944 Ga0207661_10111775 Ga0207661_101117753 246
679 3300026023 Ga0207677_10249208 Ga0207677_102492083 246
680 3300026067 Ga0207678_10458816 Ga0207678_104588161 246
681 3300026078 Ga0207702_10024539 Ga0207702_100245393 246
682 3300026078 Ga0207702_10045767 Ga0207702_100457675 246
683 3300026078 Ga0207702_10454666 Ga0207702_104546662 246
684 3300026095 Ga0207676_10166098 Ga0207676_101660983 246
685 3300026116 Ga0207674_10452659 Ga0207674_104526592 246
686 3300028379 Ga0268266_10221566 Ga0268266_102215662 246
687 3300030732 Ga0316176_1032343 Ga0316176_10323434 246
688 3300030733 Ga0314311_1097076 Ga0314311_10970763 246
689 3300030736 Ga0316180_1110667 Ga0316180_11106672 246
690 3300031456 Ga0307513_10000392 Ga0307513_1000039258 246
691 3300031995 Ga0307409_100201796 Ga0307409_1002017962 246
692 3300035086 Ga0373934_0151833 Ga0373934_0151833_49_816 246
693 3300035410 Ga0373924_0002250 Ga0373924_0002250_5496_6260 246
694 3300035692 Ga0373935_0017081 Ga0373935_0017081_1528_2292 246
695 3300035725 Ga0373947_0291097 Ga0373947_0291097_138_902 246
696 3300036401 Ga0373937_0273255 Ga0373937_0273255_607_1371 246
697 3300037068 Ga0373925_0038674 Ga0373925_0038674_2284_3048 246
698 3300044683 Ga0466965_0002838 Ga0466965_0002838_2514_3290 246
699 3300044901 Ga0466960_0248867 Ga0466960_0248867_136_912 246
700 3300046454 Ga0495592_0008325 Ga0495592_0008325_6143_6907 246
701 3300046461 Ga0495641_0085193 Ga0495641_0085193_527_1291 246
702 3300046462 Ga0495651_0004271 Ga0495651_0004271_8899_9663 246
703 3300046463 Ga0495653_0027763 Ga0495653_0027763_1029_1793 246
704 3300046476 Ga0495662_0014270 Ga0495662_0014270_727_1491 246
705 3300046477 Ga0495664_0096395 Ga0495664_0096395_141_905 246
706 3300046517 Ga0495630_0106817 Ga0495630_0106817_875_1639 246
707 3300046529 Ga0495652_0059454 Ga0495652_0059454_876_1640 246
708 3300046531 Ga0495665_0122317 Ga0495665_0122317_247_1011 246
709 3300046536 Ga0495587_0010134 Ga0495587_0010134_602_1366 246
710 3300046543 Ga0495645_0100392 Ga0495645_0100392_922_1686 246
711 3300046559 Ga0495667_0032299 Ga0495667_0032299_1870_2634 246
712 3300046642 Ga0495634_0083921 Ga0495634_0083921_48_812 246
713 3300046663 Ga0495635_0016781 Ga0495635_0016781_2700_3464 246
714 3300046675 Ga0495657_0028878 Ga0495657_0028878_2319_3083 246
715 3300046678 Ga0495599_0024734 Ga0495599_0024734_1018_1782 246
716 3300046680 Ga0495646_0016368 Ga0495646_0016368_2768_3532 246
717 3300047315 Ga0495581_0164520 Ga0495581_0164520_309_1073 246
718 3300047317 Ga0495604_0033209 Ga0495604_0033209_2720_3484 246
719 3300047319 Ga0495674_0066113 Ga0495674_0066113_1675_2439 246
720 3300047322 Ga0495680_0049559 Ga0495680_0049559_1611_2375 246
721 3300047322 Ga0495680_0122562 Ga0495680_0122562_963_1727 246
722 3300047444 Ga0495675_0165320 Ga0495675_0165320_516_1280 246
723 3300047471 Ga0495684_0006300 Ga0495684_0006300_1372_2136 246
724 3300047673 Ga0495593_0098860 Ga0495593_0098860_450_1214 246
725 3300048088 Ga0495602_0105049 Ga0495602_0105049_1059_1823 246
726 3300048905 Ga0496102_0007250 Ga0496102_0007250_6312_7100 246
727 3300048906 Ga0496103_0071169 Ga0496103_0071169_988_1776 246
728 3300048907 Ga0496104_0189401 Ga0496104_0189401_414_1202 246
729 3300048909 Ga0496106_0005157 Ga0496106_0005157_6182_6970 246
730 3300048910 Ga0496107_0052965 Ga0496107_0052965_621_1409 246
731 3300048911 Ga0496108_0013702 Ga0496108_0013702_291_1115 246
732 3300048911 Ga0496108_0306050 Ga0496108_0306050_500_1330 246
733 3300048912 Ga0496109_0019679 Ga0496109_0019679_4115_4939 246
734 3300048912 Ga0496109_0074084 Ga0496109_0074084_2171_2959 246
735 3300048913 Ga0496110_0053852 Ga0496110_0053852_1572_2396 246
736 3300048913 Ga0496110_0147815 Ga0496110_0147815_813_1601 246
737 3300049571 Ga0501034_0112269 Ga0501034_0112269_1691_2575 246
738 3300049573 Ga0501037_0097069 Ga0501037_0097069_356_1189 246
739 3300049574 Ga0501038_0009638 Ga0501038_0009638_2534_3367 246
740 3300049575 Ga0501039_0022756 Ga0501039_0022756_776_1609 246
741 3300049580 Ga0501046_0008983 Ga0501046_0008983_4306_5139 246
742 3300049583 Ga0501067_0005438 Ga0501067_0005438_4237_5103 246
743 3300049584 Ga0501068_0007312 Ga0501068_0007312_82_888 246
744 3300049586 Ga0501070_0016316 Ga0501070_0016316_218_1048 246
745 3300049586 Ga0501070_0508838 Ga0501070_0508838_74_907 246
746 3300049741 Ga0501079_0106969 Ga0501079_0106969_57_845 246
747 3300049822 Ga0501035_0175513 Ga0501035_0175513_804_1637 246
748 3300049823 Ga0501044_0067638 Ga0501044_0067638_1826_2659 246
749 3300050513 nmdc:mga0rr50_193199_c1 nmdc:mga0rr50_193199_c1_428_1195 246
750 3300053077 Ga0495601_0021026 Ga0495601_0021026_3193_3957 246
751 3300053084 Ga0495595_0057895 Ga0495595_0057895_830_1594 246
752 3300060353 Ga0501082_0019033 Ga0501082_0019033_4062_4892 246
753 3300060353 Ga0501082_0254891 Ga0501082_0254891_111_899 246
754 3300061734 Ga0530510_0087180 Ga0530510_0087180_385_1173 246
755 3300003285 Ga0007423J48922_100135 Ga0007423J48922_1001354 247
756 3300003285 Ga0007423J48922_100136 Ga0007423J48922_1001368 247
757 3300011119 Ga0105246_10023835 Ga0105246_100238353 247
758 3300013102 Ga0157371_10395019 Ga0157371_103950192 247
759 3300013308 Ga0157375_10115648 Ga0157375_101156482 247
760 3300013308 Ga0157375_10745323 Ga0157375_107453232 247
761 3300020082 Ga0206353_11505532 Ga0206353_115055323 247
762 3300024227 Ga0228598_1014053 Ga0228598_10140532 247
763 3300025929 Ga0207664_10162938 Ga0207664_101629381 247
764 3300026035 Ga0207703_10022437 Ga0207703_100224374 247
765 3300032002 Ga0307416_100513845 Ga0307416_1005138452 247
766 3300037312 Ga0395899_0037638 Ga0395899_0037638_2768_3556 247
767 3300037418 Ga0395900_0115423 Ga0395900_0115423_640_1428 247
768 3300037466 Ga0395898_0085821 Ga0395898_0085821_1567_2355 247
769 3300038443 Ga0395901_0823490 Ga0395901_0823490_48_836 247
770 3300044656 Ga0466969_0001083 Ga0466969_0001083_655_1476 247
771 3300044656 Ga0466969_0006586 Ga0466969_0006586_4890_5711 247
772 3300044684 Ga0466966_0116967 Ga0466966_0116967_569_1390 247
773 3300044693 Ga0466961_0093951 Ga0466961_0093951_619_1440 247
774 3300044693 Ga0466961_0145608 Ga0466961_0145608_571_1359 247
775 3300044694 Ga0466963_0044204 Ga0466963_0044204_288_1076 247
776 3300044719 Ga0466971_0019727 Ga0466971_0019727_1631_2452 247
777 3300045836 Ga0466958_0233149 Ga0466958_0233149_294_1115 247
778 3300045976 Ga0466967_0018422 Ga0466967_0018422_92_880 247
779 3300048912 Ga0496109_0563039 Ga0496109_0563039_157_1020 247
780 3300048915 Ga0496112_0183193 Ga0496112_0183193_1153_2016 247
781 3300048915 Ga0496112_0805776 Ga0496112_0805776_35_778 247
782 3300048916 Ga0496113_0258008 Ga0496113_0258008_281_1144 247
783 3300049569 Ga0501032_0328983 Ga0501032_0328983_117_884 247
784 3300061719 Ga0466962_0034456 Ga0466962_0034456_1051_1872 247
785 3300061719 Ga0466962_0170881 Ga0466962_0170881_56_844 247
786 3300061734 Ga0530510_0337886 Ga0530510_0337886_349_1119 247
787 iso_pu_bacteria 2515154155 2515852792 247
788 iso_pu_bacteria 2643221641 2644231095 247
789 iso_pu_bacteria 2990256926 2990257840 247
790 3300005356 Ga0070674_100075935 Ga0070674_1000759352 248
791 3300005455 Ga0070663_100002222 Ga0070663_1000022224 248
792 3300025929 Ga0207664_10003068 Ga0207664_1000306810 248
793 3300025937 Ga0207669_10216814 Ga0207669_102168142 248
794 3300031903 Ga0307407_10066021 Ga0307407_100660212 248
795 3300032004 Ga0307414_10277056 Ga0307414_102770562 248
796 3300032126 Ga0307415_100279912 Ga0307415_1002799122 248
797 3300037418 Ga0395900_0043272 Ga0395900_0043272_3193_4068 248
798 3300037466 Ga0395898_0085701 Ga0395898_0085701_564_1439 248
799 3300037471 Ga0395905_0058695 Ga0395905_0058695_151_1026 248
800 3300038443 Ga0395901_0133437 Ga0395901_0133437_1033_1908 248
801 3300048907 Ga0496104_0237372 Ga0496104_0237372_688_1518 248
802 3300048908 Ga0496105_0299843 Ga0496105_0299843_354_1184 248
803 3300048911 Ga0496108_0101916 Ga0496108_0101916_1016_1846 248
804 3300048912 Ga0496109_0106880 Ga0496109_0106880_684_1514 248
805 3300048913 Ga0496110_0012282 Ga0496110_0012282_851_1681 248
806 3300048914 Ga0496111_0124503 Ga0496111_0124503_25_855 248
807 3300048917 Ga0496114_0243599 Ga0496114_0243599_706_1536 248
808 3300048920 Ga0496117_0023817 Ga0496117_0023817_1731_2612 248
809 3300048921 Ga0496118_0052720 Ga0496118_0052720_2150_3031 248
810 3300048925 Ga0496122_0001262 Ga0496122_0001262_9649_10530 248
811 3300048928 Ga0496125_0000015 Ga0496125_0000015_137570_138451 248
812 3300049585 Ga0501069_0195202 Ga0501069_0195202_46_876 248
813 3300049587 Ga0501071_0006094 Ga0501071_0006094_1600_2430 248
814 3300049590 Ga0501074_0073462 Ga0501074_0073462_57_887 248
815 3300049593 Ga0501077_0009157 Ga0501077_0009157_2672_3514 248
816 3300049742 Ga0501080_0005549 Ga0501080_0005549_655_1485 248
817 3300049744 Ga0501083_0201075 Ga0501083_0201075_51_881 248
818 3300054114 Ga0501084_0045045 Ga0501084_0045045_1239_2069 248
819 iso_pu_bacteria 2842888712 2842890906 248
820 3300001990 JGI24737J22298_10079755 JGI24737J22298_100797552 249
821 3300005329 Ga0070683_100000566 Ga0070683_1000005662 249
822 3300005337 Ga0070682_100135192 Ga0070682_1001351922 249
823 3300005345 Ga0070692_10117298 Ga0070692_101172983 249
824 3300005366 Ga0070659_100027577 Ga0070659_1000275774 249
825 3300005456 Ga0070678_100053128 Ga0070678_1000531284 249
826 3300005530 Ga0070679_100461587 Ga0070679_1004615872 249
827 3300005535 Ga0070684_100001014 Ga0070684_10000101419 249
828 3300005548 Ga0070665_100168244 Ga0070665_1001682443 249
829 3300005564 Ga0070664_100129421 Ga0070664_1001294212 249
830 3300005614 Ga0068856_100031077 Ga0068856_1000310774 249
831 3300005615 Ga0070702_100029423 Ga0070702_1000294233 249
832 3300005616 Ga0068852_100068923 Ga0068852_1000689232 249
833 3300005618 Ga0068864_100136908 Ga0068864_1001369082 249
834 3300005842 Ga0068858_100016437 Ga0068858_1000164379 249
835 3300005844 Ga0068862_100298310 Ga0068862_1002983102 249
836 3300006881 Ga0068865_100280703 Ga0068865_1002807032 249
837 3300009545 Ga0105237_10286426 Ga0105237_102864263 249
838 3300011119 Ga0105246_10000393 Ga0105246_100003932 249
839 3300013297 Ga0157378_10830299 Ga0157378_108302991 249
840 3300013306 Ga0163162_10020330 Ga0163162_100203307 249
841 3300013307 Ga0157372_10002293 Ga0157372_1000229321 249
842 3300013308 Ga0157375_10054232 Ga0157375_100542324 249
843 3300014325 Ga0163163_10052960 Ga0163163_100529602 249
844 3300014325 Ga0163163_10315058 Ga0163163_103150582 249
845 3300014745 Ga0157377_10091425 Ga0157377_100914252 249
846 3300014968 Ga0157379_10026044 Ga0157379_100260443 249
847 3300025901 Ga0207688_10034271 Ga0207688_100342715 249
848 3300025919 Ga0207657_10022465 Ga0207657_100224654 249
849 3300025927 Ga0207687_10437597 Ga0207687_104375972 249
850 3300025938 Ga0207704_10021494 Ga0207704_100214944 249
851 3300025944 Ga0207661_10079084 Ga0207661_100790844 249
852 3300025945 Ga0207679_10318695 Ga0207679_103186952 249
853 3300026035 Ga0207703_10045242 Ga0207703_100452423 249
854 3300026088 Ga0207641_10041488 Ga0207641_100414882 249
855 3300026142 Ga0207698_10123641 Ga0207698_101236412 249
856 3300031456 Ga0307513_10172807 Ga0307513_101728072 249
857 3300031691 Ga0316579_10003042 Ga0316579_100030422 249
858 3300031727 Ga0316576_10009982 Ga0316576_100099824 249
859 3300031728 Ga0316578_10024171 Ga0316578_100241712 249
860 3300031733 Ga0316577_10034039 Ga0316577_100340394 249
861 3300032139 Ga0316580_10008578 Ga0316580_100085783 249
862 3300035119 Ga0373956_0171815 Ga0373956_0171815_162_968 249
863 3300035172 Ga0373955_0048265 Ga0373955_0048265_1244_2050 249
864 3300035398 Ga0316574_0023602 Ga0316574_0023602_1290_2090 249
865 3300035398 Ga0316574_0418525 Ga0316574_0418525_25_825 249
866 3300035724 Ga0373933_0004233 Ga0373933_0004233_3542_4348 249
867 3300036401 Ga0373937_0027294 Ga0373937_0027294_472_1278 249
868 3300036647 Ga0316582_0003824 Ga0316582_0003824_5447_6247 249
869 3300036712 Ga0316584_0096972 Ga0316584_0096972_436_1236 249
870 3300037068 Ga0373925_0032460 Ga0373925_0032460_2818_3624 249
871 3300039450 Ga0436363_1570492 Ga0436363_1570492_129_905 249
872 3300041410 Ga0439461_0002938 Ga0439461_0002938_1050_1844 249
873 3300041997 Ga0439431_0029799 Ga0439431_0029799_175_969 249
874 3300042156 Ga0439446_0053129 Ga0439446_0053129_331_1125 249
875 3300042435 Ga0439434_0085695 Ga0439434_0085695_84_878 249
876 3300044694 Ga0466963_0072424 Ga0466963_0072424_468_1262 249
877 3300044842 Ga0466957_0029833 Ga0466957_0029833_2379_3173 249
878 3300045049 Ga0466959_0144489 Ga0466959_0144489_436_1230 249
879 3300045836 Ga0466958_0067667 Ga0466958_0067667_893_1687 249
880 3300045976 Ga0466967_0011278 Ga0466967_0011278_4242_5036 249
881 3300046454 Ga0495592_0002920 Ga0495592_0002920_9498_10304 249
882 3300046462 Ga0495651_0000665 Ga0495651_0000665_2079_2885 249
883 3300046463 Ga0495653_0010781 Ga0495653_0010781_1652_2458 249
884 3300046473 Ga0495582_0083357 Ga0495582_0083357_930_1739 249
885 3300046511 Ga0495608_0003307 Ga0495608_0003307_6049_6855 249
886 3300046514 Ga0495618_0034383 Ga0495618_0034383_2328_3134 249
887 3300046516 Ga0495628_0007504 Ga0495628_0007504_4707_5513 249
888 3300046529 Ga0495652_0002616 Ga0495652_0002616_12372_13178 249
889 3300046533 Ga0495640_0074680 Ga0495640_0074680_985_1791 249
890 3300046536 Ga0495587_0009180 Ga0495587_0009180_1782_2588 249
891 3300046543 Ga0495645_0025816 Ga0495645_0025816_215_1021 249
892 3300046559 Ga0495667_0005202 Ga0495667_0005202_5073_5879 249
893 3300046663 Ga0495635_0035773 Ga0495635_0035773_327_1133 249
894 3300046675 Ga0495657_0004268 Ga0495657_0004268_5221_6027 249
895 3300046678 Ga0495599_0045954 Ga0495599_0045954_1424_2230 249
896 3300046679 Ga0495623_0043076 Ga0495623_0043076_1848_2654 249
897 3300046809 Ga0495600_0038154 Ga0495600_0038154_1968_2774 249
898 3300047317 Ga0495604_0003408 Ga0495604_0003408_4841_5647 249
899 3300047319 Ga0495674_0013538 Ga0495674_0013538_6430_7236 249
900 3300047322 Ga0495680_0016142 Ga0495680_0016142_1263_2069 249
901 3300047444 Ga0495675_0006523 Ga0495675_0006523_4284_5090 249
902 3300048088 Ga0495602_0004314 Ga0495602_0004314_9657_10463 249
903 3300048905 Ga0496102_0004193 Ga0496102_0004193_6242_7000 249
904 3300048906 Ga0496103_0112927 Ga0496103_0112927_697_1455 249
905 3300048909 Ga0496106_0066893 Ga0496106_0066893_1115_1873 249
906 3300048914 Ga0496111_0002891 Ga0496111_0002891_6106_6864 249
907 3300049585 Ga0501069_0285394 Ga0501069_0285394_99_857 249
908 3300049586 Ga0501070_0000826 Ga0501070_0000826_14405_15163 249
909 3300049590 Ga0501074_0018526 Ga0501074_0018526_2243_3001 249
910 3300049592 Ga0501076_0208177 Ga0501076_0208177_685_1464 249
911 3300049742 Ga0501080_0062281 Ga0501080_0062281_1926_2684 249
912 3300053077 Ga0495601_0241111 Ga0495601_0241111_47_853 249
913 3300053085 Ga0495619_0030545 Ga0495619_0030545_220_1026 249
914 3300054114 Ga0501084_0633347 Ga0501084_0633347_97_876 249
915 3300061719 Ga0466962_0032854 Ga0466962_0032854_1504_2298 249
916 iso_pu_bacteria 2974315732 2974318221 249
917 iso_pu_bacteria 2984523437 2984526433 249
918 3300005336 Ga0070680_100006434 Ga0070680_1000064345 250
919 3300005339 Ga0070660_100051362 Ga0070660_1000513625 250
920 3300005445 Ga0070708_100492719 Ga0070708_1004927191 250
921 3300005458 Ga0070681_10036203 Ga0070681_100362036 250
922 3300005468 Ga0070707_100049564 Ga0070707_1000495645 250
923 3300005530 Ga0070679_100066386 Ga0070679_1000663862 250
924 3300013105 Ga0157369_10326345 Ga0157369_103263452 250
925 3300014497 Ga0182008_10130389 Ga0182008_101303892 250
926 3300020070 Ga0206356_10646937 Ga0206356_106469372 250
927 3300020082 Ga0206353_11333670 Ga0206353_113336708 250
928 3300025909 Ga0207705_10016121 Ga0207705_100161214 250
929 3300025910 Ga0207684_10349341 Ga0207684_103493412 250
930 3300025912 Ga0207707_10016421 Ga0207707_100164215 250
931 3300025917 Ga0207660_10031096 Ga0207660_100310963 250
932 3300025919 Ga0207657_10066348 Ga0207657_100663485 250
933 3300025921 Ga0207652_10025250 Ga0207652_100252503 250
934 3300032002 Ga0307416_100143194 Ga0307416_1001431942 250
935 3300044693 Ga0466961_0072814 Ga0466961_0072814_599_1432 250
936 3300044901 Ga0466960_0032218 Ga0466960_0032218_669_1553 250
937 3300044901 Ga0466960_0231615 Ga0466960_0231615_87_962 250
938 3300045049 Ga0466959_0101188 Ga0466959_0101188_665_1498 250
939 3300048922 Ga0496119_0082293 Ga0496119_0082293_246_1079 250
940 3300050490 nmdc:mga03n38_60085_c1 nmdc:mga03n38_60085_c1_842_1657 250
941 3300059423 Ga0590074_014999 Ga0590074_014999_142_942 250
942 3300061734 Ga0530510_0076967 Ga0530510_0076967_734_1534 250
943 iso_pu_bacteria 2808606365 2808873103 250
944 iso_pu_bacteria 2919446982 2919449422 250
945 3300005329 Ga0070683_100640632 Ga0070683_1006406321 251
946 3300013296 Ga0157374_10793707 Ga0157374_107937071 251
947 3300014969 Ga0157376_10351081 Ga0157376_103510812 251
948 3300025935 Ga0207709_10294594 Ga0207709_102945941 251
949 3300046455 Ga0495603_0135198 Ga0495603_0135198_404_1177 251
950 3300046683 Ga0495658_0128370 Ga0495658_0128370_139_912 251
951 3300048905 Ga0496102_0004007 Ga0496102_0004007_4332_5147 251
952 3300048906 Ga0496103_0008868 Ga0496103_0008868_2572_3387 251
953 3300049572 Ga0501036_0154174 Ga0501036_0154174_982_1794 251
954 3300049574 Ga0501038_0131945 Ga0501038_0131945_70_948 251
955 3300049575 Ga0501039_0028773 Ga0501039_0028773_3033_3911 251
956 3300049576 Ga0501040_0052052 Ga0501040_0052052_786_1664 251
957 3300049577 Ga0501041_0066301 Ga0501041_0066301_1077_1955 251
958 3300049578 Ga0501042_0042602 Ga0501042_0042602_1973_2851 251
959 3300049580 Ga0501046_0134549 Ga0501046_0134549_799_1677 251
960 3300049582 Ga0501048_0192033 Ga0501048_0192033_390_1268 251
961 3300049584 Ga0501068_0042383 Ga0501068_0042383_1927_2700 251
962 3300049586 Ga0501070_0033719 Ga0501070_0033719_533_1306 251
963 3300049588 Ga0501072_0174638 Ga0501072_0174638_678_1493 251
964 3300049590 Ga0501074_0024371 Ga0501074_0024371_2170_2943 251
965 3300049590 Ga0501074_0033786 Ga0501074_0033786_1379_2257 251
966 3300049591 Ga0501075_0069104 Ga0501075_0069104_456_1334 251
967 3300049592 Ga0501076_0279083 Ga0501076_0279083_439_1254 251
968 3300049593 Ga0501077_0054018 Ga0501077_0054018_994_1767 251
969 3300049742 Ga0501080_0010859 Ga0501080_0010859_2436_3209 251
970 3300049743 Ga0501081_0012217 Ga0501081_0012217_3604_4482 251
971 3300049744 Ga0501083_0009218 Ga0501083_0009218_5018_5791 251
972 3300049822 Ga0501035_0065325 Ga0501035_0065325_2053_2826 251
973 3300049824 Ga0501045_0007317 Ga0501045_0007317_4123_5001 251
974 3300049824 Ga0501045_0377572 Ga0501045_0377572_130_942 251
975 3300053139 Ga0500568_0018960 Ga0500568_0018960_39_863 251
976 3300060353 Ga0501082_0096102 Ga0501082_0096102_1289_2167 251
977 3300005366 Ga0070659_100215024 Ga0070659_1002150242 252
978 3300009551 Ga0105238_10465709 Ga0105238_104657091 252
979 3300014497 Ga0182008_10180851 Ga0182008_101808512 252
980 3300044683 Ga0466965_0030135 Ga0466965_0030135_1121_1957 252
981 3300044706 Ga0466964_0004033 Ga0466964_0004033_2353_3189 252
982 3300044719 Ga0466971_0012684 Ga0466971_0012684_1722_2558 252
983 3300044765 Ga0466970_0015639 Ga0466970_0015639_2798_3634 252
984 3300044842 Ga0466957_0017810 Ga0466957_0017810_1744_2580 252
985 3300045976 Ga0466967_0100982 Ga0466967_0100982_1128_1964 252
986 3300048911 Ga0496108_0144225 Ga0496108_0144225_506_1306 252
987 3300048917 Ga0496114_0101271 Ga0496114_0101271_797_1627 252
988 3300061719 Ga0466962_0010555 Ga0466962_0010555_2222_3058 252
989 3300037312 Ga0395899_0035350 Ga0395899_0035350_2501_3358 253
990 3300035398 Ga0316574_0031574 Ga0316574_0031574_1722_2570 254
991 3300036712 Ga0316584_0191619 Ga0316584_0191619_185_1033 254
992 3300001979 JGI24740J21852_10029076 JGI24740J21852_100290763 255
993 3300005327 Ga0070658_10410682 Ga0070658_104106822 255
994 3300005339 Ga0070660_100027131 Ga0070660_1000271314 255
995 3300005530 Ga0070679_100216410 Ga0070679_1002164103 255
996 3300025909 Ga0207705_10155486 Ga0207705_101554862 255
997 3300025921 Ga0207652_10171755 Ga0207652_101717553 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

159

288

0.96

PF18306

LDcluster4

SLOG cluster4 family

116

249

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9609 41 247
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9603 40 244
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9575 41 247
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9472 41 247
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9395 41 247
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9778 46 247 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9682 46 247 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.936 47 241 3.40.50.450
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9257 100 243 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9123 47 241 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A371LRB8-F1-model_v4 TIGR00730 family Rossman fold protein 0.9889 81 239 GO:0005829
GO:0009691
GO:0016787
AF-A0A3A0FM09-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9857 54 247 GO:0005829
GO:0008714
GO:0009691
AF-A0A7Y2ZJN8-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9829 54 247 GO:0005829
GO:0009691
GO:0016787
AF-A0A378SHX5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9824 50 246 GO:0005829
GO:0009691
GO:0102682
AF-A0A6L3EY37-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9801 51 247 GO:0005829
GO:0009691
GO:0016787

Feature Viewer

pLDDT pTM Quality
86.39 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map