F487794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 997 | 460 | 899 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10014055|Ga0081539_100140552 |
| Length | 294 |
| Sequence | VCHGCAERRAALPSALVTTLPPAEEPSPDTGRRADEAAAVTDAAGAPKDGLRDDHREEYQQGPVTLRGRLVPPTTTDQRLLDSRGPTDWVHSDPWRVLRIQSEFVEGFGALAELGPAVSVFGSARTRRDHPDWALGESLGAALARAGFAVITGGGPGAMAATNKGAIEAGGVSVGLGIELPFEQGINEWVNLAVNFRYFFARKTMFVKYAQGFVVLPGGFGTLDELFEALVLVQTKKVTSFPIVLLGTSYWGGLLEWARGPLLERGMVGARDLDLIRVTDDVAFAAEDDAGKAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 7 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 8 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 9 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 10 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 11 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 12 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 13 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 14 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 15 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 16 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 17 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 18 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 19 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 20 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 21 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 22 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 23 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 24 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 25 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 26 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 27 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 28 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 29 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 30 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 31 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 32 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 33 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 34 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 35 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 36 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 37 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 38 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 39 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 40 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 41 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 42 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 43 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 44 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 45 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 46 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 47 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 48 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 49 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 50 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 51 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 52 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 53 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 54 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 55 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 56 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 57 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 58 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 59 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 60 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 61 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 62 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 63 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 64 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 65 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 66 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 67 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 68 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 69 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 70 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 71 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 72 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 73 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 74 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 75 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 76 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 77 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 78 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 79 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 80 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 81 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 82 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 83 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 84 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 85 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 86 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 87 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 88 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 89 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 90 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 91 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 98 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 121 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 133 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 134 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 138 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 139 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 140 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 141 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 142 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 143 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 144 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 145 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 146 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 147 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 148 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 149 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 151 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 152 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 153 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 154 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 155 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 156 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 157 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 167 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 179 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 183 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 186 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 238 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 239 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 240 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 241 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 245 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 251 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 252 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 253 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 259 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 260 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 261 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 282 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 283 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 287 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 298 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 388 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 389 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 390 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 430 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 431 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 432 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 439 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 441 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 442 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 445 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 450 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 451 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 452 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 453 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 454 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 455 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 456 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 457 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 458 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 459 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 460 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.67 |
| Metatranscriptomes | 0.5 |
| Isolates | 9.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 0.1 |
| Rhizoplane | 6.72 |
| Rhizosphere | 79.54 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 7.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10029076 | 3300001979 | Bacteria | 1819 |
| 2 | JGI24737J22298_10079755 | 3300001990 | Bacteria | 974 |
| 3 | JGI24743J22301_10011899 | 3300001991 | Bacteria | 1575 |
| 4 | Ga0007423J48922_100135 | 3300003285 | Bacteria | 7860 |
| 5 | Ga0007423J48922_100136 | 3300003285 | Bacteria | 7298 |
| 6 | Ga0070658_10258407 | 3300005327 | Bacteria | 1479 |
| 7 | Ga0070658_10410682 | 3300005327 | Bacteria | 1163 |
| 8 | Ga0070683_100000566 | 3300005329 | Bacteria | 26326 |
| 9 | Ga0070683_100028278 | 3300005329 | Bacteria | 5066 |
| 10 | Ga0070683_100076950 | 3300005329 | Bacteria | 3120 |
| 11 | Ga0070683_100142803 | 3300005329 | Bacteria | 2268 |
| 12 | Ga0070683_100350193 | 3300005329 | Bacteria | 1406 |
| 13 | Ga0070683_100483772 | 3300005329 | Bacteria | 1182 |
| 14 | Ga0070683_100640632 | 3300005329 | Bacteria | 1017 |
| 15 | Ga0068869_100036317 | 3300005334 | Bacteria | 3499 |
| 16 | Ga0070680_100006434 | 3300005336 | Bacteria | 8926 |
| 17 | Ga0070682_100110682 | 3300005337 | Bacteria | 1830 |
| 18 | Ga0070682_100135192 | 3300005337 | Bacteria | 1674 |
| 19 | Ga0070682_100201841 | 3300005337 | Bacteria | 1403 |
| 20 | Ga0068868_100085485 | 3300005338 | Bacteria | 2535 |
| 21 | Ga0068868_100316406 | 3300005338 | Bacteria | 1329 |
| 22 | Ga0070660_100027131 | 3300005339 | Bacteria | 4272 |
| 23 | Ga0070660_100051362 | 3300005339 | Bacteria | 3175 |
| 24 | Ga0070689_100337479 | 3300005340 | Bacteria | 1262 |
| 25 | Ga0070691_10048738 | 3300005341 | Bacteria | 2017 |
| 26 | Ga0070687_100114578 | 3300005343 | Bacteria | 1532 |
| 27 | Ga0070692_10117298 | 3300005345 | Bacteria | 1480 |
| 28 | Ga0070692_10349687 | 3300005345 | Bacteria | 918 |
| 29 | Ga0070668_100103590 | 3300005347 | Bacteria | 2257 |
| 30 | Ga0070675_100095762 | 3300005354 | Bacteria | 2493 |
| 31 | Ga0070674_100015450 | 3300005356 | Bacteria | 4765 |
| 32 | Ga0070674_100075935 | 3300005356 | Bacteria | 2388 |
| 33 | Ga0070673_100182403 | 3300005364 | Bacteria | 1798 |
| 34 | Ga0070659_100024836 | 3300005366 | Bacteria | 4597 |
| 35 | Ga0070659_100027577 | 3300005366 | Bacteria | 4378 |
| 36 | Ga0070659_100215024 | 3300005366 | Bacteria | 1585 |
| 37 | Ga0070667_100650584 | 3300005367 | Bacteria | 973 |
| 38 | Ga0070709_10120178 | 3300005434 | Bacteria | 1779 |
| 39 | Ga0070709_10153756 | 3300005434 | Bacteria | 1593 |
| 40 | Ga0070714_100032019 | 3300005435 | Bacteria | 4390 |
| 41 | Ga0070714_100075811 | 3300005435 | Bacteria | 2919 |
| 42 | Ga0070713_100048185 | 3300005436 | Bacteria | 3507 |
| 43 | Ga0070710_10000110 | 3300005437 | Bacteria | 38306 |
| 44 | Ga0070710_10029562 | 3300005437 | Bacteria | 2941 |
| 45 | Ga0070701_10001057 | 3300005438 | Bacteria | 10046 |
| 46 | Ga0070705_100012269 | 3300005440 | Bacteria | 4352 |
| 47 | Ga0070694_100622994 | 3300005444 | Bacteria | 871 |
| 48 | Ga0070708_100492719 | 3300005445 | Bacteria | 1156 |
| 49 | Ga0070663_100002222 | 3300005455 | Bacteria | 10869 |
| 50 | Ga0070678_100053128 | 3300005456 | Bacteria | 2945 |
| 51 | Ga0070678_100061042 | 3300005456 | Bacteria | 2778 |
| 52 | Ga0070678_100165237 | 3300005456 | Bacteria | 1797 |
| 53 | Ga0070678_100170146 | 3300005456 | Bacteria | 1774 |
| 54 | Ga0070681_10036203 | 3300005458 | Bacteria | 4957 |
| 55 | Ga0068867_100026319 | 3300005459 | Bacteria | 4176 |
| 56 | Ga0070685_10074406 | 3300005466 | Bacteria | 2021 |
| 57 | Ga0070685_10156467 | 3300005466 | Bacteria | 1449 |
| 58 | Ga0070707_100049564 | 3300005468 | Bacteria | 4026 |
| 59 | Ga0070707_100174553 | 3300005468 | Bacteria | 2094 |
| 60 | Ga0070698_100003056 | 3300005471 | Bacteria | 18446 |
| 61 | Ga0070699_100037534 | 3300005518 | Bacteria | 4194 |
| 62 | Ga0070679_100066386 | 3300005530 | Bacteria | 3596 |
| 63 | Ga0070679_100216410 | 3300005530 | Bacteria | 1878 |
| 64 | Ga0070679_100334782 | 3300005530 | Bacteria | 1462 |
| 65 | Ga0070679_100379240 | 3300005530 | Bacteria | 1361 |
| 66 | Ga0070679_100461587 | 3300005530 | Bacteria | 1215 |
| 67 | Ga0070684_100001014 | 3300005535 | Bacteria | 20027 |
| 68 | Ga0070684_100054076 | 3300005535 | Bacteria | 3497 |
| 69 | Ga0070672_100024021 | 3300005543 | Bacteria | 4497 |
| 70 | Ga0070696_100005324 | 3300005546 | Bacteria | 8585 |
| 71 | Ga0070693_100133991 | 3300005547 | Bacteria | 1552 |
| 72 | Ga0070665_100164425 | 3300005548 | Bacteria | 2221 |
| 73 | Ga0070665_100168244 | 3300005548 | Bacteria | 2194 |
| 74 | Ga0070664_100081383 | 3300005564 | Bacteria | 2791 |
| 75 | Ga0070664_100129421 | 3300005564 | Bacteria | 2217 |
| 76 | Ga0070664_100317684 | 3300005564 | Bacteria | 1410 |
| 77 | Ga0068854_100069905 | 3300005578 | Bacteria | 2565 |
| 78 | Ga0068856_100017536 | 3300005614 | Bacteria | 6938 |
| 79 | Ga0068856_100031077 | 3300005614 | Bacteria | 5223 |
| 80 | Ga0068856_100246752 | 3300005614 | Bacteria | 1801 |
| 81 | Ga0070702_100000741 | 3300005615 | Bacteria | 12358 |
| 82 | Ga0070702_100000931 | 3300005615 | Bacteria | 11456 |
| 83 | Ga0070702_100029423 | 3300005615 | Bacteria | 2987 |
| 84 | Ga0068852_100011817 | 3300005616 | Bacteria | 6596 |
| 85 | Ga0068852_100068923 | 3300005616 | Bacteria | 3098 |
| 86 | Ga0068852_100266927 | 3300005616 | Bacteria | 1645 |
| 87 | Ga0068852_100546788 | 3300005616 | Bacteria | 1158 |
| 88 | Ga0068859_100251991 | 3300005617 | Bacteria | 1856 |
| 89 | Ga0068864_100119532 | 3300005618 | Bacteria | 2354 |
| 90 | Ga0068864_100136908 | 3300005618 | Bacteria | 2206 |
| 91 | Ga0068864_100407077 | 3300005618 | Bacteria | 1294 |
| 92 | Ga0068866_10226109 | 3300005718 | Bacteria | 1132 |
| 93 | Ga0068861_100033624 | 3300005719 | Bacteria | 3784 |
| 94 | Ga0068861_100518072 | 3300005719 | Bacteria | 1081 |
| 95 | Ga0068870_10010542 | 3300005840 | Bacteria | 4252 |
| 96 | Ga0068858_100016437 | 3300005842 | Bacteria | 6949 |
| 97 | Ga0068858_100540732 | 3300005842 | Bacteria | 1127 |
| 98 | Ga0068860_100571832 | 3300005843 | Bacteria | 1134 |
| 99 | Ga0068862_100298310 | 3300005844 | Bacteria | 1482 |
| 100 | Ga0081539_10010027 | 3300005985 | Bacteria | 7794 |
| 101 | Ga0081539_10010892 | 3300005985 | Bacteria | 7302 |
| 102 | Ga0081539_10014055 | 3300005985 | Bacteria | 5958 |
| 103 | Ga0075365_10009383 | 3300006038 | Bacteria | 5620 |
| 104 | Ga0075365_10010178 | 3300006038 | Bacteria | 5461 |
| 105 | Ga0075365_10018920 | 3300006038 | Bacteria | 4242 |
| 106 | Ga0075365_10057867 | 3300006038 | Bacteria | 2579 |
| 107 | Ga0075365_10086891 | 3300006038 | Bacteria | 2126 |
| 108 | Ga0075365_10128931 | 3300006038 | Bacteria | 1749 |
| 109 | Ga0075365_10149006 | 3300006038 | Bacteria | 1627 |
| 110 | Ga0075365_10184371 | 3300006038 | Bacteria | 1460 |
| 111 | Ga0075363_100037738 | 3300006048 | Bacteria | 2538 |
| 112 | Ga0075363_100090449 | 3300006048 | Bacteria | 1684 |
| 113 | Ga0075363_100216318 | 3300006048 | Bacteria | 1097 |
| 114 | Ga0075363_100240959 | 3300006048 | Bacteria | 1039 |
| 115 | Ga0075364_10027189 | 3300006051 | Bacteria | 3653 |
| 116 | Ga0075364_10031896 | 3300006051 | Bacteria | 3385 |
| 117 | Ga0075364_10035531 | 3300006051 | Bacteria | 3220 |
| 118 | Ga0075364_10081762 | 3300006051 | Bacteria | 2136 |
| 119 | Ga0075367_10017570 | 3300006178 | Bacteria | 3929 |
| 120 | Ga0097621_100107429 | 3300006237 | Bacteria | 2355 |
| 121 | Ga0097621_100243176 | 3300006237 | Bacteria | 1574 |
| 122 | Ga0075370_10008645 | 3300006353 | Bacteria | 5248 |
| 123 | Ga0075370_10102880 | 3300006353 | Bacteria | 1654 |
| 124 | Ga0068871_100557115 | 3300006358 | Bacteria | 1039 |
| 125 | Ga0075428_100237322 | 3300006844 | Bacteria | 1968 |
| 126 | Ga0075431_100064291 | 3300006847 | Bacteria | 3788 |
| 127 | Ga0075434_100664633 | 3300006871 | Bacteria | 1060 |
| 128 | Ga0075429_100426041 | 3300006880 | Bacteria | 1162 |
| 129 | Ga0068865_100005761 | 3300006881 | Bacteria | 7531 |
| 130 | Ga0068865_100280703 | 3300006881 | Bacteria | 1326 |
| 131 | Ga0097620_100251979 | 3300006931 | Bacteria | 1856 |
| 132 | Ga0105244_10101074 | 3300009036 | Bacteria | 1410 |
| 133 | Ga0111539_10064576 | 3300009094 | Bacteria | 4329 |
| 134 | Ga0105245_10008971 | 3300009098 | Bacteria | 8723 |
| 135 | Ga0105245_10092041 | 3300009098 | Bacteria | 2792 |
| 136 | Ga0105245_10137952 | 3300009098 | Bacteria | 2294 |
| 137 | Ga0105245_10618801 | 3300009098 | Bacteria | 1111 |
| 138 | Ga0114129_10118769 | 3300009147 | Bacteria | 3642 |
| 139 | Ga0105243_10005375 | 3300009148 | Bacteria | 9994 |
| 140 | Ga0105243_10006666 | 3300009148 | Bacteria | 8917 |
| 141 | Ga0105243_10298971 | 3300009148 | Bacteria | 1458 |
| 142 | Ga0105243_10331836 | 3300009148 | Bacteria | 1389 |
| 143 | Ga0105243_10781684 | 3300009148 | Bacteria | 939 |
| 144 | Ga0105242_10140022 | 3300009176 | Bacteria | 2098 |
| 145 | Ga0105237_10286426 | 3300009545 | Bacteria | 1650 |
| 146 | Ga0105238_10040721 | 3300009551 | Bacteria | 4707 |
| 147 | Ga0105238_10465709 | 3300009551 | Bacteria | 1262 |
| 148 | Ga0105029_100937 | 3300009984 | Bacteria | 1704 |
| 149 | Ga0105239_10389235 | 3300010375 | Bacteria | 1577 |
| 150 | Ga0105239_10534251 | 3300010375 | Bacteria | 1335 |
| 151 | Ga0105239_10545572 | 3300010375 | Bacteria | 1320 |
| 152 | Ga0105246_10000393 | 3300011119 | Bacteria | 23439 |
| 153 | Ga0105246_10023835 | 3300011119 | Bacteria | 3966 |
| 154 | Ga0105246_10344269 | 3300011119 | Bacteria | 1219 |
| 155 | Ga0157371_10395019 | 3300013102 | Bacteria | 1011 |
| 156 | Ga0157369_10056458 | 3300013105 | Bacteria | 4237 |
| 157 | Ga0157369_10285744 | 3300013105 | Bacteria | 1718 |
| 158 | Ga0157369_10326345 | 3300013105 | Bacteria | 1595 |
| 159 | Ga0157374_10793707 | 3300013296 | Bacteria | 962 |
| 160 | Ga0157378_10059704 | 3300013297 | Bacteria | 3403 |
| 161 | Ga0157378_10830299 | 3300013297 | Bacteria | 951 |
| 162 | Ga0157378_10930033 | 3300013297 | Bacteria | 901 |
| 163 | Ga0163162_10020330 | 3300013306 | Bacteria | 6522 |
| 164 | Ga0157372_10002293 | 3300013307 | Bacteria | 20744 |
| 165 | Ga0157372_10205429 | 3300013307 | Bacteria | 2282 |
| 166 | Ga0157375_10031138 | 3300013308 | Bacteria | 5037 |
| 167 | Ga0157375_10054232 | 3300013308 | Bacteria | 3948 |
| 168 | Ga0157375_10115648 | 3300013308 | Bacteria | 2785 |
| 169 | Ga0157375_10151110 | 3300013308 | Bacteria | 2458 |
| 170 | Ga0157375_10242375 | 3300013308 | Bacteria | 1962 |
| 171 | Ga0157375_10745323 | 3300013308 | Bacteria | 1131 |
| 172 | Ga0163163_10052960 | 3300014325 | Bacteria | 4005 |
| 173 | Ga0163163_10117504 | 3300014325 | Bacteria | 2691 |
| 174 | Ga0163163_10315058 | 3300014325 | Bacteria | 1618 |
| 175 | Ga0157380_10021716 | 3300014326 | Bacteria | 4819 |
| 176 | Ga0157380_10071601 | 3300014326 | Bacteria | 2805 |
| 177 | Ga0157380_10644057 | 3300014326 | Bacteria | 1056 |
| 178 | Ga0182008_10130389 | 3300014497 | Bacteria | 1253 |
| 179 | Ga0182008_10180851 | 3300014497 | Bacteria | 1067 |
| 180 | Ga0157377_10026123 | 3300014745 | Bacteria | 3122 |
| 181 | Ga0157377_10091425 | 3300014745 | Bacteria | 1798 |
| 182 | Ga0157379_10026044 | 3300014968 | Bacteria | 5202 |
| 183 | Ga0157379_10215891 | 3300014968 | Bacteria | 1737 |
| 184 | Ga0157376_10351081 | 3300014969 | Bacteria | 1411 |
| 185 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 186 | Ga0206356_10646937 | 3300020070 | Bacteria | 2495 |
| 187 | Ga0206353_11333670 | 3300020082 | Bacteria | 10459 |
| 188 | Ga0206353_11505532 | 3300020082 | Bacteria | 1941 |
| 189 | Ga0213875_10003530 | 3300021388 | Bacteria | 8890 |
| 190 | Ga0228598_1014053 | 3300024227 | Bacteria | 1584 |
| 191 | Ga0207697_10076111 | 3300025315 | Bacteria | 1410 |
| 192 | Ga0207692_10002246 | 3300025898 | Bacteria | 7391 |
| 193 | Ga0207688_10006708 | 3300025901 | Bacteria | 6263 |
| 194 | Ga0207688_10034271 | 3300025901 | Bacteria | 2811 |
| 195 | Ga0207688_10057596 | 3300025901 | Bacteria | 2185 |
| 196 | Ga0207647_10226559 | 3300025904 | Bacteria | 1076 |
| 197 | Ga0207699_10053315 | 3300025906 | Bacteria | 2397 |
| 198 | Ga0207699_10217962 | 3300025906 | Bacteria | 1301 |
| 199 | Ga0207643_10002261 | 3300025908 | Bacteria | 10497 |
| 200 | Ga0207705_10016121 | 3300025909 | Bacteria | 5362 |
| 201 | Ga0207705_10155486 | 3300025909 | Bacteria | 1715 |
| 202 | Ga0207684_10349341 | 3300025910 | Bacteria | 1273 |
| 203 | Ga0207654_10111480 | 3300025911 | Bacteria | 1703 |
| 204 | Ga0207707_10016421 | 3300025912 | Bacteria | 6458 |
| 205 | Ga0207693_10116707 | 3300025915 | Bacteria | 2096 |
| 206 | Ga0207663_10025992 | 3300025916 | Bacteria | 3393 |
| 207 | Ga0207663_10219202 | 3300025916 | Bacteria | 1383 |
| 208 | Ga0207660_10031096 | 3300025917 | Bacteria | 3673 |
| 209 | Ga0207662_10013839 | 3300025918 | Bacteria | 4516 |
| 210 | Ga0207657_10022465 | 3300025919 | Bacteria | 5900 |
| 211 | Ga0207657_10066348 | 3300025919 | Bacteria | 3072 |
| 212 | Ga0207652_10025250 | 3300025921 | Bacteria | 4937 |
| 213 | Ga0207652_10171755 | 3300025921 | Bacteria | 1945 |
| 214 | Ga0207652_10492914 | 3300025921 | Bacteria | 1103 |
| 215 | Ga0207646_10113058 | 3300025922 | Bacteria | 2437 |
| 216 | Ga0207694_10049511 | 3300025924 | Bacteria | 3253 |
| 217 | Ga0207659_10086876 | 3300025926 | Bacteria | 2327 |
| 218 | Ga0207687_10051896 | 3300025927 | Bacteria | 2860 |
| 219 | Ga0207687_10437597 | 3300025927 | Bacteria | 1082 |
| 220 | Ga0207664_10003068 | 3300025929 | Bacteria | 11095 |
| 221 | Ga0207664_10019581 | 3300025929 | Bacteria | 5004 |
| 222 | Ga0207664_10162938 | 3300025929 | Bacteria | 1903 |
| 223 | Ga0207690_10161719 | 3300025932 | Bacteria | 1670 |
| 224 | Ga0207686_10212637 | 3300025934 | Bacteria | 1391 |
| 225 | Ga0207709_10180390 | 3300025935 | Bacteria | 1491 |
| 226 | Ga0207709_10294594 | 3300025935 | Bacteria | 1204 |
| 227 | Ga0207669_10036827 | 3300025937 | Bacteria | 2800 |
| 228 | Ga0207669_10216814 | 3300025937 | Bacteria | 1401 |
| 229 | Ga0207704_10021494 | 3300025938 | Bacteria | 3439 |
| 230 | Ga0207704_10037911 | 3300025938 | Bacteria | 2789 |
| 231 | Ga0207665_10041270 | 3300025939 | Bacteria | 3080 |
| 232 | Ga0207665_10208681 | 3300025939 | Bacteria | 1426 |
| 233 | Ga0207691_10035517 | 3300025940 | Bacteria | 4625 |
| 234 | Ga0207691_10144276 | 3300025940 | Bacteria | 2097 |
| 235 | Ga0207711_10401917 | 3300025941 | Bacteria | 1273 |
| 236 | Ga0207661_10079084 | 3300025944 | Bacteria | 2709 |
| 237 | Ga0207661_10081310 | 3300025944 | Bacteria | 2676 |
| 238 | Ga0207661_10111775 | 3300025944 | Bacteria | 2312 |
| 239 | Ga0207661_10279966 | 3300025944 | Bacteria | 1490 |
| 240 | Ga0207679_10166170 | 3300025945 | Bacteria | 1812 |
| 241 | Ga0207679_10318695 | 3300025945 | Bacteria | 1345 |
| 242 | Ga0207712_10087117 | 3300025961 | Bacteria | 2289 |
| 243 | Ga0207640_10041090 | 3300025981 | Bacteria | 2939 |
| 244 | Ga0207677_10185977 | 3300026023 | Bacteria | 1638 |
| 245 | Ga0207677_10249208 | 3300026023 | Bacteria | 1441 |
| 246 | Ga0207703_10022437 | 3300026035 | Bacteria | 4951 |
| 247 | Ga0207703_10045242 | 3300026035 | Bacteria | 3540 |
| 248 | Ga0207639_10006559 | 3300026041 | Bacteria | 7913 |
| 249 | Ga0207639_10059592 | 3300026041 | Bacteria | 2941 |
| 250 | Ga0207678_10358847 | 3300026067 | Bacteria | 1257 |
| 251 | Ga0207678_10458816 | 3300026067 | Bacteria | 1108 |
| 252 | Ga0207708_10000689 | 3300026075 | Bacteria | 25629 |
| 253 | Ga0207702_10024539 | 3300026078 | Bacteria | 5003 |
| 254 | Ga0207702_10045767 | 3300026078 | Bacteria | 3681 |
| 255 | Ga0207702_10160619 | 3300026078 | Bacteria | 2052 |
| 256 | Ga0207702_10454666 | 3300026078 | Bacteria | 1243 |
| 257 | Ga0207641_10041488 | 3300026088 | Bacteria | 3857 |
| 258 | Ga0207648_10008420 | 3300026089 | Bacteria | 9989 |
| 259 | Ga0207676_10127813 | 3300026095 | Bacteria | 2155 |
| 260 | Ga0207676_10166098 | 3300026095 | Bacteria | 1918 |
| 261 | Ga0207676_10282510 | 3300026095 | Bacteria | 1508 |
| 262 | Ga0207674_10452659 | 3300026116 | Bacteria | 1241 |
| 263 | Ga0207675_100001638 | 3300026118 | Bacteria | 22449 |
| 264 | Ga0207675_100460576 | 3300026118 | Bacteria | 1261 |
| 265 | Ga0207698_10049931 | 3300026142 | Bacteria | 3188 |
| 266 | Ga0207698_10089796 | 3300026142 | Bacteria | 2511 |
| 267 | Ga0207698_10123641 | 3300026142 | Bacteria | 2195 |
| 268 | Ga0209371_1028786 | 3300027312 | Bacteria | 1234 |
| 269 | Ga0209813_10005281 | 3300027866 | Bacteria | 3126 |
| 270 | Ga0268266_10221566 | 3300028379 | Bacteria | 1739 |
| 271 | Ga0268266_10222265 | 3300028379 | Bacteria | 1737 |
| 272 | Ga0268264_10000943 | 3300028381 | Bacteria | 30160 |
| 273 | Ga0265338_10005476 | 3300028800 | Bacteria | 16562 |
| 274 | Ga0316176_1032343 | 3300030732 | Bacteria | 5890 |
| 275 | Ga0314311_1097076 | 3300030733 | Bacteria | 6104 |
| 276 | Ga0316179_1081360 | 3300030734 | Bacteria | 1087 |
| 277 | Ga0316180_1110667 | 3300030736 | Bacteria | 1933 |
| 278 | Ga0316181_1123477 | 3300030744 | Bacteria | 2212 |
| 279 | Ga0307513_10000392 | 3300031456 | Bacteria | 63905 |
| 280 | Ga0307513_10172807 | 3300031456 | Bacteria | 2036 |
| 281 | Ga0307408_100026929 | 3300031548 | Bacteria | 3956 |
| 282 | Ga0316575_10000183 | 3300031665 | Bacteria | 16320 |
| 283 | Ga0316575_10005262 | 3300031665 | Bacteria | 4607 |
| 284 | Ga0316579_10000576 | 3300031691 | Bacteria | 12273 |
| 285 | Ga0316579_10003042 | 3300031691 | Bacteria | 6457 |
| 286 | Ga0316576_10000409 | 3300031727 | Bacteria | 19808 |
| 287 | Ga0316576_10005178 | 3300031727 | Bacteria | 7923 |
| 288 | Ga0316576_10009982 | 3300031727 | Bacteria | 6149 |
| 289 | Ga0316578_10001788 | 3300031728 | Bacteria | 9023 |
| 290 | Ga0316578_10003110 | 3300031728 | Bacteria | 7496 |
| 291 | Ga0316578_10024171 | 3300031728 | Bacteria | 3407 |
| 292 | Ga0307405_10049052 | 3300031731 | Bacteria | 2608 |
| 293 | Ga0316577_10034039 | 3300031733 | Bacteria | 2847 |
| 294 | Ga0307413_10076057 | 3300031824 | Bacteria | 2133 |
| 295 | Ga0307410_10011079 | 3300031852 | Bacteria | 5141 |
| 296 | Ga0307410_10095476 | 3300031852 | Bacteria | 2120 |
| 297 | Ga0307410_10125735 | 3300031852 | Bacteria | 1877 |
| 298 | Ga0307410_10183114 | 3300031852 | Bacteria | 1587 |
| 299 | Ga0307410_10445094 | 3300031852 | Bacteria | 1056 |
| 300 | Ga0307406_10060614 | 3300031901 | Bacteria | 2441 |
| 301 | Ga0307406_10143334 | 3300031901 | Bacteria | 1695 |
| 302 | Ga0307407_10066021 | 3300031903 | Bacteria | 2133 |
| 303 | Ga0307409_100021234 | 3300031995 | Bacteria | 4448 |
| 304 | Ga0307409_100038947 | 3300031995 | Bacteria | 3522 |
| 305 | Ga0307409_100148061 | 3300031995 | Bacteria | 2034 |
| 306 | Ga0307409_100154020 | 3300031995 | Bacteria | 2000 |
| 307 | Ga0307409_100201796 | 3300031995 | Bacteria | 1780 |
| 308 | Ga0307409_100346439 | 3300031995 | Bacteria | 1400 |
| 309 | Ga0307409_100385299 | 3300031995 | Bacteria | 1334 |
| 310 | Ga0307409_100536586 | 3300031995 | Bacteria | 1146 |
| 311 | Ga0307416_100003285 | 3300032002 | Bacteria | 9454 |
| 312 | Ga0307416_100113291 | 3300032002 | Bacteria | 2396 |
| 313 | Ga0307416_100143194 | 3300032002 | Bacteria | 2177 |
| 314 | Ga0307416_100460214 | 3300032002 | Bacteria | 1327 |
| 315 | Ga0307416_100513845 | 3300032002 | Bacteria | 1265 |
| 316 | Ga0307416_100603629 | 3300032002 | Bacteria | 1177 |
| 317 | Ga0307414_10277056 | 3300032004 | Bacteria | 1408 |
| 318 | Ga0307415_100081535 | 3300032126 | Bacteria | 2311 |
| 319 | Ga0307415_100239418 | 3300032126 | Bacteria | 1467 |
| 320 | Ga0307415_100266557 | 3300032126 | Bacteria | 1401 |
| 321 | Ga0307415_100279912 | 3300032126 | Bacteria | 1371 |
| 322 | Ga0316585_10002960 | 3300032137 | Bacteria | 4638 |
| 323 | Ga0316580_10008578 | 3300032139 | Bacteria | 3063 |
| 324 | Ga0307507_10085453 | 3300033179 | Bacteria | 2744 |
| 325 | Ga0373934_0151833 | 3300035086 | Bacteria | 949 |
| 326 | Ga0373956_0171815 | 3300035119 | Bacteria | 1023 |
| 327 | Ga0373955_0048265 | 3300035172 | Bacteria | 2308 |
| 328 | Ga0316574_0023602 | 3300035398 | Bacteria | 3673 |
| 329 | Ga0316574_0031574 | 3300035398 | Bacteria | 3213 |
| 330 | Ga0316574_0034648 | 3300035398 | Bacteria | 3079 |
| 331 | Ga0316574_0418525 | 3300035398 | Bacteria | 842 |
| 332 | Ga0373924_0002250 | 3300035410 | Bacteria | 6480 |
| 333 | Ga0373935_0017081 | 3300035692 | Bacteria | 4396 |
| 334 | Ga0373933_0004233 | 3300035724 | Bacteria | 7906 |
| 335 | Ga0373947_0291097 | 3300035725 | Bacteria | 1087 |
| 336 | Ga0373937_0027294 | 3300036401 | Bacteria | 5163 |
| 337 | Ga0373937_0273255 | 3300036401 | Bacteria | 1595 |
| 338 | Ga0316582_0003824 | 3300036647 | Bacteria | 7481 |
| 339 | Ga0316582_0069766 | 3300036647 | Bacteria | 2272 |
| 340 | Ga0316584_0001201 | 3300036712 | Bacteria | 15333 |
| 341 | Ga0316584_0039385 | 3300036712 | Bacteria | 3518 |
| 342 | Ga0316584_0096972 | 3300036712 | Bacteria | 2207 |
| 343 | Ga0316584_0191619 | 3300036712 | Bacteria | 1511 |
| 344 | Ga0373925_0032460 | 3300037068 | Bacteria | 3843 |
| 345 | Ga0373925_0038674 | 3300037068 | Bacteria | 3528 |
| 346 | Ga0395899_0035350 | 3300037312 | Bacteria | 3751 |
| 347 | Ga0395899_0037638 | 3300037312 | Bacteria | 3627 |
| 348 | Ga0395900_0043272 | 3300037418 | Bacteria | 4641 |
| 349 | Ga0395900_0115423 | 3300037418 | Bacteria | 2755 |
| 350 | Ga0395898_0085701 | 3300037466 | Bacteria | 3036 |
| 351 | Ga0395898_0085821 | 3300037466 | Bacteria | 3034 |
| 352 | Ga0395905_0034806 | 3300037471 | Bacteria | 4730 |
| 353 | Ga0395905_0039406 | 3300037471 | Bacteria | 4433 |
| 354 | Ga0395905_0058695 | 3300037471 | Bacteria | 3598 |
| 355 | Ga0436364_0296067 | 3300037853 | Bacteria | 138817 |
| 356 | Ga0436364_0727896 | 3300037853 | Bacteria | 5101 |
| 357 | Ga0436364_1546160 | 3300037853 | Bacteria | 10365 |
| 358 | Ga0395901_0051827 | 3300038443 | Bacteria | 4266 |
| 359 | Ga0395901_0105385 | 3300038443 | Bacteria | 2959 |
| 360 | Ga0395901_0133437 | 3300038443 | Bacteria | 2609 |
| 361 | Ga0395901_0156945 | 3300038443 | Bacteria | 2390 |
| 362 | Ga0395901_0164650 | 3300038443 | Bacteria | 2328 |
| 363 | Ga0395901_0583044 | 3300038443 | Bacteria | 1130 |
| 364 | Ga0395901_0823490 | 3300038443 | Bacteria | 915 |
| 365 | Ga0436365_1354692 | 3300039437 | Bacteria | 4700 |
| 366 | Ga0436363_1570492 | 3300039450 | Bacteria | 1075 |
| 367 | Ga0439447_032416 | 3300041407 | Bacteria | 1306 |
| 368 | Ga0439461_0002938 | 3300041410 | Bacteria | 2768 |
| 369 | Ga0451797_0676472 | 3300041453 | Bacteria | 995 |
| 370 | Ga0451833_0752021 | 3300041491 | Bacteria | 17993 |
| 371 | Ga0451837_0479937 | 3300041494 | Bacteria | 3942 |
| 372 | Ga0439431_0029799 | 3300041997 | Bacteria | 1349 |
| 373 | Ga0439442_012315 | 3300042002 | Bacteria | 1748 |
| 374 | Ga0439449_0002264 | 3300042007 | Bacteria | 7565 |
| 375 | Ga0450907_003560 | 3300042146 | Bacteria | 2770 |
| 376 | Ga0439446_0053129 | 3300042156 | Bacteria | 1213 |
| 377 | Ga0439434_0085695 | 3300042435 | Bacteria | 1004 |
| 378 | Ga0466969_0001083 | 3300044656 | Bacteria | 14730 |
| 379 | Ga0466969_0006586 | 3300044656 | Bacteria | 6175 |
| 380 | Ga0466965_0002838 | 3300044683 | Bacteria | 7467 |
| 381 | Ga0466965_0030135 | 3300044683 | Bacteria | 2642 |
| 382 | Ga0466965_0071626 | 3300044683 | Bacteria | 1744 |
| 383 | Ga0466966_0116967 | 3300044684 | Bacteria | 1640 |
| 384 | Ga0466966_0163669 | 3300044684 | Bacteria | 1354 |
| 385 | Ga0466961_0072814 | 3300044693 | Bacteria | 2179 |
| 386 | Ga0466961_0093951 | 3300044693 | Bacteria | 1892 |
| 387 | Ga0466961_0145608 | 3300044693 | Bacteria | 1481 |
| 388 | Ga0466961_0202471 | 3300044693 | Bacteria | 1227 |
| 389 | Ga0466963_0030436 | 3300044694 | Bacteria | 3483 |
| 390 | Ga0466963_0044204 | 3300044694 | Bacteria | 2932 |
| 391 | Ga0466963_0072424 | 3300044694 | Bacteria | 2321 |
| 392 | Ga0466963_0242770 | 3300044694 | Bacteria | 1263 |
| 393 | Ga0466964_0004033 | 3300044706 | Bacteria | 5398 |
| 394 | Ga0466971_0012684 | 3300044719 | Bacteria | 3696 |
| 395 | Ga0466971_0019727 | 3300044719 | Bacteria | 2995 |
| 396 | Ga0466971_0074996 | 3300044719 | Bacteria | 1538 |
| 397 | Ga0466970_0015639 | 3300044765 | Bacteria | 3905 |
| 398 | Ga0466970_0090692 | 3300044765 | Bacteria | 1658 |
| 399 | Ga0466970_0197086 | 3300044765 | Bacteria | 1120 |
| 400 | Ga0466957_0017810 | 3300044842 | Bacteria | 4167 |
| 401 | Ga0466957_0029833 | 3300044842 | Bacteria | 3254 |
| 402 | Ga0466957_0070608 | 3300044842 | Bacteria | 2158 |
| 403 | Ga0466957_0308144 | 3300044842 | Bacteria | 1065 |
| 404 | Ga0466960_0012672 | 3300044901 | Bacteria | 3565 |
| 405 | Ga0466960_0032218 | 3300044901 | Bacteria | 2425 |
| 406 | Ga0466960_0040839 | 3300044901 | Bacteria | 2195 |
| 407 | Ga0466960_0070580 | 3300044901 | Bacteria | 1738 |
| 408 | Ga0466960_0231615 | 3300044901 | Bacteria | 1020 |
| 409 | Ga0466960_0248867 | 3300044901 | Bacteria | 986 |
| 410 | Ga0466959_0101188 | 3300045049 | Bacteria | 2063 |
| 411 | Ga0466959_0144489 | 3300045049 | Bacteria | 1679 |
| 412 | Ga0466958_0067667 | 3300045836 | Bacteria | 2182 |
| 413 | Ga0466958_0233149 | 3300045836 | Bacteria | 1175 |
| 414 | Ga0466967_0009681 | 3300045976 | Bacteria | 7170 |
| 415 | Ga0466967_0011278 | 3300045976 | Bacteria | 6756 |
| 416 | Ga0466967_0018422 | 3300045976 | Bacteria | 5579 |
| 417 | Ga0466967_0100982 | 3300045976 | Bacteria | 2636 |
| 418 | Ga0466967_0214143 | 3300045976 | Bacteria | 1828 |
| 419 | Ga0466967_0234357 | 3300045976 | Bacteria | 1749 |
| 420 | Ga0466967_0243462 | 3300045976 | Bacteria | 1716 |
| 421 | Ga0466967_0469659 | 3300045976 | Bacteria | 1231 |
| 422 | Ga0466967_0702501 | 3300045976 | Bacteria | 1002 |
| 423 | Ga0495617_012050 | 3300046452 | Bacteria | 2949 |
| 424 | Ga0495592_0002920 | 3300046454 | Bacteria | 12167 |
| 425 | Ga0495592_0008325 | 3300046454 | Bacteria | 7781 |
| 426 | Ga0495592_0029277 | 3300046454 | Bacteria | 4170 |
| 427 | Ga0495592_0136449 | 3300046454 | Bacteria | 1710 |
| 428 | Ga0495603_0001577 | 3300046455 | Bacteria | 13336 |
| 429 | Ga0495603_0019833 | 3300046455 | Bacteria | 4071 |
| 430 | Ga0495603_0040676 | 3300046455 | Bacteria | 2782 |
| 431 | Ga0495603_0135198 | 3300046455 | Bacteria | 1435 |
| 432 | Ga0495629_0001919 | 3300046459 | Bacteria | 16205 |
| 433 | Ga0495629_0014235 | 3300046459 | Bacteria | 5728 |
| 434 | Ga0495641_0085193 | 3300046461 | Bacteria | 1415 |
| 435 | Ga0495651_0000665 | 3300046462 | Bacteria | 26668 |
| 436 | Ga0495651_0004271 | 3300046462 | Bacteria | 10960 |
| 437 | Ga0495651_0110843 | 3300046462 | Bacteria | 2029 |
| 438 | Ga0495651_0325967 | 3300046462 | Bacteria | 1022 |
| 439 | Ga0495653_0010781 | 3300046463 | Bacteria | 7484 |
| 440 | Ga0495653_0027763 | 3300046463 | Bacteria | 4530 |
| 441 | Ga0495653_0034150 | 3300046463 | Bacteria | 4026 |
| 442 | Ga0495580_0175091 | 3300046472 | Bacteria | 1482 |
| 443 | Ga0495582_0083357 | 3300046473 | Bacteria | 1777 |
| 444 | Ga0495582_0142923 | 3300046473 | Bacteria | 1357 |
| 445 | Ga0495605_0020240 | 3300046474 | Bacteria | 3538 |
| 446 | Ga0495662_0014270 | 3300046476 | Bacteria | 3864 |
| 447 | Ga0495662_0239766 | 3300046476 | Bacteria | 893 |
| 448 | Ga0495664_0048940 | 3300046477 | Bacteria | 2509 |
| 449 | Ga0495664_0096395 | 3300046477 | Bacteria | 1780 |
| 450 | Ga0495594_0000151 | 3300046499 | Bacteria | 33013 |
| 451 | Ga0495594_0026491 | 3300046499 | Bacteria | 3119 |
| 452 | Ga0495594_0045499 | 3300046499 | Bacteria | 2409 |
| 453 | Ga0495596_0105106 | 3300046500 | Bacteria | 1097 |
| 454 | Ga0495607_0020151 | 3300046501 | Bacteria | 4220 |
| 455 | Ga0495583_0095183 | 3300046506 | Bacteria | 1277 |
| 456 | Ga0495608_0003307 | 3300046511 | Bacteria | 11525 |
| 457 | Ga0495618_0023162 | 3300046514 | Bacteria | 3838 |
| 458 | Ga0495618_0034383 | 3300046514 | Bacteria | 3178 |
| 459 | Ga0495618_0175329 | 3300046514 | Bacteria | 1363 |
| 460 | Ga0495628_0007504 | 3300046516 | Bacteria | 9434 |
| 461 | Ga0495628_0031131 | 3300046516 | Bacteria | 4316 |
| 462 | Ga0495630_0106817 | 3300046517 | Bacteria | 2120 |
| 463 | Ga0495631_0005294 | 3300046518 | Bacteria | 6775 |
| 464 | Ga0495643_0011246 | 3300046522 | Bacteria | 5463 |
| 465 | Ga0495644_0154161 | 3300046523 | Bacteria | 880 |
| 466 | Ga0495648_0084536 | 3300046524 | Bacteria | 1795 |
| 467 | Ga0495666_0078869 | 3300046526 | Bacteria | 1559 |
| 468 | Ga0495652_0002616 | 3300046529 | Bacteria | 18397 |
| 469 | Ga0495652_0039977 | 3300046529 | Bacteria | 4054 |
| 470 | Ga0495652_0059454 | 3300046529 | Bacteria | 3233 |
| 471 | Ga0495652_0140665 | 3300046529 | Bacteria | 1898 |
| 472 | Ga0495654_0012180 | 3300046530 | Bacteria | 4627 |
| 473 | Ga0495665_0122317 | 3300046531 | Bacteria | 1363 |
| 474 | Ga0495665_0224535 | 3300046531 | Bacteria | 971 |
| 475 | Ga0495640_0007645 | 3300046533 | Bacteria | 8499 |
| 476 | Ga0495640_0034425 | 3300046533 | Bacteria | 3591 |
| 477 | Ga0495640_0074680 | 3300046533 | Bacteria | 2266 |
| 478 | Ga0495640_0101787 | 3300046533 | Bacteria | 1885 |
| 479 | Ga0495587_0009180 | 3300046536 | Bacteria | 6346 |
| 480 | Ga0495587_0010134 | 3300046536 | Bacteria | 6012 |
| 481 | Ga0495609_0010839 | 3300046538 | Bacteria | 4356 |
| 482 | Ga0495645_0025816 | 3300046543 | Bacteria | 4265 |
| 483 | Ga0495645_0100392 | 3300046543 | Bacteria | 2058 |
| 484 | Ga0495622_0007706 | 3300046557 | Bacteria | 5001 |
| 485 | Ga0495622_0065762 | 3300046557 | Bacteria | 1676 |
| 486 | Ga0495633_0153934 | 3300046558 | Bacteria | 1061 |
| 487 | Ga0495667_0005202 | 3300046559 | Bacteria | 8794 |
| 488 | Ga0495667_0026915 | 3300046559 | Bacteria | 3876 |
| 489 | Ga0495667_0032299 | 3300046559 | Bacteria | 3509 |
| 490 | Ga0495634_0018599 | 3300046642 | Bacteria | 4943 |
| 491 | Ga0495634_0050352 | 3300046642 | Bacteria | 2798 |
| 492 | Ga0495634_0083921 | 3300046642 | Bacteria | 2078 |
| 493 | Ga0495611_0017431 | 3300046648 | Bacteria | 3072 |
| 494 | Ga0495625_0084278 | 3300046660 | Bacteria | 2207 |
| 495 | Ga0495635_0016781 | 3300046663 | Bacteria | 5115 |
| 496 | Ga0495635_0035773 | 3300046663 | Bacteria | 3443 |
| 497 | Ga0495635_0105725 | 3300046663 | Bacteria | 1923 |
| 498 | Ga0495635_0117563 | 3300046663 | Bacteria | 1814 |
| 499 | Ga0495661_0016076 | 3300046665 | Bacteria | 4972 |
| 500 | Ga0495588_0001826 | 3300046674 | Bacteria | 9071 |
| 501 | Ga0495657_0004268 | 3300046675 | Bacteria | 11429 |
| 502 | Ga0495657_0028878 | 3300046675 | Bacteria | 3894 |
| 503 | Ga0495657_0038044 | 3300046675 | Bacteria | 3312 |
| 504 | Ga0495657_0042687 | 3300046675 | Bacteria | 3094 |
| 505 | Ga0495657_0069912 | 3300046675 | Bacteria | 2295 |
| 506 | Ga0495599_0024734 | 3300046678 | Bacteria | 3755 |
| 507 | Ga0495599_0045954 | 3300046678 | Bacteria | 2738 |
| 508 | Ga0495623_0043076 | 3300046679 | Bacteria | 2873 |
| 509 | Ga0495646_0016368 | 3300046680 | Bacteria | 4705 |
| 510 | Ga0495658_0080241 | 3300046683 | Bacteria | 1913 |
| 511 | Ga0495658_0128370 | 3300046683 | Bacteria | 1541 |
| 512 | Ga0495613_0016791 | 3300046689 | Bacteria | 5451 |
| 513 | Ga0495613_0098618 | 3300046689 | Bacteria | 2111 |
| 514 | Ga0495613_0224238 | 3300046689 | Bacteria | 1318 |
| 515 | Ga0495624_0231633 | 3300046690 | Bacteria | 1119 |
| 516 | Ga0495589_0009062 | 3300046794 | Bacteria | 5173 |
| 517 | Ga0495600_0026877 | 3300046809 | Bacteria | 3717 |
| 518 | Ga0495600_0038154 | 3300046809 | Bacteria | 3125 |
| 519 | Ga0495600_0069318 | 3300046809 | Bacteria | 2305 |
| 520 | Ga0495600_0221531 | 3300046809 | Bacteria | 1210 |
| 521 | Ga0495660_0087679 | 3300046810 | Bacteria | 1622 |
| 522 | Ga0495581_0024327 | 3300047315 | Bacteria | 3510 |
| 523 | Ga0495581_0164520 | 3300047315 | Bacteria | 1297 |
| 524 | Ga0495604_0003408 | 3300047317 | Bacteria | 12673 |
| 525 | Ga0495604_0018943 | 3300047317 | Bacteria | 5513 |
| 526 | Ga0495604_0033209 | 3300047317 | Bacteria | 4085 |
| 527 | Ga0495604_0048254 | 3300047317 | Bacteria | 3312 |
| 528 | Ga0495604_0165878 | 3300047317 | Bacteria | 1557 |
| 529 | Ga0495636_0002978 | 3300047318 | Bacteria | 6550 |
| 530 | Ga0495674_0013538 | 3300047319 | Bacteria | 7666 |
| 531 | Ga0495674_0066113 | 3300047319 | Bacteria | 3138 |
| 532 | Ga0495676_0003601 | 3300047321 | Bacteria | 14057 |
| 533 | Ga0495676_0016464 | 3300047321 | Bacteria | 6561 |
| 534 | Ga0495676_0065560 | 3300047321 | Bacteria | 2818 |
| 535 | Ga0495680_0016142 | 3300047322 | Bacteria | 6421 |
| 536 | Ga0495680_0043165 | 3300047322 | Bacteria | 3572 |
| 537 | Ga0495680_0049559 | 3300047322 | Bacteria | 3289 |
| 538 | Ga0495680_0122562 | 3300047322 | Bacteria | 1918 |
| 539 | Ga0495675_0006523 | 3300047444 | Bacteria | 7141 |
| 540 | Ga0495675_0165320 | 3300047444 | Bacteria | 1361 |
| 541 | Ga0495684_0006300 | 3300047471 | Bacteria | 9222 |
| 542 | Ga0495684_0053522 | 3300047471 | Bacteria | 3080 |
| 543 | Ga0495686_0119277 | 3300047472 | Bacteria | 1574 |
| 544 | Ga0495593_0030748 | 3300047673 | Bacteria | 2936 |
| 545 | Ga0495593_0098860 | 3300047673 | Bacteria | 1498 |
| 546 | Ga0495602_0004314 | 3300048088 | Bacteria | 14810 |
| 547 | Ga0495602_0105049 | 3300048088 | Bacteria | 2309 |
| 548 | Ga0495614_0024349 | 3300048089 | Bacteria | 2613 |
| 549 | Ga0495614_0039839 | 3300048089 | Bacteria | 2017 |
| 550 | Ga0495626_0139000 | 3300048091 | Bacteria | 1031 |
| 551 | Ga0496100_0013299 | 3300048903 | Bacteria | 4742 |
| 552 | Ga0496100_0311592 | 3300048903 | Bacteria | 1180 |
| 553 | Ga0496101_0203800 | 3300048904 | Bacteria | 1530 |
| 554 | Ga0496102_0004007 | 3300048905 | Bacteria | 12473 |
| 555 | Ga0496102_0004193 | 3300048905 | Bacteria | 12194 |
| 556 | Ga0496102_0007250 | 3300048905 | Bacteria | 9463 |
| 557 | Ga0496102_0012702 | 3300048905 | Bacteria | 7295 |
| 558 | Ga0496102_0148972 | 3300048905 | Bacteria | 2198 |
| 559 | Ga0496103_0008868 | 3300048906 | Bacteria | 5965 |
| 560 | Ga0496103_0046744 | 3300048906 | Bacteria | 2673 |
| 561 | Ga0496103_0071169 | 3300048906 | Bacteria | 2176 |
| 562 | Ga0496103_0112927 | 3300048906 | Bacteria | 1727 |
| 563 | Ga0496104_0031546 | 3300048907 | Bacteria | 4928 |
| 564 | Ga0496104_0189401 | 3300048907 | Bacteria | 1968 |
| 565 | Ga0496104_0237372 | 3300048907 | Bacteria | 1735 |
| 566 | Ga0496105_0002880 | 3300048908 | Bacteria | 12606 |
| 567 | Ga0496105_0020655 | 3300048908 | Bacteria | 5323 |
| 568 | Ga0496105_0052519 | 3300048908 | Bacteria | 3366 |
| 569 | Ga0496105_0117940 | 3300048908 | Bacteria | 2189 |
| 570 | Ga0496105_0299843 | 3300048908 | Bacteria | 1292 |
| 571 | Ga0496106_0005157 | 3300048909 | Bacteria | 9680 |
| 572 | Ga0496106_0066893 | 3300048909 | Bacteria | 2738 |
| 573 | Ga0496106_0170526 | 3300048909 | Bacteria | 1725 |
| 574 | Ga0496107_0047983 | 3300048910 | Bacteria | 3075 |
| 575 | Ga0496107_0052965 | 3300048910 | Bacteria | 2927 |
| 576 | Ga0496107_0187439 | 3300048910 | Bacteria | 1537 |
| 577 | Ga0496108_0013702 | 3300048911 | Bacteria | 6617 |
| 578 | Ga0496108_0086002 | 3300048911 | Bacteria | 2669 |
| 579 | Ga0496108_0087578 | 3300048911 | Bacteria | 2645 |
| 580 | Ga0496108_0094294 | 3300048911 | Bacteria | 2548 |
| 581 | Ga0496108_0101916 | 3300048911 | Bacteria | 2449 |
| 582 | Ga0496108_0118414 | 3300048911 | Bacteria | 2270 |
| 583 | Ga0496108_0144225 | 3300048911 | Bacteria | 2052 |
| 584 | Ga0496108_0214374 | 3300048911 | Bacteria | 1672 |
| 585 | Ga0496108_0306050 | 3300048911 | Bacteria | 1385 |
| 586 | Ga0496108_0405611 | 3300048911 | Bacteria | 1190 |
| 587 | Ga0496109_0019679 | 3300048912 | Bacteria | 5955 |
| 588 | Ga0496109_0039334 | 3300048912 | Bacteria | 4280 |
| 589 | Ga0496109_0054935 | 3300048912 | Bacteria | 3632 |
| 590 | Ga0496109_0074084 | 3300048912 | Bacteria | 3129 |
| 591 | Ga0496109_0106880 | 3300048912 | Bacteria | 2599 |
| 592 | Ga0496109_0161633 | 3300048912 | Bacteria | 2098 |
| 593 | Ga0496109_0563039 | 3300048912 | Bacteria | 1075 |
| 594 | Ga0496110_0012282 | 3300048913 | Bacteria | 7039 |
| 595 | Ga0496110_0052746 | 3300048913 | Bacteria | 3574 |
| 596 | Ga0496110_0053852 | 3300048913 | Bacteria | 3538 |
| 597 | Ga0496110_0077541 | 3300048913 | Bacteria | 2956 |
| 598 | Ga0496110_0147815 | 3300048913 | Bacteria | 2126 |
| 599 | Ga0496110_0207149 | 3300048913 | Bacteria | 1782 |
| 600 | Ga0496111_0002891 | 3300048914 | Bacteria | 10485 |
| 601 | Ga0496111_0023441 | 3300048914 | Bacteria | 4333 |
| 602 | Ga0496111_0124503 | 3300048914 | Bacteria | 1905 |
| 603 | Ga0496112_0183193 | 3300048915 | Bacteria | 2058 |
| 604 | Ga0496112_0305872 | 3300048915 | Bacteria | 1535 |
| 605 | Ga0496112_0805776 | 3300048915 | Bacteria | 864 |
| 606 | Ga0496113_0108967 | 3300048916 | Bacteria | 2153 |
| 607 | Ga0496113_0159140 | 3300048916 | Bacteria | 1785 |
| 608 | Ga0496113_0258008 | 3300048916 | Bacteria | 1392 |
| 609 | Ga0496113_0301320 | 3300048916 | Bacteria | 1283 |
| 610 | Ga0496114_0006892 | 3300048917 | Bacteria | 8950 |
| 611 | Ga0496114_0021605 | 3300048917 | Bacteria | 5237 |
| 612 | Ga0496114_0074885 | 3300048917 | Bacteria | 2850 |
| 613 | Ga0496114_0093372 | 3300048917 | Bacteria | 2558 |
| 614 | Ga0496114_0101271 | 3300048917 | Bacteria | 2459 |
| 615 | Ga0496114_0243599 | 3300048917 | Bacteria | 1581 |
| 616 | Ga0496114_0327725 | 3300048917 | Bacteria | 1353 |
| 617 | Ga0496117_0023817 | 3300048920 | Bacteria | 4862 |
| 618 | Ga0496118_0052720 | 3300048921 | Bacteria | 3099 |
| 619 | Ga0496119_0082293 | 3300048922 | Bacteria | 1852 |
| 620 | Ga0496119_0161674 | 3300048922 | Bacteria | 1190 |
| 621 | Ga0496120_0061349 | 3300048923 | Bacteria | 2099 |
| 622 | Ga0496122_0001262 | 3300048925 | Bacteria | 42353 |
| 623 | Ga0496122_0017612 | 3300048925 | Bacteria | 6664 |
| 624 | Ga0496123_0000275 | 3300048926 | Bacteria | 101770 |
| 625 | Ga0496124_0000370 | 3300048927 | Bacteria | 82276 |
| 626 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 627 | Ga0496125_0013536 | 3300048928 | Bacteria | 8015 |
| 628 | Ga0496126_0029561 | 3300048929 | Bacteria | 5204 |
| 629 | Ga0495678_052125 | 3300049459 | Bacteria | 1577 |
| 630 | Ga0501031_0003380 | 3300049568 | Bacteria | 10250 |
| 631 | Ga0501031_0003896 | 3300049568 | Bacteria | 9602 |
| 632 | Ga0501031_0006724 | 3300049568 | Bacteria | 7501 |
| 633 | Ga0501032_0003838 | 3300049569 | Bacteria | 11414 |
| 634 | Ga0501032_0004262 | 3300049569 | Bacteria | 10804 |
| 635 | Ga0501032_0005448 | 3300049569 | Bacteria | 9447 |
| 636 | Ga0501032_0015172 | 3300049569 | Bacteria | 5440 |
| 637 | Ga0501032_0029578 | 3300049569 | Bacteria | 3758 |
| 638 | Ga0501032_0055463 | 3300049569 | Bacteria | 2666 |
| 639 | Ga0501032_0328983 | 3300049569 | Bacteria | 986 |
| 640 | Ga0501033_0001923 | 3300049570 | Bacteria | 18084 |
| 641 | Ga0501033_0024436 | 3300049570 | Bacteria | 4558 |
| 642 | Ga0501033_0035843 | 3300049570 | Bacteria | 3718 |
| 643 | Ga0501033_0060798 | 3300049570 | Bacteria | 2785 |
| 644 | Ga0501033_0081286 | 3300049570 | Bacteria | 2376 |
| 645 | Ga0501033_0114811 | 3300049570 | Bacteria | 1957 |
| 646 | Ga0501033_0116256 | 3300049570 | Bacteria | 1943 |
| 647 | Ga0501033_0175770 | 3300049570 | Bacteria | 1536 |
| 648 | Ga0501034_0007616 | 3300049571 | Bacteria | 11519 |
| 649 | Ga0501034_0008253 | 3300049571 | Bacteria | 11024 |
| 650 | Ga0501034_0039460 | 3300049571 | Bacteria | 4782 |
| 651 | Ga0501034_0056934 | 3300049571 | Bacteria | 3932 |
| 652 | Ga0501034_0067557 | 3300049571 | Bacteria | 3587 |
| 653 | Ga0501034_0112269 | 3300049571 | Bacteria | 2716 |
| 654 | Ga0501034_0136754 | 3300049571 | Bacteria | 2431 |
| 655 | Ga0501034_0288559 | 3300049571 | Bacteria | 1579 |
| 656 | Ga0501034_0433739 | 3300049571 | Bacteria | 1233 |
| 657 | Ga0501036_0001242 | 3300049572 | Bacteria | 19500 |
| 658 | Ga0501036_0003045 | 3300049572 | Bacteria | 13352 |
| 659 | Ga0501036_0011239 | 3300049572 | Bacteria | 7407 |
| 660 | Ga0501036_0022958 | 3300049572 | Bacteria | 5252 |
| 661 | Ga0501036_0030091 | 3300049572 | Bacteria | 4587 |
| 662 | Ga0501036_0030350 | 3300049572 | Bacteria | 4567 |
| 663 | Ga0501036_0042857 | 3300049572 | Bacteria | 3831 |
| 664 | Ga0501036_0066735 | 3300049572 | Bacteria | 3044 |
| 665 | Ga0501036_0154174 | 3300049572 | Bacteria | 1938 |
| 666 | Ga0501036_0216557 | 3300049572 | Bacteria | 1608 |
| 667 | Ga0501037_0001359 | 3300049573 | Bacteria | 17961 |
| 668 | Ga0501037_0003844 | 3300049573 | Bacteria | 10900 |
| 669 | Ga0501037_0006882 | 3300049573 | Bacteria | 8305 |
| 670 | Ga0501037_0097069 | 3300049573 | Bacteria | 2129 |
| 671 | Ga0501037_0210466 | 3300049573 | Bacteria | 1371 |
| 672 | Ga0501038_0002845 | 3300049574 | Bacteria | 16106 |
| 673 | Ga0501038_0006481 | 3300049574 | Bacteria | 10833 |
| 674 | Ga0501038_0007991 | 3300049574 | Bacteria | 9747 |
| 675 | Ga0501038_0009638 | 3300049574 | Bacteria | 8859 |
| 676 | Ga0501038_0012665 | 3300049574 | Bacteria | 7708 |
| 677 | Ga0501038_0025481 | 3300049574 | Bacteria | 5271 |
| 678 | Ga0501038_0040765 | 3300049574 | Bacteria | 4051 |
| 679 | Ga0501038_0131945 | 3300049574 | Bacteria | 2050 |
| 680 | Ga0501038_0142042 | 3300049574 | Bacteria | 1963 |
| 681 | Ga0501039_0004050 | 3300049575 | Bacteria | 11011 |
| 682 | Ga0501039_0005435 | 3300049575 | Bacteria | 9635 |
| 683 | Ga0501039_0022756 | 3300049575 | Bacteria | 4808 |
| 684 | Ga0501039_0028773 | 3300049575 | Bacteria | 4279 |
| 685 | Ga0501039_0043383 | 3300049575 | Bacteria | 3474 |
| 686 | Ga0501039_0045344 | 3300049575 | Bacteria | 3397 |
| 687 | Ga0501039_0095609 | 3300049575 | Bacteria | 2316 |
| 688 | Ga0501040_0000479 | 3300049576 | Bacteria | 23837 |
| 689 | Ga0501040_0020387 | 3300049576 | Bacteria | 4417 |
| 690 | Ga0501040_0052052 | 3300049576 | Bacteria | 2802 |
| 691 | Ga0501040_0231154 | 3300049576 | Bacteria | 1317 |
| 692 | Ga0501040_0281896 | 3300049576 | Bacteria | 1187 |
| 693 | Ga0501041_0003948 | 3300049577 | Bacteria | 8556 |
| 694 | Ga0501041_0008756 | 3300049577 | Bacteria | 5954 |
| 695 | Ga0501041_0066301 | 3300049577 | Bacteria | 2212 |
| 696 | Ga0501042_0000633 | 3300049578 | Bacteria | 18819 |
| 697 | Ga0501042_0042602 | 3300049578 | Bacteria | 3232 |
| 698 | Ga0501042_0054157 | 3300049578 | Bacteria | 2861 |
| 699 | Ga0501042_0067361 | 3300049578 | Bacteria | 2559 |
| 700 | Ga0501042_0289649 | 3300049578 | Bacteria | 1183 |
| 701 | Ga0501042_0497511 | 3300049578 | Bacteria | 885 |
| 702 | Ga0501043_0002310 | 3300049579 | Bacteria | 16147 |
| 703 | Ga0501043_0004077 | 3300049579 | Bacteria | 11930 |
| 704 | Ga0501043_0008709 | 3300049579 | Bacteria | 7983 |
| 705 | Ga0501043_0011863 | 3300049579 | Bacteria | 6825 |
| 706 | Ga0501043_0046991 | 3300049579 | Bacteria | 3393 |
| 707 | Ga0501043_0061754 | 3300049579 | Bacteria | 2942 |
| 708 | Ga0501043_0083188 | 3300049579 | Bacteria | 2516 |
| 709 | Ga0501043_0103729 | 3300049579 | Bacteria | 2234 |
| 710 | Ga0501046_0004091 | 3300049580 | Bacteria | 13295 |
| 711 | Ga0501046_0005075 | 3300049580 | Bacteria | 11805 |
| 712 | Ga0501046_0008983 | 3300049580 | Bacteria | 8675 |
| 713 | Ga0501046_0023382 | 3300049580 | Bacteria | 5085 |
| 714 | Ga0501046_0038015 | 3300049580 | Bacteria | 3865 |
| 715 | Ga0501046_0055028 | 3300049580 | Bacteria | 3128 |
| 716 | Ga0501046_0064304 | 3300049580 | Bacteria | 2864 |
| 717 | Ga0501046_0134549 | 3300049580 | Bacteria | 1873 |
| 718 | Ga0501047_0000064 | 3300049581 | Bacteria | 136110 |
| 719 | Ga0501047_0003182 | 3300049581 | Bacteria | 15562 |
| 720 | Ga0501047_0009853 | 3300049581 | Bacteria | 9029 |
| 721 | Ga0501047_0018066 | 3300049581 | Bacteria | 6758 |
| 722 | Ga0501047_0057957 | 3300049581 | Bacteria | 3743 |
| 723 | Ga0501047_0066672 | 3300049581 | Bacteria | 3470 |
| 724 | Ga0501047_0071537 | 3300049581 | Bacteria | 3338 |
| 725 | Ga0501047_0074193 | 3300049581 | Bacteria | 3275 |
| 726 | Ga0501047_0087557 | 3300049581 | Bacteria | 2992 |
| 727 | Ga0501047_0099048 | 3300049581 | Bacteria | 2793 |
| 728 | Ga0501047_0102429 | 3300049581 | Bacteria | 2742 |
| 729 | Ga0501048_0001906 | 3300049582 | Bacteria | 15830 |
| 730 | Ga0501048_0002851 | 3300049582 | Bacteria | 13195 |
| 731 | Ga0501048_0002999 | 3300049582 | Bacteria | 12890 |
| 732 | Ga0501048_0008708 | 3300049582 | Bacteria | 7649 |
| 733 | Ga0501048_0103991 | 3300049582 | Bacteria | 2004 |
| 734 | Ga0501048_0192033 | 3300049582 | Bacteria | 1447 |
| 735 | Ga0501067_0005438 | 3300049583 | Bacteria | 7072 |
| 736 | Ga0501067_0049980 | 3300049583 | Bacteria | 2317 |
| 737 | Ga0501067_0050394 | 3300049583 | Bacteria | 2307 |
| 738 | Ga0501068_0004581 | 3300049584 | Bacteria | 7518 |
| 739 | Ga0501068_0007312 | 3300049584 | Bacteria | 6117 |
| 740 | Ga0501068_0042383 | 3300049584 | Bacteria | 2737 |
| 741 | Ga0501069_0037122 | 3300049585 | Bacteria | 2688 |
| 742 | Ga0501069_0060520 | 3300049585 | Bacteria | 2114 |
| 743 | Ga0501069_0131739 | 3300049585 | Bacteria | 1432 |
| 744 | Ga0501069_0166426 | 3300049585 | Bacteria | 1271 |
| 745 | Ga0501069_0195202 | 3300049585 | Bacteria | 1172 |
| 746 | Ga0501069_0246116 | 3300049585 | Bacteria | 1043 |
| 747 | Ga0501069_0285394 | 3300049585 | Bacteria | 966 |
| 748 | Ga0501070_0000534 | 3300049586 | Bacteria | 34857 |
| 749 | Ga0501070_0000826 | 3300049586 | Bacteria | 28120 |
| 750 | Ga0501070_0009724 | 3300049586 | Bacteria | 8131 |
| 751 | Ga0501070_0016316 | 3300049586 | Bacteria | 6237 |
| 752 | Ga0501070_0026776 | 3300049586 | Bacteria | 4836 |
| 753 | Ga0501070_0033719 | 3300049586 | Bacteria | 4284 |
| 754 | Ga0501070_0061826 | 3300049586 | Bacteria | 3102 |
| 755 | Ga0501070_0099778 | 3300049586 | Bacteria | 2402 |
| 756 | Ga0501070_0185282 | 3300049586 | Bacteria | 1712 |
| 757 | Ga0501070_0363699 | 3300049586 | Bacteria | 1173 |
| 758 | Ga0501070_0508838 | 3300049586 | Bacteria | 967 |
| 759 | Ga0501071_0006094 | 3300049587 | Bacteria | 7817 |
| 760 | Ga0501071_0008338 | 3300049587 | Bacteria | 6845 |
| 761 | Ga0501071_0009425 | 3300049587 | Bacteria | 6500 |
| 762 | Ga0501071_0043939 | 3300049587 | Bacteria | 3205 |
| 763 | Ga0501072_0001203 | 3300049588 | Bacteria | 19305 |
| 764 | Ga0501072_0013712 | 3300049588 | Bacteria | 6205 |
| 765 | Ga0501072_0167916 | 3300049588 | Bacteria | 1751 |
| 766 | Ga0501072_0174638 | 3300049588 | Bacteria | 1714 |
| 767 | Ga0501073_0014546 | 3300049589 | Bacteria | 5716 |
| 768 | Ga0501073_0050176 | 3300049589 | Bacteria | 2925 |
| 769 | Ga0501073_0051663 | 3300049589 | Bacteria | 2879 |
| 770 | Ga0501073_0098988 | 3300049589 | Bacteria | 2025 |
| 771 | Ga0501074_0008519 | 3300049590 | Bacteria | 7429 |
| 772 | Ga0501074_0012926 | 3300049590 | Bacteria | 6069 |
| 773 | Ga0501074_0013961 | 3300049590 | Bacteria | 5837 |
| 774 | Ga0501074_0018526 | 3300049590 | Bacteria | 5058 |
| 775 | Ga0501074_0024371 | 3300049590 | Bacteria | 4397 |
| 776 | Ga0501074_0033786 | 3300049590 | Bacteria | 3708 |
| 777 | Ga0501074_0073462 | 3300049590 | Bacteria | 2456 |
| 778 | Ga0501075_0023383 | 3300049591 | Bacteria | 4525 |
| 779 | Ga0501075_0025175 | 3300049591 | Bacteria | 4372 |
| 780 | Ga0501075_0069104 | 3300049591 | Bacteria | 2669 |
| 781 | Ga0501075_0232114 | 3300049591 | Bacteria | 1407 |
| 782 | Ga0501076_0049581 | 3300049592 | Bacteria | 3321 |
| 783 | Ga0501076_0055261 | 3300049592 | Bacteria | 3149 |
| 784 | Ga0501076_0100255 | 3300049592 | Bacteria | 2333 |
| 785 | Ga0501076_0208177 | 3300049592 | Bacteria | 1598 |
| 786 | Ga0501076_0279083 | 3300049592 | Bacteria | 1369 |
| 787 | Ga0501076_0552749 | 3300049592 | Bacteria | 949 |
| 788 | Ga0501077_0007834 | 3300049593 | Bacteria | 6595 |
| 789 | Ga0501077_0008911 | 3300049593 | Bacteria | 6225 |
| 790 | Ga0501077_0009157 | 3300049593 | Bacteria | 6149 |
| 791 | Ga0501077_0054018 | 3300049593 | Bacteria | 2551 |
| 792 | Ga0501079_0020596 | 3300049741 | Bacteria | 5042 |
| 793 | Ga0501079_0106969 | 3300049741 | Bacteria | 2171 |
| 794 | Ga0501080_0005549 | 3300049742 | Bacteria | 11264 |
| 795 | Ga0501080_0007553 | 3300049742 | Bacteria | 9826 |
| 796 | Ga0501080_0010859 | 3300049742 | Bacteria | 8334 |
| 797 | Ga0501080_0026351 | 3300049742 | Bacteria | 5402 |
| 798 | Ga0501080_0037218 | 3300049742 | Bacteria | 4543 |
| 799 | Ga0501080_0062281 | 3300049742 | Bacteria | 3472 |
| 800 | Ga0501081_0012217 | 3300049743 | Bacteria | 5633 |
| 801 | Ga0501083_0002149 | 3300049744 | Bacteria | 13523 |
| 802 | Ga0501083_0009218 | 3300049744 | Bacteria | 6970 |
| 803 | Ga0501083_0019194 | 3300049744 | Bacteria | 4761 |
| 804 | Ga0501083_0169784 | 3300049744 | Bacteria | 1426 |
| 805 | Ga0501083_0201075 | 3300049744 | Bacteria | 1299 |
| 806 | Ga0501035_0003389 | 3300049822 | Bacteria | 15250 |
| 807 | Ga0501035_0010126 | 3300049822 | Bacteria | 8750 |
| 808 | Ga0501035_0018747 | 3300049822 | Bacteria | 6373 |
| 809 | Ga0501035_0027087 | 3300049822 | Bacteria | 5240 |
| 810 | Ga0501035_0033245 | 3300049822 | Bacteria | 4690 |
| 811 | Ga0501035_0047426 | 3300049822 | Bacteria | 3856 |
| 812 | Ga0501035_0051020 | 3300049822 | Bacteria | 3705 |
| 813 | Ga0501035_0053049 | 3300049822 | Bacteria | 3627 |
| 814 | Ga0501035_0065325 | 3300049822 | Bacteria | 3232 |
| 815 | Ga0501035_0134255 | 3300049822 | Bacteria | 2155 |
| 816 | Ga0501035_0175513 | 3300049822 | Bacteria | 1849 |
| 817 | Ga0501035_0183065 | 3300049822 | Bacteria | 1804 |
| 818 | Ga0501035_0225653 | 3300049822 | Bacteria | 1598 |
| 819 | Ga0501035_0241605 | 3300049822 | Bacteria | 1536 |
| 820 | Ga0501044_0005544 | 3300049823 | Bacteria | 14011 |
| 821 | Ga0501044_0005672 | 3300049823 | Bacteria | 13838 |
| 822 | Ga0501044_0009395 | 3300049823 | Bacteria | 10653 |
| 823 | Ga0501044_0025281 | 3300049823 | Bacteria | 6293 |
| 824 | Ga0501044_0059992 | 3300049823 | Bacteria | 3896 |
| 825 | Ga0501044_0067638 | 3300049823 | Bacteria | 3639 |
| 826 | Ga0501044_0068172 | 3300049823 | Bacteria | 3624 |
| 827 | Ga0501044_0070980 | 3300049823 | Bacteria | 3542 |
| 828 | Ga0501044_0078254 | 3300049823 | Bacteria | 3351 |
| 829 | Ga0501044_0105849 | 3300049823 | Bacteria | 2825 |
| 830 | Ga0501044_0342378 | 3300049823 | Bacteria | 1416 |
| 831 | Ga0501045_0007317 | 3300049824 | Bacteria | 7671 |
| 832 | Ga0501045_0048027 | 3300049824 | Bacteria | 3111 |
| 833 | Ga0501045_0056735 | 3300049824 | Bacteria | 2865 |
| 834 | Ga0501045_0098408 | 3300049824 | Bacteria | 2164 |
| 835 | Ga0501045_0377572 | 3300049824 | Bacteria | 1055 |
| 836 | nmdc:mga03n38_154977_c1 | 3300050490 | Bacteria | 1156 |
| 837 | nmdc:mga03n38_60085_c1 | 3300050490 | Bacteria | 1727 |
| 838 | nmdc:mga03n38_70869_c1 | 3300050490 | Bacteria | 1613 |
| 839 | nmdc:mga03n38_7198_c1 | 3300050490 | Bacteria | 3922 |
| 840 | nmdc:mga00v17_16960_c1 | 3300050491 | Bacteria | 4113 |
| 841 | nmdc:mga00v17_188560_c1 | 3300050491 | Bacteria | 1331 |
| 842 | nmdc:mga00v17_192624_c1 | 3300050491 | Bacteria | 1317 |
| 843 | nmdc:mga00v17_3271_c1 | 3300050491 | Bacteria | 8353 |
| 844 | nmdc:mga00v17_64148_c1 | 3300050491 | Bacteria | 2263 |
| 845 | nmdc:mga0yw44_12213_c1 | 3300050492 | Bacteria | 4468 |
| 846 | nmdc:mga0yw44_14753_c1 | 3300050492 | Bacteria | 4160 |
| 847 | nmdc:mga0yw44_152175_c1 | 3300050492 | Bacteria | 1510 |
| 848 | nmdc:mga0yw44_152605_c1 | 3300050492 | Bacteria | 1508 |
| 849 | nmdc:mga0yw44_155062_c1 | 3300050492 | Bacteria | 1496 |
| 850 | nmdc:mga0yw44_159895_c1 | 3300050492 | Bacteria | 1474 |
| 851 | nmdc:mga0yw44_175534_c1 | 3300050492 | Bacteria | 1408 |
| 852 | nmdc:mga0yw44_194933_c1 | 3300050492 | Bacteria | 1337 |
| 853 | nmdc:mga0yw44_36358_c1 | 3300050492 | Bacteria | 2901 |
| 854 | nmdc:mga0yw44_37079_c1 | 3300050492 | Bacteria | 2877 |
| 855 | nmdc:mga0yw44_996_c1 | 3300050492 | Bacteria | 10819 |
| 856 | nmdc:mga04h51_9121_c1 | 3300050495 | Bacteria | 2676 |
| 857 | nmdc:mga07m45_107309_c1 | 3300050496 | Bacteria | 1606 |
| 858 | nmdc:mga07m45_15000_c1 | 3300050496 | Bacteria | 4137 |
| 859 | nmdc:mga07m45_153156_c1 | 3300050496 | Bacteria | 1337 |
| 860 | nmdc:mga07m45_49574_c1 | 3300050496 | Bacteria | 2364 |
| 861 | nmdc:mga07m45_88606_c1 | 3300050496 | Bacteria | 1771 |
| 862 | nmdc:mga06r32_25_c5 | 3300050510 | Bacteria | 17189 |
| 863 | nmdc:mga0rr50_193199_c1 | 3300050513 | Bacteria | 1669 |
| 864 | Ga0495601_0021026 | 3300053077 | Bacteria | 3991 |
| 865 | Ga0495601_0241111 | 3300053077 | Bacteria | 1180 |
| 866 | Ga0495595_0057895 | 3300053084 | Bacteria | 1808 |
| 867 | Ga0495619_0030545 | 3300053085 | Bacteria | 3488 |
| 868 | Ga0495619_0100016 | 3300053085 | Bacteria | 1972 |
| 869 | Ga0495619_0188569 | 3300053085 | Bacteria | 1427 |
| 870 | Ga0500643_000240 | 3300053087 | Bacteria | 50980 |
| 871 | Ga0500641_0002437 | 3300053096 | Bacteria | 6592 |
| 872 | Ga0500556_0000182 | 3300053104 | Bacteria | 51372 |
| 873 | Ga0500593_000495 | 3300053117 | Bacteria | 15558 |
| 874 | Ga0500594_0007211 | 3300053118 | Bacteria | 2514 |
| 875 | Ga0500559_0010136 | 3300053136 | Bacteria | 4054 |
| 876 | Ga0500568_0018960 | 3300053139 | Bacteria | 3001 |
| 877 | Ga0500568_0064578 | 3300053139 | Bacteria | 1410 |
| 878 | Ga0500573_0005347 | 3300053140 | Bacteria | 6872 |
| 879 | Ga0501084_0022848 | 3300054114 | Bacteria | 5218 |
| 880 | Ga0501084_0045045 | 3300054114 | Bacteria | 3694 |
| 881 | Ga0501084_0251915 | 3300054114 | Bacteria | 1490 |
| 882 | Ga0501084_0633347 | 3300054114 | Bacteria | 903 |
| 883 | Ga0590074_014999 | 3300059423 | Bacteria | 1313 |
| 884 | Ga0501082_0015873 | 3300060353 | Bacteria | 6476 |
| 885 | Ga0501082_0019033 | 3300060353 | Bacteria | 5916 |
| 886 | Ga0501082_0096102 | 3300060353 | Bacteria | 2561 |
| 887 | Ga0501082_0254891 | 3300060353 | Bacteria | 1526 |
| 888 | Ga0466962_0003816 | 3300061719 | Bacteria | 7201 |
| 889 | Ga0466962_0010555 | 3300061719 | Bacteria | 4443 |
| 890 | Ga0466962_0032854 | 3300061719 | Bacteria | 2483 |
| 891 | Ga0466962_0034456 | 3300061719 | Bacteria | 2423 |
| 892 | Ga0466962_0051688 | 3300061719 | Bacteria | 1965 |
| 893 | Ga0466962_0123782 | 3300061719 | Bacteria | 1249 |
| 894 | Ga0466962_0170881 | 3300061719 | Bacteria | 1058 |
| 895 | Ga0530510_0004958 | 3300061734 | Bacteria | 9194 |
| 896 | Ga0530510_0011276 | 3300061734 | Bacteria | 6272 |
| 897 | Ga0530510_0076967 | 3300061734 | Bacteria | 2425 |
| 898 | Ga0530510_0087180 | 3300061734 | Bacteria | 2275 |
| 899 | Ga0530510_0337886 | 3300061734 | Bacteria | 1130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0243462 | Ga0466967_0243462_89_856 | 231 |
| 2 | 3300037471 | Ga0395905_0034806 | Ga0395905_0034806_2668_3549 | 232 |
| 3 | 3300005985 | Ga0081539_10010892 | Ga0081539_100108924 | 233 |
| 4 | 3300005985 | Ga0081539_10014055 | Ga0081539_100140552 | 233 |
| 5 | 3300038443 | Ga0395901_0164650 | Ga0395901_0164650_447_1328 | 234 |
| 6 | iso_pu_bacteria | 8055066027 | 8055073559 | 234 |
| 7 | 3300046683 | Ga0495658_0080241 | Ga0495658_0080241_789_1667 | 235 |
| 8 | iso_pu_bacteria | 2643221590 | 2643961627 | 235 |
| 9 | 3300005329 | Ga0070683_100350193 | Ga0070683_1003501932 | 236 |
| 10 | 3300005456 | Ga0070678_100165237 | Ga0070678_1001652372 | 236 |
| 11 | 3300005618 | Ga0068864_100119532 | Ga0068864_1001195322 | 236 |
| 12 | 3300005842 | Ga0068858_100540732 | Ga0068858_1005407322 | 236 |
| 13 | 3300006237 | Ga0097621_100243176 | Ga0097621_1002431762 | 236 |
| 14 | 3300006358 | Ga0068871_100557115 | Ga0068871_1005571152 | 236 |
| 15 | 3300009551 | Ga0105238_10040721 | Ga0105238_100407216 | 236 |
| 16 | 3300025911 | Ga0207654_10111480 | Ga0207654_101114803 | 236 |
| 17 | 3300025934 | Ga0207686_10212637 | Ga0207686_102126372 | 236 |
| 18 | 3300026078 | Ga0207702_10160619 | Ga0207702_101606192 | 236 |
| 19 | 3300026095 | Ga0207676_10127813 | Ga0207676_101278132 | 236 |
| 20 | 3300048912 | Ga0496109_0161633 | Ga0496109_0161633_748_1515 | 236 |
| 21 | iso_pu_bacteria | 2848551377 | 2848551961 | 236 |
| 22 | iso_pu_bacteria | 2867346516 | 2867349390 | 236 |
| 23 | iso_pu_bacteria | 3001889506 | 3001890696 | 236 |
| 24 | iso_pu_bacteria | 8033684223 | 8033691453 | 236 |
| 25 | 3300031548 | Ga0307408_100026929 | Ga0307408_1000269292 | 237 |
| 26 | 3300031824 | Ga0307413_10076057 | Ga0307413_100760572 | 237 |
| 27 | 3300031852 | Ga0307410_10183114 | Ga0307410_101831141 | 237 |
| 28 | 3300031901 | Ga0307406_10143334 | Ga0307406_101433342 | 237 |
| 29 | 3300032002 | Ga0307416_100113291 | Ga0307416_1001132913 | 237 |
| 30 | 3300032126 | Ga0307415_100081535 | Ga0307415_1000815352 | 237 |
| 31 | 3300048923 | Ga0496120_0061349 | Ga0496120_0061349_54_875 | 237 |
| 32 | 3300049571 | Ga0501034_0039460 | Ga0501034_0039460_942_1697 | 237 |
| 33 | 3300049571 | Ga0501034_0067557 | Ga0501034_0067557_1518_2273 | 237 |
| 34 | iso_pu_bacteria | 2643221961 | 2645720580 | 237 |
| 35 | iso_pu_bacteria | 2643221962 | 2645723595 | 237 |
| 36 | iso_pu_bacteria | 2767802112 | 2768646612 | 237 |
| 37 | iso_pu_bacteria | 2857481737 | 2857482722 | 237 |
| 38 | iso_pu_bacteria | 2883821847 | 2883825940 | 237 |
| 39 | 3300005337 | Ga0070682_100201841 | Ga0070682_1002018412 | 238 |
| 40 | 3300006051 | Ga0075364_10027189 | Ga0075364_100271893 | 238 |
| 41 | 3300041491 | Ga0451833_0752021 | Ga0451833_0752021_5394_6125 | 238 |
| 42 | 3300044901 | Ga0466960_0040839 | Ga0466960_0040839_47_856 | 238 |
| 43 | 3300046499 | Ga0495594_0045499 | Ga0495594_0045499_459_1271 | 238 |
| 44 | 3300046557 | Ga0495622_0065762 | Ga0495622_0065762_25_837 | 238 |
| 45 | 3300047321 | Ga0495676_0065560 | Ga0495676_0065560_134_1012 | 238 |
| 46 | 3300050491 | nmdc:mga00v17_188560_c1 | nmdc:mga00v17_188560_c1_92_832 | 238 |
| 47 | 3300050491 | nmdc:mga00v17_3271_c1 | nmdc:mga00v17_3271_c1_6016_6756 | 238 |
| 48 | 3300053096 | Ga0500641_0002437 | Ga0500641_0002437_1939_2667 | 238 |
| 49 | iso_pu_bacteria | 2643221679 | 2644445896 | 238 |
| 50 | iso_pu_bacteria | 2643221681 | 2644456158 | 238 |
| 51 | iso_pu_bacteria | 2818991318 | 2819426435 | 238 |
| 52 | iso_pu_bacteria | 2862290372 | 2862293900 | 238 |
| 53 | iso_pu_bacteria | 3006425503 | 3006430106 | 238 |
| 54 | 3300044694 | Ga0466963_0242770 | Ga0466963_0242770_107_835 | 239 |
| 55 | 3300044765 | Ga0466970_0090692 | Ga0466970_0090692_391_1119 | 239 |
| 56 | 3300045976 | Ga0466967_0214143 | Ga0466967_0214143_132_923 | 239 |
| 57 | 3300049569 | Ga0501032_0029578 | Ga0501032_0029578_1077_1898 | 239 |
| 58 | 3300049571 | Ga0501034_0136754 | Ga0501034_0136754_792_1613 | 239 |
| 59 | 3300049572 | Ga0501036_0030350 | Ga0501036_0030350_3047_3868 | 239 |
| 60 | 3300049574 | Ga0501038_0025481 | Ga0501038_0025481_1251_2072 | 239 |
| 61 | 3300049579 | Ga0501043_0061754 | Ga0501043_0061754_1292_2113 | 239 |
| 62 | 3300049580 | Ga0501046_0004091 | Ga0501046_0004091_2201_3022 | 239 |
| 63 | 3300049581 | Ga0501047_0009853 | Ga0501047_0009853_6014_6835 | 239 |
| 64 | 3300049582 | Ga0501048_0103991 | Ga0501048_0103991_876_1697 | 239 |
| 65 | 3300049583 | Ga0501067_0050394 | Ga0501067_0050394_1024_1845 | 239 |
| 66 | 3300049586 | Ga0501070_0363699 | Ga0501070_0363699_254_1075 | 239 |
| 67 | 3300049589 | Ga0501073_0050176 | Ga0501073_0050176_639_1460 | 239 |
| 68 | 3300049744 | Ga0501083_0019194 | Ga0501083_0019194_613_1434 | 239 |
| 69 | 3300049822 | Ga0501035_0047426 | Ga0501035_0047426_2526_3347 | 239 |
| 70 | 3300049823 | Ga0501044_0009395 | Ga0501044_0009395_854_1675 | 239 |
| 71 | 3300050496 | nmdc:mga07m45_153156_c1 | nmdc:mga07m45_153156_c1_255_1007 | 239 |
| 72 | 3300053118 | Ga0500594_0007211 | Ga0500594_0007211_1623_2447 | 239 |
| 73 | 3300061719 | Ga0466962_0051688 | Ga0466962_0051688_1152_1880 | 239 |
| 74 | iso_pu_bacteria | 2643221548 | 2643763778 | 239 |
| 75 | iso_pu_bacteria | 2643221613 | 2644082791 | 239 |
| 76 | iso_pu_bacteria | 2643221615 | 2644091639 | 239 |
| 77 | iso_pu_bacteria | 2643221657 | 2644321442 | 239 |
| 78 | iso_pu_bacteria | 2643221682 | 2644461786 | 239 |
| 79 | iso_pu_bacteria | 2643221711 | 2644607415 | 239 |
| 80 | iso_pu_bacteria | 2643221721 | 2644665746 | 239 |
| 81 | iso_pu_bacteria | 2811994882 | 2812373798 | 239 |
| 82 | iso_pu_bacteria | 2818991462 | 2819691341 | 239 |
| 83 | iso_pu_bacteria | 2818991469 | 2819729235 | 239 |
| 84 | iso_pu_bacteria | 2862705112 | 2862707004 | 239 |
| 85 | iso_pu_bacteria | 2884994152 | 2884994434 | 239 |
| 86 | iso_pu_bacteria | 2935890801 | 2935892547 | 239 |
| 87 | iso_pu_bacteria | 2990044586 | 2990048474 | 239 |
| 88 | iso_pu_bacteria | 2997451912 | 2997453299 | 239 |
| 89 | iso_pu_bacteria | 8008485437 | 8008491219 | 239 |
| 90 | iso_pu_bacteria | 8025478263 | 8025481595 | 239 |
| 91 | iso_pu_bacteria | 8025524527 | 8025530548 | 239 |
| 92 | iso_pu_bacteria | 8056447290 | 8056449849 | 239 |
| 93 | iso_pu_bacteria | 8056667051 | 8056668967 | 239 |
| 94 | 3300005456 | Ga0070678_100061042 | Ga0070678_1000610424 | 240 |
| 95 | 3300005466 | Ga0070685_10074406 | Ga0070685_100744062 | 240 |
| 96 | 3300005618 | Ga0068864_100407077 | Ga0068864_1004070772 | 240 |
| 97 | 3300005718 | Ga0068866_10226109 | Ga0068866_102261092 | 240 |
| 98 | 3300006038 | Ga0075365_10009383 | Ga0075365_100093832 | 240 |
| 99 | 3300006038 | Ga0075365_10010178 | Ga0075365_100101785 | 240 |
| 100 | 3300006038 | Ga0075365_10018920 | Ga0075365_100189205 | 240 |
| 101 | 3300006038 | Ga0075365_10057867 | Ga0075365_100578673 | 240 |
| 102 | 3300006038 | Ga0075365_10086891 | Ga0075365_100868914 | 240 |
| 103 | 3300006038 | Ga0075365_10128931 | Ga0075365_101289312 | 240 |
| 104 | 3300006038 | Ga0075365_10184371 | Ga0075365_101843712 | 240 |
| 105 | 3300006048 | Ga0075363_100037738 | Ga0075363_1000377383 | 240 |
| 106 | 3300006048 | Ga0075363_100216318 | Ga0075363_1002163182 | 240 |
| 107 | 3300006048 | Ga0075363_100240959 | Ga0075363_1002409591 | 240 |
| 108 | 3300006051 | Ga0075364_10031896 | Ga0075364_100318963 | 240 |
| 109 | 3300006051 | Ga0075364_10035531 | Ga0075364_100355313 | 240 |
| 110 | 3300006051 | Ga0075364_10081762 | Ga0075364_100817624 | 240 |
| 111 | 3300006178 | Ga0075367_10017570 | Ga0075367_100175703 | 240 |
| 112 | 3300006353 | Ga0075370_10008645 | Ga0075370_100086454 | 240 |
| 113 | 3300006353 | Ga0075370_10102880 | Ga0075370_101028802 | 240 |
| 114 | 3300009148 | Ga0105243_10331836 | Ga0105243_103318362 | 240 |
| 115 | 3300013308 | Ga0157375_10242375 | Ga0157375_102423752 | 240 |
| 116 | 3300014326 | Ga0157380_10071601 | Ga0157380_100716014 | 240 |
| 117 | 3300025901 | Ga0207688_10057596 | Ga0207688_100575964 | 240 |
| 118 | 3300025940 | Ga0207691_10144276 | Ga0207691_101442762 | 240 |
| 119 | 3300026095 | Ga0207676_10282510 | Ga0207676_102825102 | 240 |
| 120 | 3300027866 | Ga0209813_10005281 | Ga0209813_100052814 | 240 |
| 121 | 3300028379 | Ga0268266_10222265 | Ga0268266_102222651 | 240 |
| 122 | 3300028381 | Ga0268264_10000943 | Ga0268264_100009434 | 240 |
| 123 | 3300031852 | Ga0307410_10445094 | Ga0307410_104450942 | 240 |
| 124 | 3300031995 | Ga0307409_100148061 | Ga0307409_1001480613 | 240 |
| 125 | 3300031995 | Ga0307409_100346439 | Ga0307409_1003464392 | 240 |
| 126 | 3300032002 | Ga0307416_100603629 | Ga0307416_1006036292 | 240 |
| 127 | 3300032126 | Ga0307415_100239418 | Ga0307415_1002394183 | 240 |
| 128 | 3300038443 | Ga0395901_0583044 | Ga0395901_0583044_146_874 | 240 |
| 129 | 3300041407 | Ga0439447_032416 | Ga0439447_032416_28_798 | 240 |
| 130 | 3300042146 | Ga0450907_003560 | Ga0450907_003560_153_878 | 240 |
| 131 | 3300046500 | Ga0495596_0105106 | Ga0495596_0105106_259_1074 | 240 |
| 132 | 3300048913 | Ga0496110_0052746 | Ga0496110_0052746_1134_1874 | 240 |
| 133 | 3300048917 | Ga0496114_0074885 | Ga0496114_0074885_1412_2140 | 240 |
| 134 | 3300049568 | Ga0501031_0003896 | Ga0501031_0003896_4899_5717 | 240 |
| 135 | 3300049569 | Ga0501032_0003838 | Ga0501032_0003838_5595_6413 | 240 |
| 136 | 3300049569 | Ga0501032_0015172 | Ga0501032_0015172_701_1429 | 240 |
| 137 | 3300049570 | Ga0501033_0035843 | Ga0501033_0035843_1581_2399 | 240 |
| 138 | 3300049571 | Ga0501034_0008253 | Ga0501034_0008253_4844_5662 | 240 |
| 139 | 3300049572 | Ga0501036_0001242 | Ga0501036_0001242_10991_11719 | 240 |
| 140 | 3300049572 | Ga0501036_0042857 | Ga0501036_0042857_1694_2512 | 240 |
| 141 | 3300049573 | Ga0501037_0001359 | Ga0501037_0001359_14879_15607 | 240 |
| 142 | 3300049573 | Ga0501037_0003844 | Ga0501037_0003844_6197_7015 | 240 |
| 143 | 3300049574 | Ga0501038_0002845 | Ga0501038_0002845_14175_14903 | 240 |
| 144 | 3300049574 | Ga0501038_0007991 | Ga0501038_0007991_3567_4385 | 240 |
| 145 | 3300049575 | Ga0501039_0005435 | Ga0501039_0005435_8000_8728 | 240 |
| 146 | 3300049575 | Ga0501039_0045344 | Ga0501039_0045344_255_980 | 240 |
| 147 | 3300049576 | Ga0501040_0020387 | Ga0501040_0020387_2913_3638 | 240 |
| 148 | 3300049576 | Ga0501040_0281896 | Ga0501040_0281896_295_1023 | 240 |
| 149 | 3300049577 | Ga0501041_0003948 | Ga0501041_0003948_5373_6191 | 240 |
| 150 | 3300049578 | Ga0501042_0054157 | Ga0501042_0054157_1368_2096 | 240 |
| 151 | 3300049579 | Ga0501043_0002310 | Ga0501043_0002310_4502_5230 | 240 |
| 152 | 3300049579 | Ga0501043_0004077 | Ga0501043_0004077_5976_6794 | 240 |
| 153 | 3300049580 | Ga0501046_0023382 | Ga0501046_0023382_2574_3392 | 240 |
| 154 | 3300049580 | Ga0501046_0055028 | Ga0501046_0055028_1128_1856 | 240 |
| 155 | 3300049581 | Ga0501047_0003182 | Ga0501047_0003182_7480_8298 | 240 |
| 156 | 3300049581 | Ga0501047_0018066 | Ga0501047_0018066_4416_5144 | 240 |
| 157 | 3300049582 | Ga0501048_0002999 | Ga0501048_0002999_2087_2815 | 240 |
| 158 | 3300049582 | Ga0501048_0008708 | Ga0501048_0008708_1695_2513 | 240 |
| 159 | 3300049584 | Ga0501068_0004581 | Ga0501068_0004581_1487_2305 | 240 |
| 160 | 3300049585 | Ga0501069_0037122 | Ga0501069_0037122_1448_2266 | 240 |
| 161 | 3300049585 | Ga0501069_0166426 | Ga0501069_0166426_484_1212 | 240 |
| 162 | 3300049586 | Ga0501070_0009724 | Ga0501070_0009724_4957_5775 | 240 |
| 163 | 3300049586 | Ga0501070_0026776 | Ga0501070_0026776_3274_4002 | 240 |
| 164 | 3300049587 | Ga0501071_0008338 | Ga0501071_0008338_1069_1887 | 240 |
| 165 | 3300049587 | Ga0501071_0043939 | Ga0501071_0043939_168_893 | 240 |
| 166 | 3300049588 | Ga0501072_0001203 | Ga0501072_0001203_11032_11850 | 240 |
| 167 | 3300049588 | Ga0501072_0167916 | Ga0501072_0167916_453_1181 | 240 |
| 168 | 3300049589 | Ga0501073_0014546 | Ga0501073_0014546_1332_2150 | 240 |
| 169 | 3300049589 | Ga0501073_0051663 | Ga0501073_0051663_723_1451 | 240 |
| 170 | 3300049590 | Ga0501074_0008519 | Ga0501074_0008519_1448_2266 | 240 |
| 171 | 3300049591 | Ga0501075_0025175 | Ga0501075_0025175_923_1648 | 240 |
| 172 | 3300049591 | Ga0501075_0232114 | Ga0501075_0232114_653_1393 | 240 |
| 173 | 3300049592 | Ga0501076_0055261 | Ga0501076_0055261_2007_2732 | 240 |
| 174 | 3300049592 | Ga0501076_0100255 | Ga0501076_0100255_488_1306 | 240 |
| 175 | 3300049592 | Ga0501076_0552749 | Ga0501076_0552749_135_875 | 240 |
| 176 | 3300049593 | Ga0501077_0008911 | Ga0501077_0008911_461_1279 | 240 |
| 177 | 3300049742 | Ga0501080_0007553 | Ga0501080_0007553_1565_2383 | 240 |
| 178 | 3300049742 | Ga0501080_0026351 | Ga0501080_0026351_4119_4847 | 240 |
| 179 | 3300049744 | Ga0501083_0002149 | Ga0501083_0002149_11055_11873 | 240 |
| 180 | 3300049822 | Ga0501035_0003389 | Ga0501035_0003389_7389_8207 | 240 |
| 181 | 3300049822 | Ga0501035_0018747 | Ga0501035_0018747_4295_5023 | 240 |
| 182 | 3300049823 | Ga0501044_0005544 | Ga0501044_0005544_10694_11512 | 240 |
| 183 | 3300049823 | Ga0501044_0068172 | Ga0501044_0068172_1546_2274 | 240 |
| 184 | 3300049824 | Ga0501045_0048027 | Ga0501045_0048027_1483_2208 | 240 |
| 185 | 3300050490 | nmdc:mga03n38_154977_c1 | nmdc:mga03n38_154977_c1_42_767 | 240 |
| 186 | 3300050490 | nmdc:mga03n38_70869_c1 | nmdc:mga03n38_70869_c1_744_1481 | 240 |
| 187 | 3300050490 | nmdc:mga03n38_7198_c1 | nmdc:mga03n38_7198_c1_1630_2358 | 240 |
| 188 | 3300050491 | nmdc:mga00v17_16960_c1 | nmdc:mga00v17_16960_c1_3240_3965 | 240 |
| 189 | 3300050491 | nmdc:mga00v17_192624_c1 | nmdc:mga00v17_192624_c1_337_1062 | 240 |
| 190 | 3300050492 | nmdc:mga0yw44_12213_c1 | nmdc:mga0yw44_12213_c1_18_743 | 240 |
| 191 | 3300050492 | nmdc:mga0yw44_14753_c1 | nmdc:mga0yw44_14753_c1_1251_1976 | 240 |
| 192 | 3300050492 | nmdc:mga0yw44_152605_c1 | nmdc:mga0yw44_152605_c1_523_1248 | 240 |
| 193 | 3300050492 | nmdc:mga0yw44_155062_c1 | nmdc:mga0yw44_155062_c1_518_1243 | 240 |
| 194 | 3300050492 | nmdc:mga0yw44_159895_c1 | nmdc:mga0yw44_159895_c1_194_931 | 240 |
| 195 | 3300050492 | nmdc:mga0yw44_194933_c1 | nmdc:mga0yw44_194933_c1_71_796 | 240 |
| 196 | 3300050492 | nmdc:mga0yw44_36358_c1 | nmdc:mga0yw44_36358_c1_1282_2007 | 240 |
| 197 | 3300050492 | nmdc:mga0yw44_37079_c1 | nmdc:mga0yw44_37079_c1_347_1072 | 240 |
| 198 | 3300050492 | nmdc:mga0yw44_996_c1 | nmdc:mga0yw44_996_c1_4513_5253 | 240 |
| 199 | 3300050495 | nmdc:mga04h51_9121_c1 | nmdc:mga04h51_9121_c1_407_1132 | 240 |
| 200 | 3300050496 | nmdc:mga07m45_15000_c1 | nmdc:mga07m45_15000_c1_911_1648 | 240 |
| 201 | 3300050496 | nmdc:mga07m45_49574_c1 | nmdc:mga07m45_49574_c1_1412_2137 | 240 |
| 202 | 3300050496 | nmdc:mga07m45_88606_c1 | nmdc:mga07m45_88606_c1_686_1414 | 240 |
| 203 | 3300053140 | Ga0500573_0005347 | Ga0500573_0005347_5602_6336 | 240 |
| 204 | 3300054114 | Ga0501084_0022848 | Ga0501084_0022848_1475_2293 | 240 |
| 205 | 3300060353 | Ga0501082_0015873 | Ga0501082_0015873_4590_5408 | 240 |
| 206 | 3300061734 | Ga0530510_0004958 | Ga0530510_0004958_3451_4269 | 240 |
| 207 | iso_pu_bacteria | 2537561592 | 2537900313 | 240 |
| 208 | iso_pu_bacteria | 2554235005 | 2554256442 | 240 |
| 209 | iso_pu_bacteria | 2616644814 | 2616697062 | 240 |
| 210 | iso_pu_bacteria | 2643221678 | 2644439792 | 240 |
| 211 | iso_pu_bacteria | 2643221690 | 2644505120 | 240 |
| 212 | iso_pu_bacteria | 2643221694 | 2644527443 | 240 |
| 213 | iso_pu_bacteria | 2643221722 | 2644667489 | 240 |
| 214 | iso_pu_bacteria | 2738543034 | 2739366153 | 240 |
| 215 | iso_pu_bacteria | 2751185734 | 2753073276 | 240 |
| 216 | iso_pu_bacteria | 2795385470 | 2795779801 | 240 |
| 217 | iso_pu_bacteria | 2808606982 | 2811844682 | 240 |
| 218 | iso_pu_bacteria | 2818991458 | 2819665461 | 240 |
| 219 | iso_pu_bacteria | 2862281513 | 2862285004 | 240 |
| 220 | iso_pu_bacteria | 2862507626 | 2862513252 | 240 |
| 221 | iso_pu_bacteria | 2887443736 | 2887444491 | 240 |
| 222 | iso_pu_bacteria | 2912715099 | 2912717958 | 240 |
| 223 | iso_pu_bacteria | 2912723979 | 2912730385 | 240 |
| 224 | iso_pu_bacteria | 2946024296 | 2946026501 | 240 |
| 225 | iso_pu_bacteria | 3006493962 | 3006494827 | 240 |
| 226 | iso_pu_bacteria | 8008574985 | 8008577400 | 240 |
| 227 | 3300028800 | Ga0265338_10005476 | Ga0265338_100054769 | 241 |
| 228 | 3300046454 | Ga0495592_0136449 | Ga0495592_0136449_23_841 | 241 |
| 229 | 3300046455 | Ga0495603_0001577 | Ga0495603_0001577_5728_6477 | 241 |
| 230 | 3300046455 | Ga0495603_0040676 | Ga0495603_0040676_1678_2496 | 241 |
| 231 | 3300046459 | Ga0495629_0001919 | Ga0495629_0001919_7000_7749 | 241 |
| 232 | 3300046462 | Ga0495651_0110843 | Ga0495651_0110843_160_978 | 241 |
| 233 | 3300046499 | Ga0495594_0000151 | Ga0495594_0000151_22887_23636 | 241 |
| 234 | 3300046514 | Ga0495618_0023162 | Ga0495618_0023162_539_1357 | 241 |
| 235 | 3300046529 | Ga0495652_0039977 | Ga0495652_0039977_696_1514 | 241 |
| 236 | 3300046533 | Ga0495640_0034425 | Ga0495640_0034425_740_1558 | 241 |
| 237 | 3300046559 | Ga0495667_0026915 | Ga0495667_0026915_1385_2203 | 241 |
| 238 | 3300046642 | Ga0495634_0018599 | Ga0495634_0018599_1496_2314 | 241 |
| 239 | 3300046674 | Ga0495588_0001826 | Ga0495588_0001826_4587_5336 | 241 |
| 240 | 3300046675 | Ga0495657_0042687 | Ga0495657_0042687_329_1147 | 241 |
| 241 | 3300046689 | Ga0495613_0016791 | Ga0495613_0016791_2524_3342 | 241 |
| 242 | 3300046809 | Ga0495600_0026877 | Ga0495600_0026877_2805_3623 | 241 |
| 243 | 3300047315 | Ga0495581_0024327 | Ga0495581_0024327_986_1804 | 241 |
| 244 | 3300047317 | Ga0495604_0048254 | Ga0495604_0048254_2419_3237 | 241 |
| 245 | 3300047321 | Ga0495676_0003601 | Ga0495676_0003601_8018_8767 | 241 |
| 246 | 3300047321 | Ga0495676_0016464 | Ga0495676_0016464_2442_3260 | 241 |
| 247 | 3300048089 | Ga0495614_0039839 | Ga0495614_0039839_529_1278 | 241 |
| 248 | 3300048922 | Ga0496119_0161674 | Ga0496119_0161674_87_929 | 241 |
| 249 | 3300048925 | Ga0496122_0017612 | Ga0496122_0017612_3177_4034 | 241 |
| 250 | 3300048926 | Ga0496123_0000275 | Ga0496123_0000275_97750_98607 | 241 |
| 251 | 3300048927 | Ga0496124_0000370 | Ga0496124_0000370_32735_33592 | 241 |
| 252 | 3300048928 | Ga0496125_0013536 | Ga0496125_0013536_3190_4026 | 241 |
| 253 | 3300049569 | Ga0501032_0004262 | Ga0501032_0004262_6316_7158 | 241 |
| 254 | 3300049571 | Ga0501034_0288559 | Ga0501034_0288559_93_935 | 241 |
| 255 | 3300049572 | Ga0501036_0022958 | Ga0501036_0022958_3262_4104 | 241 |
| 256 | 3300049579 | Ga0501043_0103729 | Ga0501043_0103729_630_1472 | 241 |
| 257 | 3300049822 | Ga0501035_0053049 | Ga0501035_0053049_204_1046 | 241 |
| 258 | 3300049823 | Ga0501044_0025281 | Ga0501044_0025281_4821_5663 | 241 |
| 259 | iso_pu_bacteria | 8025413630 | 8025416483 | 241 |
| 260 | iso_pu_bacteria | 8054609563 | 8054610396 | 241 |
| 261 | 3300005329 | Ga0070683_100483772 | Ga0070683_1004837722 | 242 |
| 262 | 3300005564 | Ga0070664_100081383 | Ga0070664_1000813834 | 242 |
| 263 | 3300005616 | Ga0068852_100546788 | Ga0068852_1005467882 | 242 |
| 264 | 3300005719 | Ga0068861_100518072 | Ga0068861_1005180722 | 242 |
| 265 | 3300005985 | Ga0081539_10010027 | Ga0081539_100100277 | 242 |
| 266 | 3300006048 | Ga0075363_100090449 | Ga0075363_1000904492 | 242 |
| 267 | 3300009036 | Ga0105244_10101074 | Ga0105244_101010742 | 242 |
| 268 | 3300009098 | Ga0105245_10137952 | Ga0105245_101379523 | 242 |
| 269 | 3300009148 | Ga0105243_10298971 | Ga0105243_102989711 | 242 |
| 270 | 3300010375 | Ga0105239_10389235 | Ga0105239_103892352 | 242 |
| 271 | 3300011119 | Ga0105246_10344269 | Ga0105246_103442691 | 242 |
| 272 | 3300013308 | Ga0157375_10031138 | Ga0157375_100311385 | 242 |
| 273 | 3300014326 | Ga0157380_10644057 | Ga0157380_106440572 | 242 |
| 274 | 3300025904 | Ga0207647_10226559 | Ga0207647_102265592 | 242 |
| 275 | 3300025932 | Ga0207690_10161719 | Ga0207690_101617192 | 242 |
| 276 | 3300025945 | Ga0207679_10166170 | Ga0207679_101661703 | 242 |
| 277 | 3300025961 | Ga0207712_10087117 | Ga0207712_100871172 | 242 |
| 278 | 3300026067 | Ga0207678_10358847 | Ga0207678_103588472 | 242 |
| 279 | 3300026118 | Ga0207675_100460576 | Ga0207675_1004605762 | 242 |
| 280 | 3300031995 | Ga0307409_100154020 | Ga0307409_1001540202 | 242 |
| 281 | 3300046463 | Ga0495653_0034150 | Ga0495653_0034150_2744_3553 | 242 |
| 282 | 3300046473 | Ga0495582_0142923 | Ga0495582_0142923_54_863 | 242 |
| 283 | 3300046663 | Ga0495635_0105725 | Ga0495635_0105725_912_1721 | 242 |
| 284 | 3300046809 | Ga0495600_0069318 | Ga0495600_0069318_738_1511 | 242 |
| 285 | 3300046809 | Ga0495600_0221531 | Ga0495600_0221531_174_947 | 242 |
| 286 | 3300048903 | Ga0496100_0013299 | Ga0496100_0013299_422_1195 | 242 |
| 287 | 3300048903 | Ga0496100_0311592 | Ga0496100_0311592_229_1002 | 242 |
| 288 | 3300048904 | Ga0496101_0203800 | Ga0496101_0203800_62_835 | 242 |
| 289 | 3300048905 | Ga0496102_0012702 | Ga0496102_0012702_1917_2690 | 242 |
| 290 | 3300048906 | Ga0496103_0046744 | Ga0496103_0046744_1239_2012 | 242 |
| 291 | 3300048907 | Ga0496104_0031546 | Ga0496104_0031546_355_1128 | 242 |
| 292 | 3300048908 | Ga0496105_0002880 | Ga0496105_0002880_3670_4443 | 242 |
| 293 | 3300048908 | Ga0496105_0020655 | Ga0496105_0020655_2262_3104 | 242 |
| 294 | 3300048908 | Ga0496105_0052519 | Ga0496105_0052519_1124_1897 | 242 |
| 295 | 3300048908 | Ga0496105_0117940 | Ga0496105_0117940_1073_1846 | 242 |
| 296 | 3300048909 | Ga0496106_0170526 | Ga0496106_0170526_424_1266 | 242 |
| 297 | 3300048910 | Ga0496107_0047983 | Ga0496107_0047983_284_1057 | 242 |
| 298 | 3300048911 | Ga0496108_0086002 | Ga0496108_0086002_1450_2292 | 242 |
| 299 | 3300048911 | Ga0496108_0087578 | Ga0496108_0087578_1055_1828 | 242 |
| 300 | 3300048911 | Ga0496108_0118414 | Ga0496108_0118414_960_1769 | 242 |
| 301 | 3300048911 | Ga0496108_0214374 | Ga0496108_0214374_712_1476 | 242 |
| 302 | 3300048912 | Ga0496109_0039334 | Ga0496109_0039334_1622_2395 | 242 |
| 303 | 3300048912 | Ga0496109_0054935 | Ga0496109_0054935_1356_2198 | 242 |
| 304 | 3300048913 | Ga0496110_0077541 | Ga0496110_0077541_372_1214 | 242 |
| 305 | 3300048913 | Ga0496110_0207149 | Ga0496110_0207149_584_1357 | 242 |
| 306 | 3300048916 | Ga0496113_0108967 | Ga0496113_0108967_950_1792 | 242 |
| 307 | 3300048916 | Ga0496113_0301320 | Ga0496113_0301320_155_928 | 242 |
| 308 | 3300048917 | Ga0496114_0006892 | Ga0496114_0006892_3945_4718 | 242 |
| 309 | 3300048917 | Ga0496114_0021605 | Ga0496114_0021605_1261_2103 | 242 |
| 310 | 3300049580 | Ga0501046_0038015 | Ga0501046_0038015_70_888 | 242 |
| 311 | 3300049581 | Ga0501047_0087557 | Ga0501047_0087557_462_1280 | 242 |
| 312 | 3300049585 | Ga0501069_0131739 | Ga0501069_0131739_377_1126 | 242 |
| 313 | 3300049586 | Ga0501070_0099778 | Ga0501070_0099778_51_809 | 242 |
| 314 | 3300050491 | nmdc:mga00v17_64148_c1 | nmdc:mga00v17_64148_c1_138_881 | 242 |
| 315 | 3300050496 | nmdc:mga07m45_107309_c1 | nmdc:mga07m45_107309_c1_634_1377 | 242 |
| 316 | 3300053085 | Ga0495619_0188569 | Ga0495619_0188569_84_893 | 242 |
| 317 | 3300053087 | Ga0500643_000240 | Ga0500643_000240_45778_46539 | 242 |
| 318 | 3300053104 | Ga0500556_0000182 | Ga0500556_0000182_25549_26280 | 242 |
| 319 | iso_pu_bacteria | 2811994880 | 2812362278 | 242 |
| 320 | iso_pu_bacteria | 2837268691 | 2837270126 | 242 |
| 321 | iso_pu_bacteria | 2839986021 | 2839986978 | 242 |
| 322 | iso_pu_bacteria | 2855386786 | 2855389050 | 242 |
| 323 | iso_pu_bacteria | 2904765812 | 2904767313 | 242 |
| 324 | iso_pu_bacteria | 2904770941 | 2904774598 | 242 |
| 325 | iso_pu_bacteria | 2908811453 | 2908812963 | 242 |
| 326 | iso_pu_bacteria | 2919420072 | 2919424065 | 242 |
| 327 | iso_pu_bacteria | 2919432681 | 2919436483 | 242 |
| 328 | 3300005334 | Ga0068869_100036317 | Ga0068869_1000363173 | 243 |
| 329 | 3300005345 | Ga0070692_10349687 | Ga0070692_103496871 | 243 |
| 330 | 3300005367 | Ga0070667_100650584 | Ga0070667_1006505842 | 243 |
| 331 | 3300005440 | Ga0070705_100012269 | Ga0070705_1000122695 | 243 |
| 332 | 3300005456 | Ga0070678_100170146 | Ga0070678_1001701461 | 243 |
| 333 | 3300005615 | Ga0070702_100000931 | Ga0070702_1000009318 | 243 |
| 334 | 3300009148 | Ga0105243_10005375 | Ga0105243_100053753 | 243 |
| 335 | 3300009148 | Ga0105243_10781684 | Ga0105243_107816842 | 243 |
| 336 | 3300013297 | Ga0157378_10059704 | Ga0157378_100597043 | 243 |
| 337 | 3300013308 | Ga0157375_10151110 | Ga0157375_101511104 | 243 |
| 338 | 3300015688 | Ga0183367_1002 | Ga0183367_1002288 | 243 |
| 339 | 3300027312 | Ga0209371_1028786 | Ga0209371_10287862 | 243 |
| 340 | 3300030734 | Ga0316179_1081360 | Ga0316179_10813602 | 243 |
| 341 | 3300030744 | Ga0316181_1123477 | Ga0316181_11234772 | 243 |
| 342 | 3300031665 | Ga0316575_10000183 | Ga0316575_1000018320 | 243 |
| 343 | 3300031691 | Ga0316579_10000576 | Ga0316579_100005762 | 243 |
| 344 | 3300031727 | Ga0316576_10005178 | Ga0316576_100051788 | 243 |
| 345 | 3300031728 | Ga0316578_10001788 | Ga0316578_100017888 | 243 |
| 346 | 3300031995 | Ga0307409_100536586 | Ga0307409_1005365862 | 243 |
| 347 | 3300035398 | Ga0316574_0034648 | Ga0316574_0034648_547_1308 | 243 |
| 348 | 3300036712 | Ga0316584_0001201 | Ga0316584_0001201_2890_3651 | 243 |
| 349 | 3300038443 | Ga0395901_0105385 | Ga0395901_0105385_1901_2794 | 243 |
| 350 | 3300041453 | Ga0451797_0676472 | Ga0451797_0676472_89_847 | 243 |
| 351 | 3300041494 | Ga0451837_0479937 | Ga0451837_0479937_3040_3798 | 243 |
| 352 | 3300042007 | Ga0439449_0002264 | Ga0439449_0002264_3147_3905 | 243 |
| 353 | 3300044683 | Ga0466965_0071626 | Ga0466965_0071626_968_1717 | 243 |
| 354 | 3300044684 | Ga0466966_0163669 | Ga0466966_0163669_79_840 | 243 |
| 355 | 3300044693 | Ga0466961_0202471 | Ga0466961_0202471_385_1146 | 243 |
| 356 | 3300044694 | Ga0466963_0030436 | Ga0466963_0030436_412_1170 | 243 |
| 357 | 3300044719 | Ga0466971_0074996 | Ga0466971_0074996_347_1105 | 243 |
| 358 | 3300044842 | Ga0466957_0070608 | Ga0466957_0070608_32_790 | 243 |
| 359 | 3300044901 | Ga0466960_0012672 | Ga0466960_0012672_1271_2032 | 243 |
| 360 | 3300045976 | Ga0466967_0009681 | Ga0466967_0009681_2066_2824 | 243 |
| 361 | 3300045976 | Ga0466967_0234357 | Ga0466967_0234357_46_804 | 243 |
| 362 | 3300045976 | Ga0466967_0702501 | Ga0466967_0702501_210_968 | 243 |
| 363 | 3300046452 | Ga0495617_012050 | Ga0495617_012050_2049_2807 | 243 |
| 364 | 3300046454 | Ga0495592_0029277 | Ga0495592_0029277_1759_2517 | 243 |
| 365 | 3300046455 | Ga0495603_0019833 | Ga0495603_0019833_3221_3979 | 243 |
| 366 | 3300046459 | Ga0495629_0014235 | Ga0495629_0014235_4390_5148 | 243 |
| 367 | 3300046462 | Ga0495651_0325967 | Ga0495651_0325967_177_935 | 243 |
| 368 | 3300046472 | Ga0495580_0175091 | Ga0495580_0175091_525_1283 | 243 |
| 369 | 3300046474 | Ga0495605_0020240 | Ga0495605_0020240_1854_2612 | 243 |
| 370 | 3300046476 | Ga0495662_0239766 | Ga0495662_0239766_95_853 | 243 |
| 371 | 3300046477 | Ga0495664_0048940 | Ga0495664_0048940_667_1425 | 243 |
| 372 | 3300046499 | Ga0495594_0026491 | Ga0495594_0026491_2160_2918 | 243 |
| 373 | 3300046501 | Ga0495607_0020151 | Ga0495607_0020151_663_1421 | 243 |
| 374 | 3300046506 | Ga0495583_0095183 | Ga0495583_0095183_24_782 | 243 |
| 375 | 3300046514 | Ga0495618_0175329 | Ga0495618_0175329_356_1114 | 243 |
| 376 | 3300046516 | Ga0495628_0031131 | Ga0495628_0031131_631_1389 | 243 |
| 377 | 3300046518 | Ga0495631_0005294 | Ga0495631_0005294_2395_3153 | 243 |
| 378 | 3300046522 | Ga0495643_0011246 | Ga0495643_0011246_2695_3453 | 243 |
| 379 | 3300046523 | Ga0495644_0154161 | Ga0495644_0154161_86_844 | 243 |
| 380 | 3300046524 | Ga0495648_0084536 | Ga0495648_0084536_131_889 | 243 |
| 381 | 3300046526 | Ga0495666_0078869 | Ga0495666_0078869_546_1304 | 243 |
| 382 | 3300046529 | Ga0495652_0140665 | Ga0495652_0140665_560_1318 | 243 |
| 383 | 3300046530 | Ga0495654_0012180 | Ga0495654_0012180_1630_2388 | 243 |
| 384 | 3300046531 | Ga0495665_0224535 | Ga0495665_0224535_149_907 | 243 |
| 385 | 3300046533 | Ga0495640_0007645 | Ga0495640_0007645_7416_8174 | 243 |
| 386 | 3300046533 | Ga0495640_0101787 | Ga0495640_0101787_118_927 | 243 |
| 387 | 3300046538 | Ga0495609_0010839 | Ga0495609_0010839_3099_3857 | 243 |
| 388 | 3300046557 | Ga0495622_0007706 | Ga0495622_0007706_1089_1847 | 243 |
| 389 | 3300046558 | Ga0495633_0153934 | Ga0495633_0153934_116_874 | 243 |
| 390 | 3300046642 | Ga0495634_0050352 | Ga0495634_0050352_1108_1866 | 243 |
| 391 | 3300046648 | Ga0495611_0017431 | Ga0495611_0017431_461_1219 | 243 |
| 392 | 3300046660 | Ga0495625_0084278 | Ga0495625_0084278_1306_2064 | 243 |
| 393 | 3300046663 | Ga0495635_0117563 | Ga0495635_0117563_38_796 | 243 |
| 394 | 3300046665 | Ga0495661_0016076 | Ga0495661_0016076_2013_2771 | 243 |
| 395 | 3300046675 | Ga0495657_0038044 | Ga0495657_0038044_1455_2213 | 243 |
| 396 | 3300046675 | Ga0495657_0069912 | Ga0495657_0069912_276_1034 | 243 |
| 397 | 3300046689 | Ga0495613_0098618 | Ga0495613_0098618_751_1509 | 243 |
| 398 | 3300046689 | Ga0495613_0224238 | Ga0495613_0224238_249_1007 | 243 |
| 399 | 3300046690 | Ga0495624_0231633 | Ga0495624_0231633_289_1047 | 243 |
| 400 | 3300046794 | Ga0495589_0009062 | Ga0495589_0009062_2692_3450 | 243 |
| 401 | 3300046810 | Ga0495660_0087679 | Ga0495660_0087679_409_1167 | 243 |
| 402 | 3300047317 | Ga0495604_0018943 | Ga0495604_0018943_2399_3208 | 243 |
| 403 | 3300047317 | Ga0495604_0165878 | Ga0495604_0165878_276_1034 | 243 |
| 404 | 3300047318 | Ga0495636_0002978 | Ga0495636_0002978_5469_6227 | 243 |
| 405 | 3300047322 | Ga0495680_0043165 | Ga0495680_0043165_2315_3073 | 243 |
| 406 | 3300047471 | Ga0495684_0053522 | Ga0495684_0053522_1657_2415 | 243 |
| 407 | 3300047472 | Ga0495686_0119277 | Ga0495686_0119277_347_1105 | 243 |
| 408 | 3300047673 | Ga0495593_0030748 | Ga0495593_0030748_1102_1860 | 243 |
| 409 | 3300048089 | Ga0495614_0024349 | Ga0495614_0024349_1483_2241 | 243 |
| 410 | 3300048091 | Ga0495626_0139000 | Ga0495626_0139000_82_840 | 243 |
| 411 | 3300048911 | Ga0496108_0405611 | Ga0496108_0405611_97_855 | 243 |
| 412 | 3300048914 | Ga0496111_0023441 | Ga0496111_0023441_2407_3228 | 243 |
| 413 | 3300048915 | Ga0496112_0305872 | Ga0496112_0305872_307_1092 | 243 |
| 414 | 3300048916 | Ga0496113_0159140 | Ga0496113_0159140_465_1250 | 243 |
| 415 | 3300048917 | Ga0496114_0093372 | Ga0496114_0093372_896_1693 | 243 |
| 416 | 3300048917 | Ga0496114_0327725 | Ga0496114_0327725_376_1134 | 243 |
| 417 | 3300048929 | Ga0496126_0029561 | Ga0496126_0029561_101_937 | 243 |
| 418 | 3300049459 | Ga0495678_052125 | Ga0495678_052125_132_890 | 243 |
| 419 | 3300049568 | Ga0501031_0006724 | Ga0501031_0006724_3938_4696 | 243 |
| 420 | 3300049569 | Ga0501032_0005448 | Ga0501032_0005448_2553_3311 | 243 |
| 421 | 3300049570 | Ga0501033_0001923 | Ga0501033_0001923_13290_14048 | 243 |
| 422 | 3300049570 | Ga0501033_0024436 | Ga0501033_0024436_2074_2832 | 243 |
| 423 | 3300049570 | Ga0501033_0081286 | Ga0501033_0081286_674_1432 | 243 |
| 424 | 3300049570 | Ga0501033_0116256 | Ga0501033_0116256_791_1618 | 243 |
| 425 | 3300049570 | Ga0501033_0175770 | Ga0501033_0175770_60_818 | 243 |
| 426 | 3300049571 | Ga0501034_0007616 | Ga0501034_0007616_6343_7101 | 243 |
| 427 | 3300049571 | Ga0501034_0056934 | Ga0501034_0056934_761_1597 | 243 |
| 428 | 3300049571 | Ga0501034_0433739 | Ga0501034_0433739_199_1026 | 243 |
| 429 | 3300049572 | Ga0501036_0003045 | Ga0501036_0003045_11799_12557 | 243 |
| 430 | 3300049572 | Ga0501036_0030091 | Ga0501036_0030091_2098_2856 | 243 |
| 431 | 3300049572 | Ga0501036_0216557 | Ga0501036_0216557_791_1549 | 243 |
| 432 | 3300049573 | Ga0501037_0006882 | Ga0501037_0006882_2623_3381 | 243 |
| 433 | 3300049574 | Ga0501038_0006481 | Ga0501038_0006481_9047_9805 | 243 |
| 434 | 3300049574 | Ga0501038_0012665 | Ga0501038_0012665_4905_5732 | 243 |
| 435 | 3300049575 | Ga0501039_0043383 | Ga0501039_0043383_633_1391 | 243 |
| 436 | 3300049578 | Ga0501042_0067361 | Ga0501042_0067361_99_857 | 243 |
| 437 | 3300049578 | Ga0501042_0497511 | Ga0501042_0497511_10_768 | 243 |
| 438 | 3300049579 | Ga0501043_0008709 | Ga0501043_0008709_3566_4324 | 243 |
| 439 | 3300049579 | Ga0501043_0011863 | Ga0501043_0011863_496_1254 | 243 |
| 440 | 3300049580 | Ga0501046_0005075 | Ga0501046_0005075_6663_7421 | 243 |
| 441 | 3300049581 | Ga0501047_0057957 | Ga0501047_0057957_244_1002 | 243 |
| 442 | 3300049581 | Ga0501047_0066672 | Ga0501047_0066672_2028_2855 | 243 |
| 443 | 3300049581 | Ga0501047_0099048 | Ga0501047_0099048_1958_2716 | 243 |
| 444 | 3300049581 | Ga0501047_0102429 | Ga0501047_0102429_1262_2020 | 243 |
| 445 | 3300049582 | Ga0501048_0001906 | Ga0501048_0001906_6290_7048 | 243 |
| 446 | 3300049585 | Ga0501069_0060520 | Ga0501069_0060520_590_1348 | 243 |
| 447 | 3300049585 | Ga0501069_0246116 | Ga0501069_0246116_186_929 | 243 |
| 448 | 3300049586 | Ga0501070_0000534 | Ga0501070_0000534_12148_12906 | 243 |
| 449 | 3300049589 | Ga0501073_0098988 | Ga0501073_0098988_551_1309 | 243 |
| 450 | 3300049590 | Ga0501074_0013961 | Ga0501074_0013961_1558_2316 | 243 |
| 451 | 3300049744 | Ga0501083_0169784 | Ga0501083_0169784_585_1343 | 243 |
| 452 | 3300049822 | Ga0501035_0010126 | Ga0501035_0010126_3522_4280 | 243 |
| 453 | 3300049822 | Ga0501035_0033245 | Ga0501035_0033245_3218_3976 | 243 |
| 454 | 3300049822 | Ga0501035_0051020 | Ga0501035_0051020_1869_2696 | 243 |
| 455 | 3300049822 | Ga0501035_0183065 | Ga0501035_0183065_10_768 | 243 |
| 456 | 3300049822 | Ga0501035_0225653 | Ga0501035_0225653_576_1334 | 243 |
| 457 | 3300049823 | Ga0501044_0005672 | Ga0501044_0005672_4477_5235 | 243 |
| 458 | 3300049823 | Ga0501044_0059992 | Ga0501044_0059992_2384_3142 | 243 |
| 459 | 3300049823 | Ga0501044_0105849 | Ga0501044_0105849_1606_2433 | 243 |
| 460 | 3300049824 | Ga0501045_0056735 | Ga0501045_0056735_1137_1895 | 243 |
| 461 | 3300053139 | Ga0500568_0064578 | Ga0500568_0064578_484_1338 | 243 |
| 462 | 3300061719 | Ga0466962_0003816 | Ga0466962_0003816_3021_3779 | 243 |
| 463 | 3300061719 | Ga0466962_0123782 | Ga0466962_0123782_350_1111 | 243 |
| 464 | iso_pu_bacteria | 2731639228 | 2731908189 | 243 |
| 465 | iso_pu_bacteria | 2738541272 | 2738693167 | 243 |
| 466 | iso_pu_bacteria | 2738543027 | 2739323258 | 243 |
| 467 | iso_pu_bacteria | 2739367654 | 2739607867 | 243 |
| 468 | iso_pu_bacteria | 2739367898 | 2740166446 | 243 |
| 469 | iso_pu_bacteria | 2758568621 | 2760621921 | 243 |
| 470 | iso_pu_bacteria | 2795385472 | 2795791544 | 243 |
| 471 | iso_pu_bacteria | 2799112218 | 2799185488 | 243 |
| 472 | iso_pu_bacteria | 2808606394 | 2809026763 | 243 |
| 473 | iso_pu_bacteria | 2835188231 | 2835189939 | 243 |
| 474 | iso_pu_bacteria | 2891326441 | 2891328197 | 243 |
| 475 | iso_pu_bacteria | 2932431166 | 2932433856 | 243 |
| 476 | iso_pu_bacteria | 3006321560 | 3006323891 | 243 |
| 477 | iso_pu_bacteria | 8056579771 | 8056580856 | 243 |
| 478 | 3300005327 | Ga0070658_10258407 | Ga0070658_102584072 | 244 |
| 479 | 3300005347 | Ga0070668_100103590 | Ga0070668_1001035902 | 244 |
| 480 | 3300005471 | Ga0070698_100003056 | Ga0070698_1000030563 | 244 |
| 481 | 3300005530 | Ga0070679_100334782 | Ga0070679_1003347822 | 244 |
| 482 | 3300005530 | Ga0070679_100379240 | Ga0070679_1003792402 | 244 |
| 483 | 3300005546 | Ga0070696_100005324 | Ga0070696_1000053248 | 244 |
| 484 | 3300005564 | Ga0070664_100317684 | Ga0070664_1003176842 | 244 |
| 485 | 3300005616 | Ga0068852_100266927 | Ga0068852_1002669272 | 244 |
| 486 | 3300005843 | Ga0068860_100571832 | Ga0068860_1005718322 | 244 |
| 487 | 3300006844 | Ga0075428_100237322 | Ga0075428_1002373222 | 244 |
| 488 | 3300009098 | Ga0105245_10618801 | Ga0105245_106188012 | 244 |
| 489 | 3300009147 | Ga0114129_10118769 | Ga0114129_101187693 | 244 |
| 490 | 3300021388 | Ga0213875_10003530 | Ga0213875_100035308 | 244 |
| 491 | 3300025921 | Ga0207652_10492914 | Ga0207652_104929141 | 244 |
| 492 | 3300025924 | Ga0207694_10049511 | Ga0207694_100495112 | 244 |
| 493 | 3300026041 | Ga0207639_10006559 | Ga0207639_100065598 | 244 |
| 494 | 3300031731 | Ga0307405_10049052 | Ga0307405_100490521 | 244 |
| 495 | 3300031852 | Ga0307410_10011079 | Ga0307410_100110793 | 244 |
| 496 | 3300031852 | Ga0307410_10095476 | Ga0307410_100954762 | 244 |
| 497 | 3300031901 | Ga0307406_10060614 | Ga0307406_100606143 | 244 |
| 498 | 3300031995 | Ga0307409_100021234 | Ga0307409_1000212342 | 244 |
| 499 | 3300031995 | Ga0307409_100038947 | Ga0307409_1000389473 | 244 |
| 500 | 3300032002 | Ga0307416_100003285 | Ga0307416_1000032856 | 244 |
| 501 | 3300032002 | Ga0307416_100460214 | Ga0307416_1004602142 | 244 |
| 502 | 3300032126 | Ga0307415_100266557 | Ga0307415_1002665572 | 244 |
| 503 | 3300033179 | Ga0307507_10085453 | Ga0307507_100854532 | 244 |
| 504 | 3300037853 | Ga0436364_0727896 | Ga0436364_0727896_3227_4060 | 244 |
| 505 | 3300037853 | Ga0436364_1546160 | Ga0436364_1546160_3891_4655 | 244 |
| 506 | 3300044765 | Ga0466970_0197086 | Ga0466970_0197086_309_1061 | 244 |
| 507 | 3300045976 | Ga0466967_0469659 | Ga0466967_0469659_204_971 | 244 |
| 508 | 3300048911 | Ga0496108_0094294 | Ga0496108_0094294_1101_1877 | 244 |
| 509 | 3300049568 | Ga0501031_0003380 | Ga0501031_0003380_3325_4155 | 244 |
| 510 | 3300049570 | Ga0501033_0114811 | Ga0501033_0114811_187_996 | 244 |
| 511 | 3300049572 | Ga0501036_0011239 | Ga0501036_0011239_2505_3260 | 244 |
| 512 | 3300049574 | Ga0501038_0142042 | Ga0501038_0142042_986_1741 | 244 |
| 513 | 3300049575 | Ga0501039_0004050 | Ga0501039_0004050_5091_5846 | 244 |
| 514 | 3300049576 | Ga0501040_0000479 | Ga0501040_0000479_5149_5904 | 244 |
| 515 | 3300049576 | Ga0501040_0231154 | Ga0501040_0231154_433_1188 | 244 |
| 516 | 3300049577 | Ga0501041_0008756 | Ga0501041_0008756_4484_5239 | 244 |
| 517 | 3300049578 | Ga0501042_0000633 | Ga0501042_0000633_130_885 | 244 |
| 518 | 3300049578 | Ga0501042_0289649 | Ga0501042_0289649_41_880 | 244 |
| 519 | 3300049580 | Ga0501046_0064304 | Ga0501046_0064304_1179_1988 | 244 |
| 520 | 3300049581 | Ga0501047_0000064 | Ga0501047_0000064_65743_66582 | 244 |
| 521 | 3300049581 | Ga0501047_0074193 | Ga0501047_0074193_2418_3227 | 244 |
| 522 | 3300049582 | Ga0501048_0002851 | Ga0501048_0002851_8614_9369 | 244 |
| 523 | 3300049586 | Ga0501070_0185282 | Ga0501070_0185282_649_1404 | 244 |
| 524 | 3300049587 | Ga0501071_0009425 | Ga0501071_0009425_678_1433 | 244 |
| 525 | 3300049588 | Ga0501072_0013712 | Ga0501072_0013712_613_1368 | 244 |
| 526 | 3300049590 | Ga0501074_0012926 | Ga0501074_0012926_4387_5142 | 244 |
| 527 | 3300049591 | Ga0501075_0023383 | Ga0501075_0023383_2373_3128 | 244 |
| 528 | 3300049592 | Ga0501076_0049581 | Ga0501076_0049581_2397_3152 | 244 |
| 529 | 3300049593 | Ga0501077_0007834 | Ga0501077_0007834_3658_4413 | 244 |
| 530 | 3300049741 | Ga0501079_0020596 | Ga0501079_0020596_3025_3780 | 244 |
| 531 | 3300049742 | Ga0501080_0037218 | Ga0501080_0037218_696_1451 | 244 |
| 532 | 3300049822 | Ga0501035_0241605 | Ga0501035_0241605_682_1512 | 244 |
| 533 | 3300049823 | Ga0501044_0070980 | Ga0501044_0070980_1579_2388 | 244 |
| 534 | 3300049823 | Ga0501044_0342378 | Ga0501044_0342378_494_1333 | 244 |
| 535 | 3300049824 | Ga0501045_0098408 | Ga0501045_0098408_1264_2019 | 244 |
| 536 | 3300054114 | Ga0501084_0251915 | Ga0501084_0251915_174_929 | 244 |
| 537 | 3300061734 | Ga0530510_0011276 | Ga0530510_0011276_5219_5974 | 244 |
| 538 | iso_pu_bacteria | 2899370129 | 2899375041 | 244 |
| 539 | 3300001991 | JGI24743J22301_10011899 | JGI24743J22301_100118993 | 245 |
| 540 | 3300005329 | Ga0070683_100028278 | Ga0070683_1000282783 | 245 |
| 541 | 3300005337 | Ga0070682_100110682 | Ga0070682_1001106823 | 245 |
| 542 | 3300005343 | Ga0070687_100114578 | Ga0070687_1001145782 | 245 |
| 543 | 3300005354 | Ga0070675_100095762 | Ga0070675_1000957623 | 245 |
| 544 | 3300005356 | Ga0070674_100015450 | Ga0070674_1000154503 | 245 |
| 545 | 3300005364 | Ga0070673_100182403 | Ga0070673_1001824032 | 245 |
| 546 | 3300005366 | Ga0070659_100024836 | Ga0070659_1000248366 | 245 |
| 547 | 3300005438 | Ga0070701_10001057 | Ga0070701_100010573 | 245 |
| 548 | 3300005444 | Ga0070694_100622994 | Ga0070694_1006229941 | 245 |
| 549 | 3300005459 | Ga0068867_100026319 | Ga0068867_1000263193 | 245 |
| 550 | 3300005466 | Ga0070685_10156467 | Ga0070685_101564673 | 245 |
| 551 | 3300005518 | Ga0070699_100037534 | Ga0070699_1000375344 | 245 |
| 552 | 3300005535 | Ga0070684_100054076 | Ga0070684_1000540761 | 245 |
| 553 | 3300005543 | Ga0070672_100024021 | Ga0070672_1000240214 | 245 |
| 554 | 3300005578 | Ga0068854_100069905 | Ga0068854_1000699053 | 245 |
| 555 | 3300005615 | Ga0070702_100000741 | Ga0070702_10000074110 | 245 |
| 556 | 3300005616 | Ga0068852_100011817 | Ga0068852_1000118176 | 245 |
| 557 | 3300005719 | Ga0068861_100033624 | Ga0068861_1000336245 | 245 |
| 558 | 3300005840 | Ga0068870_10010542 | Ga0068870_100105422 | 245 |
| 559 | 3300006038 | Ga0075365_10149006 | Ga0075365_101490063 | 245 |
| 560 | 3300006847 | Ga0075431_100064291 | Ga0075431_1000642912 | 245 |
| 561 | 3300006880 | Ga0075429_100426041 | Ga0075429_1004260411 | 245 |
| 562 | 3300006881 | Ga0068865_100005761 | Ga0068865_1000057616 | 245 |
| 563 | 3300009094 | Ga0111539_10064576 | Ga0111539_100645762 | 245 |
| 564 | 3300009148 | Ga0105243_10006666 | Ga0105243_100066668 | 245 |
| 565 | 3300009176 | Ga0105242_10140022 | Ga0105242_101400222 | 245 |
| 566 | 3300013297 | Ga0157378_10930033 | Ga0157378_109300331 | 245 |
| 567 | 3300013307 | Ga0157372_10205429 | Ga0157372_102054294 | 245 |
| 568 | 3300014326 | Ga0157380_10021716 | Ga0157380_100217166 | 245 |
| 569 | 3300014745 | Ga0157377_10026123 | Ga0157377_100261233 | 245 |
| 570 | 3300025315 | Ga0207697_10076111 | Ga0207697_100761112 | 245 |
| 571 | 3300025901 | Ga0207688_10006708 | Ga0207688_100067087 | 245 |
| 572 | 3300025908 | Ga0207643_10002261 | Ga0207643_100022614 | 245 |
| 573 | 3300025918 | Ga0207662_10013839 | Ga0207662_100138392 | 245 |
| 574 | 3300025926 | Ga0207659_10086876 | Ga0207659_100868761 | 245 |
| 575 | 3300025935 | Ga0207709_10180390 | Ga0207709_101803902 | 245 |
| 576 | 3300025937 | Ga0207669_10036827 | Ga0207669_100368274 | 245 |
| 577 | 3300025938 | Ga0207704_10037911 | Ga0207704_100379115 | 245 |
| 578 | 3300025940 | Ga0207691_10035517 | Ga0207691_100355175 | 245 |
| 579 | 3300025944 | Ga0207661_10279966 | Ga0207661_102799663 | 245 |
| 580 | 3300025981 | Ga0207640_10041090 | Ga0207640_100410905 | 245 |
| 581 | 3300026023 | Ga0207677_10185977 | Ga0207677_101859773 | 245 |
| 582 | 3300026041 | Ga0207639_10059592 | Ga0207639_100595925 | 245 |
| 583 | 3300026075 | Ga0207708_10000689 | Ga0207708_100006898 | 245 |
| 584 | 3300026089 | Ga0207648_10008420 | Ga0207648_100084203 | 245 |
| 585 | 3300026118 | Ga0207675_100001638 | Ga0207675_1000016385 | 245 |
| 586 | 3300026142 | Ga0207698_10049931 | Ga0207698_100499313 | 245 |
| 587 | 3300026142 | Ga0207698_10089796 | Ga0207698_100897962 | 245 |
| 588 | 3300031665 | Ga0316575_10005262 | Ga0316575_100052624 | 245 |
| 589 | 3300031727 | Ga0316576_10000409 | Ga0316576_100004096 | 245 |
| 590 | 3300031728 | Ga0316578_10003110 | Ga0316578_100031109 | 245 |
| 591 | 3300031852 | Ga0307410_10125735 | Ga0307410_101257352 | 245 |
| 592 | 3300031995 | Ga0307409_100385299 | Ga0307409_1003852991 | 245 |
| 593 | 3300032137 | Ga0316585_10002960 | Ga0316585_100029602 | 245 |
| 594 | 3300036647 | Ga0316582_0069766 | Ga0316582_0069766_749_1540 | 245 |
| 595 | 3300036712 | Ga0316584_0039385 | Ga0316584_0039385_475_1266 | 245 |
| 596 | 3300037471 | Ga0395905_0039406 | Ga0395905_0039406_1585_2430 | 245 |
| 597 | 3300037853 | Ga0436364_0296067 | Ga0436364_0296067_23740_24531 | 245 |
| 598 | 3300038443 | Ga0395901_0051827 | Ga0395901_0051827_2673_3518 | 245 |
| 599 | 3300038443 | Ga0395901_0156945 | Ga0395901_0156945_540_1385 | 245 |
| 600 | 3300039437 | Ga0436365_1354692 | Ga0436365_1354692_3743_4534 | 245 |
| 601 | 3300042002 | Ga0439442_012315 | Ga0439442_012315_319_1119 | 245 |
| 602 | 3300044842 | Ga0466957_0308144 | Ga0466957_0308144_210_998 | 245 |
| 603 | 3300044901 | Ga0466960_0070580 | Ga0466960_0070580_498_1286 | 245 |
| 604 | 3300048905 | Ga0496102_0148972 | Ga0496102_0148972_1197_1961 | 245 |
| 605 | 3300048910 | Ga0496107_0187439 | Ga0496107_0187439_627_1391 | 245 |
| 606 | 3300049569 | Ga0501032_0055463 | Ga0501032_0055463_327_1178 | 245 |
| 607 | 3300049570 | Ga0501033_0060798 | Ga0501033_0060798_523_1374 | 245 |
| 608 | 3300049572 | Ga0501036_0066735 | Ga0501036_0066735_792_1643 | 245 |
| 609 | 3300049573 | Ga0501037_0210466 | Ga0501037_0210466_209_1060 | 245 |
| 610 | 3300049574 | Ga0501038_0040765 | Ga0501038_0040765_1266_2117 | 245 |
| 611 | 3300049575 | Ga0501039_0095609 | Ga0501039_0095609_1301_2152 | 245 |
| 612 | 3300049579 | Ga0501043_0046991 | Ga0501043_0046991_2095_2946 | 245 |
| 613 | 3300049579 | Ga0501043_0083188 | Ga0501043_0083188_304_1155 | 245 |
| 614 | 3300049581 | Ga0501047_0071537 | Ga0501047_0071537_293_1144 | 245 |
| 615 | 3300049583 | Ga0501067_0049980 | Ga0501067_0049980_530_1294 | 245 |
| 616 | 3300049586 | Ga0501070_0061826 | Ga0501070_0061826_660_1511 | 245 |
| 617 | 3300049822 | Ga0501035_0027087 | Ga0501035_0027087_1235_2086 | 245 |
| 618 | 3300049822 | Ga0501035_0134255 | Ga0501035_0134255_1285_2136 | 245 |
| 619 | 3300049823 | Ga0501044_0078254 | Ga0501044_0078254_1549_2400 | 245 |
| 620 | 3300050492 | nmdc:mga0yw44_152175_c1 | nmdc:mga0yw44_152175_c1_227_991 | 245 |
| 621 | 3300050492 | nmdc:mga0yw44_175534_c1 | nmdc:mga0yw44_175534_c1_403_1146 | 245 |
| 622 | 3300050510 | nmdc:mga06r32_25_c5 | nmdc:mga06r32_25_c5_2686_3453 | 245 |
| 623 | 3300053085 | Ga0495619_0100016 | Ga0495619_0100016_104_871 | 245 |
| 624 | 3300053117 | Ga0500593_000495 | Ga0500593_000495_5080_5823 | 245 |
| 625 | 3300053136 | Ga0500559_0010136 | Ga0500559_0010136_1934_2698 | 245 |
| 626 | iso_pu_bacteria | 2585427649 | 2586064174 | 245 |
| 627 | iso_pu_bacteria | 2643221561 | 2643823872 | 245 |
| 628 | iso_pu_bacteria | 2643221696 | 2644533148 | 245 |
| 629 | iso_pu_bacteria | 2758568522 | 2760304130 | 245 |
| 630 | iso_pu_bacteria | 2808606522 | 2809586579 | 245 |
| 631 | iso_pu_bacteria | 2866612099 | 2866618749 | 245 |
| 632 | iso_pu_bacteria | 2915768154 | 2915772472 | 245 |
| 633 | iso_pu_bacteria | 2919051321 | 2919052322 | 245 |
| 634 | 3300005329 | Ga0070683_100076950 | Ga0070683_1000769504 | 246 |
| 635 | 3300005329 | Ga0070683_100142803 | Ga0070683_1001428034 | 246 |
| 636 | 3300005338 | Ga0068868_100085485 | Ga0068868_1000854853 | 246 |
| 637 | 3300005338 | Ga0068868_100316406 | Ga0068868_1003164062 | 246 |
| 638 | 3300005340 | Ga0070689_100337479 | Ga0070689_1003374791 | 246 |
| 639 | 3300005341 | Ga0070691_10048738 | Ga0070691_100487382 | 246 |
| 640 | 3300005434 | Ga0070709_10120178 | Ga0070709_101201782 | 246 |
| 641 | 3300005434 | Ga0070709_10153756 | Ga0070709_101537562 | 246 |
| 642 | 3300005435 | Ga0070714_100032019 | Ga0070714_1000320193 | 246 |
| 643 | 3300005435 | Ga0070714_100075811 | Ga0070714_1000758113 | 246 |
| 644 | 3300005436 | Ga0070713_100048185 | Ga0070713_1000481853 | 246 |
| 645 | 3300005437 | Ga0070710_10000110 | Ga0070710_100001102 | 246 |
| 646 | 3300005437 | Ga0070710_10029562 | Ga0070710_100295622 | 246 |
| 647 | 3300005468 | Ga0070707_100174553 | Ga0070707_1001745532 | 246 |
| 648 | 3300005547 | Ga0070693_100133991 | Ga0070693_1001339911 | 246 |
| 649 | 3300005548 | Ga0070665_100164425 | Ga0070665_1001644253 | 246 |
| 650 | 3300005614 | Ga0068856_100017536 | Ga0068856_1000175364 | 246 |
| 651 | 3300005614 | Ga0068856_100246752 | Ga0068856_1002467523 | 246 |
| 652 | 3300005617 | Ga0068859_100251991 | Ga0068859_1002519912 | 246 |
| 653 | 3300006237 | Ga0097621_100107429 | Ga0097621_1001074292 | 246 |
| 654 | 3300006871 | Ga0075434_100664633 | Ga0075434_1006646332 | 246 |
| 655 | 3300006931 | Ga0097620_100251979 | Ga0097620_1002519792 | 246 |
| 656 | 3300009098 | Ga0105245_10008971 | Ga0105245_100089717 | 246 |
| 657 | 3300009098 | Ga0105245_10092041 | Ga0105245_100920414 | 246 |
| 658 | 3300009984 | Ga0105029_100937 | Ga0105029_1009372 | 246 |
| 659 | 3300010375 | Ga0105239_10534251 | Ga0105239_105342512 | 246 |
| 660 | 3300010375 | Ga0105239_10545572 | Ga0105239_105455722 | 246 |
| 661 | 3300013105 | Ga0157369_10056458 | Ga0157369_100564583 | 246 |
| 662 | 3300013105 | Ga0157369_10285744 | Ga0157369_102857442 | 246 |
| 663 | 3300014325 | Ga0163163_10117504 | Ga0163163_101175043 | 246 |
| 664 | 3300014968 | Ga0157379_10215891 | Ga0157379_102158912 | 246 |
| 665 | 3300025898 | Ga0207692_10002246 | Ga0207692_100022467 | 246 |
| 666 | 3300025906 | Ga0207699_10053315 | Ga0207699_100533152 | 246 |
| 667 | 3300025906 | Ga0207699_10217962 | Ga0207699_102179622 | 246 |
| 668 | 3300025915 | Ga0207693_10116707 | Ga0207693_101167071 | 246 |
| 669 | 3300025916 | Ga0207663_10025992 | Ga0207663_100259922 | 246 |
| 670 | 3300025916 | Ga0207663_10219202 | Ga0207663_102192021 | 246 |
| 671 | 3300025922 | Ga0207646_10113058 | Ga0207646_101130583 | 246 |
| 672 | 3300025927 | Ga0207687_10051896 | Ga0207687_100518964 | 246 |
| 673 | 3300025929 | Ga0207664_10019581 | Ga0207664_100195814 | 246 |
| 674 | 3300025939 | Ga0207665_10041270 | Ga0207665_100412704 | 246 |
| 675 | 3300025939 | Ga0207665_10208681 | Ga0207665_102086812 | 246 |
| 676 | 3300025941 | Ga0207711_10401917 | Ga0207711_104019172 | 246 |
| 677 | 3300025944 | Ga0207661_10081310 | Ga0207661_100813104 | 246 |
| 678 | 3300025944 | Ga0207661_10111775 | Ga0207661_101117753 | 246 |
| 679 | 3300026023 | Ga0207677_10249208 | Ga0207677_102492083 | 246 |
| 680 | 3300026067 | Ga0207678_10458816 | Ga0207678_104588161 | 246 |
| 681 | 3300026078 | Ga0207702_10024539 | Ga0207702_100245393 | 246 |
| 682 | 3300026078 | Ga0207702_10045767 | Ga0207702_100457675 | 246 |
| 683 | 3300026078 | Ga0207702_10454666 | Ga0207702_104546662 | 246 |
| 684 | 3300026095 | Ga0207676_10166098 | Ga0207676_101660983 | 246 |
| 685 | 3300026116 | Ga0207674_10452659 | Ga0207674_104526592 | 246 |
| 686 | 3300028379 | Ga0268266_10221566 | Ga0268266_102215662 | 246 |
| 687 | 3300030732 | Ga0316176_1032343 | Ga0316176_10323434 | 246 |
| 688 | 3300030733 | Ga0314311_1097076 | Ga0314311_10970763 | 246 |
| 689 | 3300030736 | Ga0316180_1110667 | Ga0316180_11106672 | 246 |
| 690 | 3300031456 | Ga0307513_10000392 | Ga0307513_1000039258 | 246 |
| 691 | 3300031995 | Ga0307409_100201796 | Ga0307409_1002017962 | 246 |
| 692 | 3300035086 | Ga0373934_0151833 | Ga0373934_0151833_49_816 | 246 |
| 693 | 3300035410 | Ga0373924_0002250 | Ga0373924_0002250_5496_6260 | 246 |
| 694 | 3300035692 | Ga0373935_0017081 | Ga0373935_0017081_1528_2292 | 246 |
| 695 | 3300035725 | Ga0373947_0291097 | Ga0373947_0291097_138_902 | 246 |
| 696 | 3300036401 | Ga0373937_0273255 | Ga0373937_0273255_607_1371 | 246 |
| 697 | 3300037068 | Ga0373925_0038674 | Ga0373925_0038674_2284_3048 | 246 |
| 698 | 3300044683 | Ga0466965_0002838 | Ga0466965_0002838_2514_3290 | 246 |
| 699 | 3300044901 | Ga0466960_0248867 | Ga0466960_0248867_136_912 | 246 |
| 700 | 3300046454 | Ga0495592_0008325 | Ga0495592_0008325_6143_6907 | 246 |
| 701 | 3300046461 | Ga0495641_0085193 | Ga0495641_0085193_527_1291 | 246 |
| 702 | 3300046462 | Ga0495651_0004271 | Ga0495651_0004271_8899_9663 | 246 |
| 703 | 3300046463 | Ga0495653_0027763 | Ga0495653_0027763_1029_1793 | 246 |
| 704 | 3300046476 | Ga0495662_0014270 | Ga0495662_0014270_727_1491 | 246 |
| 705 | 3300046477 | Ga0495664_0096395 | Ga0495664_0096395_141_905 | 246 |
| 706 | 3300046517 | Ga0495630_0106817 | Ga0495630_0106817_875_1639 | 246 |
| 707 | 3300046529 | Ga0495652_0059454 | Ga0495652_0059454_876_1640 | 246 |
| 708 | 3300046531 | Ga0495665_0122317 | Ga0495665_0122317_247_1011 | 246 |
| 709 | 3300046536 | Ga0495587_0010134 | Ga0495587_0010134_602_1366 | 246 |
| 710 | 3300046543 | Ga0495645_0100392 | Ga0495645_0100392_922_1686 | 246 |
| 711 | 3300046559 | Ga0495667_0032299 | Ga0495667_0032299_1870_2634 | 246 |
| 712 | 3300046642 | Ga0495634_0083921 | Ga0495634_0083921_48_812 | 246 |
| 713 | 3300046663 | Ga0495635_0016781 | Ga0495635_0016781_2700_3464 | 246 |
| 714 | 3300046675 | Ga0495657_0028878 | Ga0495657_0028878_2319_3083 | 246 |
| 715 | 3300046678 | Ga0495599_0024734 | Ga0495599_0024734_1018_1782 | 246 |
| 716 | 3300046680 | Ga0495646_0016368 | Ga0495646_0016368_2768_3532 | 246 |
| 717 | 3300047315 | Ga0495581_0164520 | Ga0495581_0164520_309_1073 | 246 |
| 718 | 3300047317 | Ga0495604_0033209 | Ga0495604_0033209_2720_3484 | 246 |
| 719 | 3300047319 | Ga0495674_0066113 | Ga0495674_0066113_1675_2439 | 246 |
| 720 | 3300047322 | Ga0495680_0049559 | Ga0495680_0049559_1611_2375 | 246 |
| 721 | 3300047322 | Ga0495680_0122562 | Ga0495680_0122562_963_1727 | 246 |
| 722 | 3300047444 | Ga0495675_0165320 | Ga0495675_0165320_516_1280 | 246 |
| 723 | 3300047471 | Ga0495684_0006300 | Ga0495684_0006300_1372_2136 | 246 |
| 724 | 3300047673 | Ga0495593_0098860 | Ga0495593_0098860_450_1214 | 246 |
| 725 | 3300048088 | Ga0495602_0105049 | Ga0495602_0105049_1059_1823 | 246 |
| 726 | 3300048905 | Ga0496102_0007250 | Ga0496102_0007250_6312_7100 | 246 |
| 727 | 3300048906 | Ga0496103_0071169 | Ga0496103_0071169_988_1776 | 246 |
| 728 | 3300048907 | Ga0496104_0189401 | Ga0496104_0189401_414_1202 | 246 |
| 729 | 3300048909 | Ga0496106_0005157 | Ga0496106_0005157_6182_6970 | 246 |
| 730 | 3300048910 | Ga0496107_0052965 | Ga0496107_0052965_621_1409 | 246 |
| 731 | 3300048911 | Ga0496108_0013702 | Ga0496108_0013702_291_1115 | 246 |
| 732 | 3300048911 | Ga0496108_0306050 | Ga0496108_0306050_500_1330 | 246 |
| 733 | 3300048912 | Ga0496109_0019679 | Ga0496109_0019679_4115_4939 | 246 |
| 734 | 3300048912 | Ga0496109_0074084 | Ga0496109_0074084_2171_2959 | 246 |
| 735 | 3300048913 | Ga0496110_0053852 | Ga0496110_0053852_1572_2396 | 246 |
| 736 | 3300048913 | Ga0496110_0147815 | Ga0496110_0147815_813_1601 | 246 |
| 737 | 3300049571 | Ga0501034_0112269 | Ga0501034_0112269_1691_2575 | 246 |
| 738 | 3300049573 | Ga0501037_0097069 | Ga0501037_0097069_356_1189 | 246 |
| 739 | 3300049574 | Ga0501038_0009638 | Ga0501038_0009638_2534_3367 | 246 |
| 740 | 3300049575 | Ga0501039_0022756 | Ga0501039_0022756_776_1609 | 246 |
| 741 | 3300049580 | Ga0501046_0008983 | Ga0501046_0008983_4306_5139 | 246 |
| 742 | 3300049583 | Ga0501067_0005438 | Ga0501067_0005438_4237_5103 | 246 |
| 743 | 3300049584 | Ga0501068_0007312 | Ga0501068_0007312_82_888 | 246 |
| 744 | 3300049586 | Ga0501070_0016316 | Ga0501070_0016316_218_1048 | 246 |
| 745 | 3300049586 | Ga0501070_0508838 | Ga0501070_0508838_74_907 | 246 |
| 746 | 3300049741 | Ga0501079_0106969 | Ga0501079_0106969_57_845 | 246 |
| 747 | 3300049822 | Ga0501035_0175513 | Ga0501035_0175513_804_1637 | 246 |
| 748 | 3300049823 | Ga0501044_0067638 | Ga0501044_0067638_1826_2659 | 246 |
| 749 | 3300050513 | nmdc:mga0rr50_193199_c1 | nmdc:mga0rr50_193199_c1_428_1195 | 246 |
| 750 | 3300053077 | Ga0495601_0021026 | Ga0495601_0021026_3193_3957 | 246 |
| 751 | 3300053084 | Ga0495595_0057895 | Ga0495595_0057895_830_1594 | 246 |
| 752 | 3300060353 | Ga0501082_0019033 | Ga0501082_0019033_4062_4892 | 246 |
| 753 | 3300060353 | Ga0501082_0254891 | Ga0501082_0254891_111_899 | 246 |
| 754 | 3300061734 | Ga0530510_0087180 | Ga0530510_0087180_385_1173 | 246 |
| 755 | 3300003285 | Ga0007423J48922_100135 | Ga0007423J48922_1001354 | 247 |
| 756 | 3300003285 | Ga0007423J48922_100136 | Ga0007423J48922_1001368 | 247 |
| 757 | 3300011119 | Ga0105246_10023835 | Ga0105246_100238353 | 247 |
| 758 | 3300013102 | Ga0157371_10395019 | Ga0157371_103950192 | 247 |
| 759 | 3300013308 | Ga0157375_10115648 | Ga0157375_101156482 | 247 |
| 760 | 3300013308 | Ga0157375_10745323 | Ga0157375_107453232 | 247 |
| 761 | 3300020082 | Ga0206353_11505532 | Ga0206353_115055323 | 247 |
| 762 | 3300024227 | Ga0228598_1014053 | Ga0228598_10140532 | 247 |
| 763 | 3300025929 | Ga0207664_10162938 | Ga0207664_101629381 | 247 |
| 764 | 3300026035 | Ga0207703_10022437 | Ga0207703_100224374 | 247 |
| 765 | 3300032002 | Ga0307416_100513845 | Ga0307416_1005138452 | 247 |
| 766 | 3300037312 | Ga0395899_0037638 | Ga0395899_0037638_2768_3556 | 247 |
| 767 | 3300037418 | Ga0395900_0115423 | Ga0395900_0115423_640_1428 | 247 |
| 768 | 3300037466 | Ga0395898_0085821 | Ga0395898_0085821_1567_2355 | 247 |
| 769 | 3300038443 | Ga0395901_0823490 | Ga0395901_0823490_48_836 | 247 |
| 770 | 3300044656 | Ga0466969_0001083 | Ga0466969_0001083_655_1476 | 247 |
| 771 | 3300044656 | Ga0466969_0006586 | Ga0466969_0006586_4890_5711 | 247 |
| 772 | 3300044684 | Ga0466966_0116967 | Ga0466966_0116967_569_1390 | 247 |
| 773 | 3300044693 | Ga0466961_0093951 | Ga0466961_0093951_619_1440 | 247 |
| 774 | 3300044693 | Ga0466961_0145608 | Ga0466961_0145608_571_1359 | 247 |
| 775 | 3300044694 | Ga0466963_0044204 | Ga0466963_0044204_288_1076 | 247 |
| 776 | 3300044719 | Ga0466971_0019727 | Ga0466971_0019727_1631_2452 | 247 |
| 777 | 3300045836 | Ga0466958_0233149 | Ga0466958_0233149_294_1115 | 247 |
| 778 | 3300045976 | Ga0466967_0018422 | Ga0466967_0018422_92_880 | 247 |
| 779 | 3300048912 | Ga0496109_0563039 | Ga0496109_0563039_157_1020 | 247 |
| 780 | 3300048915 | Ga0496112_0183193 | Ga0496112_0183193_1153_2016 | 247 |
| 781 | 3300048915 | Ga0496112_0805776 | Ga0496112_0805776_35_778 | 247 |
| 782 | 3300048916 | Ga0496113_0258008 | Ga0496113_0258008_281_1144 | 247 |
| 783 | 3300049569 | Ga0501032_0328983 | Ga0501032_0328983_117_884 | 247 |
| 784 | 3300061719 | Ga0466962_0034456 | Ga0466962_0034456_1051_1872 | 247 |
| 785 | 3300061719 | Ga0466962_0170881 | Ga0466962_0170881_56_844 | 247 |
| 786 | 3300061734 | Ga0530510_0337886 | Ga0530510_0337886_349_1119 | 247 |
| 787 | iso_pu_bacteria | 2515154155 | 2515852792 | 247 |
| 788 | iso_pu_bacteria | 2643221641 | 2644231095 | 247 |
| 789 | iso_pu_bacteria | 2990256926 | 2990257840 | 247 |
| 790 | 3300005356 | Ga0070674_100075935 | Ga0070674_1000759352 | 248 |
| 791 | 3300005455 | Ga0070663_100002222 | Ga0070663_1000022224 | 248 |
| 792 | 3300025929 | Ga0207664_10003068 | Ga0207664_1000306810 | 248 |
| 793 | 3300025937 | Ga0207669_10216814 | Ga0207669_102168142 | 248 |
| 794 | 3300031903 | Ga0307407_10066021 | Ga0307407_100660212 | 248 |
| 795 | 3300032004 | Ga0307414_10277056 | Ga0307414_102770562 | 248 |
| 796 | 3300032126 | Ga0307415_100279912 | Ga0307415_1002799122 | 248 |
| 797 | 3300037418 | Ga0395900_0043272 | Ga0395900_0043272_3193_4068 | 248 |
| 798 | 3300037466 | Ga0395898_0085701 | Ga0395898_0085701_564_1439 | 248 |
| 799 | 3300037471 | Ga0395905_0058695 | Ga0395905_0058695_151_1026 | 248 |
| 800 | 3300038443 | Ga0395901_0133437 | Ga0395901_0133437_1033_1908 | 248 |
| 801 | 3300048907 | Ga0496104_0237372 | Ga0496104_0237372_688_1518 | 248 |
| 802 | 3300048908 | Ga0496105_0299843 | Ga0496105_0299843_354_1184 | 248 |
| 803 | 3300048911 | Ga0496108_0101916 | Ga0496108_0101916_1016_1846 | 248 |
| 804 | 3300048912 | Ga0496109_0106880 | Ga0496109_0106880_684_1514 | 248 |
| 805 | 3300048913 | Ga0496110_0012282 | Ga0496110_0012282_851_1681 | 248 |
| 806 | 3300048914 | Ga0496111_0124503 | Ga0496111_0124503_25_855 | 248 |
| 807 | 3300048917 | Ga0496114_0243599 | Ga0496114_0243599_706_1536 | 248 |
| 808 | 3300048920 | Ga0496117_0023817 | Ga0496117_0023817_1731_2612 | 248 |
| 809 | 3300048921 | Ga0496118_0052720 | Ga0496118_0052720_2150_3031 | 248 |
| 810 | 3300048925 | Ga0496122_0001262 | Ga0496122_0001262_9649_10530 | 248 |
| 811 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_137570_138451 | 248 |
| 812 | 3300049585 | Ga0501069_0195202 | Ga0501069_0195202_46_876 | 248 |
| 813 | 3300049587 | Ga0501071_0006094 | Ga0501071_0006094_1600_2430 | 248 |
| 814 | 3300049590 | Ga0501074_0073462 | Ga0501074_0073462_57_887 | 248 |
| 815 | 3300049593 | Ga0501077_0009157 | Ga0501077_0009157_2672_3514 | 248 |
| 816 | 3300049742 | Ga0501080_0005549 | Ga0501080_0005549_655_1485 | 248 |
| 817 | 3300049744 | Ga0501083_0201075 | Ga0501083_0201075_51_881 | 248 |
| 818 | 3300054114 | Ga0501084_0045045 | Ga0501084_0045045_1239_2069 | 248 |
| 819 | iso_pu_bacteria | 2842888712 | 2842890906 | 248 |
| 820 | 3300001990 | JGI24737J22298_10079755 | JGI24737J22298_100797552 | 249 |
| 821 | 3300005329 | Ga0070683_100000566 | Ga0070683_1000005662 | 249 |
| 822 | 3300005337 | Ga0070682_100135192 | Ga0070682_1001351922 | 249 |
| 823 | 3300005345 | Ga0070692_10117298 | Ga0070692_101172983 | 249 |
| 824 | 3300005366 | Ga0070659_100027577 | Ga0070659_1000275774 | 249 |
| 825 | 3300005456 | Ga0070678_100053128 | Ga0070678_1000531284 | 249 |
| 826 | 3300005530 | Ga0070679_100461587 | Ga0070679_1004615872 | 249 |
| 827 | 3300005535 | Ga0070684_100001014 | Ga0070684_10000101419 | 249 |
| 828 | 3300005548 | Ga0070665_100168244 | Ga0070665_1001682443 | 249 |
| 829 | 3300005564 | Ga0070664_100129421 | Ga0070664_1001294212 | 249 |
| 830 | 3300005614 | Ga0068856_100031077 | Ga0068856_1000310774 | 249 |
| 831 | 3300005615 | Ga0070702_100029423 | Ga0070702_1000294233 | 249 |
| 832 | 3300005616 | Ga0068852_100068923 | Ga0068852_1000689232 | 249 |
| 833 | 3300005618 | Ga0068864_100136908 | Ga0068864_1001369082 | 249 |
| 834 | 3300005842 | Ga0068858_100016437 | Ga0068858_1000164379 | 249 |
| 835 | 3300005844 | Ga0068862_100298310 | Ga0068862_1002983102 | 249 |
| 836 | 3300006881 | Ga0068865_100280703 | Ga0068865_1002807032 | 249 |
| 837 | 3300009545 | Ga0105237_10286426 | Ga0105237_102864263 | 249 |
| 838 | 3300011119 | Ga0105246_10000393 | Ga0105246_100003932 | 249 |
| 839 | 3300013297 | Ga0157378_10830299 | Ga0157378_108302991 | 249 |
| 840 | 3300013306 | Ga0163162_10020330 | Ga0163162_100203307 | 249 |
| 841 | 3300013307 | Ga0157372_10002293 | Ga0157372_1000229321 | 249 |
| 842 | 3300013308 | Ga0157375_10054232 | Ga0157375_100542324 | 249 |
| 843 | 3300014325 | Ga0163163_10052960 | Ga0163163_100529602 | 249 |
| 844 | 3300014325 | Ga0163163_10315058 | Ga0163163_103150582 | 249 |
| 845 | 3300014745 | Ga0157377_10091425 | Ga0157377_100914252 | 249 |
| 846 | 3300014968 | Ga0157379_10026044 | Ga0157379_100260443 | 249 |
| 847 | 3300025901 | Ga0207688_10034271 | Ga0207688_100342715 | 249 |
| 848 | 3300025919 | Ga0207657_10022465 | Ga0207657_100224654 | 249 |
| 849 | 3300025927 | Ga0207687_10437597 | Ga0207687_104375972 | 249 |
| 850 | 3300025938 | Ga0207704_10021494 | Ga0207704_100214944 | 249 |
| 851 | 3300025944 | Ga0207661_10079084 | Ga0207661_100790844 | 249 |
| 852 | 3300025945 | Ga0207679_10318695 | Ga0207679_103186952 | 249 |
| 853 | 3300026035 | Ga0207703_10045242 | Ga0207703_100452423 | 249 |
| 854 | 3300026088 | Ga0207641_10041488 | Ga0207641_100414882 | 249 |
| 855 | 3300026142 | Ga0207698_10123641 | Ga0207698_101236412 | 249 |
| 856 | 3300031456 | Ga0307513_10172807 | Ga0307513_101728072 | 249 |
| 857 | 3300031691 | Ga0316579_10003042 | Ga0316579_100030422 | 249 |
| 858 | 3300031727 | Ga0316576_10009982 | Ga0316576_100099824 | 249 |
| 859 | 3300031728 | Ga0316578_10024171 | Ga0316578_100241712 | 249 |
| 860 | 3300031733 | Ga0316577_10034039 | Ga0316577_100340394 | 249 |
| 861 | 3300032139 | Ga0316580_10008578 | Ga0316580_100085783 | 249 |
| 862 | 3300035119 | Ga0373956_0171815 | Ga0373956_0171815_162_968 | 249 |
| 863 | 3300035172 | Ga0373955_0048265 | Ga0373955_0048265_1244_2050 | 249 |
| 864 | 3300035398 | Ga0316574_0023602 | Ga0316574_0023602_1290_2090 | 249 |
| 865 | 3300035398 | Ga0316574_0418525 | Ga0316574_0418525_25_825 | 249 |
| 866 | 3300035724 | Ga0373933_0004233 | Ga0373933_0004233_3542_4348 | 249 |
| 867 | 3300036401 | Ga0373937_0027294 | Ga0373937_0027294_472_1278 | 249 |
| 868 | 3300036647 | Ga0316582_0003824 | Ga0316582_0003824_5447_6247 | 249 |
| 869 | 3300036712 | Ga0316584_0096972 | Ga0316584_0096972_436_1236 | 249 |
| 870 | 3300037068 | Ga0373925_0032460 | Ga0373925_0032460_2818_3624 | 249 |
| 871 | 3300039450 | Ga0436363_1570492 | Ga0436363_1570492_129_905 | 249 |
| 872 | 3300041410 | Ga0439461_0002938 | Ga0439461_0002938_1050_1844 | 249 |
| 873 | 3300041997 | Ga0439431_0029799 | Ga0439431_0029799_175_969 | 249 |
| 874 | 3300042156 | Ga0439446_0053129 | Ga0439446_0053129_331_1125 | 249 |
| 875 | 3300042435 | Ga0439434_0085695 | Ga0439434_0085695_84_878 | 249 |
| 876 | 3300044694 | Ga0466963_0072424 | Ga0466963_0072424_468_1262 | 249 |
| 877 | 3300044842 | Ga0466957_0029833 | Ga0466957_0029833_2379_3173 | 249 |
| 878 | 3300045049 | Ga0466959_0144489 | Ga0466959_0144489_436_1230 | 249 |
| 879 | 3300045836 | Ga0466958_0067667 | Ga0466958_0067667_893_1687 | 249 |
| 880 | 3300045976 | Ga0466967_0011278 | Ga0466967_0011278_4242_5036 | 249 |
| 881 | 3300046454 | Ga0495592_0002920 | Ga0495592_0002920_9498_10304 | 249 |
| 882 | 3300046462 | Ga0495651_0000665 | Ga0495651_0000665_2079_2885 | 249 |
| 883 | 3300046463 | Ga0495653_0010781 | Ga0495653_0010781_1652_2458 | 249 |
| 884 | 3300046473 | Ga0495582_0083357 | Ga0495582_0083357_930_1739 | 249 |
| 885 | 3300046511 | Ga0495608_0003307 | Ga0495608_0003307_6049_6855 | 249 |
| 886 | 3300046514 | Ga0495618_0034383 | Ga0495618_0034383_2328_3134 | 249 |
| 887 | 3300046516 | Ga0495628_0007504 | Ga0495628_0007504_4707_5513 | 249 |
| 888 | 3300046529 | Ga0495652_0002616 | Ga0495652_0002616_12372_13178 | 249 |
| 889 | 3300046533 | Ga0495640_0074680 | Ga0495640_0074680_985_1791 | 249 |
| 890 | 3300046536 | Ga0495587_0009180 | Ga0495587_0009180_1782_2588 | 249 |
| 891 | 3300046543 | Ga0495645_0025816 | Ga0495645_0025816_215_1021 | 249 |
| 892 | 3300046559 | Ga0495667_0005202 | Ga0495667_0005202_5073_5879 | 249 |
| 893 | 3300046663 | Ga0495635_0035773 | Ga0495635_0035773_327_1133 | 249 |
| 894 | 3300046675 | Ga0495657_0004268 | Ga0495657_0004268_5221_6027 | 249 |
| 895 | 3300046678 | Ga0495599_0045954 | Ga0495599_0045954_1424_2230 | 249 |
| 896 | 3300046679 | Ga0495623_0043076 | Ga0495623_0043076_1848_2654 | 249 |
| 897 | 3300046809 | Ga0495600_0038154 | Ga0495600_0038154_1968_2774 | 249 |
| 898 | 3300047317 | Ga0495604_0003408 | Ga0495604_0003408_4841_5647 | 249 |
| 899 | 3300047319 | Ga0495674_0013538 | Ga0495674_0013538_6430_7236 | 249 |
| 900 | 3300047322 | Ga0495680_0016142 | Ga0495680_0016142_1263_2069 | 249 |
| 901 | 3300047444 | Ga0495675_0006523 | Ga0495675_0006523_4284_5090 | 249 |
| 902 | 3300048088 | Ga0495602_0004314 | Ga0495602_0004314_9657_10463 | 249 |
| 903 | 3300048905 | Ga0496102_0004193 | Ga0496102_0004193_6242_7000 | 249 |
| 904 | 3300048906 | Ga0496103_0112927 | Ga0496103_0112927_697_1455 | 249 |
| 905 | 3300048909 | Ga0496106_0066893 | Ga0496106_0066893_1115_1873 | 249 |
| 906 | 3300048914 | Ga0496111_0002891 | Ga0496111_0002891_6106_6864 | 249 |
| 907 | 3300049585 | Ga0501069_0285394 | Ga0501069_0285394_99_857 | 249 |
| 908 | 3300049586 | Ga0501070_0000826 | Ga0501070_0000826_14405_15163 | 249 |
| 909 | 3300049590 | Ga0501074_0018526 | Ga0501074_0018526_2243_3001 | 249 |
| 910 | 3300049592 | Ga0501076_0208177 | Ga0501076_0208177_685_1464 | 249 |
| 911 | 3300049742 | Ga0501080_0062281 | Ga0501080_0062281_1926_2684 | 249 |
| 912 | 3300053077 | Ga0495601_0241111 | Ga0495601_0241111_47_853 | 249 |
| 913 | 3300053085 | Ga0495619_0030545 | Ga0495619_0030545_220_1026 | 249 |
| 914 | 3300054114 | Ga0501084_0633347 | Ga0501084_0633347_97_876 | 249 |
| 915 | 3300061719 | Ga0466962_0032854 | Ga0466962_0032854_1504_2298 | 249 |
| 916 | iso_pu_bacteria | 2974315732 | 2974318221 | 249 |
| 917 | iso_pu_bacteria | 2984523437 | 2984526433 | 249 |
| 918 | 3300005336 | Ga0070680_100006434 | Ga0070680_1000064345 | 250 |
| 919 | 3300005339 | Ga0070660_100051362 | Ga0070660_1000513625 | 250 |
| 920 | 3300005445 | Ga0070708_100492719 | Ga0070708_1004927191 | 250 |
| 921 | 3300005458 | Ga0070681_10036203 | Ga0070681_100362036 | 250 |
| 922 | 3300005468 | Ga0070707_100049564 | Ga0070707_1000495645 | 250 |
| 923 | 3300005530 | Ga0070679_100066386 | Ga0070679_1000663862 | 250 |
| 924 | 3300013105 | Ga0157369_10326345 | Ga0157369_103263452 | 250 |
| 925 | 3300014497 | Ga0182008_10130389 | Ga0182008_101303892 | 250 |
| 926 | 3300020070 | Ga0206356_10646937 | Ga0206356_106469372 | 250 |
| 927 | 3300020082 | Ga0206353_11333670 | Ga0206353_113336708 | 250 |
| 928 | 3300025909 | Ga0207705_10016121 | Ga0207705_100161214 | 250 |
| 929 | 3300025910 | Ga0207684_10349341 | Ga0207684_103493412 | 250 |
| 930 | 3300025912 | Ga0207707_10016421 | Ga0207707_100164215 | 250 |
| 931 | 3300025917 | Ga0207660_10031096 | Ga0207660_100310963 | 250 |
| 932 | 3300025919 | Ga0207657_10066348 | Ga0207657_100663485 | 250 |
| 933 | 3300025921 | Ga0207652_10025250 | Ga0207652_100252503 | 250 |
| 934 | 3300032002 | Ga0307416_100143194 | Ga0307416_1001431942 | 250 |
| 935 | 3300044693 | Ga0466961_0072814 | Ga0466961_0072814_599_1432 | 250 |
| 936 | 3300044901 | Ga0466960_0032218 | Ga0466960_0032218_669_1553 | 250 |
| 937 | 3300044901 | Ga0466960_0231615 | Ga0466960_0231615_87_962 | 250 |
| 938 | 3300045049 | Ga0466959_0101188 | Ga0466959_0101188_665_1498 | 250 |
| 939 | 3300048922 | Ga0496119_0082293 | Ga0496119_0082293_246_1079 | 250 |
| 940 | 3300050490 | nmdc:mga03n38_60085_c1 | nmdc:mga03n38_60085_c1_842_1657 | 250 |
| 941 | 3300059423 | Ga0590074_014999 | Ga0590074_014999_142_942 | 250 |
| 942 | 3300061734 | Ga0530510_0076967 | Ga0530510_0076967_734_1534 | 250 |
| 943 | iso_pu_bacteria | 2808606365 | 2808873103 | 250 |
| 944 | iso_pu_bacteria | 2919446982 | 2919449422 | 250 |
| 945 | 3300005329 | Ga0070683_100640632 | Ga0070683_1006406321 | 251 |
| 946 | 3300013296 | Ga0157374_10793707 | Ga0157374_107937071 | 251 |
| 947 | 3300014969 | Ga0157376_10351081 | Ga0157376_103510812 | 251 |
| 948 | 3300025935 | Ga0207709_10294594 | Ga0207709_102945941 | 251 |
| 949 | 3300046455 | Ga0495603_0135198 | Ga0495603_0135198_404_1177 | 251 |
| 950 | 3300046683 | Ga0495658_0128370 | Ga0495658_0128370_139_912 | 251 |
| 951 | 3300048905 | Ga0496102_0004007 | Ga0496102_0004007_4332_5147 | 251 |
| 952 | 3300048906 | Ga0496103_0008868 | Ga0496103_0008868_2572_3387 | 251 |
| 953 | 3300049572 | Ga0501036_0154174 | Ga0501036_0154174_982_1794 | 251 |
| 954 | 3300049574 | Ga0501038_0131945 | Ga0501038_0131945_70_948 | 251 |
| 955 | 3300049575 | Ga0501039_0028773 | Ga0501039_0028773_3033_3911 | 251 |
| 956 | 3300049576 | Ga0501040_0052052 | Ga0501040_0052052_786_1664 | 251 |
| 957 | 3300049577 | Ga0501041_0066301 | Ga0501041_0066301_1077_1955 | 251 |
| 958 | 3300049578 | Ga0501042_0042602 | Ga0501042_0042602_1973_2851 | 251 |
| 959 | 3300049580 | Ga0501046_0134549 | Ga0501046_0134549_799_1677 | 251 |
| 960 | 3300049582 | Ga0501048_0192033 | Ga0501048_0192033_390_1268 | 251 |
| 961 | 3300049584 | Ga0501068_0042383 | Ga0501068_0042383_1927_2700 | 251 |
| 962 | 3300049586 | Ga0501070_0033719 | Ga0501070_0033719_533_1306 | 251 |
| 963 | 3300049588 | Ga0501072_0174638 | Ga0501072_0174638_678_1493 | 251 |
| 964 | 3300049590 | Ga0501074_0024371 | Ga0501074_0024371_2170_2943 | 251 |
| 965 | 3300049590 | Ga0501074_0033786 | Ga0501074_0033786_1379_2257 | 251 |
| 966 | 3300049591 | Ga0501075_0069104 | Ga0501075_0069104_456_1334 | 251 |
| 967 | 3300049592 | Ga0501076_0279083 | Ga0501076_0279083_439_1254 | 251 |
| 968 | 3300049593 | Ga0501077_0054018 | Ga0501077_0054018_994_1767 | 251 |
| 969 | 3300049742 | Ga0501080_0010859 | Ga0501080_0010859_2436_3209 | 251 |
| 970 | 3300049743 | Ga0501081_0012217 | Ga0501081_0012217_3604_4482 | 251 |
| 971 | 3300049744 | Ga0501083_0009218 | Ga0501083_0009218_5018_5791 | 251 |
| 972 | 3300049822 | Ga0501035_0065325 | Ga0501035_0065325_2053_2826 | 251 |
| 973 | 3300049824 | Ga0501045_0007317 | Ga0501045_0007317_4123_5001 | 251 |
| 974 | 3300049824 | Ga0501045_0377572 | Ga0501045_0377572_130_942 | 251 |
| 975 | 3300053139 | Ga0500568_0018960 | Ga0500568_0018960_39_863 | 251 |
| 976 | 3300060353 | Ga0501082_0096102 | Ga0501082_0096102_1289_2167 | 251 |
| 977 | 3300005366 | Ga0070659_100215024 | Ga0070659_1002150242 | 252 |
| 978 | 3300009551 | Ga0105238_10465709 | Ga0105238_104657091 | 252 |
| 979 | 3300014497 | Ga0182008_10180851 | Ga0182008_101808512 | 252 |
| 980 | 3300044683 | Ga0466965_0030135 | Ga0466965_0030135_1121_1957 | 252 |
| 981 | 3300044706 | Ga0466964_0004033 | Ga0466964_0004033_2353_3189 | 252 |
| 982 | 3300044719 | Ga0466971_0012684 | Ga0466971_0012684_1722_2558 | 252 |
| 983 | 3300044765 | Ga0466970_0015639 | Ga0466970_0015639_2798_3634 | 252 |
| 984 | 3300044842 | Ga0466957_0017810 | Ga0466957_0017810_1744_2580 | 252 |
| 985 | 3300045976 | Ga0466967_0100982 | Ga0466967_0100982_1128_1964 | 252 |
| 986 | 3300048911 | Ga0496108_0144225 | Ga0496108_0144225_506_1306 | 252 |
| 987 | 3300048917 | Ga0496114_0101271 | Ga0496114_0101271_797_1627 | 252 |
| 988 | 3300061719 | Ga0466962_0010555 | Ga0466962_0010555_2222_3058 | 252 |
| 989 | 3300037312 | Ga0395899_0035350 | Ga0395899_0035350_2501_3358 | 253 |
| 990 | 3300035398 | Ga0316574_0031574 | Ga0316574_0031574_1722_2570 | 254 |
| 991 | 3300036712 | Ga0316584_0191619 | Ga0316584_0191619_185_1033 | 254 |
| 992 | 3300001979 | JGI24740J21852_10029076 | JGI24740J21852_100290763 | 255 |
| 993 | 3300005327 | Ga0070658_10410682 | Ga0070658_104106822 | 255 |
| 994 | 3300005339 | Ga0070660_100027131 | Ga0070660_1000271314 | 255 |
| 995 | 3300005530 | Ga0070679_100216410 | Ga0070679_1002164103 | 255 |
| 996 | 3300025909 | Ga0207705_10155486 | Ga0207705_101554862 | 255 |
| 997 | 3300025921 | Ga0207652_10171755 | Ga0207652_101717553 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wq3-assembly1.cif.gz_B-2 | crystal structure of type-ii log from corynebacterium glutamicum | 0.9609 | 41 | 247 |
| 5zi9-assembly1.cif.gz_A | crystal structure of type-ii log from streptomyces coelicolor a3 | 0.9603 | 40 | 244 |
| 5wq3-assembly1.cif.gz_C-3 | crystal structure of type-ii log from corynebacterium glutamicum | 0.9575 | 41 | 247 |
| 5wq3-assembly1.cif.gz_B-2 | crystal structure of type-ii log from corynebacterium glutamicum | 0.9472 | 41 | 247 |
| 5wq3-assembly1.cif.gz_C-3 | crystal structure of type-ii log from corynebacterium glutamicum | 0.9395 | 41 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5wq3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9778 | 46 | 247 | 3.40.50.450 |
| 5wq3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9682 | 46 | 247 | 3.40.50.450 |
| 1wekF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.936 | 47 | 241 | 3.40.50.450 |
| af_Q8I1V0_170_336_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9257 | 100 | 243 | 3.40.50.450 |
| 1wekF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9123 | 47 | 241 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A371LRB8-F1-model_v4 | TIGR00730 family Rossman fold protein | 0.9889 | 81 | 239 |
GO:0005829
GO:0009691 GO:0016787 |
| AF-A0A3A0FM09-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9857 | 54 | 247 |
GO:0005829
GO:0008714 GO:0009691 |
| AF-A0A7Y2ZJN8-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9829 | 54 | 247 |
GO:0005829
GO:0009691 GO:0016787 |
| AF-A0A378SHX5-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9824 | 50 | 246 |
GO:0005829
GO:0009691 GO:0102682 |
| AF-A0A6L3EY37-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9801 | 51 | 247 |
GO:0005829
GO:0009691 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar