F487702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 573 | 893 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_33851_c1|nmdc:mga03n38_33851_c1_61_1209 |
| Length | 382 |
| Sequence | MARHGGKRIQIGKIEFSHCLYFRTSCTDHDGLSHIAPGPILPAQRTTETIMKQRQLGKNGPKTSAIGLGAMGMSGMYGPADRAESIATIHAALEAGVTLIDTGDFYGMGHNEMLIGEALKGVPRDRFQISVKFGALRDPAGNWLGYDARPVAVKSALAYTLQRLGLDHIDIYRPSRLDPNVPIEDTVGAVAEMVKAGYVRHIGLSEIGAETIRRAAAVHPISDLQIEYSLISRGIEEQILPTLRELGIGVTAYGVLSRGLISGHWQAGTALAKGDFRGMSPRFQAENAARNLALVEALRAVAEARGASVAQVAIAWVAAQGADIVPLVGARRRDRLAEALGALDLELSTDDLAAIERAVPKGAASGSRYPERAMADLDSERT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 6 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 7 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 8 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 9 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 10 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 11 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 12 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 13 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 14 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 15 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 16 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 17 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 18 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 19 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 20 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 21 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 22 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 23 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 24 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 25 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 26 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 27 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 28 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 29 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 30 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 31 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 32 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 33 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 34 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 35 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 36 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 37 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 38 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 39 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 40 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 41 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 42 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 43 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 44 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 45 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 46 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 47 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 48 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 49 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 50 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 51 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 52 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 53 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 54 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 55 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 56 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 57 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 58 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 59 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 60 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 61 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 62 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 63 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 64 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 65 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 66 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 67 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 68 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 69 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 70 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 71 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 72 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 73 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 74 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 75 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 76 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 77 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 78 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 79 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 80 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 81 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 82 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 83 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 84 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 85 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 86 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 87 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 88 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 89 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 90 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 91 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 92 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 94 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 95 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 96 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 97 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 98 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 99 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 100 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 102 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 103 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 105 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 106 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 107 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 109 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 110 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 111 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 119 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 121 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 149 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 154 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 162 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 164 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 165 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 166 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 168 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 169 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 170 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 171 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 172 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 173 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 174 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 175 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 176 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 177 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 178 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 179 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 180 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 181 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 182 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 183 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 184 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 185 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 186 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 190 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 192 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 193 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 194 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 195 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 196 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 197 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 198 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 199 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 200 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 202 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 203 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 217 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 232 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 234 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 235 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 236 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 237 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 238 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 239 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 244 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 247 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 304 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 308 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 309 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 310 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 311 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 312 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 313 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 314 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 315 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 316 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 317 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 318 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 319 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 320 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 321 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 322 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 323 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 324 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 325 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 326 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 327 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 328 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 329 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 330 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 331 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 332 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 333 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 334 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 335 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 336 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 337 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 338 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 339 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 340 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 341 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 342 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 343 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 344 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 345 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 346 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 347 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 348 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 349 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 350 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 351 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 352 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 353 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 354 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 355 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 356 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 357 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 358 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 359 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 360 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 361 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 362 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 363 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 364 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 365 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 366 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 367 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 368 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 369 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 370 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 371 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 372 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 373 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 374 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 375 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 376 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 377 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 378 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 469 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 470 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 471 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 472 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 473 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 476 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 477 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 478 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 479 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 480 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 481 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 482 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 483 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 484 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 485 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 486 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 511 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 515 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 517 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 530 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 531 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 534 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 535 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 536 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 537 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 538 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 539 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 540 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 541 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 542 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 543 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 545 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 546 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 547 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 548 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 549 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 551 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 552 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 553 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 554 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 555 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 556 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 557 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 559 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 560 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 561 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 562 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 563 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 564 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 565 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 566 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 567 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 568 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 569 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 570 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 571 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 572 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 573 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.43 |
| Metatranscriptomes | 0.4 |
| Isolates | 10.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.57 |
| Nodule | 2.42 |
| Rhizoplane | 3.42 |
| Rhizosphere | 75.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10051184 | 3300001990 | Bacteria | 1254 |
| 2 | JGI24735J21928_10001861 | 3300002067 | Bacteria | 7399 |
| 3 | JGI24738J21930_10002057 | 3300002075 | Bacteria | 5393 |
| 4 | JGI24744J21845_10020508 | 3300002077 | Bacteria | 1303 |
| 5 | JGI25151J46595_10003611 | 3300003187 | Bacteria | 8460 |
| 6 | JGI25406J46586_10003682 | 3300003203 | Bacteria | 7184 |
| 7 | JGI25153J46596_10000059 | 3300003215 | Bacteria | 131871 |
| 8 | JGI25153J46596_10000347 | 3300003215 | Bacteria | 32342 |
| 9 | JGI25153J46596_10045284 | 3300003215 | Bacteria | 1314 |
| 10 | rootH1_10039975 | 3300003316 | Bacteria | 4505 |
| 11 | rootH1_10039975 | 3300003323 | Bacteria | 3576 |
| 12 | rootL2_10042670 | 3300003322 | Bacteria | 2560 |
| 13 | rootL2_10244431 | 3300003322 | Bacteria | 4542 |
| 14 | rootH1_10244174 | 3300003323 | Bacteria | 1338 |
| 15 | JGI25160J50197_1019999 | 3300003354 | Bacteria | 2034 |
| 16 | Ga0006562J51391_1039231 | 3300003578 | Bacteria | 1955 |
| 17 | Ga0006562J51391_1097249 | 3300003578 | Bacteria | 3250 |
| 18 | Ga0006562J51391_1097250 | 3300003578 | Bacteria | 4360 |
| 19 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 20 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 21 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 22 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 23 | Ga0055524_1003285 | 3300003775 | Bacteria | 7912 |
| 24 | Ga0055536_1002443 | 3300003781 | Bacteria | 10433 |
| 25 | Ga0055528_1003718 | 3300003790 | Bacteria | 7540 |
| 26 | Ga0055530_10000180 | 3300003791 | Bacteria | 57095 |
| 27 | Ga0055530_10000371 | 3300003791 | Bacteria | 40721 |
| 28 | Ga0055531_10000844 | 3300003794 | Bacteria | 25295 |
| 29 | Ga0055531_10020550 | 3300003794 | Bacteria | 2605 |
| 30 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 31 | Ga0065165_1000041 | 3300005262 | Bacteria | 203876 |
| 32 | Ga0065704_10001157 | 3300005289 | Bacteria | 9708 |
| 33 | Ga0070658_10023456 | 3300005327 | Bacteria | 4952 |
| 34 | Ga0070658_10486722 | 3300005327 | Bacteria | 1065 |
| 35 | Ga0070676_10005433 | 3300005328 | Bacteria | 6788 |
| 36 | Ga0070683_100044156 | 3300005329 | Bacteria | 4109 |
| 37 | Ga0070683_100543434 | 3300005329 | Bacteria | 1111 |
| 38 | Ga0070690_100000353 | 3300005330 | Bacteria | 23608 |
| 39 | Ga0070670_100022096 | 3300005331 | Bacteria | 5476 |
| 40 | Ga0070680_100040786 | 3300005336 | Bacteria | 3761 |
| 41 | Ga0070682_100002246 | 3300005337 | Bacteria | 10707 |
| 42 | Ga0068868_100016065 | 3300005338 | Bacteria | 5551 |
| 43 | Ga0070660_100001656 | 3300005339 | Bacteria | 15309 |
| 44 | Ga0070689_100001225 | 3300005340 | Bacteria | 16291 |
| 45 | Ga0070691_10000400 | 3300005341 | Bacteria | 15742 |
| 46 | Ga0070687_100000797 | 3300005343 | Bacteria | 10479 |
| 47 | Ga0070687_100033026 | 3300005343 | Bacteria | 2551 |
| 48 | Ga0070661_100000384 | 3300005344 | Bacteria | 34636 |
| 49 | Ga0070661_100036544 | 3300005344 | Bacteria | 3571 |
| 50 | Ga0070692_10005510 | 3300005345 | Bacteria | 5406 |
| 51 | Ga0070668_100000244 | 3300005347 | Bacteria | 35854 |
| 52 | Ga0070669_100005644 | 3300005353 | Bacteria | 9039 |
| 53 | Ga0070675_100010071 | 3300005354 | Bacteria | 7370 |
| 54 | Ga0070671_100015311 | 3300005355 | Bacteria | 6193 |
| 55 | Ga0070671_100148165 | 3300005355 | Bacteria | 1981 |
| 56 | Ga0070671_100156542 | 3300005355 | Bacteria | 1925 |
| 57 | Ga0070671_100355568 | 3300005355 | Bacteria | 1250 |
| 58 | Ga0070674_100004514 | 3300005356 | Bacteria | 7945 |
| 59 | Ga0070674_100058420 | 3300005356 | Bacteria | 2681 |
| 60 | Ga0070674_100151898 | 3300005356 | Bacteria | 1748 |
| 61 | Ga0070673_100001304 | 3300005364 | Bacteria | 14521 |
| 62 | Ga0070673_100043152 | 3300005364 | Bacteria | 3482 |
| 63 | Ga0070659_100001838 | 3300005366 | Bacteria | 15239 |
| 64 | Ga0070667_100000032 | 3300005367 | Bacteria | 176783 |
| 65 | Ga0070667_100038589 | 3300005367 | Bacteria | 4004 |
| 66 | Ga0070703_10074344 | 3300005406 | Bacteria | 1142 |
| 67 | Ga0070709_10002721 | 3300005434 | Bacteria | 9553 |
| 68 | Ga0070714_100011159 | 3300005435 | Bacteria | 7121 |
| 69 | Ga0070714_100034133 | 3300005435 | Bacteria | 4259 |
| 70 | Ga0070713_100014713 | 3300005436 | Bacteria | 5821 |
| 71 | Ga0070713_100177568 | 3300005436 | Bacteria | 1912 |
| 72 | Ga0070710_10000631 | 3300005437 | Bacteria | 16763 |
| 73 | Ga0070701_10000411 | 3300005438 | Bacteria | 14521 |
| 74 | Ga0070711_100012991 | 3300005439 | Bacteria | 5219 |
| 75 | Ga0070705_100003021 | 3300005440 | Bacteria | 8314 |
| 76 | Ga0070700_100006086 | 3300005441 | Bacteria | 6426 |
| 77 | Ga0070694_100009526 | 3300005444 | Bacteria | 5958 |
| 78 | Ga0070708_100001636 | 3300005445 | Bacteria | 17177 |
| 79 | Ga0070663_100000213 | 3300005455 | Bacteria | 29048 |
| 80 | Ga0070663_100002295 | 3300005455 | Bacteria | 10732 |
| 81 | Ga0070663_100114797 | 3300005455 | Bacteria | 2028 |
| 82 | Ga0070678_100001330 | 3300005456 | Bacteria | 13125 |
| 83 | Ga0070678_100067356 | 3300005456 | Bacteria | 2665 |
| 84 | Ga0070662_100001264 | 3300005457 | Bacteria | 15537 |
| 85 | Ga0070681_10087479 | 3300005458 | Bacteria | 3069 |
| 86 | Ga0068867_100009543 | 3300005459 | Bacteria | 6840 |
| 87 | Ga0070706_100078965 | 3300005467 | Bacteria | 3046 |
| 88 | Ga0070699_100108834 | 3300005518 | Bacteria | 2432 |
| 89 | Ga0070684_100006348 | 3300005535 | Bacteria | 9137 |
| 90 | Ga0070697_100000600 | 3300005536 | Bacteria | 27338 |
| 91 | Ga0070697_100018903 | 3300005536 | Bacteria | 5437 |
| 92 | Ga0068853_100002094 | 3300005539 | Bacteria | 14803 |
| 93 | Ga0068853_100003586 | 3300005539 | Bacteria | 11884 |
| 94 | Ga0070672_100000593 | 3300005543 | Bacteria | 21257 |
| 95 | Ga0070686_100008356 | 3300005544 | Bacteria | 5796 |
| 96 | Ga0070695_100019548 | 3300005545 | Bacteria | 4124 |
| 97 | Ga0070696_100009212 | 3300005546 | Bacteria | 6608 |
| 98 | Ga0070693_100002402 | 3300005547 | Bacteria | 8618 |
| 99 | Ga0070665_100010157 | 3300005548 | Bacteria | 9520 |
| 100 | Ga0070665_100193817 | 3300005548 | Bacteria | 2033 |
| 101 | Ga0070665_100279887 | 3300005548 | Bacteria | 1670 |
| 102 | Ga0070704_100001660 | 3300005549 | Bacteria | 12063 |
| 103 | Ga0068855_100000893 | 3300005563 | Bacteria | 37029 |
| 104 | Ga0070664_100001131 | 3300005564 | Bacteria | 21074 |
| 105 | Ga0068857_100004274 | 3300005577 | Bacteria | 12044 |
| 106 | Ga0068854_100004366 | 3300005578 | Bacteria | 8918 |
| 107 | Ga0068856_100002475 | 3300005614 | Bacteria | 19007 |
| 108 | Ga0068856_100070159 | 3300005614 | Bacteria | 3466 |
| 109 | Ga0070702_100002170 | 3300005615 | Bacteria | 8355 |
| 110 | Ga0068852_100001835 | 3300005616 | Bacteria | 14449 |
| 111 | Ga0068859_100039295 | 3300005617 | Bacteria | 4747 |
| 112 | Ga0068864_100009139 | 3300005618 | Bacteria | 8170 |
| 113 | Ga0068866_10000716 | 3300005718 | Bacteria | 15063 |
| 114 | Ga0068861_100002260 | 3300005719 | Bacteria | 12517 |
| 115 | Ga0068861_100011313 | 3300005719 | Bacteria | 6196 |
| 116 | Ga0068851_10110910 | 3300005834 | Bacteria | 1464 |
| 117 | Ga0068870_10027496 | 3300005840 | Bacteria | 2846 |
| 118 | Ga0068863_100006545 | 3300005841 | Bacteria | 11431 |
| 119 | Ga0068863_100052519 | 3300005841 | Bacteria | 3862 |
| 120 | Ga0068858_100002708 | 3300005842 | Bacteria | 17868 |
| 121 | Ga0068860_100001510 | 3300005843 | Bacteria | 25075 |
| 122 | Ga0068862_100001549 | 3300005844 | Bacteria | 21017 |
| 123 | Ga0068862_100037119 | 3300005844 | Bacteria | 4129 |
| 124 | Ga0068862_100055189 | 3300005844 | Bacteria | 3403 |
| 125 | Ga0081455_10160346 | 3300005937 | Bacteria | 1725 |
| 126 | Ga0081538_10009878 | 3300005981 | Bacteria | 7890 |
| 127 | Ga0081540_1063568 | 3300005983 | Bacteria | 1746 |
| 128 | Ga0081539_10000260 | 3300005985 | Bacteria | 121685 |
| 129 | Ga0081539_10002379 | 3300005985 | Bacteria | 26904 |
| 130 | Ga0081539_10004993 | 3300005985 | Bacteria | 14028 |
| 131 | Ga0075365_10020608 | 3300006038 | Bacteria | 4091 |
| 132 | Ga0075365_10027832 | 3300006038 | Bacteria | 3601 |
| 133 | Ga0075365_10090639 | 3300006038 | Bacteria | 2082 |
| 134 | Ga0075368_10007337 | 3300006042 | Bacteria | 3887 |
| 135 | Ga0075368_10017684 | 3300006042 | Bacteria | 2671 |
| 136 | Ga0075363_100044516 | 3300006048 | Bacteria | 2351 |
| 137 | Ga0075364_10060179 | 3300006051 | Bacteria | 2491 |
| 138 | Ga0075364_10273090 | 3300006051 | Bacteria | 1150 |
| 139 | Ga0070715_10001549 | 3300006163 | Bacteria | 6735 |
| 140 | Ga0070716_100003352 | 3300006173 | Bacteria | 7530 |
| 141 | Ga0070712_100010677 | 3300006175 | Bacteria | 5799 |
| 142 | Ga0075367_10203416 | 3300006178 | Bacteria | 1237 |
| 143 | Ga0097621_100140530 | 3300006237 | Bacteria | 2063 |
| 144 | Ga0075370_10144723 | 3300006353 | Bacteria | 1391 |
| 145 | Ga0068871_100029996 | 3300006358 | Bacteria | 4279 |
| 146 | Ga0075428_100060512 | 3300006844 | Bacteria | 4147 |
| 147 | Ga0075430_100255262 | 3300006846 | Bacteria | 1452 |
| 148 | Ga0075431_100211576 | 3300006847 | Bacteria | 1980 |
| 149 | Ga0075433_10016953 | 3300006852 | Bacteria | 6020 |
| 150 | Ga0075433_10043589 | 3300006852 | Bacteria | 3895 |
| 151 | Ga0075429_100019359 | 3300006880 | Bacteria | 5895 |
| 152 | Ga0068865_100000336 | 3300006881 | Bacteria | 25976 |
| 153 | Ga0075436_100034897 | 3300006914 | Bacteria | 3469 |
| 154 | Ga0097620_100039295 | 3300006931 | Bacteria | 4747 |
| 155 | Ga0099826_10058826 | 3300006948 | Bacteria | 2517 |
| 156 | Ga0075435_100029485 | 3300007076 | Bacteria | 4306 |
| 157 | Ga0075435_100499820 | 3300007076 | Bacteria | 1051 |
| 158 | Ga0105244_10063203 | 3300009036 | Bacteria | 1859 |
| 159 | Ga0105240_10103548 | 3300009093 | Bacteria | 3458 |
| 160 | Ga0105240_10458571 | 3300009093 | Bacteria | 1425 |
| 161 | Ga0111539_10155560 | 3300009094 | Bacteria | 2675 |
| 162 | Ga0111539_10701496 | 3300009094 | Bacteria | 1178 |
| 163 | Ga0105245_10000688 | 3300009098 | Bacteria | 30513 |
| 164 | Ga0105245_10154098 | 3300009098 | Bacteria | 2175 |
| 165 | Ga0105247_10009820 | 3300009101 | Bacteria | 5798 |
| 166 | Ga0105247_10016880 | 3300009101 | Bacteria | 4377 |
| 167 | Ga0114129_10058018 | 3300009147 | Bacteria | 5416 |
| 168 | Ga0105243_10000473 | 3300009148 | Bacteria | 41355 |
| 169 | Ga0105243_10106287 | 3300009148 | Bacteria | 2339 |
| 170 | Ga0105241_10002593 | 3300009174 | Bacteria | 13553 |
| 171 | Ga0105242_10000217 | 3300009176 | Bacteria | 45033 |
| 172 | Ga0105248_10000143 | 3300009177 | Bacteria | 82037 |
| 173 | Ga0105248_10000487 | 3300009177 | Bacteria | 45265 |
| 174 | Ga0105237_10000638 | 3300009545 | Bacteria | 48948 |
| 175 | Ga0105237_10007897 | 3300009545 | Bacteria | 11593 |
| 176 | Ga0105238_10000015 | 3300009551 | Bacteria | 241590 |
| 177 | Ga0105238_10008427 | 3300009551 | Bacteria | 10321 |
| 178 | Ga0105238_10219096 | 3300009551 | Bacteria | 1879 |
| 179 | Ga0105249_10000211 | 3300009553 | Bacteria | 66931 |
| 180 | Ga0105249_10001143 | 3300009553 | Bacteria | 23484 |
| 181 | Ga0105249_10152251 | 3300009553 | Bacteria | 2228 |
| 182 | Ga0099796_10003661 | 3300010159 | Bacteria | 3603 |
| 183 | Ga0105239_10004376 | 3300010375 | Bacteria | 16914 |
| 184 | Ga0105239_10531243 | 3300010375 | Bacteria | 1339 |
| 185 | Ga0105239_10576996 | 3300010375 | Bacteria | 1282 |
| 186 | Ga0105246_10000451 | 3300011119 | Bacteria | 22023 |
| 187 | Ga0157373_10027812 | 3300013100 | Bacteria | 4080 |
| 188 | Ga0157369_10001385 | 3300013105 | Bacteria | 29863 |
| 189 | Ga0157369_10134064 | 3300013105 | Bacteria | 2623 |
| 190 | Ga0157374_10001745 | 3300013296 | Bacteria | 18248 |
| 191 | Ga0157374_10004977 | 3300013296 | Bacteria | 11148 |
| 192 | Ga0157374_10027795 | 3300013296 | Bacteria | 5107 |
| 193 | Ga0157378_10001026 | 3300013297 | Bacteria | 25538 |
| 194 | Ga0163162_10000935 | 3300013306 | Bacteria | 27140 |
| 195 | Ga0163162_10037798 | 3300013306 | Bacteria | 4818 |
| 196 | Ga0163162_10063999 | 3300013306 | Bacteria | 3722 |
| 197 | Ga0157372_10003142 | 3300013307 | Bacteria | 17807 |
| 198 | Ga0157375_10012343 | 3300013308 | Bacteria | 7575 |
| 199 | Ga0157375_10042148 | 3300013308 | Bacteria | 4415 |
| 200 | Ga0163163_10040262 | 3300014325 | Bacteria | 4563 |
| 201 | Ga0163163_10098993 | 3300014325 | Bacteria | 2937 |
| 202 | Ga0157380_10001124 | 3300014326 | Bacteria | 17252 |
| 203 | Ga0157380_10045986 | 3300014326 | Bacteria | 3427 |
| 204 | Ga0157377_10000791 | 3300014745 | Bacteria | 13068 |
| 205 | Ga0157379_10006054 | 3300014968 | Bacteria | 10419 |
| 206 | Ga0157376_10000510 | 3300014969 | Bacteria | 25116 |
| 207 | Ga0183367_1009 | 3300015688 | Bacteria | 484598 |
| 208 | Ga0163161_10025207 | 3300017792 | Bacteria | 4208 |
| 209 | Ga0163161_10068801 | 3300017792 | Bacteria | 2587 |
| 210 | Ga0163161_10268631 | 3300017792 | Bacteria | 1334 |
| 211 | Ga0206353_10718303 | 3300020082 | Bacteria | 2749 |
| 212 | Ga0214542_1018224 | 3300021321 | Bacteria | 6020 |
| 213 | Ga0214543_1000134 | 3300021327 | Bacteria | 102056 |
| 214 | Ga0213872_10100302 | 3300021361 | Bacteria | 1291 |
| 215 | Ga0213872_10110791 | 3300021361 | Bacteria | 1219 |
| 216 | Ga0213874_10046082 | 3300021377 | Bacteria | 1322 |
| 217 | Ga0213876_10009202 | 3300021384 | Bacteria | 5320 |
| 218 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 219 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 220 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 221 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 222 | Ga0209026_1001674 | 3300025250 | Bacteria | 9321 |
| 223 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 224 | Ga0209129_1000689 | 3300025258 | Bacteria | 22147 |
| 225 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 226 | Ga0209673_1040467 | 3300025273 | Bacteria | 1333 |
| 227 | Ga0209130_1000399 | 3300025284 | Bacteria | 47530 |
| 228 | Ga0209676_1000547 | 3300025292 | Bacteria | 57868 |
| 229 | Ga0209025_1001742 | 3300025294 | Bacteria | 26127 |
| 230 | Ga0209025_1024299 | 3300025294 | Bacteria | 3132 |
| 231 | Ga0209564_1007507 | 3300025295 | Bacteria | 5617 |
| 232 | Ga0209758_1000095 | 3300025297 | Bacteria | 237870 |
| 233 | Ga0209758_1030482 | 3300025297 | Bacteria | 2233 |
| 234 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 235 | Ga0209050_1004401 | 3300025298 | Bacteria | 9540 |
| 236 | Ga0209050_1014984 | 3300025298 | Bacteria | 3292 |
| 237 | Ga0209256_1001682 | 3300025299 | Bacteria | 21428 |
| 238 | Ga0209256_1009580 | 3300025299 | Bacteria | 4220 |
| 239 | Ga0207426_1000046 | 3300025302 | Bacteria | 422271 |
| 240 | Ga0209051_1015616 | 3300025303 | Bacteria | 3482 |
| 241 | Ga0209051_1024871 | 3300025303 | Bacteria | 2452 |
| 242 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 243 | Ga0209257_1000477 | 3300025304 | Bacteria | 72873 |
| 244 | Ga0209257_1004227 | 3300025304 | Bacteria | 11372 |
| 245 | Ga0209257_1019432 | 3300025304 | Bacteria | 2559 |
| 246 | Ga0207656_10078840 | 3300025321 | Bacteria | 1477 |
| 247 | Ga0207710_10006089 | 3300025900 | Bacteria | 5166 |
| 248 | Ga0207680_10006249 | 3300025903 | Bacteria | 5749 |
| 249 | Ga0207647_10003873 | 3300025904 | Bacteria | 11188 |
| 250 | Ga0207647_10043088 | 3300025904 | Bacteria | 2825 |
| 251 | Ga0207699_10010704 | 3300025906 | Bacteria | 4612 |
| 252 | Ga0207645_10001040 | 3300025907 | Bacteria | 22925 |
| 253 | Ga0207643_10009053 | 3300025908 | Bacteria | 5347 |
| 254 | Ga0207705_10018281 | 3300025909 | Bacteria | 5013 |
| 255 | Ga0207684_10174360 | 3300025910 | Bacteria | 1854 |
| 256 | Ga0207707_10054439 | 3300025912 | Bacteria | 3483 |
| 257 | Ga0207695_10188223 | 3300025913 | Bacteria | 1982 |
| 258 | Ga0207695_10236318 | 3300025913 | Bacteria | 1730 |
| 259 | Ga0207671_10046382 | 3300025914 | Bacteria | 3215 |
| 260 | Ga0207671_10048751 | 3300025914 | Bacteria | 3135 |
| 261 | Ga0207693_10000278 | 3300025915 | Bacteria | 47482 |
| 262 | Ga0207663_10002954 | 3300025916 | Bacteria | 8216 |
| 263 | Ga0207660_10042397 | 3300025917 | Bacteria | 3194 |
| 264 | Ga0207662_10005916 | 3300025918 | Bacteria | 6566 |
| 265 | Ga0207662_10023054 | 3300025918 | Bacteria | 3573 |
| 266 | Ga0207657_10000047 | 3300025919 | Bacteria | 111686 |
| 267 | Ga0207681_10006557 | 3300025923 | Bacteria | 7144 |
| 268 | Ga0207681_10153398 | 3300025923 | Bacteria | 1729 |
| 269 | Ga0207694_10000017 | 3300025924 | Bacteria | 342100 |
| 270 | Ga0207694_10036175 | 3300025924 | Bacteria | 3789 |
| 271 | Ga0207664_10015644 | 3300025929 | Bacteria | 5514 |
| 272 | Ga0207644_10034679 | 3300025931 | Bacteria | 3532 |
| 273 | Ga0207644_10204472 | 3300025931 | Bacteria | 1559 |
| 274 | Ga0207706_10000079 | 3300025933 | Bacteria | 100592 |
| 275 | Ga0207686_10016824 | 3300025934 | Bacteria | 4107 |
| 276 | Ga0207709_10023947 | 3300025935 | Bacteria | 3481 |
| 277 | Ga0207669_10009273 | 3300025937 | Bacteria | 4676 |
| 278 | Ga0207669_10079995 | 3300025937 | Bacteria | 2089 |
| 279 | Ga0207704_10016264 | 3300025938 | Bacteria | 3819 |
| 280 | Ga0207704_10127593 | 3300025938 | Bacteria | 1755 |
| 281 | Ga0207665_10000432 | 3300025939 | Bacteria | 28864 |
| 282 | Ga0207691_10007711 | 3300025940 | Bacteria | 10359 |
| 283 | Ga0207691_10027134 | 3300025940 | Bacteria | 5373 |
| 284 | Ga0207711_10001415 | 3300025941 | Bacteria | 22473 |
| 285 | Ga0207711_10051163 | 3300025941 | Bacteria | 3537 |
| 286 | Ga0207661_10030887 | 3300025944 | Bacteria | 4131 |
| 287 | Ga0207651_10019716 | 3300025960 | Bacteria | 4050 |
| 288 | Ga0207712_10004820 | 3300025961 | Bacteria | 8521 |
| 289 | Ga0207668_10004345 | 3300025972 | Bacteria | 8322 |
| 290 | Ga0207640_10007564 | 3300025981 | Bacteria | 5999 |
| 291 | Ga0207658_10000048 | 3300025986 | Bacteria | 130723 |
| 292 | Ga0207658_10445490 | 3300025986 | Bacteria | 1145 |
| 293 | Ga0207639_10005055 | 3300026041 | Bacteria | 8886 |
| 294 | Ga0207678_10000111 | 3300026067 | Bacteria | 67188 |
| 295 | Ga0207678_10000877 | 3300026067 | Bacteria | 27644 |
| 296 | Ga0207708_10000526 | 3300026075 | Bacteria | 29587 |
| 297 | Ga0207702_10075114 | 3300026078 | Bacteria | 2919 |
| 298 | Ga0207641_10019105 | 3300026088 | Bacteria | 5621 |
| 299 | Ga0207641_10428767 | 3300026088 | Bacteria | 1274 |
| 300 | Ga0207648_10011260 | 3300026089 | Bacteria | 8434 |
| 301 | Ga0207648_10069754 | 3300026089 | Bacteria | 3063 |
| 302 | Ga0207676_10060990 | 3300026095 | Bacteria | 2985 |
| 303 | Ga0207674_10001475 | 3300026116 | Bacteria | 30401 |
| 304 | Ga0207675_100007188 | 3300026118 | Bacteria | 10521 |
| 305 | Ga0207675_100018149 | 3300026118 | Bacteria | 6559 |
| 306 | Ga0207683_10000026 | 3300026121 | Bacteria | 111890 |
| 307 | Ga0207683_10069410 | 3300026121 | Bacteria | 3112 |
| 308 | Ga0209813_10011864 | 3300027866 | Bacteria | 2288 |
| 309 | Ga0207428_10000668 | 3300027907 | Bacteria | 40081 |
| 310 | Ga0207428_10097474 | 3300027907 | Bacteria | 2276 |
| 311 | Ga0268266_10021536 | 3300028379 | Bacteria | 5492 |
| 312 | Ga0268266_10073294 | 3300028379 | Bacteria | 2971 |
| 313 | Ga0268266_10345624 | 3300028379 | Bacteria | 1397 |
| 314 | Ga0268265_10000876 | 3300028380 | Bacteria | 28172 |
| 315 | Ga0268265_10001620 | 3300028380 | Bacteria | 18546 |
| 316 | Ga0268265_10056529 | 3300028380 | Bacteria | 2986 |
| 317 | Ga0268264_10018500 | 3300028381 | Bacteria | 5698 |
| 318 | Ga0268264_10070350 | 3300028381 | Bacteria | 2962 |
| 319 | Ga0268264_10229146 | 3300028381 | Bacteria | 1715 |
| 320 | Ga0265336_10000664 | 3300028666 | Bacteria | 18678 |
| 321 | Ga0307517_10131954 | 3300028786 | Bacteria | 1794 |
| 322 | Ga0307515_10015071 | 3300028794 | Bacteria | 14277 |
| 323 | Ga0307515_10123046 | 3300028794 | Bacteria | 2921 |
| 324 | Ga0307515_10324832 | 3300028794 | Bacteria | 1202 |
| 325 | Ga0265338_10083232 | 3300028800 | Bacteria | 2677 |
| 326 | Ga0307511_10012485 | 3300030521 | Bacteria | 8334 |
| 327 | Ga0307512_10010397 | 3300030522 | Bacteria | 8877 |
| 328 | Ga0265332_10010400 | 3300031238 | Bacteria | 4141 |
| 329 | Ga0265328_10021119 | 3300031239 | Bacteria | 2488 |
| 330 | Ga0265328_10029163 | 3300031239 | Bacteria | 2062 |
| 331 | Ga0265320_10056299 | 3300031240 | Bacteria | 1890 |
| 332 | Ga0265325_10016843 | 3300031241 | Bacteria | 4076 |
| 333 | Ga0265340_10000024 | 3300031247 | Bacteria | 77206 |
| 334 | Ga0265340_10011864 | 3300031247 | Bacteria | 4616 |
| 335 | Ga0265340_10011993 | 3300031247 | Bacteria | 4584 |
| 336 | Ga0265340_10015861 | 3300031247 | Bacteria | 3908 |
| 337 | Ga0265340_10079455 | 3300031247 | Bacteria | 1546 |
| 338 | Ga0265339_10001398 | 3300031249 | Bacteria | 17958 |
| 339 | Ga0265316_10010461 | 3300031344 | Bacteria | 8449 |
| 340 | Ga0265316_10048376 | 3300031344 | Bacteria | 3357 |
| 341 | Ga0265316_10053576 | 3300031344 | Bacteria | 3160 |
| 342 | Ga0265316_10115896 | 3300031344 | Bacteria | 2025 |
| 343 | Ga0265316_10223758 | 3300031344 | Bacteria | 1387 |
| 344 | Ga0307513_10029898 | 3300031456 | Bacteria | 6197 |
| 345 | Ga0307513_10058751 | 3300031456 | Bacteria | 4085 |
| 346 | Ga0307513_10174035 | 3300031456 | Bacteria | 2026 |
| 347 | Ga0307513_10200611 | 3300031456 | Bacteria | 1836 |
| 348 | Ga0307513_10343730 | 3300031456 | Bacteria | 1242 |
| 349 | Ga0307509_10047478 | 3300031507 | Bacteria | 4618 |
| 350 | Ga0307509_10263464 | 3300031507 | Bacteria | 1497 |
| 351 | Ga0265313_10009270 | 3300031595 | Bacteria | 6406 |
| 352 | Ga0307508_10052441 | 3300031616 | Bacteria | 3623 |
| 353 | Ga0307508_10055097 | 3300031616 | Bacteria | 3523 |
| 354 | Ga0307514_10037737 | 3300031649 | Bacteria | 3827 |
| 355 | Ga0307514_10070308 | 3300031649 | Bacteria | 2629 |
| 356 | Ga0265314_10029466 | 3300031711 | Bacteria | 4079 |
| 357 | Ga0265342_10065193 | 3300031712 | Bacteria | 2135 |
| 358 | Ga0307516_10014197 | 3300031730 | Bacteria | 8438 |
| 359 | Ga0307405_10033749 | 3300031731 | Bacteria | 3039 |
| 360 | Ga0307518_10056055 | 3300031838 | Bacteria | 2863 |
| 361 | Ga0307410_10059722 | 3300031852 | Bacteria | 2604 |
| 362 | Ga0307407_10200845 | 3300031903 | Bacteria | 1336 |
| 363 | Ga0307409_100013759 | 3300031995 | Bacteria | 5227 |
| 364 | Ga0307409_100145715 | 3300031995 | Bacteria | 2048 |
| 365 | Ga0307409_100268444 | 3300031995 | Bacteria | 1570 |
| 366 | Ga0307416_100077246 | 3300032002 | Bacteria | 2796 |
| 367 | Ga0307416_100200071 | 3300032002 | Bacteria | 1895 |
| 368 | Ga0307414_10239282 | 3300032004 | Bacteria | 1502 |
| 369 | Ga0307415_100074593 | 3300032126 | Bacteria | 2398 |
| 370 | Ga0307415_100204657 | 3300032126 | Bacteria | 1569 |
| 371 | Ga0307510_10096719 | 3300033180 | Bacteria | 2766 |
| 372 | Ga0373953_0004923 | 3300035117 | Bacteria | 4295 |
| 373 | Ga0373954_0018234 | 3300035118 | Bacteria | 3157 |
| 374 | Ga0373956_0063556 | 3300035119 | Bacteria | 1674 |
| 375 | Ga0373957_0014754 | 3300035120 | Bacteria | 2676 |
| 376 | Ga0373960_0066121 | 3300035121 | Bacteria | 1107 |
| 377 | Ga0373924_0049670 | 3300035410 | Bacteria | 1736 |
| 378 | Ga0373931_0004176 | 3300035691 | Bacteria | 6568 |
| 379 | Ga0373933_0140324 | 3300035724 | Bacteria | 1525 |
| 380 | Ga0316582_0062309 | 3300036647 | Bacteria | 2394 |
| 381 | Ga0316584_0104569 | 3300036712 | Bacteria | 2119 |
| 382 | Ga0316584_0106033 | 3300036712 | Bacteria | 2103 |
| 383 | Ga0395899_0000016 | 3300037312 | Bacteria | 468322 |
| 384 | Ga0395899_0000197 | 3300037312 | Bacteria | 88596 |
| 385 | Ga0395899_0032059 | 3300037312 | Bacteria | 3947 |
| 386 | Ga0395899_0034053 | 3300037312 | Bacteria | 3824 |
| 387 | Ga0395899_0227247 | 3300037312 | Bacteria | 1290 |
| 388 | Ga0395900_0000006 | 3300037418 | Bacteria | 495364 |
| 389 | Ga0395900_0093038 | 3300037418 | Bacteria | 3097 |
| 390 | Ga0395898_0020812 | 3300037466 | Bacteria | 6658 |
| 391 | Ga0395898_0174874 | 3300037466 | Bacteria | 2052 |
| 392 | Ga0395905_0004212 | 3300037471 | Bacteria | 15041 |
| 393 | Ga0395905_0018788 | 3300037471 | Bacteria | 6557 |
| 394 | Ga0395905_0030180 | 3300037471 | Bacteria | 5110 |
| 395 | Ga0395905_0073489 | 3300037471 | Bacteria | 3205 |
| 396 | Ga0395905_0123707 | 3300037471 | Bacteria | 2432 |
| 397 | Ga0395905_0279365 | 3300037471 | Bacteria | 1556 |
| 398 | Ga0436364_1558329 | 3300037853 | Bacteria | 8309 |
| 399 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 400 | Ga0395901_0000683 | 3300038443 | Bacteria | 38895 |
| 401 | Ga0395901_0165847 | 3300038443 | Bacteria | 2319 |
| 402 | Ga0395901_0356948 | 3300038443 | Bacteria | 1508 |
| 403 | Ga0395901_0472259 | 3300038443 | Bacteria | 1280 |
| 404 | Ga0436365_0968347 | 3300039437 | Bacteria | 4671 |
| 405 | Ga0436365_1738300 | 3300039437 | Bacteria | 3334 |
| 406 | Ga0436365_1805460 | 3300039437 | Bacteria | 13545 |
| 407 | Ga0436360_0359615 | 3300039438 | Bacteria | 2164 |
| 408 | Ga0436361_0647556 | 3300039447 | Bacteria | 5610 |
| 409 | Ga0436361_0745464 | 3300039447 | Bacteria | 2337 |
| 410 | Ga0436361_0794720 | 3300039447 | Bacteria | 1062 |
| 411 | Ga0436361_0914477 | 3300039447 | Bacteria | 3776 |
| 412 | Ga0436363_0338474 | 3300039450 | Bacteria | 1477 |
| 413 | Ga0436363_0394091 | 3300039450 | Bacteria | 1209 |
| 414 | Ga0436363_0614601 | 3300039450 | Bacteria | 3836 |
| 415 | Ga0436363_1644309 | 3300039450 | Bacteria | 3908 |
| 416 | Ga0439436_0001143 | 3300041404 | Bacteria | 7528 |
| 417 | Ga0439447_023052 | 3300041407 | Bacteria | 1625 |
| 418 | Ga0439465_0003975 | 3300041413 | Bacteria | 4822 |
| 419 | Ga0451851_0679826 | 3300041507 | Bacteria | 1162 |
| 420 | Ga0439448_0007409 | 3300042005 | Bacteria | 3181 |
| 421 | Ga0439449_0001376 | 3300042007 | Bacteria | 9507 |
| 422 | Ga0439449_0071515 | 3300042007 | Bacteria | 1278 |
| 423 | Ga0439455_0006090 | 3300042012 | Bacteria | 2485 |
| 424 | Ga0439457_000207 | 3300042014 | Bacteria | 15627 |
| 425 | Ga0450903_000278 | 3300042138 | Bacteria | 11255 |
| 426 | Ga0450901_008779 | 3300042533 | Bacteria | 1043 |
| 427 | Ga0466969_0016382 | 3300044656 | Bacteria | 3877 |
| 428 | Ga0466961_0013455 | 3300044693 | Bacteria | 5241 |
| 429 | Ga0466961_0027628 | 3300044693 | Bacteria | 3650 |
| 430 | Ga0466961_0051398 | 3300044693 | Bacteria | 2632 |
| 431 | Ga0466963_0052875 | 3300044694 | Bacteria | 2696 |
| 432 | Ga0466964_0019589 | 3300044706 | Bacteria | 2602 |
| 433 | Ga0466964_0039741 | 3300044706 | Bacteria | 1897 |
| 434 | Ga0466968_0004993 | 3300044735 | Bacteria | 4970 |
| 435 | Ga0466970_0006844 | 3300044765 | Bacteria | 5707 |
| 436 | Ga0466970_0079792 | 3300044765 | Bacteria | 1767 |
| 437 | Ga0466957_0040230 | 3300044842 | Bacteria | 2823 |
| 438 | Ga0466960_0059672 | 3300044901 | Bacteria | 1867 |
| 439 | Ga0466959_0003297 | 3300045049 | Bacteria | 10531 |
| 440 | Ga0466958_0010420 | 3300045836 | Bacteria | 5206 |
| 441 | Ga0466958_0151544 | 3300045836 | Bacteria | 1463 |
| 442 | Ga0466967_0040191 | 3300045976 | Bacteria | 4026 |
| 443 | Ga0466967_0053848 | 3300045976 | Bacteria | 3538 |
| 444 | Ga0495617_017169 | 3300046452 | Bacteria | 2443 |
| 445 | Ga0495627_002901 | 3300046453 | Bacteria | 7891 |
| 446 | Ga0495627_020006 | 3300046453 | Bacteria | 2236 |
| 447 | Ga0495592_0000576 | 3300046454 | Bacteria | 26018 |
| 448 | Ga0495592_0036867 | 3300046454 | Bacteria | 3681 |
| 449 | Ga0495603_0029320 | 3300046455 | Bacteria | 3318 |
| 450 | Ga0495590_0000056 | 3300046457 | Bacteria | 96913 |
| 451 | Ga0495590_0000181 | 3300046457 | Bacteria | 36847 |
| 452 | Ga0495590_0005479 | 3300046457 | Bacteria | 5031 |
| 453 | Ga0495629_0024815 | 3300046459 | Bacteria | 4266 |
| 454 | Ga0495629_0037690 | 3300046459 | Bacteria | 3407 |
| 455 | Ga0495629_0051449 | 3300046459 | Bacteria | 2883 |
| 456 | Ga0495638_0000170 | 3300046460 | Bacteria | 101629 |
| 457 | Ga0495638_0070621 | 3300046460 | Bacteria | 2138 |
| 458 | Ga0495638_0108248 | 3300046460 | Bacteria | 1653 |
| 459 | Ga0495651_0001088 | 3300046462 | Bacteria | 20919 |
| 460 | Ga0495651_0146244 | 3300046462 | Bacteria | 1708 |
| 461 | Ga0495653_0014171 | 3300046463 | Bacteria | 6499 |
| 462 | Ga0495653_0023047 | 3300046463 | Bacteria | 5035 |
| 463 | Ga0495653_0044531 | 3300046463 | Bacteria | 3444 |
| 464 | Ga0495653_0058615 | 3300046463 | Bacteria | 2926 |
| 465 | Ga0495650_0001692 | 3300046471 | Bacteria | 20320 |
| 466 | Ga0495580_0017736 | 3300046472 | Bacteria | 5314 |
| 467 | Ga0495582_0003999 | 3300046473 | Bacteria | 8278 |
| 468 | Ga0495582_0183515 | 3300046473 | Bacteria | 1192 |
| 469 | Ga0495605_0013096 | 3300046474 | Bacteria | 4582 |
| 470 | Ga0495605_0020407 | 3300046474 | Bacteria | 3521 |
| 471 | Ga0495605_0024308 | 3300046474 | Bacteria | 3172 |
| 472 | Ga0495605_0031139 | 3300046474 | Bacteria | 2727 |
| 473 | Ga0495605_0040953 | 3300046474 | Bacteria | 2309 |
| 474 | Ga0495639_0027004 | 3300046475 | Bacteria | 2540 |
| 475 | Ga0495662_0002860 | 3300046476 | Bacteria | 8730 |
| 476 | Ga0495662_0003653 | 3300046476 | Bacteria | 7757 |
| 477 | Ga0495662_0098107 | 3300046476 | Bacteria | 1433 |
| 478 | Ga0495664_0003663 | 3300046477 | Bacteria | 8372 |
| 479 | Ga0495664_0030585 | 3300046477 | Bacteria | 3154 |
| 480 | Ga0495584_0000781 | 3300046491 | Bacteria | 20991 |
| 481 | Ga0495584_0004084 | 3300046491 | Bacteria | 7881 |
| 482 | Ga0495584_0012951 | 3300046491 | Bacteria | 4257 |
| 483 | Ga0495584_0018413 | 3300046491 | Bacteria | 3549 |
| 484 | Ga0495584_0018992 | 3300046491 | Bacteria | 3492 |
| 485 | Ga0495584_0028938 | 3300046491 | Bacteria | 2808 |
| 486 | Ga0495584_0055763 | 3300046491 | Bacteria | 1988 |
| 487 | Ga0495585_0001585 | 3300046492 | Bacteria | 17617 |
| 488 | Ga0495585_0003957 | 3300046492 | Bacteria | 9781 |
| 489 | Ga0495585_0007730 | 3300046492 | Bacteria | 6552 |
| 490 | Ga0495585_0073955 | 3300046492 | Bacteria | 1854 |
| 491 | Ga0495594_0005242 | 3300046499 | Bacteria | 6664 |
| 492 | Ga0495594_0057786 | 3300046499 | Bacteria | 2142 |
| 493 | Ga0495594_0088101 | 3300046499 | Bacteria | 1737 |
| 494 | Ga0495596_0005730 | 3300046500 | Bacteria | 5831 |
| 495 | Ga0495596_0005838 | 3300046500 | Bacteria | 5759 |
| 496 | Ga0495596_0009329 | 3300046500 | Bacteria | 4318 |
| 497 | Ga0495596_0011210 | 3300046500 | Bacteria | 3873 |
| 498 | Ga0495596_0021074 | 3300046500 | Bacteria | 2662 |
| 499 | Ga0495596_0063786 | 3300046500 | Bacteria | 1433 |
| 500 | Ga0495607_0000876 | 3300046501 | Bacteria | 28090 |
| 501 | Ga0495607_0008486 | 3300046501 | Bacteria | 7020 |
| 502 | Ga0495607_0023261 | 3300046501 | Bacteria | 3879 |
| 503 | Ga0495607_0024504 | 3300046501 | Bacteria | 3761 |
| 504 | Ga0495607_0031397 | 3300046501 | Bacteria | 3252 |
| 505 | Ga0495607_0047494 | 3300046501 | Bacteria | 2515 |
| 506 | Ga0495607_0055921 | 3300046501 | Bacteria | 2267 |
| 507 | Ga0495583_0000417 | 3300046506 | Bacteria | 64786 |
| 508 | Ga0495583_0000679 | 3300046506 | Bacteria | 44179 |
| 509 | Ga0495583_0001028 | 3300046506 | Bacteria | 31717 |
| 510 | Ga0495583_0015368 | 3300046506 | Bacteria | 4166 |
| 511 | Ga0495583_0022229 | 3300046506 | Bacteria | 3242 |
| 512 | Ga0495606_0000149 | 3300046507 | Bacteria | 120165 |
| 513 | Ga0495608_0019764 | 3300046511 | Bacteria | 4632 |
| 514 | Ga0495610_0014805 | 3300046512 | Bacteria | 4564 |
| 515 | Ga0495616_0011077 | 3300046513 | Bacteria | 5182 |
| 516 | Ga0495616_0012884 | 3300046513 | Bacteria | 4729 |
| 517 | Ga0495616_0015409 | 3300046513 | Bacteria | 4252 |
| 518 | Ga0495616_0088451 | 3300046513 | Bacteria | 1470 |
| 519 | Ga0495616_0090757 | 3300046513 | Bacteria | 1446 |
| 520 | Ga0495618_0012897 | 3300046514 | Bacteria | 5080 |
| 521 | Ga0495618_0159371 | 3300046514 | Bacteria | 1439 |
| 522 | Ga0495628_0010616 | 3300046516 | Bacteria | 7812 |
| 523 | Ga0495628_0031356 | 3300046516 | Bacteria | 4300 |
| 524 | Ga0495628_0195200 | 3300046516 | Bacteria | 1527 |
| 525 | Ga0495630_0012548 | 3300046517 | Bacteria | 6156 |
| 526 | Ga0495630_0111574 | 3300046517 | Bacteria | 2071 |
| 527 | Ga0495631_0009289 | 3300046518 | Bacteria | 4916 |
| 528 | Ga0495631_0012663 | 3300046518 | Bacteria | 4112 |
| 529 | Ga0495631_0110644 | 3300046518 | Bacteria | 1181 |
| 530 | Ga0495632_0000253 | 3300046519 | Bacteria | 53145 |
| 531 | Ga0495632_0000311 | 3300046519 | Bacteria | 47116 |
| 532 | Ga0495632_0000365 | 3300046519 | Bacteria | 43021 |
| 533 | Ga0495632_0030056 | 3300046519 | Bacteria | 2823 |
| 534 | Ga0495637_0024388 | 3300046520 | Bacteria | 2737 |
| 535 | Ga0495643_0000302 | 3300046522 | Bacteria | 68932 |
| 536 | Ga0495643_0000729 | 3300046522 | Bacteria | 37503 |
| 537 | Ga0495643_0026408 | 3300046522 | Bacteria | 3277 |
| 538 | Ga0495644_0005947 | 3300046523 | Bacteria | 4757 |
| 539 | Ga0495644_0006899 | 3300046523 | Bacteria | 4397 |
| 540 | Ga0495644_0010053 | 3300046523 | Bacteria | 3645 |
| 541 | Ga0495648_0000119 | 3300046524 | Bacteria | 95682 |
| 542 | Ga0495648_0011121 | 3300046524 | Bacteria | 6809 |
| 543 | Ga0495648_0030554 | 3300046524 | Bacteria | 3560 |
| 544 | Ga0495648_0104808 | 3300046524 | Bacteria | 1552 |
| 545 | Ga0495666_0001696 | 3300046526 | Bacteria | 10883 |
| 546 | Ga0495666_0003516 | 3300046526 | Bacteria | 7907 |
| 547 | Ga0495642_0001135 | 3300046528 | Bacteria | 12239 |
| 548 | Ga0495642_0025039 | 3300046528 | Bacteria | 2363 |
| 549 | Ga0495642_0036493 | 3300046528 | Bacteria | 1986 |
| 550 | Ga0495652_0001055 | 3300046529 | Bacteria | 31311 |
| 551 | Ga0495652_0017628 | 3300046529 | Bacteria | 6371 |
| 552 | Ga0495652_0071737 | 3300046529 | Bacteria | 2889 |
| 553 | Ga0495654_0005778 | 3300046530 | Bacteria | 7130 |
| 554 | Ga0495665_0005387 | 3300046531 | Bacteria | 6894 |
| 555 | Ga0495640_0004953 | 3300046533 | Bacteria | 10586 |
| 556 | Ga0495640_0033080 | 3300046533 | Bacteria | 3676 |
| 557 | Ga0495586_0001960 | 3300046535 | Bacteria | 11233 |
| 558 | Ga0495586_0004758 | 3300046535 | Bacteria | 7260 |
| 559 | Ga0495586_0026453 | 3300046535 | Bacteria | 3104 |
| 560 | Ga0495587_0001673 | 3300046536 | Bacteria | 14794 |
| 561 | Ga0495609_0001674 | 3300046538 | Bacteria | 14400 |
| 562 | Ga0495609_0038896 | 3300046538 | Bacteria | 2143 |
| 563 | Ga0495597_0000123 | 3300046542 | Bacteria | 70236 |
| 564 | Ga0495597_0000127 | 3300046542 | Bacteria | 69108 |
| 565 | Ga0495597_0000439 | 3300046542 | Bacteria | 35464 |
| 566 | Ga0495597_0002383 | 3300046542 | Bacteria | 11993 |
| 567 | Ga0495597_0003217 | 3300046542 | Bacteria | 9714 |
| 568 | Ga0495597_0004061 | 3300046542 | Bacteria | 8189 |
| 569 | Ga0495645_0046359 | 3300046543 | Bacteria | 3168 |
| 570 | Ga0495622_0000480 | 3300046557 | Bacteria | 25158 |
| 571 | Ga0495622_0023694 | 3300046557 | Bacteria | 2863 |
| 572 | Ga0495622_0059605 | 3300046557 | Bacteria | 1767 |
| 573 | Ga0495622_0121009 | 3300046557 | Bacteria | 1195 |
| 574 | Ga0495633_0000088 | 3300046558 | Bacteria | 124193 |
| 575 | Ga0495633_0003948 | 3300046558 | Bacteria | 9651 |
| 576 | Ga0495633_0004308 | 3300046558 | Bacteria | 9087 |
| 577 | Ga0495633_0004365 | 3300046558 | Bacteria | 9026 |
| 578 | Ga0495667_0022019 | 3300046559 | Bacteria | 4297 |
| 579 | Ga0495668_0000460 | 3300046616 | Bacteria | 52158 |
| 580 | Ga0495668_0001529 | 3300046616 | Bacteria | 21962 |
| 581 | Ga0495668_0025601 | 3300046616 | Bacteria | 3351 |
| 582 | Ga0495668_0025818 | 3300046616 | Bacteria | 3336 |
| 583 | Ga0495668_0052708 | 3300046616 | Bacteria | 2250 |
| 584 | Ga0495668_0076011 | 3300046616 | Bacteria | 1844 |
| 585 | Ga0495668_0090919 | 3300046616 | Bacteria | 1672 |
| 586 | Ga0495668_0110950 | 3300046616 | Bacteria | 1500 |
| 587 | Ga0495668_0140030 | 3300046616 | Bacteria | 1324 |
| 588 | Ga0495634_0001729 | 3300046642 | Bacteria | 18914 |
| 589 | Ga0495634_0003826 | 3300046642 | Bacteria | 11953 |
| 590 | Ga0495634_0029265 | 3300046642 | Bacteria | 3814 |
| 591 | Ga0495634_0076175 | 3300046642 | Bacteria | 2202 |
| 592 | Ga0495611_0000793 | 3300046648 | Bacteria | 17555 |
| 593 | Ga0495611_0015713 | 3300046648 | Bacteria | 3234 |
| 594 | Ga0495611_0055740 | 3300046648 | Bacteria | 1788 |
| 595 | Ga0495625_0002200 | 3300046660 | Bacteria | 21593 |
| 596 | Ga0495625_0002701 | 3300046660 | Bacteria | 18852 |
| 597 | Ga0495625_0084561 | 3300046660 | Bacteria | 2203 |
| 598 | Ga0495635_0024224 | 3300046663 | Bacteria | 4231 |
| 599 | Ga0495635_0039975 | 3300046663 | Bacteria | 3242 |
| 600 | Ga0495661_0000923 | 3300046665 | Bacteria | 26835 |
| 601 | Ga0495661_0001513 | 3300046665 | Bacteria | 19348 |
| 602 | Ga0495661_0010130 | 3300046665 | Bacteria | 6442 |
| 603 | Ga0495661_0125823 | 3300046665 | Bacteria | 1410 |
| 604 | Ga0495661_0181494 | 3300046665 | Bacteria | 1115 |
| 605 | Ga0495588_0082701 | 3300046674 | Bacteria | 1677 |
| 606 | Ga0495657_0010913 | 3300046675 | Bacteria | 6815 |
| 607 | Ga0495657_0100431 | 3300046675 | Bacteria | 1844 |
| 608 | Ga0495657_0173736 | 3300046675 | Bacteria | 1325 |
| 609 | Ga0495599_0008650 | 3300046678 | Bacteria | 6195 |
| 610 | Ga0495599_0105256 | 3300046678 | Bacteria | 1758 |
| 611 | Ga0495623_0028591 | 3300046679 | Bacteria | 3586 |
| 612 | Ga0495646_0005821 | 3300046680 | Bacteria | 7817 |
| 613 | Ga0495646_0096780 | 3300046680 | Bacteria | 1697 |
| 614 | Ga0495669_0000479 | 3300046684 | Bacteria | 18564 |
| 615 | Ga0495669_0004096 | 3300046684 | Bacteria | 5996 |
| 616 | Ga0495613_0001087 | 3300046689 | Bacteria | 20759 |
| 617 | Ga0495613_0002547 | 3300046689 | Bacteria | 13719 |
| 618 | Ga0495613_0006343 | 3300046689 | Bacteria | 8846 |
| 619 | Ga0495613_0014884 | 3300046689 | Bacteria | 5774 |
| 620 | Ga0495613_0018858 | 3300046689 | Bacteria | 5140 |
| 621 | Ga0495613_0036156 | 3300046689 | Bacteria | 3662 |
| 622 | Ga0495670_0000229 | 3300046691 | Bacteria | 25517 |
| 623 | Ga0495670_0013404 | 3300046691 | Bacteria | 4033 |
| 624 | Ga0495670_0014792 | 3300046691 | Bacteria | 3841 |
| 625 | Ga0495649_0001723 | 3300046694 | Bacteria | 16178 |
| 626 | Ga0495649_0028444 | 3300046694 | Bacteria | 3098 |
| 627 | Ga0495649_0127220 | 3300046694 | Bacteria | 1345 |
| 628 | Ga0495589_0000610 | 3300046794 | Bacteria | 24076 |
| 629 | Ga0495589_0005398 | 3300046794 | Bacteria | 6744 |
| 630 | Ga0495589_0014904 | 3300046794 | Bacteria | 4000 |
| 631 | Ga0495589_0015410 | 3300046794 | Bacteria | 3935 |
| 632 | Ga0495589_0043427 | 3300046794 | Bacteria | 2237 |
| 633 | Ga0495600_0027751 | 3300046809 | Bacteria | 3659 |
| 634 | Ga0495660_0002813 | 3300046810 | Bacteria | 10948 |
| 635 | Ga0495660_0008510 | 3300046810 | Bacteria | 6007 |
| 636 | Ga0495581_0013715 | 3300047315 | Bacteria | 4699 |
| 637 | Ga0495581_0015281 | 3300047315 | Bacteria | 4456 |
| 638 | Ga0495581_0116140 | 3300047315 | Bacteria | 1556 |
| 639 | Ga0495604_0002334 | 3300047317 | Bacteria | 15210 |
| 640 | Ga0495604_0009084 | 3300047317 | Bacteria | 7864 |
| 641 | Ga0495604_0023674 | 3300047317 | Bacteria | 4901 |
| 642 | Ga0495604_0029760 | 3300047317 | Bacteria | 4343 |
| 643 | Ga0495604_0039198 | 3300047317 | Bacteria | 3724 |
| 644 | Ga0495604_0061766 | 3300047317 | Bacteria | 2864 |
| 645 | Ga0495636_0008434 | 3300047318 | Bacteria | 4066 |
| 646 | Ga0495636_0043068 | 3300047318 | Bacteria | 1877 |
| 647 | Ga0495636_0070873 | 3300047318 | Bacteria | 1487 |
| 648 | Ga0495674_0002692 | 3300047319 | Bacteria | 17298 |
| 649 | Ga0495674_0023200 | 3300047319 | Bacteria | 5720 |
| 650 | Ga0495672_0001319 | 3300047320 | Bacteria | 24677 |
| 651 | Ga0495672_0001582 | 3300047320 | Bacteria | 22235 |
| 652 | Ga0495672_0020626 | 3300047320 | Bacteria | 4312 |
| 653 | Ga0495672_0025826 | 3300047320 | Bacteria | 3755 |
| 654 | Ga0495676_0000031 | 3300047321 | Bacteria | 132364 |
| 655 | Ga0495676_0000862 | 3300047321 | Bacteria | 25339 |
| 656 | Ga0495676_0005345 | 3300047321 | Bacteria | 11760 |
| 657 | Ga0495680_0019816 | 3300047322 | Bacteria | 5672 |
| 658 | Ga0495683_0005694 | 3300047323 | Bacteria | 6883 |
| 659 | Ga0495683_0018019 | 3300047323 | Bacteria | 3655 |
| 660 | Ga0495683_0029973 | 3300047323 | Bacteria | 2778 |
| 661 | Ga0495683_0043978 | 3300047323 | Bacteria | 2246 |
| 662 | Ga0495687_001468 | 3300047443 | Bacteria | 21616 |
| 663 | Ga0495687_005116 | 3300047443 | Bacteria | 8494 |
| 664 | Ga0495675_0002328 | 3300047444 | Bacteria | 11351 |
| 665 | Ga0495675_0010257 | 3300047444 | Bacteria | 5849 |
| 666 | Ga0495675_0023769 | 3300047444 | Bacteria | 3905 |
| 667 | Ga0495675_0033535 | 3300047444 | Bacteria | 3277 |
| 668 | Ga0495675_0071558 | 3300047444 | Bacteria | 2188 |
| 669 | Ga0495675_0119798 | 3300047444 | Bacteria | 1639 |
| 670 | Ga0495677_0006349 | 3300047445 | Bacteria | 4463 |
| 671 | Ga0495677_0008672 | 3300047445 | Bacteria | 3773 |
| 672 | Ga0495679_009108 | 3300047446 | Bacteria | 3997 |
| 673 | Ga0495685_079380 | 3300047447 | Bacteria | 1094 |
| 674 | Ga0495673_0000223 | 3300047469 | Bacteria | 84150 |
| 675 | Ga0495681_0000939 | 3300047470 | Bacteria | 22463 |
| 676 | Ga0495681_0018579 | 3300047470 | Bacteria | 3827 |
| 677 | Ga0495681_0019049 | 3300047470 | Bacteria | 3759 |
| 678 | Ga0495681_0040434 | 3300047470 | Bacteria | 2270 |
| 679 | Ga0495684_0064158 | 3300047471 | Bacteria | 2791 |
| 680 | Ga0495684_0067687 | 3300047471 | Bacteria | 2716 |
| 681 | Ga0495684_0311681 | 3300047471 | Bacteria | 1128 |
| 682 | Ga0495686_0000021 | 3300047472 | Bacteria | 426560 |
| 683 | Ga0495686_0002134 | 3300047472 | Bacteria | 19329 |
| 684 | Ga0495686_0008657 | 3300047472 | Bacteria | 7432 |
| 685 | Ga0495686_0013091 | 3300047472 | Bacteria | 5775 |
| 686 | Ga0495686_0050582 | 3300047472 | Bacteria | 2611 |
| 687 | Ga0495593_0004669 | 3300047673 | Bacteria | 8148 |
| 688 | Ga0495593_0007232 | 3300047673 | Bacteria | 6507 |
| 689 | Ga0495593_0024924 | 3300047673 | Bacteria | 3310 |
| 690 | Ga0495593_0028589 | 3300047673 | Bacteria | 3062 |
| 691 | Ga0495593_0060351 | 3300047673 | Bacteria | 1986 |
| 692 | Ga0495602_0016473 | 3300048088 | Bacteria | 7433 |
| 693 | Ga0495602_0028276 | 3300048088 | Bacteria | 5368 |
| 694 | Ga0495602_0031172 | 3300048088 | Bacteria | 5045 |
| 695 | Ga0495602_0086198 | 3300048088 | Bacteria | 2622 |
| 696 | Ga0495614_0005393 | 3300048089 | Bacteria | 5769 |
| 697 | Ga0495614_0011401 | 3300048089 | Bacteria | 3912 |
| 698 | Ga0495626_0000005 | 3300048091 | Bacteria | 337534 |
| 699 | Ga0495626_0015821 | 3300048091 | Bacteria | 3851 |
| 700 | Ga0495626_0019890 | 3300048091 | Bacteria | 3350 |
| 701 | Ga0495626_0024308 | 3300048091 | Bacteria | 2971 |
| 702 | Ga0495626_0035489 | 3300048091 | Bacteria | 2380 |
| 703 | Ga0495626_0040297 | 3300048091 | Bacteria | 2207 |
| 704 | Ga0495626_0043398 | 3300048091 | Bacteria | 2109 |
| 705 | Ga0495626_0050528 | 3300048091 | Bacteria | 1920 |
| 706 | Ga0495626_0071295 | 3300048091 | Bacteria | 1562 |
| 707 | Ga0496100_0011314 | 3300048903 | Bacteria | 5076 |
| 708 | Ga0496100_0385481 | 3300048903 | Bacteria | 1065 |
| 709 | Ga0496101_0005155 | 3300048904 | Bacteria | 8311 |
| 710 | Ga0496102_0044010 | 3300048905 | Bacteria | 4049 |
| 711 | Ga0496102_0093031 | 3300048905 | Bacteria | 2793 |
| 712 | Ga0496102_0179800 | 3300048905 | Bacteria | 1993 |
| 713 | Ga0496103_0042347 | 3300048906 | Bacteria | 2801 |
| 714 | Ga0496105_0023140 | 3300048908 | Bacteria | 5038 |
| 715 | Ga0496105_0102242 | 3300048908 | Bacteria | 2366 |
| 716 | Ga0496106_0041301 | 3300048909 | Bacteria | 3455 |
| 717 | Ga0496106_0141499 | 3300048909 | Bacteria | 1893 |
| 718 | Ga0496107_0017244 | 3300048910 | Bacteria | 5078 |
| 719 | Ga0496107_0050519 | 3300048910 | Bacteria | 2997 |
| 720 | Ga0496108_0010303 | 3300048911 | Bacteria | 7589 |
| 721 | Ga0496108_0185860 | 3300048911 | Bacteria | 1800 |
| 722 | Ga0496109_0037831 | 3300048912 | Bacteria | 4361 |
| 723 | Ga0496109_0326562 | 3300048912 | Bacteria | 1448 |
| 724 | Ga0496109_0377124 | 3300048912 | Bacteria | 1340 |
| 725 | Ga0496109_0559946 | 3300048912 | Bacteria | 1078 |
| 726 | Ga0496110_0014313 | 3300048913 | Bacteria | 6582 |
| 727 | Ga0496110_0035014 | 3300048913 | Bacteria | 4353 |
| 728 | Ga0496110_0049348 | 3300048913 | Bacteria | 3692 |
| 729 | Ga0496111_0001836 | 3300048914 | Bacteria | 12505 |
| 730 | Ga0496111_0085602 | 3300048914 | Bacteria | 2305 |
| 731 | Ga0496112_0001267 | 3300048915 | Bacteria | 19165 |
| 732 | Ga0496112_0016434 | 3300048915 | Bacteria | 6933 |
| 733 | Ga0496112_0016818 | 3300048915 | Bacteria | 6861 |
| 734 | Ga0496112_0260013 | 3300048915 | Bacteria | 1685 |
| 735 | Ga0496114_0045732 | 3300048917 | Bacteria | 3637 |
| 736 | Ga0496115_0002726 | 3300048918 | Bacteria | 12689 |
| 737 | Ga0496115_0020967 | 3300048918 | Bacteria | 5042 |
| 738 | Ga0496115_0046019 | 3300048918 | Bacteria | 3485 |
| 739 | Ga0496115_0064859 | 3300048918 | Bacteria | 2949 |
| 740 | Ga0496117_0094846 | 3300048920 | Bacteria | 1908 |
| 741 | Ga0496122_0000142 | 3300048925 | Bacteria | 168391 |
| 742 | Ga0496122_0089925 | 3300048925 | Bacteria | 2097 |
| 743 | Ga0496122_0155793 | 3300048925 | Bacteria | 1402 |
| 744 | Ga0496123_0000148 | 3300048926 | Bacteria | 143265 |
| 745 | Ga0496123_0027358 | 3300048926 | Bacteria | 4249 |
| 746 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 747 | Ga0496124_0381154 | 3300048927 | Bacteria | 986 |
| 748 | Ga0496125_0022904 | 3300048928 | Bacteria | 5786 |
| 749 | Ga0496126_0000050 | 3300048929 | Bacteria | 316466 |
| 750 | Ga0495678_000256 | 3300049459 | Bacteria | 59602 |
| 751 | Ga0495678_000524 | 3300049459 | Bacteria | 37449 |
| 752 | Ga0495678_000732 | 3300049459 | Bacteria | 29802 |
| 753 | Ga0495678_004011 | 3300049459 | Bacteria | 8782 |
| 754 | Ga0495678_016975 | 3300049459 | Bacteria | 3310 |
| 755 | Ga0495682_0000308 | 3300049460 | Bacteria | 36905 |
| 756 | Ga0501032_0057205 | 3300049569 | Bacteria | 2620 |
| 757 | Ga0501032_0090200 | 3300049569 | Bacteria | 2034 |
| 758 | Ga0501033_0086063 | 3300049570 | Bacteria | 2301 |
| 759 | Ga0501033_0209419 | 3300049570 | Bacteria | 1391 |
| 760 | Ga0501034_0131914 | 3300049571 | Bacteria | 2481 |
| 761 | Ga0501034_0178180 | 3300049571 | Bacteria | 2091 |
| 762 | Ga0501034_0280811 | 3300049571 | Bacteria | 1604 |
| 763 | Ga0501034_0393725 | 3300049571 | Bacteria | 1309 |
| 764 | Ga0501034_0464770 | 3300049571 | Bacteria | 1182 |
| 765 | Ga0501036_0013938 | 3300049572 | Bacteria | 6685 |
| 766 | Ga0501036_0092149 | 3300049572 | Bacteria | 2560 |
| 767 | Ga0501037_0156139 | 3300049573 | Bacteria | 1628 |
| 768 | Ga0501038_0017722 | 3300049574 | Bacteria | 6436 |
| 769 | Ga0501038_0060781 | 3300049574 | Bacteria | 3233 |
| 770 | Ga0501038_0264471 | 3300049574 | Bacteria | 1358 |
| 771 | Ga0501039_0059260 | 3300049575 | Bacteria | 2966 |
| 772 | Ga0501039_0095671 | 3300049575 | Bacteria | 2315 |
| 773 | Ga0501039_0110515 | 3300049575 | Bacteria | 2149 |
| 774 | Ga0501042_0032063 | 3300049578 | Bacteria | 3719 |
| 775 | Ga0501042_0337865 | 3300049578 | Bacteria | 1089 |
| 776 | Ga0501043_0020490 | 3300049579 | Bacteria | 5188 |
| 777 | Ga0501043_0051843 | 3300049579 | Bacteria | 3224 |
| 778 | Ga0501043_0054164 | 3300049579 | Bacteria | 3150 |
| 779 | Ga0501043_0095690 | 3300049579 | Bacteria | 2334 |
| 780 | Ga0501043_0259348 | 3300049579 | Bacteria | 1337 |
| 781 | Ga0501046_0071329 | 3300049580 | Bacteria | 2699 |
| 782 | Ga0501046_0150064 | 3300049580 | Bacteria | 1759 |
| 783 | Ga0501046_0195387 | 3300049580 | Bacteria | 1507 |
| 784 | Ga0501047_0058832 | 3300049581 | Bacteria | 3712 |
| 785 | Ga0501047_0061667 | 3300049581 | Bacteria | 3618 |
| 786 | Ga0501047_0070748 | 3300049581 | Bacteria | 3359 |
| 787 | Ga0501047_0242493 | 3300049581 | Bacteria | 1652 |
| 788 | Ga0501047_0275166 | 3300049581 | Bacteria | 1529 |
| 789 | Ga0501048_0100173 | 3300049582 | Bacteria | 2044 |
| 790 | Ga0501048_0319774 | 3300049582 | Bacteria | 1105 |
| 791 | Ga0501070_0045431 | 3300049586 | Bacteria | 3653 |
| 792 | Ga0501070_0046624 | 3300049586 | Bacteria | 3604 |
| 793 | Ga0501070_0050448 | 3300049586 | Bacteria | 3455 |
| 794 | Ga0501070_0070803 | 3300049586 | Bacteria | 2887 |
| 795 | Ga0501070_0090627 | 3300049586 | Bacteria | 2530 |
| 796 | Ga0501070_0091701 | 3300049586 | Bacteria | 2514 |
| 797 | Ga0501070_0163330 | 3300049586 | Bacteria | 1836 |
| 798 | Ga0501072_0017620 | 3300049588 | Bacteria | 5492 |
| 799 | Ga0501073_0004147 | 3300049589 | Bacteria | 10867 |
| 800 | Ga0501073_0019004 | 3300049589 | Bacteria | 4965 |
| 801 | Ga0501073_0023396 | 3300049589 | Bacteria | 4436 |
| 802 | Ga0501074_0006780 | 3300049590 | Bacteria | 8267 |
| 803 | Ga0501074_0077661 | 3300049590 | Bacteria | 2383 |
| 804 | Ga0501074_0083528 | 3300049590 | Bacteria | 2290 |
| 805 | Ga0501076_0245766 | 3300049592 | Bacteria | 1464 |
| 806 | Ga0501257_014512 | 3300049686 | Bacteria | 1813 |
| 807 | Ga0501079_0375806 | 3300049741 | Bacteria | 1114 |
| 808 | Ga0501080_0029055 | 3300049742 | Bacteria | 5146 |
| 809 | Ga0501080_0046968 | 3300049742 | Bacteria | 4019 |
| 810 | Ga0501080_0064652 | 3300049742 | Bacteria | 3403 |
| 811 | Ga0501080_0069187 | 3300049742 | Bacteria | 3283 |
| 812 | Ga0501080_0111887 | 3300049742 | Bacteria | 2531 |
| 813 | Ga0501080_0247844 | 3300049742 | Bacteria | 1624 |
| 814 | Ga0501080_0551761 | 3300049742 | Bacteria | 1026 |
| 815 | Ga0501081_0034541 | 3300049743 | Bacteria | 3441 |
| 816 | Ga0501083_0000749 | 3300049744 | Bacteria | 21218 |
| 817 | Ga0501083_0020618 | 3300049744 | Bacteria | 4584 |
| 818 | Ga0501083_0052792 | 3300049744 | Bacteria | 2730 |
| 819 | Ga0501083_0141683 | 3300049744 | Bacteria | 1574 |
| 820 | Ga0501083_0149104 | 3300049744 | Bacteria | 1531 |
| 821 | Ga0501269_003107 | 3300049766 | Bacteria | 2015 |
| 822 | Ga0501035_0124124 | 3300049822 | Bacteria | 2255 |
| 823 | Ga0501035_0173768 | 3300049822 | Bacteria | 1860 |
| 824 | Ga0501044_0017691 | 3300049823 | Bacteria | 7645 |
| 825 | Ga0501044_0043682 | 3300049823 | Bacteria | 4655 |
| 826 | Ga0501044_0081620 | 3300049823 | Bacteria | 3272 |
| 827 | Ga0501044_0101410 | 3300049823 | Bacteria | 2896 |
| 828 | Ga0501044_0256423 | 3300049823 | Bacteria | 1688 |
| 829 | Ga0501044_0325707 | 3300049823 | Bacteria | 1460 |
| 830 | Ga0501045_0128594 | 3300049824 | Bacteria | 1883 |
| 831 | Ga0501045_0148648 | 3300049824 | Bacteria | 1743 |
| 832 | nmdc:mga03n38_33851_c1 | 3300050490 | Bacteria | 2177 |
| 833 | nmdc:mga0yw44_282764_c1 | 3300050492 | Bacteria | 1109 |
| 834 | nmdc:mga06z11_21838_c1 | 3300050494 | Bacteria | 2980 |
| 835 | nmdc:mga05p37_321116_c1 | 3300050507 | Bacteria | 1833 |
| 836 | nmdc:mga05p37_96330_c1 | 3300050507 | Bacteria | 3645 |
| 837 | nmdc:mga09592_26300_c1 | 3300050508 | Bacteria | 4820 |
| 838 | nmdc:mga0qj67_86337_c1 | 3300050509 | Bacteria | 2517 |
| 839 | nmdc:mga06r32_35609_c1 | 3300050510 | Bacteria | 4697 |
| 840 | nmdc:mga08y16_339701_c1 | 3300050511 | Bacteria | 1544 |
| 841 | nmdc:mga08y16_456_c1 | 3300050511 | Bacteria | 38036 |
| 842 | nmdc:mga0n895_152409_c1 | 3300050512 | Bacteria | 2342 |
| 843 | nmdc:mga0n895_73236_c1 | 3300050512 | Bacteria | 3401 |
| 844 | nmdc:mga0rr50_21985_c1 | 3300050513 | Bacteria | 4368 |
| 845 | nmdc:mga08x19_209840_c1 | 3300050514 | Bacteria | 1337 |
| 846 | nmdc:mga0a205_20785_c1 | 3300050515 | Bacteria | 5619 |
| 847 | nmdc:mga0a205_227048_c1 | 3300050515 | Bacteria | 1752 |
| 848 | Ga0495655_0027280 | 3300053083 | Bacteria | 1353 |
| 849 | Ga0495655_0028742 | 3300053083 | Bacteria | 1331 |
| 850 | Ga0495595_0094900 | 3300053084 | Bacteria | 1434 |
| 851 | Ga0495619_0037869 | 3300053085 | Bacteria | 3145 |
| 852 | Ga0495619_0203014 | 3300053085 | Bacteria | 1372 |
| 853 | Ga0500578_0073503 | 3300053086 | Bacteria | 2178 |
| 854 | Ga0500643_002974 | 3300053087 | Bacteria | 8394 |
| 855 | Ga0500644_0009720 | 3300053088 | Bacteria | 2582 |
| 856 | Ga0500566_0000273 | 3300053094 | Bacteria | 27887 |
| 857 | Ga0500641_0009865 | 3300053096 | Bacteria | 3439 |
| 858 | Ga0500641_0012929 | 3300053096 | Bacteria | 3058 |
| 859 | Ga0500650_0003353 | 3300053098 | Bacteria | 5553 |
| 860 | Ga0500553_015652 | 3300053101 | Bacteria | 3851 |
| 861 | Ga0500555_012647 | 3300053103 | Bacteria | 2430 |
| 862 | Ga0500556_0094566 | 3300053104 | Bacteria | 1145 |
| 863 | Ga0500595_000050 | 3300053119 | Bacteria | 88696 |
| 864 | Ga0500597_000191 | 3300053120 | Bacteria | 12574 |
| 865 | Ga0500608_004458 | 3300053122 | Bacteria | 5428 |
| 866 | Ga0500608_032876 | 3300053122 | Bacteria | 2466 |
| 867 | Ga0500608_068534 | 3300053122 | Bacteria | 1689 |
| 868 | Ga0500642_0001500 | 3300053130 | Bacteria | 6725 |
| 869 | Ga0500652_000390 | 3300053131 | Bacteria | 15731 |
| 870 | Ga0500652_086027 | 3300053131 | Bacteria | 1311 |
| 871 | Ga0500658_0047555 | 3300053134 | Bacteria | 1742 |
| 872 | Ga0500559_0000106 | 3300053136 | Bacteria | 65670 |
| 873 | Ga0500568_0002649 | 3300053139 | Bacteria | 10390 |
| 874 | Ga0500568_0002674 | 3300053139 | Bacteria | 10335 |
| 875 | Ga0500588_0000462 | 3300053146 | Bacteria | 6441 |
| 876 | Ga0500588_0062086 | 3300053146 | Bacteria | 1200 |
| 877 | Ga0500590_022922 | 3300053148 | Bacteria | 3244 |
| 878 | Ga0500604_0002621 | 3300053151 | Bacteria | 4898 |
| 879 | Ga0500604_0024172 | 3300053151 | Bacteria | 1737 |
| 880 | Ga0500616_0001247 | 3300053153 | Bacteria | 25504 |
| 881 | Ga0500622_0000697 | 3300053156 | Bacteria | 29561 |
| 882 | Ga0500622_0015301 | 3300053156 | Bacteria | 4109 |
| 883 | Ga0500634_0078887 | 3300053161 | Bacteria | 1702 |
| 884 | Ga0500636_0012147 | 3300053177 | Bacteria | 5043 |
| 885 | Ga0500625_072208 | 3300053729 | Bacteria | 1532 |
| 886 | Ga0500645_021809 | 3300053730 | Bacteria | 1974 |
| 887 | Ga0500596_000127 | 3300053735 | Bacteria | 11097 |
| 888 | Ga0500599_013765 | 3300053736 | Bacteria | 1097 |
| 889 | Ga0501084_0250232 | 3300054114 | Bacteria | 1496 |
| 890 | Ga0501084_0291171 | 3300054114 | Bacteria | 1379 |
| 891 | Ga0501082_0046358 | 3300060353 | Bacteria | 3747 |
| 892 | Ga0501082_0100104 | 3300060353 | Bacteria | 2507 |
| 893 | Ga0501082_0152946 | 3300060353 | Bacteria | 2004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0100104 | Ga0501082_0100104_1724_2497 | 254 |
| 2 | 3300046665 | Ga0495661_0181494 | Ga0495661_0181494_14_841 | 273 |
| 3 | 3300046535 | Ga0495586_0004758 | Ga0495586_0004758_6405_7238 | 276 |
| 4 | 3300003791 | Ga0055530_10000180 | Ga0055530_1000018021 | 291 |
| 5 | 3300003791 | Ga0055530_10000371 | Ga0055530_1000037123 | 291 |
| 6 | 3300003794 | Ga0055531_10000844 | Ga0055531_1000084425 | 291 |
| 7 | 3300025298 | Ga0209050_1000034 | Ga0209050_1000034373 | 291 |
| 8 | 3300025304 | Ga0209257_1000052 | Ga0209257_100005237 | 291 |
| 9 | 3300009551 | Ga0105238_10000015 | Ga0105238_1000001595 | 293 |
| 10 | 3300037471 | Ga0395905_0279365 | Ga0395905_0279365_309_1289 | 301 |
| 11 | 3300025929 | Ga0207664_10015644 | Ga0207664_100156445 | 304 |
| 12 | 3300037312 | Ga0395899_0000197 | Ga0395899_0000197_13593_14588 | 304 |
| 13 | 3300037418 | Ga0395900_0000006 | Ga0395900_0000006_188101_189096 | 304 |
| 14 | 3300037466 | Ga0395898_0020812 | Ga0395898_0020812_143_1138 | 304 |
| 15 | 3300037471 | Ga0395905_0004212 | Ga0395905_0004212_8620_9615 | 304 |
| 16 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_231350_232345 | 304 |
| 17 | 3300028379 | Ga0268266_10073294 | Ga0268266_100732943 | 305 |
| 18 | 3300044694 | Ga0466963_0052875 | Ga0466963_0052875_1464_2384 | 306 |
| 19 | 3300048909 | Ga0496106_0141499 | Ga0496106_0141499_214_1224 | 306 |
| 20 | 3300049586 | Ga0501070_0045431 | Ga0501070_0045431_2406_3332 | 306 |
| 21 | 3300049742 | Ga0501080_0247844 | Ga0501080_0247844_499_1500 | 306 |
| 22 | 3300049822 | Ga0501035_0173768 | Ga0501035_0173768_607_1608 | 306 |
| 23 | 3300031456 | Ga0307513_10029898 | Ga0307513_100298986 | 307 |
| 24 | iso_pu_bacteria | 2767802442 | 2770198959 | 307 |
| 25 | 3300049766 | Ga0501269_003107 | Ga0501269_003107_949_1881 | 308 |
| 26 | 3300053122 | Ga0500608_032876 | Ga0500608_032876_431_1363 | 308 |
| 27 | iso_pu_bacteria | 8054558443 | 8054559917 | 308 |
| 28 | 3300005435 | Ga0070714_100011159 | Ga0070714_1000111597 | 309 |
| 29 | 3300009098 | Ga0105245_10154098 | Ga0105245_101540982 | 309 |
| 30 | 3300025224 | Ga0209784_100002 | Ga0209784_100002587 | 309 |
| 31 | 3300025225 | Ga0209566_100003 | Ga0209566_100003587 | 309 |
| 32 | 3300025226 | Ga0209674_100004 | Ga0209674_100004587 | 309 |
| 33 | 3300025230 | Ga0209563_100006 | Ga0209563_100006587 | 309 |
| 34 | 3300025253 | Ga0209677_100003 | Ga0209677_100003587 | 309 |
| 35 | 3300037853 | Ga0436364_1558329 | Ga0436364_1558329_7332_8264 | 309 |
| 36 | 3300038443 | Ga0395901_0356948 | Ga0395901_0356948_162_1112 | 309 |
| 37 | 3300039450 | Ga0436363_0614601 | Ga0436363_0614601_1825_2757 | 309 |
| 38 | 3300044901 | Ga0466960_0059672 | Ga0466960_0059672_400_1350 | 309 |
| 39 | 3300045836 | Ga0466958_0151544 | Ga0466958_0151544_174_1124 | 309 |
| 40 | 3300049823 | Ga0501044_0325707 | Ga0501044_0325707_476_1408 | 309 |
| 41 | 3300053134 | Ga0500658_0047555 | Ga0500658_0047555_61_1062 | 309 |
| 42 | 3300028794 | Ga0307515_10324832 | Ga0307515_103248321 | 310 |
| 43 | 3300031238 | Ga0265332_10010400 | Ga0265332_100104004 | 310 |
| 44 | 3300031344 | Ga0265316_10048376 | Ga0265316_100483763 | 310 |
| 45 | 3300037471 | Ga0395905_0018788 | Ga0395905_0018788_109_1044 | 310 |
| 46 | 3300039450 | Ga0436363_0394091 | Ga0436363_0394091_145_1080 | 310 |
| 47 | 3300046463 | Ga0495653_0014171 | Ga0495653_0014171_3715_4653 | 310 |
| 48 | 3300046463 | Ga0495653_0058615 | Ga0495653_0058615_217_1155 | 310 |
| 49 | 3300046472 | Ga0495580_0017736 | Ga0495580_0017736_3595_4533 | 310 |
| 50 | 3300046474 | Ga0495605_0013096 | Ga0495605_0013096_249_1187 | 310 |
| 51 | 3300046474 | Ga0495605_0031139 | Ga0495605_0031139_843_1781 | 310 |
| 52 | 3300046474 | Ga0495605_0040953 | Ga0495605_0040953_407_1345 | 310 |
| 53 | 3300046491 | Ga0495584_0000781 | Ga0495584_0000781_17372_18310 | 310 |
| 54 | 3300046491 | Ga0495584_0018992 | Ga0495584_0018992_246_1184 | 310 |
| 55 | 3300046499 | Ga0495594_0088101 | Ga0495594_0088101_575_1513 | 310 |
| 56 | 3300046500 | Ga0495596_0005730 | Ga0495596_0005730_2042_2980 | 310 |
| 57 | 3300046500 | Ga0495596_0063786 | Ga0495596_0063786_325_1263 | 310 |
| 58 | 3300046501 | Ga0495607_0000876 | Ga0495607_0000876_5574_6512 | 310 |
| 59 | 3300046501 | Ga0495607_0023261 | Ga0495607_0023261_2750_3688 | 310 |
| 60 | 3300046501 | Ga0495607_0031397 | Ga0495607_0031397_1668_2606 | 310 |
| 61 | 3300046506 | Ga0495583_0000679 | Ga0495583_0000679_21574_22512 | 310 |
| 62 | 3300046506 | Ga0495583_0001028 | Ga0495583_0001028_25686_26624 | 310 |
| 63 | 3300046506 | Ga0495583_0015368 | Ga0495583_0015368_2813_3751 | 310 |
| 64 | 3300046511 | Ga0495608_0019764 | Ga0495608_0019764_3639_4589 | 310 |
| 65 | 3300046513 | Ga0495616_0011077 | Ga0495616_0011077_2238_3176 | 310 |
| 66 | 3300046513 | Ga0495616_0012884 | Ga0495616_0012884_1456_2394 | 310 |
| 67 | 3300046513 | Ga0495616_0088451 | Ga0495616_0088451_299_1237 | 310 |
| 68 | 3300046513 | Ga0495616_0090757 | Ga0495616_0090757_218_1156 | 310 |
| 69 | 3300046518 | Ga0495631_0009289 | Ga0495631_0009289_2866_3804 | 310 |
| 70 | 3300046518 | Ga0495631_0110644 | Ga0495631_0110644_140_1078 | 310 |
| 71 | 3300046519 | Ga0495632_0000253 | Ga0495632_0000253_20413_21351 | 310 |
| 72 | 3300046519 | Ga0495632_0030056 | Ga0495632_0030056_451_1389 | 310 |
| 73 | 3300046520 | Ga0495637_0024388 | Ga0495637_0024388_986_1924 | 310 |
| 74 | 3300046522 | Ga0495643_0000729 | Ga0495643_0000729_12065_13003 | 310 |
| 75 | 3300046522 | Ga0495643_0026408 | Ga0495643_0026408_2246_3184 | 310 |
| 76 | 3300046523 | Ga0495644_0005947 | Ga0495644_0005947_12_950 | 310 |
| 77 | 3300046523 | Ga0495644_0010053 | Ga0495644_0010053_1024_1962 | 310 |
| 78 | 3300046524 | Ga0495648_0030554 | Ga0495648_0030554_1154_2092 | 310 |
| 79 | 3300046524 | Ga0495648_0104808 | Ga0495648_0104808_55_993 | 310 |
| 80 | 3300046526 | Ga0495666_0001696 | Ga0495666_0001696_1560_2498 | 310 |
| 81 | 3300046529 | Ga0495652_0001055 | Ga0495652_0001055_28494_29432 | 310 |
| 82 | 3300046531 | Ga0495665_0005387 | Ga0495665_0005387_5626_6564 | 310 |
| 83 | 3300046535 | Ga0495586_0026453 | Ga0495586_0026453_703_1641 | 310 |
| 84 | 3300046542 | Ga0495597_0000439 | Ga0495597_0000439_10121_11059 | 310 |
| 85 | 3300046542 | Ga0495597_0002383 | Ga0495597_0002383_8622_9560 | 310 |
| 86 | 3300046557 | Ga0495622_0023694 | Ga0495622_0023694_1883_2818 | 310 |
| 87 | 3300046557 | Ga0495622_0121009 | Ga0495622_0121009_25_966 | 310 |
| 88 | 3300046558 | Ga0495633_0004308 | Ga0495633_0004308_1391_2329 | 310 |
| 89 | 3300046616 | Ga0495668_0025601 | Ga0495668_0025601_279_1217 | 310 |
| 90 | 3300046642 | Ga0495634_0003826 | Ga0495634_0003826_6390_7328 | 310 |
| 91 | 3300046665 | Ga0495661_0001513 | Ga0495661_0001513_8550_9488 | 310 |
| 92 | 3300046665 | Ga0495661_0010130 | Ga0495661_0010130_4890_5828 | 310 |
| 93 | 3300046665 | Ga0495661_0125823 | Ga0495661_0125823_233_1171 | 310 |
| 94 | 3300046674 | Ga0495588_0082701 | Ga0495588_0082701_677_1615 | 310 |
| 95 | 3300046678 | Ga0495599_0105256 | Ga0495599_0105256_791_1729 | 310 |
| 96 | 3300046679 | Ga0495623_0028591 | Ga0495623_0028591_1698_2636 | 310 |
| 97 | 3300046689 | Ga0495613_0001087 | Ga0495613_0001087_2078_3013 | 310 |
| 98 | 3300046694 | Ga0495649_0001723 | Ga0495649_0001723_8864_9802 | 310 |
| 99 | 3300046794 | Ga0495589_0000610 | Ga0495589_0000610_8446_9384 | 310 |
| 100 | 3300046794 | Ga0495589_0005398 | Ga0495589_0005398_4890_5828 | 310 |
| 101 | 3300046794 | Ga0495589_0015410 | Ga0495589_0015410_34_984 | 310 |
| 102 | 3300046809 | Ga0495600_0027751 | Ga0495600_0027751_2529_3467 | 310 |
| 103 | 3300046810 | Ga0495660_0002813 | Ga0495660_0002813_320_1258 | 310 |
| 104 | 3300047317 | Ga0495604_0009084 | Ga0495604_0009084_771_1709 | 310 |
| 105 | 3300047318 | Ga0495636_0008434 | Ga0495636_0008434_1793_2731 | 310 |
| 106 | 3300047320 | Ga0495672_0001319 | Ga0495672_0001319_23571_24521 | 310 |
| 107 | 3300047320 | Ga0495672_0025826 | Ga0495672_0025826_235_1173 | 310 |
| 108 | 3300047323 | Ga0495683_0018019 | Ga0495683_0018019_1076_2014 | 310 |
| 109 | 3300047323 | Ga0495683_0043978 | Ga0495683_0043978_1045_1983 | 310 |
| 110 | 3300047443 | Ga0495687_001468 | Ga0495687_001468_18196_19134 | 310 |
| 111 | 3300047444 | Ga0495675_0010257 | Ga0495675_0010257_944_1882 | 310 |
| 112 | 3300047445 | Ga0495677_0008672 | Ga0495677_0008672_145_1083 | 310 |
| 113 | 3300047446 | Ga0495679_009108 | Ga0495679_009108_1038_1976 | 310 |
| 114 | 3300047470 | Ga0495681_0019049 | Ga0495681_0019049_1474_2412 | 310 |
| 115 | 3300047673 | Ga0495593_0060351 | Ga0495593_0060351_353_1291 | 310 |
| 116 | 3300048088 | Ga0495602_0016473 | Ga0495602_0016473_1119_2057 | 310 |
| 117 | 3300048091 | Ga0495626_0000005 | Ga0495626_0000005_290152_291090 | 310 |
| 118 | 3300048091 | Ga0495626_0019890 | Ga0495626_0019890_1238_2176 | 310 |
| 119 | 3300048091 | Ga0495626_0024308 | Ga0495626_0024308_1661_2599 | 310 |
| 120 | 3300048091 | Ga0495626_0043398 | Ga0495626_0043398_1148_2086 | 310 |
| 121 | 3300048091 | Ga0495626_0050528 | Ga0495626_0050528_910_1893 | 310 |
| 122 | 3300048905 | Ga0496102_0179800 | Ga0496102_0179800_254_1192 | 310 |
| 123 | 3300049459 | Ga0495678_000256 | Ga0495678_000256_17640_18578 | 310 |
| 124 | 3300049459 | Ga0495678_000524 | Ga0495678_000524_20843_21781 | 310 |
| 125 | 3300049460 | Ga0495682_0000308 | Ga0495682_0000308_15184_16122 | 310 |
| 126 | 3300049580 | Ga0501046_0150064 | Ga0501046_0150064_330_1271 | 310 |
| 127 | 3300049742 | Ga0501080_0551761 | Ga0501080_0551761_22_972 | 310 |
| 128 | 3300049744 | Ga0501083_0000749 | Ga0501083_0000749_19860_20798 | 310 |
| 129 | 3300049744 | Ga0501083_0141683 | Ga0501083_0141683_601_1542 | 310 |
| 130 | 3300050492 | nmdc:mga0yw44_282764_c1 | nmdc:mga0yw44_282764_c1_142_1077 | 310 |
| 131 | 3300053122 | Ga0500608_004458 | Ga0500608_004458_53_994 | 310 |
| 132 | 3300053736 | Ga0500599_013765 | Ga0500599_013765_12_953 | 310 |
| 133 | 3300005289 | Ga0065704_10001157 | Ga0065704_100011574 | 311 |
| 134 | 3300005985 | Ga0081539_10000260 | Ga0081539_10000260114 | 311 |
| 135 | 3300013306 | Ga0163162_10063999 | Ga0163162_100639992 | 311 |
| 136 | 3300021384 | Ga0213876_10009202 | Ga0213876_100092021 | 311 |
| 137 | 3300025924 | Ga0207694_10000017 | Ga0207694_10000017213 | 311 |
| 138 | 3300028381 | Ga0268264_10070350 | Ga0268264_100703502 | 311 |
| 139 | 3300038443 | Ga0395901_0165847 | Ga0395901_0165847_1334_2272 | 311 |
| 140 | 3300039437 | Ga0436365_0968347 | Ga0436365_0968347_927_1865 | 311 |
| 141 | 3300039437 | Ga0436365_1738300 | Ga0436365_1738300_1661_2599 | 311 |
| 142 | 3300039437 | Ga0436365_1805460 | Ga0436365_1805460_4352_5290 | 311 |
| 143 | 3300046689 | Ga0495613_0006343 | Ga0495613_0006343_431_1378 | 311 |
| 144 | 3300048918 | Ga0496115_0064859 | Ga0496115_0064859_1390_2328 | 311 |
| 145 | 3300049571 | Ga0501034_0464770 | Ga0501034_0464770_13_969 | 311 |
| 146 | 3300049578 | Ga0501042_0337865 | Ga0501042_0337865_116_1060 | 311 |
| 147 | 3300049686 | Ga0501257_014512 | Ga0501257_014512_683_1636 | 311 |
| 148 | 3300049743 | Ga0501081_0034541 | Ga0501081_0034541_2387_3331 | 311 |
| 149 | 3300050512 | nmdc:mga0n895_152409_c1 | nmdc:mga0n895_152409_c1_1009_1953 | 311 |
| 150 | 3300050515 | nmdc:mga0a205_20785_c1 | nmdc:mga0a205_20785_c1_4310_5254 | 311 |
| 151 | 3300053131 | Ga0500652_086027 | Ga0500652_086027_23_967 | 311 |
| 152 | 3300042005 | Ga0439448_0007409 | Ga0439448_0007409_218_1162 | 313 |
| 153 | 3300042012 | Ga0439455_0006090 | Ga0439455_0006090_291_1235 | 313 |
| 154 | 3300042533 | Ga0450901_008779 | Ga0450901_008779_27_971 | 313 |
| 155 | 3300046514 | Ga0495618_0159371 | Ga0495618_0159371_449_1393 | 313 |
| 156 | 3300046675 | Ga0495657_0010913 | Ga0495657_0010913_5843_6787 | 313 |
| 157 | 3300046794 | Ga0495589_0014904 | Ga0495589_0014904_735_1679 | 313 |
| 158 | 3300047318 | Ga0495636_0043068 | Ga0495636_0043068_881_1837 | 313 |
| 159 | 3300047318 | Ga0495636_0070873 | Ga0495636_0070873_480_1424 | 313 |
| 160 | 3300048925 | Ga0496122_0155793 | Ga0496122_0155793_54_1010 | 313 |
| 161 | 3300049742 | Ga0501080_0069187 | Ga0501080_0069187_1712_2662 | 313 |
| 162 | 3300060353 | Ga0501082_0046358 | Ga0501082_0046358_2600_3550 | 313 |
| 163 | 3300009036 | Ga0105244_10063203 | Ga0105244_100632032 | 314 |
| 164 | 3300031247 | Ga0265340_10015861 | Ga0265340_100158612 | 314 |
| 165 | 3300045976 | Ga0466967_0053848 | Ga0466967_0053848_2208_3158 | 314 |
| 166 | 3300046457 | Ga0495590_0005479 | Ga0495590_0005479_3403_4347 | 314 |
| 167 | 3300046542 | Ga0495597_0003217 | Ga0495597_0003217_5803_6747 | 314 |
| 168 | 3300046694 | Ga0495649_0127220 | Ga0495649_0127220_255_1199 | 314 |
| 169 | 3300047323 | Ga0495683_0005694 | Ga0495683_0005694_1772_2716 | 314 |
| 170 | 3300048910 | Ga0496107_0050519 | Ga0496107_0050519_1190_2134 | 314 |
| 171 | 3300048912 | Ga0496109_0559946 | Ga0496109_0559946_54_998 | 314 |
| 172 | 3300048914 | Ga0496111_0001836 | Ga0496111_0001836_3123_4067 | 314 |
| 173 | 3300048915 | Ga0496112_0016434 | Ga0496112_0016434_216_1160 | 314 |
| 174 | 3300048926 | Ga0496123_0027358 | Ga0496123_0027358_134_1078 | 314 |
| 175 | 3300048927 | Ga0496124_0381154 | Ga0496124_0381154_30_974 | 314 |
| 176 | 3300037312 | Ga0395899_0000016 | Ga0395899_0000016_401298_402248 | 315 |
| 177 | 3300049744 | Ga0501083_0149104 | Ga0501083_0149104_85_1086 | 316 |
| 178 | 3300049823 | Ga0501044_0101410 | Ga0501044_0101410_671_1672 | 316 |
| 179 | 3300003322 | rootL2_10244431 | rootL2_102444311 | 317 |
| 180 | 3300021361 | Ga0213872_10100302 | Ga0213872_101003022 | 317 |
| 181 | 3300039447 | Ga0436361_0647556 | Ga0436361_0647556_4456_5448 | 317 |
| 182 | 3300041507 | Ga0451851_0679826 | Ga0451851_0679826_41_1021 | 317 |
| 183 | 3300031247 | Ga0265340_10011864 | Ga0265340_100118644 | 318 |
| 184 | 3300046501 | Ga0495607_0047494 | Ga0495607_0047494_23_988 | 318 |
| 185 | 3300046506 | Ga0495583_0022229 | Ga0495583_0022229_1083_2048 | 318 |
| 186 | 3300048928 | Ga0496125_0022904 | Ga0496125_0022904_680_1645 | 318 |
| 187 | 3300053131 | Ga0500652_000390 | Ga0500652_000390_8250_9215 | 318 |
| 188 | 3300049586 | Ga0501070_0050448 | Ga0501070_0050448_932_2008 | 319 |
| 189 | 3300049590 | Ga0501074_0083528 | Ga0501074_0083528_827_1903 | 319 |
| 190 | 3300053735 | Ga0500596_000127 | Ga0500596_000127_5281_6246 | 319 |
| 191 | 3300031616 | Ga0307508_10052441 | Ga0307508_100524413 | 321 |
| 192 | 3300047444 | Ga0495675_0033535 | Ga0495675_0033535_1879_2874 | 321 |
| 193 | 3300049571 | Ga0501034_0393725 | Ga0501034_0393725_168_1172 | 321 |
| 194 | 3300053730 | Ga0500645_021809 | Ga0500645_021809_132_1124 | 321 |
| 195 | iso_pu_bacteria | 2883291878 | 2883295599 | 322 |
| 196 | 3300028381 | Ga0268264_10229146 | Ga0268264_102291462 | 323 |
| 197 | 3300028794 | Ga0307515_10015071 | Ga0307515_100150713 | 323 |
| 198 | 3300039447 | Ga0436361_0794720 | Ga0436361_0794720_19_990 | 323 |
| 199 | 3300046459 | Ga0495629_0037690 | Ga0495629_0037690_132_1127 | 323 |
| 200 | 3300046476 | Ga0495662_0003653 | Ga0495662_0003653_2890_3885 | 323 |
| 201 | 3300046689 | Ga0495613_0018858 | Ga0495613_0018858_517_1512 | 323 |
| 202 | 3300048911 | Ga0496108_0185860 | Ga0496108_0185860_775_1755 | 323 |
| 203 | 3300048912 | Ga0496109_0326562 | Ga0496109_0326562_262_1242 | 323 |
| 204 | 3300048913 | Ga0496110_0049348 | Ga0496110_0049348_2147_3127 | 323 |
| 205 | 3300048915 | Ga0496112_0260013 | Ga0496112_0260013_232_1212 | 323 |
| 206 | iso_pu_bacteria | 2883354860 | 2883358453 | 323 |
| 207 | 3300046524 | Ga0495648_0011121 | Ga0495648_0011121_2975_3955 | 324 |
| 208 | 3300048091 | Ga0495626_0040297 | Ga0495626_0040297_766_1746 | 324 |
| 209 | iso_pu_bacteria | 2509276019 | 2509375980 | 324 |
| 210 | iso_pu_bacteria | 2850079185 | 2850081901 | 324 |
| 211 | iso_pu_bacteria | 2899359706 | 2899360395 | 324 |
| 212 | 3300005343 | Ga0070687_100033026 | Ga0070687_1000330263 | 325 |
| 213 | 3300025918 | Ga0207662_10023054 | Ga0207662_100230543 | 325 |
| 214 | 3300028666 | Ga0265336_10000664 | Ga0265336_1000066418 | 325 |
| 215 | 3300028800 | Ga0265338_10083232 | Ga0265338_100832322 | 325 |
| 216 | 3300031239 | Ga0265328_10021119 | Ga0265328_100211193 | 325 |
| 217 | 3300031240 | Ga0265320_10056299 | Ga0265320_100562992 | 325 |
| 218 | 3300031241 | Ga0265325_10016843 | Ga0265325_100168432 | 325 |
| 219 | 3300031247 | Ga0265340_10079455 | Ga0265340_100794551 | 325 |
| 220 | 3300031344 | Ga0265316_10053576 | Ga0265316_100535763 | 325 |
| 221 | 3300031344 | Ga0265316_10115896 | Ga0265316_101158962 | 325 |
| 222 | 3300031595 | Ga0265313_10009270 | Ga0265313_100092704 | 325 |
| 223 | 3300031712 | Ga0265342_10065193 | Ga0265342_100651932 | 325 |
| 224 | 3300044693 | Ga0466961_0027628 | Ga0466961_0027628_874_1860 | 325 |
| 225 | 3300046474 | Ga0495605_0020407 | Ga0495605_0020407_493_1476 | 325 |
| 226 | 3300046491 | Ga0495584_0012951 | Ga0495584_0012951_404_1387 | 325 |
| 227 | 3300046528 | Ga0495642_0036493 | Ga0495642_0036493_301_1284 | 325 |
| 228 | 3300046616 | Ga0495668_0090919 | Ga0495668_0090919_198_1181 | 325 |
| 229 | 3300046794 | Ga0495589_0043427 | Ga0495589_0043427_492_1475 | 325 |
| 230 | 3300047323 | Ga0495683_0029973 | Ga0495683_0029973_132_1115 | 325 |
| 231 | 3300049586 | Ga0501070_0046624 | Ga0501070_0046624_2146_3159 | 325 |
| 232 | iso_pu_bacteria | 2643221614 | 2644088757 | 325 |
| 233 | iso_pu_bacteria | 2643221629 | 2644166185 | 325 |
| 234 | iso_pu_bacteria | 2643221661 | 2644343992 | 325 |
| 235 | iso_pu_bacteria | 2643221662 | 2644346810 | 325 |
| 236 | iso_pu_bacteria | 2643221666 | 2644368529 | 325 |
| 237 | iso_pu_bacteria | 2738541317 | 2738947905 | 325 |
| 238 | iso_pu_bacteria | 2913308742 | 2913312887 | 325 |
| 239 | 3300003781 | Ga0055536_1002443 | Ga0055536_100244312 | 326 |
| 240 | 3300005455 | Ga0070663_100114797 | Ga0070663_1001147972 | 326 |
| 241 | 3300025292 | Ga0209676_1000547 | Ga0209676_10005477 | 326 |
| 242 | 3300025298 | Ga0209050_1014984 | Ga0209050_10149843 | 326 |
| 243 | 3300049575 | Ga0501039_0110515 | Ga0501039_0110515_1077_2069 | 326 |
| 244 | 3300049741 | Ga0501079_0375806 | Ga0501079_0375806_36_1028 | 326 |
| 245 | 3300049824 | Ga0501045_0128594 | Ga0501045_0128594_10_1002 | 326 |
| 246 | iso_pu_bacteria | 2508501122 | 2509107642 | 326 |
| 247 | iso_pu_bacteria | 2510461069 | 2510839595 | 326 |
| 248 | iso_pu_bacteria | 2513237159 | 2513997787 | 326 |
| 249 | iso_pu_bacteria | 2558860100 | 2558868253 | 326 |
| 250 | iso_pu_bacteria | 2579778521 | 2579858254 | 326 |
| 251 | iso_pu_bacteria | 2582581866 | 2585395537 | 326 |
| 252 | iso_pu_bacteria | 2597490356 | 2599100367 | 326 |
| 253 | iso_pu_bacteria | 2619618881 | 2619855430 | 326 |
| 254 | iso_pu_bacteria | 2619619003 | 2620354027 | 326 |
| 255 | iso_pu_bacteria | 2643221637 | 2644208884 | 326 |
| 256 | iso_pu_bacteria | 2643221718 | 2644652414 | 326 |
| 257 | iso_pu_bacteria | 2675903060 | 2676487635 | 326 |
| 258 | iso_pu_bacteria | 2791355048 | 2792461237 | 326 |
| 259 | iso_pu_bacteria | 2791355094 | 2792639545 | 326 |
| 260 | iso_pu_bacteria | 2811994917 | 2812483263 | 326 |
| 261 | iso_pu_bacteria | 2837268691 | 2837271229 | 326 |
| 262 | iso_pu_bacteria | 2842521101 | 2842521964 | 326 |
| 263 | iso_pu_bacteria | 2842694124 | 2842697673 | 326 |
| 264 | iso_pu_bacteria | 2843744320 | 2843745306 | 326 |
| 265 | iso_pu_bacteria | 2846952575 | 2846956405 | 326 |
| 266 | iso_pu_bacteria | 2848858292 | 2848862041 | 326 |
| 267 | iso_pu_bacteria | 2849560528 | 2849564583 | 326 |
| 268 | iso_pu_bacteria | 2849573788 | 2849577694 | 326 |
| 269 | iso_pu_bacteria | 2851153111 | 2851155680 | 326 |
| 270 | iso_pu_bacteria | 2862290372 | 2862297197 | 326 |
| 271 | iso_pu_bacteria | 2873314349 | 2873318468 | 326 |
| 272 | iso_pu_bacteria | 2893066018 | 2893067222 | 326 |
| 273 | iso_pu_bacteria | 2899803654 | 2899804258 | 326 |
| 274 | iso_pu_bacteria | 2908756301 | 2908756360 | 326 |
| 275 | iso_pu_bacteria | 8003830390 | 8003835450 | 326 |
| 276 | 3300013105 | Ga0157369_10134064 | Ga0157369_101340642 | 327 |
| 277 | 3300020082 | Ga0206353_10718303 | Ga0206353_107183032 | 327 |
| 278 | 3300031247 | Ga0265340_10000024 | Ga0265340_1000002447 | 327 |
| 279 | 3300031344 | Ga0265316_10010461 | Ga0265316_100104619 | 327 |
| 280 | 3300049569 | Ga0501032_0090200 | Ga0501032_0090200_242_1315 | 327 |
| 281 | 3300049570 | Ga0501033_0209419 | Ga0501033_0209419_89_1075 | 327 |
| 282 | 3300049575 | Ga0501039_0059260 | Ga0501039_0059260_751_1824 | 327 |
| 283 | 3300049579 | Ga0501043_0095690 | Ga0501043_0095690_740_1735 | 327 |
| 284 | 3300049580 | Ga0501046_0071329 | Ga0501046_0071329_899_1885 | 327 |
| 285 | 3300049581 | Ga0501047_0061667 | Ga0501047_0061667_1487_2560 | 327 |
| 286 | 3300049581 | Ga0501047_0275166 | Ga0501047_0275166_121_1116 | 327 |
| 287 | 3300049590 | Ga0501074_0077661 | Ga0501074_0077661_1361_2347 | 327 |
| 288 | 3300049742 | Ga0501080_0029055 | Ga0501080_0029055_1074_2069 | 327 |
| 289 | 3300049744 | Ga0501083_0020618 | Ga0501083_0020618_3508_4500 | 327 |
| 290 | 3300054114 | Ga0501084_0291171 | Ga0501084_0291171_287_1282 | 327 |
| 291 | iso_pu_bacteria | 2513237104 | 2513719835 | 327 |
| 292 | iso_pu_bacteria | 2775506902 | 2776270219 | 327 |
| 293 | iso_pu_bacteria | 2775506904 | 2776285054 | 327 |
| 294 | iso_pu_bacteria | 2840764183 | 2840765932 | 327 |
| 295 | iso_pu_bacteria | 2894652903 | 2894654983 | 327 |
| 296 | iso_pu_bacteria | 2935777560 | 2935782269 | 327 |
| 297 | iso_pu_bacteria | 2989771324 | 2989775759 | 327 |
| 298 | iso_pu_bacteria | 3002141150 | 3002142490 | 327 |
| 299 | iso_pu_bacteria | 8001781756 | 8001786643 | 327 |
| 300 | iso_pu_bacteria | 8016530956 | 8016539594 | 327 |
| 301 | iso_pu_bacteria | 8016539877 | 8016543890 | 327 |
| 302 | iso_pu_bacteria | 8016557553 | 8016557837 | 327 |
| 303 | iso_pu_bacteria | 8016566248 | 8016569289 | 327 |
| 304 | iso_pu_bacteria | 8016595262 | 8016595856 | 327 |
| 305 | iso_pu_bacteria | 8016603502 | 8016606721 | 327 |
| 306 | iso_pu_bacteria | 8016622563 | 8016623367 | 327 |
| 307 | iso_pu_bacteria | 8019530166 | 8019530874 | 327 |
| 308 | iso_pu_bacteria | 8019538911 | 8019540709 | 327 |
| 309 | iso_pu_bacteria | 8019547302 | 8019550388 | 327 |
| 310 | iso_pu_bacteria | 8047710418 | 8047716355 | 327 |
| 311 | 3300003323 | rootH1_10244174 | rootH1_102441741 | 328 |
| 312 | 3300005355 | Ga0070671_100355568 | Ga0070671_1003555681 | 328 |
| 313 | 3300044706 | Ga0466964_0019589 | Ga0466964_0019589_43_1032 | 328 |
| 314 | 3300044706 | Ga0466964_0039741 | Ga0466964_0039741_598_1587 | 328 |
| 315 | 3300046460 | Ga0495638_0108248 | Ga0495638_0108248_507_1499 | 328 |
| 316 | 3300046616 | Ga0495668_0110950 | Ga0495668_0110950_143_1132 | 328 |
| 317 | 3300046648 | Ga0495611_0015713 | Ga0495611_0015713_547_1536 | 328 |
| 318 | 3300046694 | Ga0495649_0028444 | Ga0495649_0028444_1627_2619 | 328 |
| 319 | 3300049823 | Ga0501044_0256423 | Ga0501044_0256423_278_1288 | 328 |
| 320 | 3300053083 | Ga0495655_0027280 | Ga0495655_0027280_121_1119 | 328 |
| 321 | 3300053088 | Ga0500644_0009720 | Ga0500644_0009720_14_1006 | 328 |
| 322 | 3300053156 | Ga0500622_0000697 | Ga0500622_0000697_6082_7074 | 328 |
| 323 | 3300053156 | Ga0500622_0015301 | Ga0500622_0015301_2305_3291 | 328 |
| 324 | iso_pu_bacteria | 2751185725 | 2753036247 | 328 |
| 325 | iso_pu_bacteria | 2751185792 | 2753324118 | 328 |
| 326 | iso_pu_bacteria | 2821443989 | 2821447131 | 328 |
| 327 | iso_pu_bacteria | 2844533157 | 2844537245 | 328 |
| 328 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002357 | 329 |
| 329 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002357 | 329 |
| 330 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004357 | 329 |
| 331 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002357 | 329 |
| 332 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002486 | 329 |
| 333 | 3300005262 | Ga0065165_1000041 | Ga0065165_1000041168 | 329 |
| 334 | 3300005327 | Ga0070658_10486722 | Ga0070658_104867221 | 329 |
| 335 | 3300005355 | Ga0070671_100148165 | Ga0070671_1001481652 | 329 |
| 336 | 3300005356 | Ga0070674_100058420 | Ga0070674_1000584202 | 329 |
| 337 | 3300005364 | Ga0070673_100043152 | Ga0070673_1000431525 | 329 |
| 338 | 3300005445 | Ga0070708_100001636 | Ga0070708_1000016368 | 329 |
| 339 | 3300005456 | Ga0070678_100067356 | Ga0070678_1000673563 | 329 |
| 340 | 3300005467 | Ga0070706_100078965 | Ga0070706_1000789651 | 329 |
| 341 | 3300005518 | Ga0070699_100108834 | Ga0070699_1001088343 | 329 |
| 342 | 3300005536 | Ga0070697_100018903 | Ga0070697_1000189032 | 329 |
| 343 | 3300005840 | Ga0068870_10027496 | Ga0068870_100274962 | 329 |
| 344 | 3300005841 | Ga0068863_100052519 | Ga0068863_1000525192 | 329 |
| 345 | 3300006353 | Ga0075370_10144723 | Ga0075370_101447231 | 329 |
| 346 | 3300007076 | Ga0075435_100499820 | Ga0075435_1004998201 | 329 |
| 347 | 3300009101 | Ga0105247_10016880 | Ga0105247_100168803 | 329 |
| 348 | 3300009551 | Ga0105238_10008427 | Ga0105238_100084274 | 329 |
| 349 | 3300009553 | Ga0105249_10152251 | Ga0105249_101522512 | 329 |
| 350 | 3300013308 | Ga0157375_10042148 | Ga0157375_100421482 | 329 |
| 351 | 3300014325 | Ga0163163_10098993 | Ga0163163_100989932 | 329 |
| 352 | 3300014326 | Ga0157380_10045986 | Ga0157380_100459862 | 329 |
| 353 | 3300017792 | Ga0163161_10068801 | Ga0163161_100688011 | 329 |
| 354 | 3300025250 | Ga0209026_1001674 | Ga0209026_10016748 | 329 |
| 355 | 3300025304 | Ga0209257_1004227 | Ga0209257_10042274 | 329 |
| 356 | 3300025908 | Ga0207643_10009053 | Ga0207643_100090532 | 329 |
| 357 | 3300025910 | Ga0207684_10174360 | Ga0207684_101743602 | 329 |
| 358 | 3300025924 | Ga0207694_10036175 | Ga0207694_100361754 | 329 |
| 359 | 3300025938 | Ga0207704_10127593 | Ga0207704_101275932 | 329 |
| 360 | 3300025940 | Ga0207691_10027134 | Ga0207691_100271346 | 329 |
| 361 | 3300026088 | Ga0207641_10019105 | Ga0207641_100191056 | 329 |
| 362 | 3300026089 | Ga0207648_10069754 | Ga0207648_100697543 | 329 |
| 363 | 3300026121 | Ga0207683_10069410 | Ga0207683_100694102 | 329 |
| 364 | 3300031456 | Ga0307513_10343730 | Ga0307513_103437301 | 329 |
| 365 | 3300031995 | Ga0307409_100145715 | Ga0307409_1001457152 | 329 |
| 366 | 3300036647 | Ga0316582_0062309 | Ga0316582_0062309_180_1172 | 329 |
| 367 | 3300036712 | Ga0316584_0104569 | Ga0316584_0104569_92_1084 | 329 |
| 368 | 3300044693 | Ga0466961_0051398 | Ga0466961_0051398_271_1314 | 329 |
| 369 | 3300046460 | Ga0495638_0070621 | Ga0495638_0070621_711_1709 | 329 |
| 370 | 3300046616 | Ga0495668_0140030 | Ga0495668_0140030_237_1229 | 329 |
| 371 | 3300047472 | Ga0495686_0013091 | Ga0495686_0013091_1655_2647 | 329 |
| 372 | 3300047472 | Ga0495686_0050582 | Ga0495686_0050582_691_1689 | 329 |
| 373 | 3300049569 | Ga0501032_0057205 | Ga0501032_0057205_333_1355 | 329 |
| 374 | 3300049570 | Ga0501033_0086063 | Ga0501033_0086063_631_1653 | 329 |
| 375 | 3300049571 | Ga0501034_0280811 | Ga0501034_0280811_467_1489 | 329 |
| 376 | 3300049572 | Ga0501036_0013938 | Ga0501036_0013938_2008_3030 | 329 |
| 377 | 3300049572 | Ga0501036_0092149 | Ga0501036_0092149_133_1125 | 329 |
| 378 | 3300049573 | Ga0501037_0156139 | Ga0501037_0156139_107_1153 | 329 |
| 379 | 3300049574 | Ga0501038_0017722 | Ga0501038_0017722_4764_5786 | 329 |
| 380 | 3300049574 | Ga0501038_0060781 | Ga0501038_0060781_148_1194 | 329 |
| 381 | 3300049575 | Ga0501039_0095671 | Ga0501039_0095671_800_1792 | 329 |
| 382 | 3300049578 | Ga0501042_0032063 | Ga0501042_0032063_1828_2850 | 329 |
| 383 | 3300049579 | Ga0501043_0020490 | Ga0501043_0020490_2137_3183 | 329 |
| 384 | 3300049579 | Ga0501043_0054164 | Ga0501043_0054164_1269_2291 | 329 |
| 385 | 3300049580 | Ga0501046_0195387 | Ga0501046_0195387_44_1066 | 329 |
| 386 | 3300049581 | Ga0501047_0058832 | Ga0501047_0058832_624_1670 | 329 |
| 387 | 3300049581 | Ga0501047_0242493 | Ga0501047_0242493_165_1187 | 329 |
| 388 | 3300049582 | Ga0501048_0100173 | Ga0501048_0100173_980_1972 | 329 |
| 389 | 3300049582 | Ga0501048_0319774 | Ga0501048_0319774_33_1055 | 329 |
| 390 | 3300049586 | Ga0501070_0090627 | Ga0501070_0090627_1242_2288 | 329 |
| 391 | 3300049586 | Ga0501070_0091701 | Ga0501070_0091701_144_1166 | 329 |
| 392 | 3300049588 | Ga0501072_0017620 | Ga0501072_0017620_4302_5315 | 329 |
| 393 | 3300049589 | Ga0501073_0004147 | Ga0501073_0004147_745_1767 | 329 |
| 394 | 3300049589 | Ga0501073_0023396 | Ga0501073_0023396_1194_2195 | 329 |
| 395 | 3300049590 | Ga0501074_0006780 | Ga0501074_0006780_366_1388 | 329 |
| 396 | 3300049742 | Ga0501080_0046968 | Ga0501080_0046968_1845_2867 | 329 |
| 397 | 3300049742 | Ga0501080_0064652 | Ga0501080_0064652_646_1647 | 329 |
| 398 | 3300049744 | Ga0501083_0052792 | Ga0501083_0052792_218_1240 | 329 |
| 399 | 3300049822 | Ga0501035_0124124 | Ga0501035_0124124_1157_2158 | 329 |
| 400 | 3300049823 | Ga0501044_0017691 | Ga0501044_0017691_3945_4967 | 329 |
| 401 | 3300049824 | Ga0501045_0148648 | Ga0501045_0148648_98_1090 | 329 |
| 402 | 3300050511 | nmdc:mga08y16_339701_c1 | nmdc:mga08y16_339701_c1_202_1194 | 329 |
| 403 | 3300053096 | Ga0500641_0012929 | Ga0500641_0012929_1201_2199 | 329 |
| 404 | 3300053153 | Ga0500616_0001247 | Ga0500616_0001247_15153_16151 | 329 |
| 405 | 3300054114 | Ga0501084_0250232 | Ga0501084_0250232_258_1280 | 329 |
| 406 | 3300060353 | Ga0501082_0152946 | Ga0501082_0152946_332_1354 | 329 |
| 407 | iso_pu_bacteria | 2643221601 | 2644019731 | 329 |
| 408 | iso_pu_bacteria | 2643221631 | 2644180379 | 329 |
| 409 | iso_pu_bacteria | 2767802112 | 2768647398 | 329 |
| 410 | iso_pu_bacteria | 2857542790 | 2857547099 | 329 |
| 411 | iso_pu_bacteria | 3006493962 | 3006501053 | 329 |
| 412 | 3300002075 | JGI24738J21930_10002057 | JGI24738J21930_100020572 | 330 |
| 413 | 3300002077 | JGI24744J21845_10020508 | JGI24744J21845_100205082 | 330 |
| 414 | 3300003187 | JGI25151J46595_10003611 | JGI25151J46595_100036115 | 330 |
| 415 | 3300003203 | JGI25406J46586_10003682 | JGI25406J46586_100036827 | 330 |
| 416 | 3300003215 | JGI25153J46596_10000059 | JGI25153J46596_1000005918 | 330 |
| 417 | 3300003215 | JGI25153J46596_10000347 | JGI25153J46596_1000034729 | 330 |
| 418 | 3300003316 | rootH1_10039975 | rootH1_100399753 | 330 |
| 419 | 3300003322 | rootL2_10042670 | rootL2_100426703 | 330 |
| 420 | 3300003775 | Ga0055524_1003285 | Ga0055524_10032854 | 330 |
| 421 | 3300003790 | Ga0055528_1003718 | Ga0055528_10037183 | 330 |
| 422 | 3300003794 | Ga0055531_10020550 | Ga0055531_100205503 | 330 |
| 423 | 3300005327 | Ga0070658_10023456 | Ga0070658_100234563 | 330 |
| 424 | 3300005328 | Ga0070676_10005433 | Ga0070676_100054337 | 330 |
| 425 | 3300005329 | Ga0070683_100044156 | Ga0070683_1000441563 | 330 |
| 426 | 3300005329 | Ga0070683_100543434 | Ga0070683_1005434341 | 330 |
| 427 | 3300005330 | Ga0070690_100000353 | Ga0070690_1000003533 | 330 |
| 428 | 3300005331 | Ga0070670_100022096 | Ga0070670_1000220964 | 330 |
| 429 | 3300005336 | Ga0070680_100040786 | Ga0070680_1000407863 | 330 |
| 430 | 3300005337 | Ga0070682_100002246 | Ga0070682_10000224611 | 330 |
| 431 | 3300005338 | Ga0068868_100016065 | Ga0068868_1000160654 | 330 |
| 432 | 3300005339 | Ga0070660_100001656 | Ga0070660_1000016565 | 330 |
| 433 | 3300005340 | Ga0070689_100001225 | Ga0070689_10000122510 | 330 |
| 434 | 3300005341 | Ga0070691_10000400 | Ga0070691_100004004 | 330 |
| 435 | 3300005343 | Ga0070687_100000797 | Ga0070687_1000007978 | 330 |
| 436 | 3300005344 | Ga0070661_100000384 | Ga0070661_10000038425 | 330 |
| 437 | 3300005345 | Ga0070692_10005510 | Ga0070692_100055101 | 330 |
| 438 | 3300005347 | Ga0070668_100000244 | Ga0070668_10000024425 | 330 |
| 439 | 3300005353 | Ga0070669_100005644 | Ga0070669_1000056444 | 330 |
| 440 | 3300005354 | Ga0070675_100010071 | Ga0070675_1000100714 | 330 |
| 441 | 3300005355 | Ga0070671_100015311 | Ga0070671_1000153114 | 330 |
| 442 | 3300005356 | Ga0070674_100004514 | Ga0070674_1000045148 | 330 |
| 443 | 3300005356 | Ga0070674_100151898 | Ga0070674_1001518981 | 330 |
| 444 | 3300005364 | Ga0070673_100001304 | Ga0070673_10000130415 | 330 |
| 445 | 3300005366 | Ga0070659_100001838 | Ga0070659_10000183814 | 330 |
| 446 | 3300005367 | Ga0070667_100038589 | Ga0070667_1000385893 | 330 |
| 447 | 3300005406 | Ga0070703_10074344 | Ga0070703_100743441 | 330 |
| 448 | 3300005434 | Ga0070709_10002721 | Ga0070709_1000272111 | 330 |
| 449 | 3300005435 | Ga0070714_100034133 | Ga0070714_1000341333 | 330 |
| 450 | 3300005436 | Ga0070713_100014713 | Ga0070713_1000147136 | 330 |
| 451 | 3300005436 | Ga0070713_100177568 | Ga0070713_1001775684 | 330 |
| 452 | 3300005437 | Ga0070710_10000631 | Ga0070710_100006313 | 330 |
| 453 | 3300005438 | Ga0070701_10000411 | Ga0070701_100004112 | 330 |
| 454 | 3300005439 | Ga0070711_100012991 | Ga0070711_1000129913 | 330 |
| 455 | 3300005440 | Ga0070705_100003021 | Ga0070705_1000030211 | 330 |
| 456 | 3300005441 | Ga0070700_100006086 | Ga0070700_1000060865 | 330 |
| 457 | 3300005444 | Ga0070694_100009526 | Ga0070694_1000095264 | 330 |
| 458 | 3300005455 | Ga0070663_100002295 | Ga0070663_1000022951 | 330 |
| 459 | 3300005456 | Ga0070678_100001330 | Ga0070678_10000133010 | 330 |
| 460 | 3300005457 | Ga0070662_100001264 | Ga0070662_10000126411 | 330 |
| 461 | 3300005458 | Ga0070681_10087479 | Ga0070681_100874793 | 330 |
| 462 | 3300005459 | Ga0068867_100009543 | Ga0068867_1000095433 | 330 |
| 463 | 3300005535 | Ga0070684_100006348 | Ga0070684_1000063487 | 330 |
| 464 | 3300005536 | Ga0070697_100000600 | Ga0070697_10000060016 | 330 |
| 465 | 3300005539 | Ga0068853_100002094 | Ga0068853_10000209411 | 330 |
| 466 | 3300005543 | Ga0070672_100000593 | Ga0070672_10000059317 | 330 |
| 467 | 3300005544 | Ga0070686_100008356 | Ga0070686_1000083563 | 330 |
| 468 | 3300005545 | Ga0070695_100019548 | Ga0070695_1000195481 | 330 |
| 469 | 3300005546 | Ga0070696_100009212 | Ga0070696_1000092121 | 330 |
| 470 | 3300005547 | Ga0070693_100002402 | Ga0070693_1000024027 | 330 |
| 471 | 3300005548 | Ga0070665_100010157 | Ga0070665_1000101575 | 330 |
| 472 | 3300005548 | Ga0070665_100193817 | Ga0070665_1001938172 | 330 |
| 473 | 3300005549 | Ga0070704_100001660 | Ga0070704_1000016604 | 330 |
| 474 | 3300005563 | Ga0068855_100000893 | Ga0068855_1000008933 | 330 |
| 475 | 3300005564 | Ga0070664_100001131 | Ga0070664_10000113111 | 330 |
| 476 | 3300005577 | Ga0068857_100004274 | Ga0068857_10000427412 | 330 |
| 477 | 3300005578 | Ga0068854_100004366 | Ga0068854_1000043664 | 330 |
| 478 | 3300005614 | Ga0068856_100002475 | Ga0068856_1000024753 | 330 |
| 479 | 3300005615 | Ga0070702_100002170 | Ga0070702_1000021705 | 330 |
| 480 | 3300005616 | Ga0068852_100001835 | Ga0068852_1000018355 | 330 |
| 481 | 3300005617 | Ga0068859_100039295 | Ga0068859_1000392954 | 330 |
| 482 | 3300005618 | Ga0068864_100009139 | Ga0068864_1000091395 | 330 |
| 483 | 3300005718 | Ga0068866_10000716 | Ga0068866_100007164 | 330 |
| 484 | 3300005719 | Ga0068861_100002260 | Ga0068861_1000022603 | 330 |
| 485 | 3300005834 | Ga0068851_10110910 | Ga0068851_101109102 | 330 |
| 486 | 3300005841 | Ga0068863_100006545 | Ga0068863_1000065456 | 330 |
| 487 | 3300005842 | Ga0068858_100002708 | Ga0068858_1000027082 | 330 |
| 488 | 3300005843 | Ga0068860_100001510 | Ga0068860_1000015102 | 330 |
| 489 | 3300005844 | Ga0068862_100001549 | Ga0068862_10000154910 | 330 |
| 490 | 3300005844 | Ga0068862_100037119 | Ga0068862_1000371195 | 330 |
| 491 | 3300005937 | Ga0081455_10160346 | Ga0081455_101603461 | 330 |
| 492 | 3300005985 | Ga0081539_10002379 | Ga0081539_1000237911 | 330 |
| 493 | 3300005985 | Ga0081539_10004993 | Ga0081539_100049938 | 330 |
| 494 | 3300006038 | Ga0075365_10020608 | Ga0075365_100206084 | 330 |
| 495 | 3300006038 | Ga0075365_10027832 | Ga0075365_100278322 | 330 |
| 496 | 3300006038 | Ga0075365_10090639 | Ga0075365_100906392 | 330 |
| 497 | 3300006051 | Ga0075364_10060179 | Ga0075364_100601793 | 330 |
| 498 | 3300006163 | Ga0070715_10001549 | Ga0070715_100015495 | 330 |
| 499 | 3300006173 | Ga0070716_100003352 | Ga0070716_1000033523 | 330 |
| 500 | 3300006175 | Ga0070712_100010677 | Ga0070712_1000106774 | 330 |
| 501 | 3300006237 | Ga0097621_100140530 | Ga0097621_1001405303 | 330 |
| 502 | 3300006358 | Ga0068871_100029996 | Ga0068871_1000299963 | 330 |
| 503 | 3300006844 | Ga0075428_100060512 | Ga0075428_1000605125 | 330 |
| 504 | 3300006846 | Ga0075430_100255262 | Ga0075430_1002552622 | 330 |
| 505 | 3300006847 | Ga0075431_100211576 | Ga0075431_1002115762 | 330 |
| 506 | 3300006852 | Ga0075433_10016953 | Ga0075433_100169535 | 330 |
| 507 | 3300006852 | Ga0075433_10043589 | Ga0075433_100435893 | 330 |
| 508 | 3300006880 | Ga0075429_100019359 | Ga0075429_1000193595 | 330 |
| 509 | 3300006881 | Ga0068865_100000336 | Ga0068865_10000033617 | 330 |
| 510 | 3300006914 | Ga0075436_100034897 | Ga0075436_1000348974 | 330 |
| 511 | 3300006931 | Ga0097620_100039295 | Ga0097620_1000392954 | 330 |
| 512 | 3300007076 | Ga0075435_100029485 | Ga0075435_1000294853 | 330 |
| 513 | 3300009093 | Ga0105240_10103548 | Ga0105240_101035483 | 330 |
| 514 | 3300009094 | Ga0111539_10155560 | Ga0111539_101555603 | 330 |
| 515 | 3300009098 | Ga0105245_10000688 | Ga0105245_1000068826 | 330 |
| 516 | 3300009101 | Ga0105247_10009820 | Ga0105247_100098202 | 330 |
| 517 | 3300009148 | Ga0105243_10000473 | Ga0105243_1000047329 | 330 |
| 518 | 3300009174 | Ga0105241_10002593 | Ga0105241_100025939 | 330 |
| 519 | 3300009176 | Ga0105242_10000217 | Ga0105242_1000021724 | 330 |
| 520 | 3300009177 | Ga0105248_10000487 | Ga0105248_1000048722 | 330 |
| 521 | 3300009545 | Ga0105237_10000638 | Ga0105237_1000063825 | 330 |
| 522 | 3300009551 | Ga0105238_10219096 | Ga0105238_102190963 | 330 |
| 523 | 3300009553 | Ga0105249_10001143 | Ga0105249_1000114317 | 330 |
| 524 | 3300010159 | Ga0099796_10003661 | Ga0099796_100036613 | 330 |
| 525 | 3300010375 | Ga0105239_10004376 | Ga0105239_1000437614 | 330 |
| 526 | 3300011119 | Ga0105246_10000451 | Ga0105246_100004512 | 330 |
| 527 | 3300013100 | Ga0157373_10027812 | Ga0157373_100278123 | 330 |
| 528 | 3300013105 | Ga0157369_10001385 | Ga0157369_100013853 | 330 |
| 529 | 3300013296 | Ga0157374_10004977 | Ga0157374_100049777 | 330 |
| 530 | 3300013296 | Ga0157374_10027795 | Ga0157374_100277957 | 330 |
| 531 | 3300013297 | Ga0157378_10001026 | Ga0157378_1000102626 | 330 |
| 532 | 3300013306 | Ga0163162_10000935 | Ga0163162_1000093516 | 330 |
| 533 | 3300013307 | Ga0157372_10003142 | Ga0157372_1000314214 | 330 |
| 534 | 3300013308 | Ga0157375_10012343 | Ga0157375_100123435 | 330 |
| 535 | 3300014325 | Ga0163163_10040262 | Ga0163163_100402623 | 330 |
| 536 | 3300014326 | Ga0157380_10001124 | Ga0157380_1000112413 | 330 |
| 537 | 3300014745 | Ga0157377_10000791 | Ga0157377_100007918 | 330 |
| 538 | 3300014968 | Ga0157379_10006054 | Ga0157379_100060548 | 330 |
| 539 | 3300014969 | Ga0157376_10000510 | Ga0157376_1000051015 | 330 |
| 540 | 3300017792 | Ga0163161_10025207 | Ga0163161_100252073 | 330 |
| 541 | 3300021321 | Ga0214542_1018224 | Ga0214542_10182242 | 330 |
| 542 | 3300021327 | Ga0214543_1000134 | Ga0214543_100013420 | 330 |
| 543 | 3300021377 | Ga0213874_10046082 | Ga0213874_100460821 | 330 |
| 544 | 3300025258 | Ga0209129_1000689 | Ga0209129_10006899 | 330 |
| 545 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010358 | 330 |
| 546 | 3300025273 | Ga0209673_1040467 | Ga0209673_10404672 | 330 |
| 547 | 3300025294 | Ga0209025_1001742 | Ga0209025_100174215 | 330 |
| 548 | 3300025294 | Ga0209025_1024299 | Ga0209025_10242994 | 330 |
| 549 | 3300025295 | Ga0209564_1007507 | Ga0209564_10075071 | 330 |
| 550 | 3300025297 | Ga0209758_1000095 | Ga0209758_1000095214 | 330 |
| 551 | 3300025297 | Ga0209758_1030482 | Ga0209758_10304822 | 330 |
| 552 | 3300025298 | Ga0209050_1004401 | Ga0209050_10044016 | 330 |
| 553 | 3300025299 | Ga0209256_1001682 | Ga0209256_10016829 | 330 |
| 554 | 3300025299 | Ga0209256_1009580 | Ga0209256_10095802 | 330 |
| 555 | 3300025303 | Ga0209051_1015616 | Ga0209051_10156164 | 330 |
| 556 | 3300025303 | Ga0209051_1024871 | Ga0209051_10248712 | 330 |
| 557 | 3300025304 | Ga0209257_1000477 | Ga0209257_100047720 | 330 |
| 558 | 3300025304 | Ga0209257_1019432 | Ga0209257_10194322 | 330 |
| 559 | 3300025321 | Ga0207656_10078840 | Ga0207656_100788401 | 330 |
| 560 | 3300025900 | Ga0207710_10006089 | Ga0207710_100060893 | 330 |
| 561 | 3300025903 | Ga0207680_10006249 | Ga0207680_100062492 | 330 |
| 562 | 3300025904 | Ga0207647_10003873 | Ga0207647_100038733 | 330 |
| 563 | 3300025906 | Ga0207699_10010704 | Ga0207699_100107043 | 330 |
| 564 | 3300025907 | Ga0207645_10001040 | Ga0207645_100010401 | 330 |
| 565 | 3300025909 | Ga0207705_10018281 | Ga0207705_100182813 | 330 |
| 566 | 3300025912 | Ga0207707_10054439 | Ga0207707_100544393 | 330 |
| 567 | 3300025914 | Ga0207671_10048751 | Ga0207671_100487511 | 330 |
| 568 | 3300025915 | Ga0207693_10000278 | Ga0207693_1000027822 | 330 |
| 569 | 3300025916 | Ga0207663_10002954 | Ga0207663_100029543 | 330 |
| 570 | 3300025917 | Ga0207660_10042397 | Ga0207660_100423973 | 330 |
| 571 | 3300025918 | Ga0207662_10005916 | Ga0207662_100059164 | 330 |
| 572 | 3300025919 | Ga0207657_10000047 | Ga0207657_1000004724 | 330 |
| 573 | 3300025931 | Ga0207644_10034679 | Ga0207644_100346793 | 330 |
| 574 | 3300025933 | Ga0207706_10000079 | Ga0207706_1000007978 | 330 |
| 575 | 3300025934 | Ga0207686_10016824 | Ga0207686_100168243 | 330 |
| 576 | 3300025935 | Ga0207709_10023947 | Ga0207709_100239473 | 330 |
| 577 | 3300025937 | Ga0207669_10009273 | Ga0207669_100092733 | 330 |
| 578 | 3300025938 | Ga0207704_10016264 | Ga0207704_100162643 | 330 |
| 579 | 3300025939 | Ga0207665_10000432 | Ga0207665_100004324 | 330 |
| 580 | 3300025940 | Ga0207691_10007711 | Ga0207691_100077119 | 330 |
| 581 | 3300025941 | Ga0207711_10051163 | Ga0207711_100511633 | 330 |
| 582 | 3300025944 | Ga0207661_10030887 | Ga0207661_100308873 | 330 |
| 583 | 3300025960 | Ga0207651_10019716 | Ga0207651_100197162 | 330 |
| 584 | 3300025972 | Ga0207668_10004345 | Ga0207668_100043453 | 330 |
| 585 | 3300025981 | Ga0207640_10007564 | Ga0207640_100075644 | 330 |
| 586 | 3300025986 | Ga0207658_10445490 | Ga0207658_104454901 | 330 |
| 587 | 3300026041 | Ga0207639_10005055 | Ga0207639_100050553 | 330 |
| 588 | 3300026067 | Ga0207678_10000111 | Ga0207678_1000011122 | 330 |
| 589 | 3300026075 | Ga0207708_10000526 | Ga0207708_1000052612 | 330 |
| 590 | 3300026088 | Ga0207641_10428767 | Ga0207641_104287671 | 330 |
| 591 | 3300026089 | Ga0207648_10011260 | Ga0207648_100112609 | 330 |
| 592 | 3300026095 | Ga0207676_10060990 | Ga0207676_100609903 | 330 |
| 593 | 3300026116 | Ga0207674_10001475 | Ga0207674_1000147516 | 330 |
| 594 | 3300026118 | Ga0207675_100018149 | Ga0207675_1000181493 | 330 |
| 595 | 3300026121 | Ga0207683_10000026 | Ga0207683_1000002686 | 330 |
| 596 | 3300027907 | Ga0207428_10097474 | Ga0207428_100974743 | 330 |
| 597 | 3300028379 | Ga0268266_10021536 | Ga0268266_100215363 | 330 |
| 598 | 3300028380 | Ga0268265_10001620 | Ga0268265_1000162017 | 330 |
| 599 | 3300028381 | Ga0268264_10018500 | Ga0268264_100185003 | 330 |
| 600 | 3300028786 | Ga0307517_10131954 | Ga0307517_101319541 | 330 |
| 601 | 3300028794 | Ga0307515_10123046 | Ga0307515_101230463 | 330 |
| 602 | 3300031239 | Ga0265328_10029163 | Ga0265328_100291631 | 330 |
| 603 | 3300031247 | Ga0265340_10011993 | Ga0265340_100119935 | 330 |
| 604 | 3300031249 | Ga0265339_10001398 | Ga0265339_1000139810 | 330 |
| 605 | 3300031344 | Ga0265316_10223758 | Ga0265316_102237582 | 330 |
| 606 | 3300031456 | Ga0307513_10174035 | Ga0307513_101740353 | 330 |
| 607 | 3300031456 | Ga0307513_10200611 | Ga0307513_102006111 | 330 |
| 608 | 3300031507 | Ga0307509_10263464 | Ga0307509_102634642 | 330 |
| 609 | 3300031649 | Ga0307514_10037737 | Ga0307514_100377374 | 330 |
| 610 | 3300031711 | Ga0265314_10029466 | Ga0265314_100294663 | 330 |
| 611 | 3300031730 | Ga0307516_10014197 | Ga0307516_100141974 | 330 |
| 612 | 3300031731 | Ga0307405_10033749 | Ga0307405_100337492 | 330 |
| 613 | 3300031995 | Ga0307409_100013759 | Ga0307409_1000137593 | 330 |
| 614 | 3300031995 | Ga0307409_100268444 | Ga0307409_1002684442 | 330 |
| 615 | 3300032002 | Ga0307416_100200071 | Ga0307416_1002000712 | 330 |
| 616 | 3300032126 | Ga0307415_100204657 | Ga0307415_1002046572 | 330 |
| 617 | 3300035117 | Ga0373953_0004923 | Ga0373953_0004923_187_1212 | 330 |
| 618 | 3300035118 | Ga0373954_0018234 | Ga0373954_0018234_332_1357 | 330 |
| 619 | 3300035119 | Ga0373956_0063556 | Ga0373956_0063556_411_1436 | 330 |
| 620 | 3300035120 | Ga0373957_0014754 | Ga0373957_0014754_56_1081 | 330 |
| 621 | 3300035121 | Ga0373960_0066121 | Ga0373960_0066121_78_1082 | 330 |
| 622 | 3300035410 | Ga0373924_0049670 | Ga0373924_0049670_198_1223 | 330 |
| 623 | 3300035691 | Ga0373931_0004176 | Ga0373931_0004176_2978_3982 | 330 |
| 624 | 3300035724 | Ga0373933_0140324 | Ga0373933_0140324_401_1426 | 330 |
| 625 | 3300036712 | Ga0316584_0106033 | Ga0316584_0106033_750_1745 | 330 |
| 626 | 3300037312 | Ga0395899_0032059 | Ga0395899_0032059_1391_2401 | 330 |
| 627 | 3300037312 | Ga0395899_0227247 | Ga0395899_0227247_168_1172 | 330 |
| 628 | 3300037418 | Ga0395900_0093038 | Ga0395900_0093038_1093_2097 | 330 |
| 629 | 3300037466 | Ga0395898_0174874 | Ga0395898_0174874_919_1923 | 330 |
| 630 | 3300037471 | Ga0395905_0030180 | Ga0395905_0030180_2858_3868 | 330 |
| 631 | 3300037471 | Ga0395905_0123707 | Ga0395905_0123707_205_1209 | 330 |
| 632 | 3300038443 | Ga0395901_0000683 | Ga0395901_0000683_14930_15934 | 330 |
| 633 | 3300039450 | Ga0436363_0338474 | Ga0436363_0338474_268_1332 | 330 |
| 634 | 3300039450 | Ga0436363_1644309 | Ga0436363_1644309_2565_3569 | 330 |
| 635 | 3300041404 | Ga0439436_0001143 | Ga0439436_0001143_4604_5599 | 330 |
| 636 | 3300041407 | Ga0439447_023052 | Ga0439447_023052_285_1280 | 330 |
| 637 | 3300041413 | Ga0439465_0003975 | Ga0439465_0003975_2652_3647 | 330 |
| 638 | 3300042007 | Ga0439449_0071515 | Ga0439449_0071515_95_1093 | 330 |
| 639 | 3300044765 | Ga0466970_0079792 | Ga0466970_0079792_408_1436 | 330 |
| 640 | 3300044842 | Ga0466957_0040230 | Ga0466957_0040230_485_1531 | 330 |
| 641 | 3300045836 | Ga0466958_0010420 | Ga0466958_0010420_1063_2061 | 330 |
| 642 | 3300046452 | Ga0495617_017169 | Ga0495617_017169_286_1284 | 330 |
| 643 | 3300046453 | Ga0495627_002901 | Ga0495627_002901_3774_4772 | 330 |
| 644 | 3300046453 | Ga0495627_020006 | Ga0495627_020006_739_1737 | 330 |
| 645 | 3300046454 | Ga0495592_0036867 | Ga0495592_0036867_2335_3330 | 330 |
| 646 | 3300046455 | Ga0495603_0029320 | Ga0495603_0029320_50_1048 | 330 |
| 647 | 3300046457 | Ga0495590_0000056 | Ga0495590_0000056_45272_46270 | 330 |
| 648 | 3300046457 | Ga0495590_0000181 | Ga0495590_0000181_30671_31669 | 330 |
| 649 | 3300046459 | Ga0495629_0051449 | Ga0495629_0051449_211_1236 | 330 |
| 650 | 3300046460 | Ga0495638_0000170 | Ga0495638_0000170_78676_79674 | 330 |
| 651 | 3300046462 | Ga0495651_0146244 | Ga0495651_0146244_91_1116 | 330 |
| 652 | 3300046463 | Ga0495653_0023047 | Ga0495653_0023047_2779_3777 | 330 |
| 653 | 3300046471 | Ga0495650_0001692 | Ga0495650_0001692_9174_10172 | 330 |
| 654 | 3300046473 | Ga0495582_0003999 | Ga0495582_0003999_7129_8127 | 330 |
| 655 | 3300046474 | Ga0495605_0024308 | Ga0495605_0024308_307_1317 | 330 |
| 656 | 3300046475 | Ga0495639_0027004 | Ga0495639_0027004_71_1069 | 330 |
| 657 | 3300046476 | Ga0495662_0098107 | Ga0495662_0098107_349_1356 | 330 |
| 658 | 3300046477 | Ga0495664_0030585 | Ga0495664_0030585_81_1106 | 330 |
| 659 | 3300046491 | Ga0495584_0004084 | Ga0495584_0004084_2568_3578 | 330 |
| 660 | 3300046491 | Ga0495584_0018413 | Ga0495584_0018413_714_1712 | 330 |
| 661 | 3300046491 | Ga0495584_0028938 | Ga0495584_0028938_1124_2122 | 330 |
| 662 | 3300046491 | Ga0495584_0055763 | Ga0495584_0055763_338_1348 | 330 |
| 663 | 3300046492 | Ga0495585_0001585 | Ga0495585_0001585_16492_17490 | 330 |
| 664 | 3300046492 | Ga0495585_0003957 | Ga0495585_0003957_6374_7372 | 330 |
| 665 | 3300046492 | Ga0495585_0007730 | Ga0495585_0007730_1745_2743 | 330 |
| 666 | 3300046492 | Ga0495585_0073955 | Ga0495585_0073955_287_1285 | 330 |
| 667 | 3300046499 | Ga0495594_0005242 | Ga0495594_0005242_3849_4847 | 330 |
| 668 | 3300046499 | Ga0495594_0057786 | Ga0495594_0057786_115_1110 | 330 |
| 669 | 3300046500 | Ga0495596_0005838 | Ga0495596_0005838_874_1872 | 330 |
| 670 | 3300046500 | Ga0495596_0009329 | Ga0495596_0009329_1140_2138 | 330 |
| 671 | 3300046500 | Ga0495596_0011210 | Ga0495596_0011210_1078_2076 | 330 |
| 672 | 3300046500 | Ga0495596_0021074 | Ga0495596_0021074_378_1376 | 330 |
| 673 | 3300046501 | Ga0495607_0008486 | Ga0495607_0008486_5857_6867 | 330 |
| 674 | 3300046501 | Ga0495607_0024504 | Ga0495607_0024504_1115_2113 | 330 |
| 675 | 3300046501 | Ga0495607_0055921 | Ga0495607_0055921_972_1970 | 330 |
| 676 | 3300046506 | Ga0495583_0000417 | Ga0495583_0000417_48146_49144 | 330 |
| 677 | 3300046507 | Ga0495606_0000149 | Ga0495606_0000149_5700_6701 | 330 |
| 678 | 3300046513 | Ga0495616_0015409 | Ga0495616_0015409_1802_2800 | 330 |
| 679 | 3300046514 | Ga0495618_0012897 | Ga0495618_0012897_2131_3156 | 330 |
| 680 | 3300046516 | Ga0495628_0010616 | Ga0495628_0010616_3883_4908 | 330 |
| 681 | 3300046516 | Ga0495628_0195200 | Ga0495628_0195200_49_1044 | 330 |
| 682 | 3300046517 | Ga0495630_0111574 | Ga0495630_0111574_141_1166 | 330 |
| 683 | 3300046518 | Ga0495631_0012663 | Ga0495631_0012663_1227_2225 | 330 |
| 684 | 3300046519 | Ga0495632_0000311 | Ga0495632_0000311_21487_22485 | 330 |
| 685 | 3300046519 | Ga0495632_0000365 | Ga0495632_0000365_29173_30171 | 330 |
| 686 | 3300046522 | Ga0495643_0000302 | Ga0495643_0000302_22469_23467 | 330 |
| 687 | 3300046523 | Ga0495644_0006899 | Ga0495644_0006899_3248_4246 | 330 |
| 688 | 3300046524 | Ga0495648_0000119 | Ga0495648_0000119_38097_39095 | 330 |
| 689 | 3300046526 | Ga0495666_0003516 | Ga0495666_0003516_3600_4598 | 330 |
| 690 | 3300046528 | Ga0495642_0001135 | Ga0495642_0001135_5804_6802 | 330 |
| 691 | 3300046528 | Ga0495642_0025039 | Ga0495642_0025039_752_1762 | 330 |
| 692 | 3300046529 | Ga0495652_0017628 | Ga0495652_0017628_2212_3237 | 330 |
| 693 | 3300046529 | Ga0495652_0071737 | Ga0495652_0071737_1028_2023 | 330 |
| 694 | 3300046530 | Ga0495654_0005778 | Ga0495654_0005778_4964_5974 | 330 |
| 695 | 3300046533 | Ga0495640_0004953 | Ga0495640_0004953_1164_2162 | 330 |
| 696 | 3300046533 | Ga0495640_0033080 | Ga0495640_0033080_945_1940 | 330 |
| 697 | 3300046535 | Ga0495586_0001960 | Ga0495586_0001960_3996_4994 | 330 |
| 698 | 3300046538 | Ga0495609_0001674 | Ga0495609_0001674_9005_10012 | 330 |
| 699 | 3300046538 | Ga0495609_0038896 | Ga0495609_0038896_963_1973 | 330 |
| 700 | 3300046542 | Ga0495597_0000123 | Ga0495597_0000123_22139_23137 | 330 |
| 701 | 3300046542 | Ga0495597_0000127 | Ga0495597_0000127_18519_19517 | 330 |
| 702 | 3300046542 | Ga0495597_0004061 | Ga0495597_0004061_6865_7875 | 330 |
| 703 | 3300046543 | Ga0495645_0046359 | Ga0495645_0046359_2122_3147 | 330 |
| 704 | 3300046557 | Ga0495622_0000480 | Ga0495622_0000480_2254_3252 | 330 |
| 705 | 3300046558 | Ga0495633_0000088 | Ga0495633_0000088_87623_88621 | 330 |
| 706 | 3300046558 | Ga0495633_0003948 | Ga0495633_0003948_2253_3251 | 330 |
| 707 | 3300046558 | Ga0495633_0004365 | Ga0495633_0004365_3773_4771 | 330 |
| 708 | 3300046559 | Ga0495667_0022019 | Ga0495667_0022019_3049_4074 | 330 |
| 709 | 3300046616 | Ga0495668_0000460 | Ga0495668_0000460_18172_19170 | 330 |
| 710 | 3300046616 | Ga0495668_0001529 | Ga0495668_0001529_17479_18489 | 330 |
| 711 | 3300046616 | Ga0495668_0025818 | Ga0495668_0025818_496_1494 | 330 |
| 712 | 3300046616 | Ga0495668_0052708 | Ga0495668_0052708_178_1176 | 330 |
| 713 | 3300046616 | Ga0495668_0076011 | Ga0495668_0076011_797_1795 | 330 |
| 714 | 3300046642 | Ga0495634_0029265 | Ga0495634_0029265_1175_2170 | 330 |
| 715 | 3300046642 | Ga0495634_0076175 | Ga0495634_0076175_514_1539 | 330 |
| 716 | 3300046648 | Ga0495611_0000793 | Ga0495611_0000793_2832_3830 | 330 |
| 717 | 3300046648 | Ga0495611_0055740 | Ga0495611_0055740_152_1150 | 330 |
| 718 | 3300046660 | Ga0495625_0002200 | Ga0495625_0002200_16916_17914 | 330 |
| 719 | 3300046660 | Ga0495625_0002701 | Ga0495625_0002701_15590_16588 | 330 |
| 720 | 3300046660 | Ga0495625_0084561 | Ga0495625_0084561_238_1239 | 330 |
| 721 | 3300046663 | Ga0495635_0024224 | Ga0495635_0024224_2645_3643 | 330 |
| 722 | 3300046663 | Ga0495635_0039975 | Ga0495635_0039975_61_1086 | 330 |
| 723 | 3300046665 | Ga0495661_0000923 | Ga0495661_0000923_14871_15869 | 330 |
| 724 | 3300046675 | Ga0495657_0100431 | Ga0495657_0100431_86_1081 | 330 |
| 725 | 3300046675 | Ga0495657_0173736 | Ga0495657_0173736_199_1224 | 330 |
| 726 | 3300046678 | Ga0495599_0008650 | Ga0495599_0008650_2962_3987 | 330 |
| 727 | 3300046680 | Ga0495646_0096780 | Ga0495646_0096780_666_1664 | 330 |
| 728 | 3300046684 | Ga0495669_0000479 | Ga0495669_0000479_16471_17469 | 330 |
| 729 | 3300046684 | Ga0495669_0004096 | Ga0495669_0004096_3901_4899 | 330 |
| 730 | 3300046689 | Ga0495613_0002547 | Ga0495613_0002547_7078_8073 | 330 |
| 731 | 3300046689 | Ga0495613_0014884 | Ga0495613_0014884_954_1952 | 330 |
| 732 | 3300046689 | Ga0495613_0036156 | Ga0495613_0036156_2134_3132 | 330 |
| 733 | 3300046691 | Ga0495670_0000229 | Ga0495670_0000229_16085_17083 | 330 |
| 734 | 3300046691 | Ga0495670_0013404 | Ga0495670_0013404_2042_3040 | 330 |
| 735 | 3300046691 | Ga0495670_0014792 | Ga0495670_0014792_701_1699 | 330 |
| 736 | 3300046810 | Ga0495660_0008510 | Ga0495660_0008510_2760_3758 | 330 |
| 737 | 3300047315 | Ga0495581_0015281 | Ga0495581_0015281_2703_3701 | 330 |
| 738 | 3300047315 | Ga0495581_0116140 | Ga0495581_0116140_506_1501 | 330 |
| 739 | 3300047317 | Ga0495604_0002334 | Ga0495604_0002334_2462_3469 | 330 |
| 740 | 3300047317 | Ga0495604_0023674 | Ga0495604_0023674_3656_4666 | 330 |
| 741 | 3300047317 | Ga0495604_0029760 | Ga0495604_0029760_1418_2413 | 330 |
| 742 | 3300047317 | Ga0495604_0039198 | Ga0495604_0039198_2420_3418 | 330 |
| 743 | 3300047317 | Ga0495604_0061766 | Ga0495604_0061766_1469_2494 | 330 |
| 744 | 3300047319 | Ga0495674_0023200 | Ga0495674_0023200_2367_3392 | 330 |
| 745 | 3300047320 | Ga0495672_0001582 | Ga0495672_0001582_10990_12000 | 330 |
| 746 | 3300047321 | Ga0495676_0000031 | Ga0495676_0000031_17629_18627 | 330 |
| 747 | 3300047321 | Ga0495676_0005345 | Ga0495676_0005345_1670_2665 | 330 |
| 748 | 3300047322 | Ga0495680_0019816 | Ga0495680_0019816_466_1491 | 330 |
| 749 | 3300047444 | Ga0495675_0002328 | Ga0495675_0002328_2878_3876 | 330 |
| 750 | 3300047444 | Ga0495675_0023769 | Ga0495675_0023769_1701_2726 | 330 |
| 751 | 3300047444 | Ga0495675_0071558 | Ga0495675_0071558_493_1500 | 330 |
| 752 | 3300047445 | Ga0495677_0006349 | Ga0495677_0006349_2929_3927 | 330 |
| 753 | 3300047447 | Ga0495685_079380 | Ga0495685_079380_58_1056 | 330 |
| 754 | 3300047470 | Ga0495681_0000939 | Ga0495681_0000939_5959_6957 | 330 |
| 755 | 3300047470 | Ga0495681_0018579 | Ga0495681_0018579_1467_2465 | 330 |
| 756 | 3300047470 | Ga0495681_0040434 | Ga0495681_0040434_168_1169 | 330 |
| 757 | 3300047471 | Ga0495684_0064158 | Ga0495684_0064158_1626_2651 | 330 |
| 758 | 3300047471 | Ga0495684_0311681 | Ga0495684_0311681_89_1084 | 330 |
| 759 | 3300047673 | Ga0495593_0007232 | Ga0495593_0007232_470_1468 | 330 |
| 760 | 3300047673 | Ga0495593_0024924 | Ga0495593_0024924_730_1728 | 330 |
| 761 | 3300048088 | Ga0495602_0028276 | Ga0495602_0028276_4092_5117 | 330 |
| 762 | 3300048089 | Ga0495614_0005393 | Ga0495614_0005393_4665_5663 | 330 |
| 763 | 3300048091 | Ga0495626_0015821 | Ga0495626_0015821_334_1332 | 330 |
| 764 | 3300048091 | Ga0495626_0035489 | Ga0495626_0035489_616_1617 | 330 |
| 765 | 3300048091 | Ga0495626_0071295 | Ga0495626_0071295_422_1420 | 330 |
| 766 | 3300048903 | Ga0496100_0011314 | Ga0496100_0011314_2014_3018 | 330 |
| 767 | 3300048904 | Ga0496101_0005155 | Ga0496101_0005155_5334_6338 | 330 |
| 768 | 3300048905 | Ga0496102_0044010 | Ga0496102_0044010_2885_3889 | 330 |
| 769 | 3300048906 | Ga0496103_0042347 | Ga0496103_0042347_547_1551 | 330 |
| 770 | 3300048908 | Ga0496105_0023140 | Ga0496105_0023140_2187_3191 | 330 |
| 771 | 3300048909 | Ga0496106_0041301 | Ga0496106_0041301_153_1157 | 330 |
| 772 | 3300048910 | Ga0496107_0017244 | Ga0496107_0017244_2059_3063 | 330 |
| 773 | 3300048911 | Ga0496108_0010303 | Ga0496108_0010303_2389_3393 | 330 |
| 774 | 3300048912 | Ga0496109_0377124 | Ga0496109_0377124_258_1253 | 330 |
| 775 | 3300048913 | Ga0496110_0014313 | Ga0496110_0014313_4456_5460 | 330 |
| 776 | 3300048913 | Ga0496110_0035014 | Ga0496110_0035014_1930_2925 | 330 |
| 777 | 3300048915 | Ga0496112_0001267 | Ga0496112_0001267_12878_13873 | 330 |
| 778 | 3300048915 | Ga0496112_0016818 | Ga0496112_0016818_195_1199 | 330 |
| 779 | 3300048917 | Ga0496114_0045732 | Ga0496114_0045732_490_1494 | 330 |
| 780 | 3300048918 | Ga0496115_0002726 | Ga0496115_0002726_10615_11613 | 330 |
| 781 | 3300048918 | Ga0496115_0020967 | Ga0496115_0020967_2193_3197 | 330 |
| 782 | 3300048918 | Ga0496115_0046019 | Ga0496115_0046019_1319_2344 | 330 |
| 783 | 3300048925 | Ga0496122_0089925 | Ga0496122_0089925_230_1225 | 330 |
| 784 | 3300049459 | Ga0495678_000732 | Ga0495678_000732_7419_8417 | 330 |
| 785 | 3300049459 | Ga0495678_004011 | Ga0495678_004011_2083_3081 | 330 |
| 786 | 3300049459 | Ga0495678_016975 | Ga0495678_016975_371_1369 | 330 |
| 787 | 3300049574 | Ga0501038_0264471 | Ga0501038_0264471_190_1194 | 330 |
| 788 | 3300049579 | Ga0501043_0051843 | Ga0501043_0051843_2176_3177 | 330 |
| 789 | 3300049579 | Ga0501043_0259348 | Ga0501043_0259348_186_1187 | 330 |
| 790 | 3300049581 | Ga0501047_0070748 | Ga0501047_0070748_1388_2383 | 330 |
| 791 | 3300049586 | Ga0501070_0070803 | Ga0501070_0070803_1851_2855 | 330 |
| 792 | 3300049592 | Ga0501076_0245766 | Ga0501076_0245766_378_1382 | 330 |
| 793 | 3300049742 | Ga0501080_0111887 | Ga0501080_0111887_1226_2230 | 330 |
| 794 | 3300049823 | Ga0501044_0081620 | Ga0501044_0081620_892_1893 | 330 |
| 795 | 3300050507 | nmdc:mga05p37_321116_c1 | nmdc:mga05p37_321116_c1_541_1545 | 330 |
| 796 | 3300050508 | nmdc:mga09592_26300_c1 | nmdc:mga09592_26300_c1_626_1630 | 330 |
| 797 | 3300050509 | nmdc:mga0qj67_86337_c1 | nmdc:mga0qj67_86337_c1_1473_2477 | 330 |
| 798 | 3300050510 | nmdc:mga06r32_35609_c1 | nmdc:mga06r32_35609_c1_3136_4140 | 330 |
| 799 | 3300050512 | nmdc:mga0n895_73236_c1 | nmdc:mga0n895_73236_c1_1364_2368 | 330 |
| 800 | 3300050513 | nmdc:mga0rr50_21985_c1 | nmdc:mga0rr50_21985_c1_1365_2369 | 330 |
| 801 | 3300050514 | nmdc:mga08x19_209840_c1 | nmdc:mga08x19_209840_c1_297_1301 | 330 |
| 802 | 3300050515 | nmdc:mga0a205_227048_c1 | nmdc:mga0a205_227048_c1_122_1126 | 330 |
| 803 | 3300053083 | Ga0495655_0028742 | Ga0495655_0028742_237_1244 | 330 |
| 804 | 3300053084 | Ga0495595_0094900 | Ga0495595_0094900_211_1236 | 330 |
| 805 | 3300053085 | Ga0495619_0203014 | Ga0495619_0203014_84_1109 | 330 |
| 806 | 3300053086 | Ga0500578_0073503 | Ga0500578_0073503_1018_2019 | 330 |
| 807 | 3300053094 | Ga0500566_0000273 | Ga0500566_0000273_23541_24542 | 330 |
| 808 | 3300053096 | Ga0500641_0009865 | Ga0500641_0009865_958_1959 | 330 |
| 809 | 3300053098 | Ga0500650_0003353 | Ga0500650_0003353_11_1012 | 330 |
| 810 | 3300053103 | Ga0500555_012647 | Ga0500555_012647_722_1723 | 330 |
| 811 | 3300053119 | Ga0500595_000050 | Ga0500595_000050_69007_70008 | 330 |
| 812 | 3300053130 | Ga0500642_0001500 | Ga0500642_0001500_4842_5843 | 330 |
| 813 | 3300053136 | Ga0500559_0000106 | Ga0500559_0000106_32594_33595 | 330 |
| 814 | 3300053139 | Ga0500568_0002649 | Ga0500568_0002649_3104_4105 | 330 |
| 815 | 3300053139 | Ga0500568_0002674 | Ga0500568_0002674_3319_4320 | 330 |
| 816 | 3300053146 | Ga0500588_0000462 | Ga0500588_0000462_232_1233 | 330 |
| 817 | 3300053146 | Ga0500588_0062086 | Ga0500588_0062086_55_1056 | 330 |
| 818 | 3300053151 | Ga0500604_0002621 | Ga0500604_0002621_369_1370 | 330 |
| 819 | 3300053151 | Ga0500604_0024172 | Ga0500604_0024172_530_1531 | 330 |
| 820 | 3300053161 | Ga0500634_0078887 | Ga0500634_0078887_586_1587 | 330 |
| 821 | 3300053177 | Ga0500636_0012147 | Ga0500636_0012147_2806_3807 | 330 |
| 822 | 3300053729 | Ga0500625_072208 | Ga0500625_072208_249_1253 | 330 |
| 823 | iso_pu_bacteria | 2877676314 | 2877682067 | 330 |
| 824 | 3300005344 | Ga0070661_100036544 | Ga0070661_1000365443 | 331 |
| 825 | 3300005367 | Ga0070667_100000032 | Ga0070667_10000003250 | 331 |
| 826 | 3300005455 | Ga0070663_100000213 | Ga0070663_10000021321 | 331 |
| 827 | 3300005539 | Ga0068853_100003586 | Ga0068853_1000035865 | 331 |
| 828 | 3300005548 | Ga0070665_100279887 | Ga0070665_1002798871 | 331 |
| 829 | 3300005614 | Ga0068856_100070159 | Ga0068856_1000701594 | 331 |
| 830 | 3300005719 | Ga0068861_100011313 | Ga0068861_1000113137 | 331 |
| 831 | 3300005844 | Ga0068862_100055189 | Ga0068862_1000551892 | 331 |
| 832 | 3300005981 | Ga0081538_10009878 | Ga0081538_100098786 | 331 |
| 833 | 3300005983 | Ga0081540_1063568 | Ga0081540_10635682 | 331 |
| 834 | 3300006042 | Ga0075368_10007337 | Ga0075368_100073373 | 331 |
| 835 | 3300006048 | Ga0075363_100044516 | Ga0075363_1000445162 | 331 |
| 836 | 3300006178 | Ga0075367_10203416 | Ga0075367_102034161 | 331 |
| 837 | 3300009093 | Ga0105240_10458571 | Ga0105240_104585712 | 331 |
| 838 | 3300009094 | Ga0111539_10701496 | Ga0111539_107014962 | 331 |
| 839 | 3300009147 | Ga0114129_10058018 | Ga0114129_100580186 | 331 |
| 840 | 3300009148 | Ga0105243_10106287 | Ga0105243_101062874 | 331 |
| 841 | 3300009177 | Ga0105248_10000143 | Ga0105248_1000014356 | 331 |
| 842 | 3300009545 | Ga0105237_10007897 | Ga0105237_100078974 | 331 |
| 843 | 3300009553 | Ga0105249_10000211 | Ga0105249_1000021126 | 331 |
| 844 | 3300010375 | Ga0105239_10531243 | Ga0105239_105312432 | 331 |
| 845 | 3300010375 | Ga0105239_10576996 | Ga0105239_105769962 | 331 |
| 846 | 3300013296 | Ga0157374_10001745 | Ga0157374_1000174515 | 331 |
| 847 | 3300013306 | Ga0163162_10037798 | Ga0163162_100377983 | 331 |
| 848 | 3300021361 | Ga0213872_10110791 | Ga0213872_101107912 | 331 |
| 849 | 3300025913 | Ga0207695_10188223 | Ga0207695_101882232 | 331 |
| 850 | 3300025913 | Ga0207695_10236318 | Ga0207695_102363182 | 331 |
| 851 | 3300025914 | Ga0207671_10046382 | Ga0207671_100463822 | 331 |
| 852 | 3300025923 | Ga0207681_10006557 | Ga0207681_100065573 | 331 |
| 853 | 3300025923 | Ga0207681_10153398 | Ga0207681_101533983 | 331 |
| 854 | 3300025937 | Ga0207669_10079995 | Ga0207669_100799952 | 331 |
| 855 | 3300025941 | Ga0207711_10001415 | Ga0207711_1000141525 | 331 |
| 856 | 3300025961 | Ga0207712_10004820 | Ga0207712_100048206 | 331 |
| 857 | 3300025986 | Ga0207658_10000048 | Ga0207658_1000004889 | 331 |
| 858 | 3300026067 | Ga0207678_10000877 | Ga0207678_1000087721 | 331 |
| 859 | 3300026078 | Ga0207702_10075114 | Ga0207702_100751142 | 331 |
| 860 | 3300026118 | Ga0207675_100007188 | Ga0207675_10000718810 | 331 |
| 861 | 3300027866 | Ga0209813_10011864 | Ga0209813_100118642 | 331 |
| 862 | 3300027907 | Ga0207428_10000668 | Ga0207428_1000066834 | 331 |
| 863 | 3300028379 | Ga0268266_10345624 | Ga0268266_103456241 | 331 |
| 864 | 3300028380 | Ga0268265_10000876 | Ga0268265_100008763 | 331 |
| 865 | 3300028380 | Ga0268265_10056529 | Ga0268265_100565292 | 331 |
| 866 | 3300031852 | Ga0307410_10059722 | Ga0307410_100597223 | 331 |
| 867 | 3300031903 | Ga0307407_10200845 | Ga0307407_102008451 | 331 |
| 868 | 3300032002 | Ga0307416_100077246 | Ga0307416_1000772462 | 331 |
| 869 | 3300032004 | Ga0307414_10239282 | Ga0307414_102392822 | 331 |
| 870 | 3300032126 | Ga0307415_100074593 | Ga0307415_1000745933 | 331 |
| 871 | 3300037312 | Ga0395899_0034053 | Ga0395899_0034053_1284_2279 | 331 |
| 872 | 3300038443 | Ga0395901_0472259 | Ga0395901_0472259_265_1266 | 331 |
| 873 | 3300039438 | Ga0436360_0359615 | Ga0436360_0359615_1041_2039 | 331 |
| 874 | 3300039447 | Ga0436361_0745464 | Ga0436361_0745464_176_1183 | 331 |
| 875 | 3300039447 | Ga0436361_0914477 | Ga0436361_0914477_2028_3041 | 331 |
| 876 | 3300042007 | Ga0439449_0001376 | Ga0439449_0001376_5401_6414 | 331 |
| 877 | 3300044735 | Ga0466968_0004993 | Ga0466968_0004993_3089_4096 | 331 |
| 878 | 3300045049 | Ga0466959_0003297 | Ga0466959_0003297_4425_5474 | 331 |
| 879 | 3300047319 | Ga0495674_0002692 | Ga0495674_0002692_9906_10958 | 331 |
| 880 | 3300047320 | Ga0495672_0020626 | Ga0495672_0020626_2673_3677 | 331 |
| 881 | 3300047472 | Ga0495686_0000021 | Ga0495686_0000021_60101_61105 | 331 |
| 882 | 3300047472 | Ga0495686_0002134 | Ga0495686_0002134_14839_15873 | 331 |
| 883 | 3300048903 | Ga0496100_0385481 | Ga0496100_0385481_21_1031 | 331 |
| 884 | 3300048905 | Ga0496102_0093031 | Ga0496102_0093031_942_1946 | 331 |
| 885 | 3300048908 | Ga0496105_0102242 | Ga0496105_0102242_1270_2268 | 331 |
| 886 | 3300048912 | Ga0496109_0037831 | Ga0496109_0037831_80_1078 | 331 |
| 887 | 3300048914 | Ga0496111_0085602 | Ga0496111_0085602_778_1776 | 331 |
| 888 | 3300048920 | Ga0496117_0094846 | Ga0496117_0094846_107_1111 | 331 |
| 889 | 3300048925 | Ga0496122_0000142 | Ga0496122_0000142_21988_23022 | 331 |
| 890 | 3300048926 | Ga0496123_0000148 | Ga0496123_0000148_12071_13105 | 331 |
| 891 | 3300048929 | Ga0496126_0000050 | Ga0496126_0000050_218334_219338 | 331 |
| 892 | 3300049571 | Ga0501034_0131914 | Ga0501034_0131914_1174_2187 | 331 |
| 893 | 3300049589 | Ga0501073_0019004 | Ga0501073_0019004_1868_2881 | 331 |
| 894 | 3300050490 | nmdc:mga03n38_33851_c1 | nmdc:mga03n38_33851_c1_61_1209 | 331 |
| 895 | 3300050494 | nmdc:mga06z11_21838_c1 | nmdc:mga06z11_21838_c1_203_1201 | 331 |
| 896 | 3300050507 | nmdc:mga05p37_96330_c1 | nmdc:mga05p37_96330_c1_1068_2090 | 331 |
| 897 | 3300050511 | nmdc:mga08y16_456_c1 | nmdc:mga08y16_456_c1_2426_3445 | 331 |
| 898 | 3300053087 | Ga0500643_002974 | Ga0500643_002974_210_1244 | 331 |
| 899 | 3300053104 | Ga0500556_0094566 | Ga0500556_0094566_121_1122 | 331 |
| 900 | 3300053120 | Ga0500597_000191 | Ga0500597_000191_4940_5974 | 331 |
| 901 | 3300053148 | Ga0500590_022922 | Ga0500590_022922_1152_2165 | 331 |
| 902 | iso_pu_bacteria | 2582581313 | 2585304958 | 331 |
| 903 | iso_pu_bacteria | 2582581314 | 2585318881 | 331 |
| 904 | iso_pu_bacteria | 2643221647 | 2644269136 | 331 |
| 905 | iso_pu_bacteria | 2643221678 | 2644436256 | 331 |
| 906 | iso_pu_bacteria | 2643221714 | 2644625873 | 331 |
| 907 | iso_pu_bacteria | 2786546132 | 2786669470 | 331 |
| 908 | iso_pu_bacteria | 2808606359 | 2808841149 | 331 |
| 909 | iso_pu_bacteria | 2808606375 | 2808919658 | 331 |
| 910 | iso_pu_bacteria | 2818991472 | 2819739343 | 331 |
| 911 | iso_pu_bacteria | 2867428634 | 2867430126 | 331 |
| 912 | iso_pu_bacteria | 2912715099 | 2912721029 | 331 |
| 913 | iso_pu_bacteria | 2919468124 | 2919468552 | 331 |
| 914 | iso_pu_bacteria | 2946072368 | 2946075111 | 331 |
| 915 | iso_pu_bacteria | 2954380949 | 2954387193 | 331 |
| 916 | iso_pu_bacteria | 2954673503 | 2954675959 | 331 |
| 917 | iso_pu_bacteria | 2954682443 | 2954688207 | 331 |
| 918 | iso_pu_bacteria | 2954691527 | 2954698029 | 331 |
| 919 | iso_pu_bacteria | 2954701450 | 2954704186 | 331 |
| 920 | iso_pu_bacteria | 2954711539 | 2954717138 | 331 |
| 921 | iso_pu_bacteria | 2954721474 | 2954727106 | 331 |
| 922 | iso_pu_bacteria | 2954731030 | 2954734695 | 331 |
| 923 | iso_pu_bacteria | 2954740390 | 2954746011 | 331 |
| 924 | iso_pu_bacteria | 2954749733 | 2954753582 | 331 |
| 925 | iso_pu_bacteria | 2954759201 | 2954764981 | 331 |
| 926 | iso_pu_bacteria | 3006486233 | 3006489064 | 331 |
| 927 | iso_pu_bacteria | 8056829672 | 8056836828 | 331 |
| 928 | 3300003354 | JGI25160J50197_1019999 | JGI25160J50197_10199991 | 332 |
| 929 | 3300025284 | Ga0209130_1000399 | Ga0209130_100039910 | 332 |
| 930 | 3300025302 | Ga0207426_1000046 | Ga0207426_100004656 | 332 |
| 931 | 3300030522 | Ga0307512_10010397 | Ga0307512_100103977 | 332 |
| 932 | 3300031616 | Ga0307508_10055097 | Ga0307508_100550972 | 332 |
| 933 | 3300046512 | Ga0495610_0014805 | Ga0495610_0014805_777_1781 | 332 |
| 934 | 3300003215 | JGI25153J46596_10045284 | JGI25153J46596_100452841 | 333 |
| 935 | 3300003578 | Ga0006562J51391_1039231 | Ga0006562J51391_10392312 | 333 |
| 936 | 3300003578 | Ga0006562J51391_1097249 | Ga0006562J51391_10972492 | 333 |
| 937 | 3300003578 | Ga0006562J51391_1097250 | Ga0006562J51391_10972504 | 333 |
| 938 | 3300006042 | Ga0075368_10017684 | Ga0075368_100176843 | 333 |
| 939 | 3300006051 | Ga0075364_10273090 | Ga0075364_102730901 | 333 |
| 940 | 3300006948 | Ga0099826_10058826 | Ga0099826_100588261 | 333 |
| 941 | 3300015688 | Ga0183367_1009 | Ga0183367_100946 | 333 |
| 942 | 3300017792 | Ga0163161_10268631 | Ga0163161_102686311 | 333 |
| 943 | 3300030521 | Ga0307511_10012485 | Ga0307511_100124858 | 333 |
| 944 | 3300031456 | Ga0307513_10058751 | Ga0307513_100587513 | 333 |
| 945 | 3300031507 | Ga0307509_10047478 | Ga0307509_100474785 | 333 |
| 946 | 3300031649 | Ga0307514_10070308 | Ga0307514_100703081 | 333 |
| 947 | 3300031838 | Ga0307518_10056055 | Ga0307518_100560551 | 333 |
| 948 | 3300033180 | Ga0307510_10096719 | Ga0307510_100967193 | 333 |
| 949 | 3300042014 | Ga0439457_000207 | Ga0439457_000207_13589_14599 | 333 |
| 950 | 3300042138 | Ga0450903_000278 | Ga0450903_000278_9973_10983 | 333 |
| 951 | 3300044656 | Ga0466969_0016382 | Ga0466969_0016382_649_1677 | 333 |
| 952 | 3300046454 | Ga0495592_0000576 | Ga0495592_0000576_10195_11205 | 333 |
| 953 | 3300046459 | Ga0495629_0024815 | Ga0495629_0024815_648_1658 | 333 |
| 954 | 3300046462 | Ga0495651_0001088 | Ga0495651_0001088_16833_17843 | 333 |
| 955 | 3300046473 | Ga0495582_0183515 | Ga0495582_0183515_172_1182 | 333 |
| 956 | 3300046476 | Ga0495662_0002860 | Ga0495662_0002860_6603_7613 | 333 |
| 957 | 3300046477 | Ga0495664_0003663 | Ga0495664_0003663_6109_7119 | 333 |
| 958 | 3300046516 | Ga0495628_0031356 | Ga0495628_0031356_203_1213 | 333 |
| 959 | 3300046517 | Ga0495630_0012548 | Ga0495630_0012548_1253_2263 | 333 |
| 960 | 3300046536 | Ga0495587_0001673 | Ga0495587_0001673_9256_10266 | 333 |
| 961 | 3300046557 | Ga0495622_0059605 | Ga0495622_0059605_648_1658 | 333 |
| 962 | 3300046642 | Ga0495634_0001729 | Ga0495634_0001729_10021_11031 | 333 |
| 963 | 3300046680 | Ga0495646_0005821 | Ga0495646_0005821_1139_2149 | 333 |
| 964 | 3300047315 | Ga0495581_0013715 | Ga0495581_0013715_959_1969 | 333 |
| 965 | 3300047321 | Ga0495676_0000862 | Ga0495676_0000862_24129_25139 | 333 |
| 966 | 3300047443 | Ga0495687_005116 | Ga0495687_005116_5369_6391 | 333 |
| 967 | 3300047444 | Ga0495675_0119798 | Ga0495675_0119798_381_1391 | 333 |
| 968 | 3300047469 | Ga0495673_0000223 | Ga0495673_0000223_36866_37876 | 333 |
| 969 | 3300047471 | Ga0495684_0067687 | Ga0495684_0067687_716_1726 | 333 |
| 970 | 3300047472 | Ga0495686_0008657 | Ga0495686_0008657_4509_5534 | 333 |
| 971 | 3300047673 | Ga0495593_0004669 | Ga0495593_0004669_5058_6068 | 333 |
| 972 | 3300048088 | Ga0495602_0031172 | Ga0495602_0031172_3573_4583 | 333 |
| 973 | 3300048089 | Ga0495614_0011401 | Ga0495614_0011401_610_1620 | 333 |
| 974 | 3300048927 | Ga0496124_0000046 | Ga0496124_0000046_22898_23914 | 333 |
| 975 | 3300049571 | Ga0501034_0178180 | Ga0501034_0178180_410_1426 | 333 |
| 976 | 3300049586 | Ga0501070_0163330 | Ga0501070_0163330_639_1649 | 333 |
| 977 | 3300053085 | Ga0495619_0037869 | Ga0495619_0037869_656_1666 | 333 |
| 978 | 3300053101 | Ga0500553_015652 | Ga0500553_015652_2557_3567 | 333 |
| 979 | 3300053122 | Ga0500608_068534 | Ga0500608_068534_180_1190 | 333 |
| 980 | iso_pu_bacteria | 2862281513 | 2862288264 | 333 |
| 981 | 3300001990 | JGI24737J22298_10051184 | JGI24737J22298_100511842 | 334 |
| 982 | 3300002067 | JGI24735J21928_10001861 | JGI24735J21928_100018612 | 334 |
| 983 | 3300005355 | Ga0070671_100156542 | Ga0070671_1001565422 | 334 |
| 984 | 3300025904 | Ga0207647_10043088 | Ga0207647_100430882 | 334 |
| 985 | 3300025931 | Ga0207644_10204472 | Ga0207644_102044722 | 334 |
| 986 | 3300037471 | Ga0395905_0073489 | Ga0395905_0073489_201_1205 | 334 |
| 987 | 3300044693 | Ga0466961_0013455 | Ga0466961_0013455_1740_2744 | 334 |
| 988 | 3300044765 | Ga0466970_0006844 | Ga0466970_0006844_2429_3433 | 334 |
| 989 | 3300045976 | Ga0466967_0040191 | Ga0466967_0040191_2964_3968 | 334 |
| 990 | 3300046463 | Ga0495653_0044531 | Ga0495653_0044531_1552_2556 | 334 |
| 991 | 3300047673 | Ga0495593_0028589 | Ga0495593_0028589_640_1644 | 334 |
| 992 | 3300048088 | Ga0495602_0086198 | Ga0495602_0086198_1429_2433 | 334 |
| 993 | 3300049823 | Ga0501044_0043682 | Ga0501044_0043682_3443_4504 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9462 | 1 | 312 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9394 | 1 | 313 |
| 1pz1-assembly2.cif.gz_B | structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) | 0.9199 | 1 | 319 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9168 | 1 | 313 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9141 | 1 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.962 | 1 | 333 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9417 | 1 | 225 | 3.20.20.100 |
| af_P49249_9_269_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9412 | 2 | 258 | 3.20.20.100 |
| 3v0uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9394 | 1 | 313 | 3.20.20.100 |
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9393 | 68 | 334 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6A8B0-F1-model_v4 | deleted | 0.9908 | 2 | 180 |
|
| AF-A0A1G9MJ32-F1-model_v4 | Predicted oxidoreductase | 0.9872 | 1 | 332 |
GO:0004033
GO:0005737 |
| AF-A0A4Q3GSW9-F1-model_v4 | Aldo/keto reductase | 0.9861 | 1 | 209 |
GO:0004033
GO:0005737 |
| AF-A0A1G9MJ32-F1-model_v4 | Predicted oxidoreductase | 0.9812 | 1 | 332 |
GO:0004033
GO:0005737 |
| AF-A0A4Q3GSW9-F1-model_v4 | Aldo/keto reductase | 0.9767 | 1 | 209 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar