F487702

General Info

Members Datasets Scaffolds Average Seq Length
993 573 893 330

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_33851_c1|nmdc:mga03n38_33851_c1_61_1209
Length 382
Sequence MARHGGKRIQIGKIEFSHCLYFRTSCTDHDGLSHIAPGPILPAQRTTETIMKQRQLGKNGPKTSAIGLGAMGMSGMYGPADRAESIATIHAALEAGVTLIDTGDFYGMGHNEMLIGEALKGVPRDRFQISVKFGALRDPAGNWLGYDARPVAVKSALAYTLQRLGLDHIDIYRPSRLDPNVPIEDTVGAVAEMVKAGYVRHIGLSEIGAETIRRAAAVHPISDLQIEYSLISRGIEEQILPTLRELGIGVTAYGVLSRGLISGHWQAGTALAKGDFRGMSPRFQAENAARNLALVEALRAVAEARGASVAQVAIAWVAAQGADIVPLVGARRRDRLAEALGALDLELSTDDLAAIERAVPKGAASGSRYPERAMADLDSERT

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
7 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
8 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
9 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
10 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
11 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
12 2619618881 Frankia sp. ACN1ag Isolate Unclassified
13 2619619003 Frankia sp. CpI1-P Isolate Nodule
14 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
15 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
16 2643221629 Devosia sp. Root105 Isolate Unclassified
17 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
18 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
19 2643221647 Streptomyces sp. Root369 Isolate Unclassified
20 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
21 2643221662 Devosia sp. Root413D1 Isolate Unclassified
22 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
23 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
24 2643221714 Streptomyces sp. Root264 Isolate Unclassified
25 2643221718 Rhizobium sp. Root268 Isolate Unclassified
26 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
27 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
28 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
29 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
30 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
31 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
32 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
33 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
34 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
35 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
36 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
37 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
38 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
39 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
40 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
41 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
42 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
43 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
44 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
45 2842694124 Methylopila sp. R-72369 Isolate Unclassified
46 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
47 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
48 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
49 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
50 2849560528 Caulobacter zeae 410 Isolate Unclassified
51 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
52 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
53 2851153111 Caulobacter radicis 736 Isolate Unclassified
54 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
55 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
56 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
57 2867428634 Streptomyces sp. RP5T Isolate Unclassified
58 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
59 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
60 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
61 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
62 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
63 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
64 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
65 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
66 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
67 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
68 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
69 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
70 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
71 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
72 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
73 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
74 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
75 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
76 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
77 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
78 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
79 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
80 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
81 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
82 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
83 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
84 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
85 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
86 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
87 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
88 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
89 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
90 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
91 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
92 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
94 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
95 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
96 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
97 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
102 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
109 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
113 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
114 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
115 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
116 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
117 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
121 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
122 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
123 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
124 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
125 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
126 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
127 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
128 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
129 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
130 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
131 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
132 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
133 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
134 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
135 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
136 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
137 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
138 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
139 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
140 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
141 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
142 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
143 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
147 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
148 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
149 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
150 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
151 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
152 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
155 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
156 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
157 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
158 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
159 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
160 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
161 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
162 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
163 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
167 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
168 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
169 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
170 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
171 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
172 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
173 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
174 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
175 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
176 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
177 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
178 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
179 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
180 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
181 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
182 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
183 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
184 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
185 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
186 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
187 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
188 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
189 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
190 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
191 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
192 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
193 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
194 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
195 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
196 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
197 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
198 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
199 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
200 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
201 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
202 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
203 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
204 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
205 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
206 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
207 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
208 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
209 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
210 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
211 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
212 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
213 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
214 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
215 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
216 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
217 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
218 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
219 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
220 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
221 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
222 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
225 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
228 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
229 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
230 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
231 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
232 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
233 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
235 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
236 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
237 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
238 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
239 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
244 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
246 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
248 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
255 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
303 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
304 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
308 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
309 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
310 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
311 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
312 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
313 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
314 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
315 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
316 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
317 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
318 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
319 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
320 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
321 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
322 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
323 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
324 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
325 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
326 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
327 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
328 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
329 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
330 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
331 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
332 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
333 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
336 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
337 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
338 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
339 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
340 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
341 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
342 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
343 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
344 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
345 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
346 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
353 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
354 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
355 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
356 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
357 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
358 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
359 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
360 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
361 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
362 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
363 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
364 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
365 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
366 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
367 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
368 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
369 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
370 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
371 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
372 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
373 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
374 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
375 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
376 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
377 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
378 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
379 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
380 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
381 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
382 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
383 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
384 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
385 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
386 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
387 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
388 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
389 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
390 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
391 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
392 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
393 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
394 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
395 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
396 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
397 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
398 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
399 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
400 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
401 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
402 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
403 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
404 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
405 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
406 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
407 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
408 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
409 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
410 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
411 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
412 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
413 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
414 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
415 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
416 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
417 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
418 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
419 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
420 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
421 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
422 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
423 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
424 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
425 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
426 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
427 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
428 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
429 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
430 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
431 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
432 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
433 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
434 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
435 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
436 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
437 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
438 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
439 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
440 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
441 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
442 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
443 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
444 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
445 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
448 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
449 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
450 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
451 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
452 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
453 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
454 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
455 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
456 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
457 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
458 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
459 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
460 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
461 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
462 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
463 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
464 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
465 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
466 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
467 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
468 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
469 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
470 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
471 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
472 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
473 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
474 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
475 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
476 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
477 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
481 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
482 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
483 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
484 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
485 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
486 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
487 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
488 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
501 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
502 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
503 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
504 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
505 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
509 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
510 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
511 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
514 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
525 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
526 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
527 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
528 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
529 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
530 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
531 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
532 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
533 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
534 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
535 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
536 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
537 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
538 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
539 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
540 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
541 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
542 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
543 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
544 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
545 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
546 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
547 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
548 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
549 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
550 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
551 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
552 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
553 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
554 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
555 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
556 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
557 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
558 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
559 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
560 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
561 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
562 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
563 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
564 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
565 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
566 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
567 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
568 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
569 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
570 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
571 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
572 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
573 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.43
Metatranscriptomes 0.4
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.57
Nodule 2.42
Rhizoplane 3.42
Rhizosphere 75.23
Stem 0
Stem Tuber 0
Unclassified 9.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10051184 3300001990 Bacteria 1254
2 JGI24735J21928_10001861 3300002067 Bacteria 7399
3 JGI24738J21930_10002057 3300002075 Bacteria 5393
4 JGI24744J21845_10020508 3300002077 Bacteria 1303
5 JGI25151J46595_10003611 3300003187 Bacteria 8460
6 JGI25406J46586_10003682 3300003203 Bacteria 7184
7 JGI25153J46596_10000059 3300003215 Bacteria 131871
8 JGI25153J46596_10000347 3300003215 Bacteria 32342
9 JGI25153J46596_10045284 3300003215 Bacteria 1314
10 rootH1_10039975 3300003316 Bacteria 4505
11 rootH1_10039975 3300003323 Bacteria 3576
12 rootL2_10042670 3300003322 Bacteria 2560
13 rootL2_10244431 3300003322 Bacteria 4542
14 rootH1_10244174 3300003323 Bacteria 1338
15 JGI25160J50197_1019999 3300003354 Bacteria 2034
16 Ga0006562J51391_1039231 3300003578 Bacteria 1955
17 Ga0006562J51391_1097249 3300003578 Bacteria 3250
18 Ga0006562J51391_1097250 3300003578 Bacteria 4360
19 Ga0055538_1000002 3300003751 Bacteria 999437
20 Ga0055539_1000002 3300003752 Bacteria 999437
21 Ga0055533_1000004 3300003756 Bacteria 999437
22 Ga0055525_1000002 3300003759 Bacteria 999437
23 Ga0055524_1003285 3300003775 Bacteria 7912
24 Ga0055536_1002443 3300003781 Bacteria 10433
25 Ga0055528_1003718 3300003790 Bacteria 7540
26 Ga0055530_10000180 3300003791 Bacteria 57095
27 Ga0055530_10000371 3300003791 Bacteria 40721
28 Ga0055531_10000844 3300003794 Bacteria 25295
29 Ga0055531_10020550 3300003794 Bacteria 2605
30 Ga0055541_1000002 3300003841 Bacteria 896405
31 Ga0065165_1000041 3300005262 Bacteria 203876
32 Ga0065704_10001157 3300005289 Bacteria 9708
33 Ga0070658_10023456 3300005327 Bacteria 4952
34 Ga0070658_10486722 3300005327 Bacteria 1065
35 Ga0070676_10005433 3300005328 Bacteria 6788
36 Ga0070683_100044156 3300005329 Bacteria 4109
37 Ga0070683_100543434 3300005329 Bacteria 1111
38 Ga0070690_100000353 3300005330 Bacteria 23608
39 Ga0070670_100022096 3300005331 Bacteria 5476
40 Ga0070680_100040786 3300005336 Bacteria 3761
41 Ga0070682_100002246 3300005337 Bacteria 10707
42 Ga0068868_100016065 3300005338 Bacteria 5551
43 Ga0070660_100001656 3300005339 Bacteria 15309
44 Ga0070689_100001225 3300005340 Bacteria 16291
45 Ga0070691_10000400 3300005341 Bacteria 15742
46 Ga0070687_100000797 3300005343 Bacteria 10479
47 Ga0070687_100033026 3300005343 Bacteria 2551
48 Ga0070661_100000384 3300005344 Bacteria 34636
49 Ga0070661_100036544 3300005344 Bacteria 3571
50 Ga0070692_10005510 3300005345 Bacteria 5406
51 Ga0070668_100000244 3300005347 Bacteria 35854
52 Ga0070669_100005644 3300005353 Bacteria 9039
53 Ga0070675_100010071 3300005354 Bacteria 7370
54 Ga0070671_100015311 3300005355 Bacteria 6193
55 Ga0070671_100148165 3300005355 Bacteria 1981
56 Ga0070671_100156542 3300005355 Bacteria 1925
57 Ga0070671_100355568 3300005355 Bacteria 1250
58 Ga0070674_100004514 3300005356 Bacteria 7945
59 Ga0070674_100058420 3300005356 Bacteria 2681
60 Ga0070674_100151898 3300005356 Bacteria 1748
61 Ga0070673_100001304 3300005364 Bacteria 14521
62 Ga0070673_100043152 3300005364 Bacteria 3482
63 Ga0070659_100001838 3300005366 Bacteria 15239
64 Ga0070667_100000032 3300005367 Bacteria 176783
65 Ga0070667_100038589 3300005367 Bacteria 4004
66 Ga0070703_10074344 3300005406 Bacteria 1142
67 Ga0070709_10002721 3300005434 Bacteria 9553
68 Ga0070714_100011159 3300005435 Bacteria 7121
69 Ga0070714_100034133 3300005435 Bacteria 4259
70 Ga0070713_100014713 3300005436 Bacteria 5821
71 Ga0070713_100177568 3300005436 Bacteria 1912
72 Ga0070710_10000631 3300005437 Bacteria 16763
73 Ga0070701_10000411 3300005438 Bacteria 14521
74 Ga0070711_100012991 3300005439 Bacteria 5219
75 Ga0070705_100003021 3300005440 Bacteria 8314
76 Ga0070700_100006086 3300005441 Bacteria 6426
77 Ga0070694_100009526 3300005444 Bacteria 5958
78 Ga0070708_100001636 3300005445 Bacteria 17177
79 Ga0070663_100000213 3300005455 Bacteria 29048
80 Ga0070663_100002295 3300005455 Bacteria 10732
81 Ga0070663_100114797 3300005455 Bacteria 2028
82 Ga0070678_100001330 3300005456 Bacteria 13125
83 Ga0070678_100067356 3300005456 Bacteria 2665
84 Ga0070662_100001264 3300005457 Bacteria 15537
85 Ga0070681_10087479 3300005458 Bacteria 3069
86 Ga0068867_100009543 3300005459 Bacteria 6840
87 Ga0070706_100078965 3300005467 Bacteria 3046
88 Ga0070699_100108834 3300005518 Bacteria 2432
89 Ga0070684_100006348 3300005535 Bacteria 9137
90 Ga0070697_100000600 3300005536 Bacteria 27338
91 Ga0070697_100018903 3300005536 Bacteria 5437
92 Ga0068853_100002094 3300005539 Bacteria 14803
93 Ga0068853_100003586 3300005539 Bacteria 11884
94 Ga0070672_100000593 3300005543 Bacteria 21257
95 Ga0070686_100008356 3300005544 Bacteria 5796
96 Ga0070695_100019548 3300005545 Bacteria 4124
97 Ga0070696_100009212 3300005546 Bacteria 6608
98 Ga0070693_100002402 3300005547 Bacteria 8618
99 Ga0070665_100010157 3300005548 Bacteria 9520
100 Ga0070665_100193817 3300005548 Bacteria 2033
101 Ga0070665_100279887 3300005548 Bacteria 1670
102 Ga0070704_100001660 3300005549 Bacteria 12063
103 Ga0068855_100000893 3300005563 Bacteria 37029
104 Ga0070664_100001131 3300005564 Bacteria 21074
105 Ga0068857_100004274 3300005577 Bacteria 12044
106 Ga0068854_100004366 3300005578 Bacteria 8918
107 Ga0068856_100002475 3300005614 Bacteria 19007
108 Ga0068856_100070159 3300005614 Bacteria 3466
109 Ga0070702_100002170 3300005615 Bacteria 8355
110 Ga0068852_100001835 3300005616 Bacteria 14449
111 Ga0068859_100039295 3300005617 Bacteria 4747
112 Ga0068864_100009139 3300005618 Bacteria 8170
113 Ga0068866_10000716 3300005718 Bacteria 15063
114 Ga0068861_100002260 3300005719 Bacteria 12517
115 Ga0068861_100011313 3300005719 Bacteria 6196
116 Ga0068851_10110910 3300005834 Bacteria 1464
117 Ga0068870_10027496 3300005840 Bacteria 2846
118 Ga0068863_100006545 3300005841 Bacteria 11431
119 Ga0068863_100052519 3300005841 Bacteria 3862
120 Ga0068858_100002708 3300005842 Bacteria 17868
121 Ga0068860_100001510 3300005843 Bacteria 25075
122 Ga0068862_100001549 3300005844 Bacteria 21017
123 Ga0068862_100037119 3300005844 Bacteria 4129
124 Ga0068862_100055189 3300005844 Bacteria 3403
125 Ga0081455_10160346 3300005937 Bacteria 1725
126 Ga0081538_10009878 3300005981 Bacteria 7890
127 Ga0081540_1063568 3300005983 Bacteria 1746
128 Ga0081539_10000260 3300005985 Bacteria 121685
129 Ga0081539_10002379 3300005985 Bacteria 26904
130 Ga0081539_10004993 3300005985 Bacteria 14028
131 Ga0075365_10020608 3300006038 Bacteria 4091
132 Ga0075365_10027832 3300006038 Bacteria 3601
133 Ga0075365_10090639 3300006038 Bacteria 2082
134 Ga0075368_10007337 3300006042 Bacteria 3887
135 Ga0075368_10017684 3300006042 Bacteria 2671
136 Ga0075363_100044516 3300006048 Bacteria 2351
137 Ga0075364_10060179 3300006051 Bacteria 2491
138 Ga0075364_10273090 3300006051 Bacteria 1150
139 Ga0070715_10001549 3300006163 Bacteria 6735
140 Ga0070716_100003352 3300006173 Bacteria 7530
141 Ga0070712_100010677 3300006175 Bacteria 5799
142 Ga0075367_10203416 3300006178 Bacteria 1237
143 Ga0097621_100140530 3300006237 Bacteria 2063
144 Ga0075370_10144723 3300006353 Bacteria 1391
145 Ga0068871_100029996 3300006358 Bacteria 4279
146 Ga0075428_100060512 3300006844 Bacteria 4147
147 Ga0075430_100255262 3300006846 Bacteria 1452
148 Ga0075431_100211576 3300006847 Bacteria 1980
149 Ga0075433_10016953 3300006852 Bacteria 6020
150 Ga0075433_10043589 3300006852 Bacteria 3895
151 Ga0075429_100019359 3300006880 Bacteria 5895
152 Ga0068865_100000336 3300006881 Bacteria 25976
153 Ga0075436_100034897 3300006914 Bacteria 3469
154 Ga0097620_100039295 3300006931 Bacteria 4747
155 Ga0099826_10058826 3300006948 Bacteria 2517
156 Ga0075435_100029485 3300007076 Bacteria 4306
157 Ga0075435_100499820 3300007076 Bacteria 1051
158 Ga0105244_10063203 3300009036 Bacteria 1859
159 Ga0105240_10103548 3300009093 Bacteria 3458
160 Ga0105240_10458571 3300009093 Bacteria 1425
161 Ga0111539_10155560 3300009094 Bacteria 2675
162 Ga0111539_10701496 3300009094 Bacteria 1178
163 Ga0105245_10000688 3300009098 Bacteria 30513
164 Ga0105245_10154098 3300009098 Bacteria 2175
165 Ga0105247_10009820 3300009101 Bacteria 5798
166 Ga0105247_10016880 3300009101 Bacteria 4377
167 Ga0114129_10058018 3300009147 Bacteria 5416
168 Ga0105243_10000473 3300009148 Bacteria 41355
169 Ga0105243_10106287 3300009148 Bacteria 2339
170 Ga0105241_10002593 3300009174 Bacteria 13553
171 Ga0105242_10000217 3300009176 Bacteria 45033
172 Ga0105248_10000143 3300009177 Bacteria 82037
173 Ga0105248_10000487 3300009177 Bacteria 45265
174 Ga0105237_10000638 3300009545 Bacteria 48948
175 Ga0105237_10007897 3300009545 Bacteria 11593
176 Ga0105238_10000015 3300009551 Bacteria 241590
177 Ga0105238_10008427 3300009551 Bacteria 10321
178 Ga0105238_10219096 3300009551 Bacteria 1879
179 Ga0105249_10000211 3300009553 Bacteria 66931
180 Ga0105249_10001143 3300009553 Bacteria 23484
181 Ga0105249_10152251 3300009553 Bacteria 2228
182 Ga0099796_10003661 3300010159 Bacteria 3603
183 Ga0105239_10004376 3300010375 Bacteria 16914
184 Ga0105239_10531243 3300010375 Bacteria 1339
185 Ga0105239_10576996 3300010375 Bacteria 1282
186 Ga0105246_10000451 3300011119 Bacteria 22023
187 Ga0157373_10027812 3300013100 Bacteria 4080
188 Ga0157369_10001385 3300013105 Bacteria 29863
189 Ga0157369_10134064 3300013105 Bacteria 2623
190 Ga0157374_10001745 3300013296 Bacteria 18248
191 Ga0157374_10004977 3300013296 Bacteria 11148
192 Ga0157374_10027795 3300013296 Bacteria 5107
193 Ga0157378_10001026 3300013297 Bacteria 25538
194 Ga0163162_10000935 3300013306 Bacteria 27140
195 Ga0163162_10037798 3300013306 Bacteria 4818
196 Ga0163162_10063999 3300013306 Bacteria 3722
197 Ga0157372_10003142 3300013307 Bacteria 17807
198 Ga0157375_10012343 3300013308 Bacteria 7575
199 Ga0157375_10042148 3300013308 Bacteria 4415
200 Ga0163163_10040262 3300014325 Bacteria 4563
201 Ga0163163_10098993 3300014325 Bacteria 2937
202 Ga0157380_10001124 3300014326 Bacteria 17252
203 Ga0157380_10045986 3300014326 Bacteria 3427
204 Ga0157377_10000791 3300014745 Bacteria 13068
205 Ga0157379_10006054 3300014968 Bacteria 10419
206 Ga0157376_10000510 3300014969 Bacteria 25116
207 Ga0183367_1009 3300015688 Bacteria 484598
208 Ga0163161_10025207 3300017792 Bacteria 4208
209 Ga0163161_10068801 3300017792 Bacteria 2587
210 Ga0163161_10268631 3300017792 Bacteria 1334
211 Ga0206353_10718303 3300020082 Bacteria 2749
212 Ga0214542_1018224 3300021321 Bacteria 6020
213 Ga0214543_1000134 3300021327 Bacteria 102056
214 Ga0213872_10100302 3300021361 Bacteria 1291
215 Ga0213872_10110791 3300021361 Bacteria 1219
216 Ga0213874_10046082 3300021377 Bacteria 1322
217 Ga0213876_10009202 3300021384 Bacteria 5320
218 Ga0209784_100002 3300025224 Bacteria 1753105
219 Ga0209566_100003 3300025225 Bacteria 1753105
220 Ga0209674_100004 3300025226 Bacteria 1753105
221 Ga0209563_100006 3300025230 Bacteria 1753105
222 Ga0209026_1001674 3300025250 Bacteria 9321
223 Ga0209677_100003 3300025253 Bacteria 1753105
224 Ga0209129_1000689 3300025258 Bacteria 22147
225 Ga0209673_1000010 3300025273 Bacteria 596656
226 Ga0209673_1040467 3300025273 Bacteria 1333
227 Ga0209130_1000399 3300025284 Bacteria 47530
228 Ga0209676_1000547 3300025292 Bacteria 57868
229 Ga0209025_1001742 3300025294 Bacteria 26127
230 Ga0209025_1024299 3300025294 Bacteria 3132
231 Ga0209564_1007507 3300025295 Bacteria 5617
232 Ga0209758_1000095 3300025297 Bacteria 237870
233 Ga0209758_1030482 3300025297 Bacteria 2233
234 Ga0209050_1000034 3300025298 Bacteria 433906
235 Ga0209050_1004401 3300025298 Bacteria 9540
236 Ga0209050_1014984 3300025298 Bacteria 3292
237 Ga0209256_1001682 3300025299 Bacteria 21428
238 Ga0209256_1009580 3300025299 Bacteria 4220
239 Ga0207426_1000046 3300025302 Bacteria 422271
240 Ga0209051_1015616 3300025303 Bacteria 3482
241 Ga0209051_1024871 3300025303 Bacteria 2452
242 Ga0209257_1000052 3300025304 Bacteria 430947
243 Ga0209257_1000477 3300025304 Bacteria 72873
244 Ga0209257_1004227 3300025304 Bacteria 11372
245 Ga0209257_1019432 3300025304 Bacteria 2559
246 Ga0207656_10078840 3300025321 Bacteria 1477
247 Ga0207710_10006089 3300025900 Bacteria 5166
248 Ga0207680_10006249 3300025903 Bacteria 5749
249 Ga0207647_10003873 3300025904 Bacteria 11188
250 Ga0207647_10043088 3300025904 Bacteria 2825
251 Ga0207699_10010704 3300025906 Bacteria 4612
252 Ga0207645_10001040 3300025907 Bacteria 22925
253 Ga0207643_10009053 3300025908 Bacteria 5347
254 Ga0207705_10018281 3300025909 Bacteria 5013
255 Ga0207684_10174360 3300025910 Bacteria 1854
256 Ga0207707_10054439 3300025912 Bacteria 3483
257 Ga0207695_10188223 3300025913 Bacteria 1982
258 Ga0207695_10236318 3300025913 Bacteria 1730
259 Ga0207671_10046382 3300025914 Bacteria 3215
260 Ga0207671_10048751 3300025914 Bacteria 3135
261 Ga0207693_10000278 3300025915 Bacteria 47482
262 Ga0207663_10002954 3300025916 Bacteria 8216
263 Ga0207660_10042397 3300025917 Bacteria 3194
264 Ga0207662_10005916 3300025918 Bacteria 6566
265 Ga0207662_10023054 3300025918 Bacteria 3573
266 Ga0207657_10000047 3300025919 Bacteria 111686
267 Ga0207681_10006557 3300025923 Bacteria 7144
268 Ga0207681_10153398 3300025923 Bacteria 1729
269 Ga0207694_10000017 3300025924 Bacteria 342100
270 Ga0207694_10036175 3300025924 Bacteria 3789
271 Ga0207664_10015644 3300025929 Bacteria 5514
272 Ga0207644_10034679 3300025931 Bacteria 3532
273 Ga0207644_10204472 3300025931 Bacteria 1559
274 Ga0207706_10000079 3300025933 Bacteria 100592
275 Ga0207686_10016824 3300025934 Bacteria 4107
276 Ga0207709_10023947 3300025935 Bacteria 3481
277 Ga0207669_10009273 3300025937 Bacteria 4676
278 Ga0207669_10079995 3300025937 Bacteria 2089
279 Ga0207704_10016264 3300025938 Bacteria 3819
280 Ga0207704_10127593 3300025938 Bacteria 1755
281 Ga0207665_10000432 3300025939 Bacteria 28864
282 Ga0207691_10007711 3300025940 Bacteria 10359
283 Ga0207691_10027134 3300025940 Bacteria 5373
284 Ga0207711_10001415 3300025941 Bacteria 22473
285 Ga0207711_10051163 3300025941 Bacteria 3537
286 Ga0207661_10030887 3300025944 Bacteria 4131
287 Ga0207651_10019716 3300025960 Bacteria 4050
288 Ga0207712_10004820 3300025961 Bacteria 8521
289 Ga0207668_10004345 3300025972 Bacteria 8322
290 Ga0207640_10007564 3300025981 Bacteria 5999
291 Ga0207658_10000048 3300025986 Bacteria 130723
292 Ga0207658_10445490 3300025986 Bacteria 1145
293 Ga0207639_10005055 3300026041 Bacteria 8886
294 Ga0207678_10000111 3300026067 Bacteria 67188
295 Ga0207678_10000877 3300026067 Bacteria 27644
296 Ga0207708_10000526 3300026075 Bacteria 29587
297 Ga0207702_10075114 3300026078 Bacteria 2919
298 Ga0207641_10019105 3300026088 Bacteria 5621
299 Ga0207641_10428767 3300026088 Bacteria 1274
300 Ga0207648_10011260 3300026089 Bacteria 8434
301 Ga0207648_10069754 3300026089 Bacteria 3063
302 Ga0207676_10060990 3300026095 Bacteria 2985
303 Ga0207674_10001475 3300026116 Bacteria 30401
304 Ga0207675_100007188 3300026118 Bacteria 10521
305 Ga0207675_100018149 3300026118 Bacteria 6559
306 Ga0207683_10000026 3300026121 Bacteria 111890
307 Ga0207683_10069410 3300026121 Bacteria 3112
308 Ga0209813_10011864 3300027866 Bacteria 2288
309 Ga0207428_10000668 3300027907 Bacteria 40081
310 Ga0207428_10097474 3300027907 Bacteria 2276
311 Ga0268266_10021536 3300028379 Bacteria 5492
312 Ga0268266_10073294 3300028379 Bacteria 2971
313 Ga0268266_10345624 3300028379 Bacteria 1397
314 Ga0268265_10000876 3300028380 Bacteria 28172
315 Ga0268265_10001620 3300028380 Bacteria 18546
316 Ga0268265_10056529 3300028380 Bacteria 2986
317 Ga0268264_10018500 3300028381 Bacteria 5698
318 Ga0268264_10070350 3300028381 Bacteria 2962
319 Ga0268264_10229146 3300028381 Bacteria 1715
320 Ga0265336_10000664 3300028666 Bacteria 18678
321 Ga0307517_10131954 3300028786 Bacteria 1794
322 Ga0307515_10015071 3300028794 Bacteria 14277
323 Ga0307515_10123046 3300028794 Bacteria 2921
324 Ga0307515_10324832 3300028794 Bacteria 1202
325 Ga0265338_10083232 3300028800 Bacteria 2677
326 Ga0307511_10012485 3300030521 Bacteria 8334
327 Ga0307512_10010397 3300030522 Bacteria 8877
328 Ga0265332_10010400 3300031238 Bacteria 4141
329 Ga0265328_10021119 3300031239 Bacteria 2488
330 Ga0265328_10029163 3300031239 Bacteria 2062
331 Ga0265320_10056299 3300031240 Bacteria 1890
332 Ga0265325_10016843 3300031241 Bacteria 4076
333 Ga0265340_10000024 3300031247 Bacteria 77206
334 Ga0265340_10011864 3300031247 Bacteria 4616
335 Ga0265340_10011993 3300031247 Bacteria 4584
336 Ga0265340_10015861 3300031247 Bacteria 3908
337 Ga0265340_10079455 3300031247 Bacteria 1546
338 Ga0265339_10001398 3300031249 Bacteria 17958
339 Ga0265316_10010461 3300031344 Bacteria 8449
340 Ga0265316_10048376 3300031344 Bacteria 3357
341 Ga0265316_10053576 3300031344 Bacteria 3160
342 Ga0265316_10115896 3300031344 Bacteria 2025
343 Ga0265316_10223758 3300031344 Bacteria 1387
344 Ga0307513_10029898 3300031456 Bacteria 6197
345 Ga0307513_10058751 3300031456 Bacteria 4085
346 Ga0307513_10174035 3300031456 Bacteria 2026
347 Ga0307513_10200611 3300031456 Bacteria 1836
348 Ga0307513_10343730 3300031456 Bacteria 1242
349 Ga0307509_10047478 3300031507 Bacteria 4618
350 Ga0307509_10263464 3300031507 Bacteria 1497
351 Ga0265313_10009270 3300031595 Bacteria 6406
352 Ga0307508_10052441 3300031616 Bacteria 3623
353 Ga0307508_10055097 3300031616 Bacteria 3523
354 Ga0307514_10037737 3300031649 Bacteria 3827
355 Ga0307514_10070308 3300031649 Bacteria 2629
356 Ga0265314_10029466 3300031711 Bacteria 4079
357 Ga0265342_10065193 3300031712 Bacteria 2135
358 Ga0307516_10014197 3300031730 Bacteria 8438
359 Ga0307405_10033749 3300031731 Bacteria 3039
360 Ga0307518_10056055 3300031838 Bacteria 2863
361 Ga0307410_10059722 3300031852 Bacteria 2604
362 Ga0307407_10200845 3300031903 Bacteria 1336
363 Ga0307409_100013759 3300031995 Bacteria 5227
364 Ga0307409_100145715 3300031995 Bacteria 2048
365 Ga0307409_100268444 3300031995 Bacteria 1570
366 Ga0307416_100077246 3300032002 Bacteria 2796
367 Ga0307416_100200071 3300032002 Bacteria 1895
368 Ga0307414_10239282 3300032004 Bacteria 1502
369 Ga0307415_100074593 3300032126 Bacteria 2398
370 Ga0307415_100204657 3300032126 Bacteria 1569
371 Ga0307510_10096719 3300033180 Bacteria 2766
372 Ga0373953_0004923 3300035117 Bacteria 4295
373 Ga0373954_0018234 3300035118 Bacteria 3157
374 Ga0373956_0063556 3300035119 Bacteria 1674
375 Ga0373957_0014754 3300035120 Bacteria 2676
376 Ga0373960_0066121 3300035121 Bacteria 1107
377 Ga0373924_0049670 3300035410 Bacteria 1736
378 Ga0373931_0004176 3300035691 Bacteria 6568
379 Ga0373933_0140324 3300035724 Bacteria 1525
380 Ga0316582_0062309 3300036647 Bacteria 2394
381 Ga0316584_0104569 3300036712 Bacteria 2119
382 Ga0316584_0106033 3300036712 Bacteria 2103
383 Ga0395899_0000016 3300037312 Bacteria 468322
384 Ga0395899_0000197 3300037312 Bacteria 88596
385 Ga0395899_0032059 3300037312 Bacteria 3947
386 Ga0395899_0034053 3300037312 Bacteria 3824
387 Ga0395899_0227247 3300037312 Bacteria 1290
388 Ga0395900_0000006 3300037418 Bacteria 495364
389 Ga0395900_0093038 3300037418 Bacteria 3097
390 Ga0395898_0020812 3300037466 Bacteria 6658
391 Ga0395898_0174874 3300037466 Bacteria 2052
392 Ga0395905_0004212 3300037471 Bacteria 15041
393 Ga0395905_0018788 3300037471 Bacteria 6557
394 Ga0395905_0030180 3300037471 Bacteria 5110
395 Ga0395905_0073489 3300037471 Bacteria 3205
396 Ga0395905_0123707 3300037471 Bacteria 2432
397 Ga0395905_0279365 3300037471 Bacteria 1556
398 Ga0436364_1558329 3300037853 Bacteria 8309
399 Ga0395901_0000001 3300038443 Bacteria 800383
400 Ga0395901_0000683 3300038443 Bacteria 38895
401 Ga0395901_0165847 3300038443 Bacteria 2319
402 Ga0395901_0356948 3300038443 Bacteria 1508
403 Ga0395901_0472259 3300038443 Bacteria 1280
404 Ga0436365_0968347 3300039437 Bacteria 4671
405 Ga0436365_1738300 3300039437 Bacteria 3334
406 Ga0436365_1805460 3300039437 Bacteria 13545
407 Ga0436360_0359615 3300039438 Bacteria 2164
408 Ga0436361_0647556 3300039447 Bacteria 5610
409 Ga0436361_0745464 3300039447 Bacteria 2337
410 Ga0436361_0794720 3300039447 Bacteria 1062
411 Ga0436361_0914477 3300039447 Bacteria 3776
412 Ga0436363_0338474 3300039450 Bacteria 1477
413 Ga0436363_0394091 3300039450 Bacteria 1209
414 Ga0436363_0614601 3300039450 Bacteria 3836
415 Ga0436363_1644309 3300039450 Bacteria 3908
416 Ga0439436_0001143 3300041404 Bacteria 7528
417 Ga0439447_023052 3300041407 Bacteria 1625
418 Ga0439465_0003975 3300041413 Bacteria 4822
419 Ga0451851_0679826 3300041507 Bacteria 1162
420 Ga0439448_0007409 3300042005 Bacteria 3181
421 Ga0439449_0001376 3300042007 Bacteria 9507
422 Ga0439449_0071515 3300042007 Bacteria 1278
423 Ga0439455_0006090 3300042012 Bacteria 2485
424 Ga0439457_000207 3300042014 Bacteria 15627
425 Ga0450903_000278 3300042138 Bacteria 11255
426 Ga0450901_008779 3300042533 Bacteria 1043
427 Ga0466969_0016382 3300044656 Bacteria 3877
428 Ga0466961_0013455 3300044693 Bacteria 5241
429 Ga0466961_0027628 3300044693 Bacteria 3650
430 Ga0466961_0051398 3300044693 Bacteria 2632
431 Ga0466963_0052875 3300044694 Bacteria 2696
432 Ga0466964_0019589 3300044706 Bacteria 2602
433 Ga0466964_0039741 3300044706 Bacteria 1897
434 Ga0466968_0004993 3300044735 Bacteria 4970
435 Ga0466970_0006844 3300044765 Bacteria 5707
436 Ga0466970_0079792 3300044765 Bacteria 1767
437 Ga0466957_0040230 3300044842 Bacteria 2823
438 Ga0466960_0059672 3300044901 Bacteria 1867
439 Ga0466959_0003297 3300045049 Bacteria 10531
440 Ga0466958_0010420 3300045836 Bacteria 5206
441 Ga0466958_0151544 3300045836 Bacteria 1463
442 Ga0466967_0040191 3300045976 Bacteria 4026
443 Ga0466967_0053848 3300045976 Bacteria 3538
444 Ga0495617_017169 3300046452 Bacteria 2443
445 Ga0495627_002901 3300046453 Bacteria 7891
446 Ga0495627_020006 3300046453 Bacteria 2236
447 Ga0495592_0000576 3300046454 Bacteria 26018
448 Ga0495592_0036867 3300046454 Bacteria 3681
449 Ga0495603_0029320 3300046455 Bacteria 3318
450 Ga0495590_0000056 3300046457 Bacteria 96913
451 Ga0495590_0000181 3300046457 Bacteria 36847
452 Ga0495590_0005479 3300046457 Bacteria 5031
453 Ga0495629_0024815 3300046459 Bacteria 4266
454 Ga0495629_0037690 3300046459 Bacteria 3407
455 Ga0495629_0051449 3300046459 Bacteria 2883
456 Ga0495638_0000170 3300046460 Bacteria 101629
457 Ga0495638_0070621 3300046460 Bacteria 2138
458 Ga0495638_0108248 3300046460 Bacteria 1653
459 Ga0495651_0001088 3300046462 Bacteria 20919
460 Ga0495651_0146244 3300046462 Bacteria 1708
461 Ga0495653_0014171 3300046463 Bacteria 6499
462 Ga0495653_0023047 3300046463 Bacteria 5035
463 Ga0495653_0044531 3300046463 Bacteria 3444
464 Ga0495653_0058615 3300046463 Bacteria 2926
465 Ga0495650_0001692 3300046471 Bacteria 20320
466 Ga0495580_0017736 3300046472 Bacteria 5314
467 Ga0495582_0003999 3300046473 Bacteria 8278
468 Ga0495582_0183515 3300046473 Bacteria 1192
469 Ga0495605_0013096 3300046474 Bacteria 4582
470 Ga0495605_0020407 3300046474 Bacteria 3521
471 Ga0495605_0024308 3300046474 Bacteria 3172
472 Ga0495605_0031139 3300046474 Bacteria 2727
473 Ga0495605_0040953 3300046474 Bacteria 2309
474 Ga0495639_0027004 3300046475 Bacteria 2540
475 Ga0495662_0002860 3300046476 Bacteria 8730
476 Ga0495662_0003653 3300046476 Bacteria 7757
477 Ga0495662_0098107 3300046476 Bacteria 1433
478 Ga0495664_0003663 3300046477 Bacteria 8372
479 Ga0495664_0030585 3300046477 Bacteria 3154
480 Ga0495584_0000781 3300046491 Bacteria 20991
481 Ga0495584_0004084 3300046491 Bacteria 7881
482 Ga0495584_0012951 3300046491 Bacteria 4257
483 Ga0495584_0018413 3300046491 Bacteria 3549
484 Ga0495584_0018992 3300046491 Bacteria 3492
485 Ga0495584_0028938 3300046491 Bacteria 2808
486 Ga0495584_0055763 3300046491 Bacteria 1988
487 Ga0495585_0001585 3300046492 Bacteria 17617
488 Ga0495585_0003957 3300046492 Bacteria 9781
489 Ga0495585_0007730 3300046492 Bacteria 6552
490 Ga0495585_0073955 3300046492 Bacteria 1854
491 Ga0495594_0005242 3300046499 Bacteria 6664
492 Ga0495594_0057786 3300046499 Bacteria 2142
493 Ga0495594_0088101 3300046499 Bacteria 1737
494 Ga0495596_0005730 3300046500 Bacteria 5831
495 Ga0495596_0005838 3300046500 Bacteria 5759
496 Ga0495596_0009329 3300046500 Bacteria 4318
497 Ga0495596_0011210 3300046500 Bacteria 3873
498 Ga0495596_0021074 3300046500 Bacteria 2662
499 Ga0495596_0063786 3300046500 Bacteria 1433
500 Ga0495607_0000876 3300046501 Bacteria 28090
501 Ga0495607_0008486 3300046501 Bacteria 7020
502 Ga0495607_0023261 3300046501 Bacteria 3879
503 Ga0495607_0024504 3300046501 Bacteria 3761
504 Ga0495607_0031397 3300046501 Bacteria 3252
505 Ga0495607_0047494 3300046501 Bacteria 2515
506 Ga0495607_0055921 3300046501 Bacteria 2267
507 Ga0495583_0000417 3300046506 Bacteria 64786
508 Ga0495583_0000679 3300046506 Bacteria 44179
509 Ga0495583_0001028 3300046506 Bacteria 31717
510 Ga0495583_0015368 3300046506 Bacteria 4166
511 Ga0495583_0022229 3300046506 Bacteria 3242
512 Ga0495606_0000149 3300046507 Bacteria 120165
513 Ga0495608_0019764 3300046511 Bacteria 4632
514 Ga0495610_0014805 3300046512 Bacteria 4564
515 Ga0495616_0011077 3300046513 Bacteria 5182
516 Ga0495616_0012884 3300046513 Bacteria 4729
517 Ga0495616_0015409 3300046513 Bacteria 4252
518 Ga0495616_0088451 3300046513 Bacteria 1470
519 Ga0495616_0090757 3300046513 Bacteria 1446
520 Ga0495618_0012897 3300046514 Bacteria 5080
521 Ga0495618_0159371 3300046514 Bacteria 1439
522 Ga0495628_0010616 3300046516 Bacteria 7812
523 Ga0495628_0031356 3300046516 Bacteria 4300
524 Ga0495628_0195200 3300046516 Bacteria 1527
525 Ga0495630_0012548 3300046517 Bacteria 6156
526 Ga0495630_0111574 3300046517 Bacteria 2071
527 Ga0495631_0009289 3300046518 Bacteria 4916
528 Ga0495631_0012663 3300046518 Bacteria 4112
529 Ga0495631_0110644 3300046518 Bacteria 1181
530 Ga0495632_0000253 3300046519 Bacteria 53145
531 Ga0495632_0000311 3300046519 Bacteria 47116
532 Ga0495632_0000365 3300046519 Bacteria 43021
533 Ga0495632_0030056 3300046519 Bacteria 2823
534 Ga0495637_0024388 3300046520 Bacteria 2737
535 Ga0495643_0000302 3300046522 Bacteria 68932
536 Ga0495643_0000729 3300046522 Bacteria 37503
537 Ga0495643_0026408 3300046522 Bacteria 3277
538 Ga0495644_0005947 3300046523 Bacteria 4757
539 Ga0495644_0006899 3300046523 Bacteria 4397
540 Ga0495644_0010053 3300046523 Bacteria 3645
541 Ga0495648_0000119 3300046524 Bacteria 95682
542 Ga0495648_0011121 3300046524 Bacteria 6809
543 Ga0495648_0030554 3300046524 Bacteria 3560
544 Ga0495648_0104808 3300046524 Bacteria 1552
545 Ga0495666_0001696 3300046526 Bacteria 10883
546 Ga0495666_0003516 3300046526 Bacteria 7907
547 Ga0495642_0001135 3300046528 Bacteria 12239
548 Ga0495642_0025039 3300046528 Bacteria 2363
549 Ga0495642_0036493 3300046528 Bacteria 1986
550 Ga0495652_0001055 3300046529 Bacteria 31311
551 Ga0495652_0017628 3300046529 Bacteria 6371
552 Ga0495652_0071737 3300046529 Bacteria 2889
553 Ga0495654_0005778 3300046530 Bacteria 7130
554 Ga0495665_0005387 3300046531 Bacteria 6894
555 Ga0495640_0004953 3300046533 Bacteria 10586
556 Ga0495640_0033080 3300046533 Bacteria 3676
557 Ga0495586_0001960 3300046535 Bacteria 11233
558 Ga0495586_0004758 3300046535 Bacteria 7260
559 Ga0495586_0026453 3300046535 Bacteria 3104
560 Ga0495587_0001673 3300046536 Bacteria 14794
561 Ga0495609_0001674 3300046538 Bacteria 14400
562 Ga0495609_0038896 3300046538 Bacteria 2143
563 Ga0495597_0000123 3300046542 Bacteria 70236
564 Ga0495597_0000127 3300046542 Bacteria 69108
565 Ga0495597_0000439 3300046542 Bacteria 35464
566 Ga0495597_0002383 3300046542 Bacteria 11993
567 Ga0495597_0003217 3300046542 Bacteria 9714
568 Ga0495597_0004061 3300046542 Bacteria 8189
569 Ga0495645_0046359 3300046543 Bacteria 3168
570 Ga0495622_0000480 3300046557 Bacteria 25158
571 Ga0495622_0023694 3300046557 Bacteria 2863
572 Ga0495622_0059605 3300046557 Bacteria 1767
573 Ga0495622_0121009 3300046557 Bacteria 1195
574 Ga0495633_0000088 3300046558 Bacteria 124193
575 Ga0495633_0003948 3300046558 Bacteria 9651
576 Ga0495633_0004308 3300046558 Bacteria 9087
577 Ga0495633_0004365 3300046558 Bacteria 9026
578 Ga0495667_0022019 3300046559 Bacteria 4297
579 Ga0495668_0000460 3300046616 Bacteria 52158
580 Ga0495668_0001529 3300046616 Bacteria 21962
581 Ga0495668_0025601 3300046616 Bacteria 3351
582 Ga0495668_0025818 3300046616 Bacteria 3336
583 Ga0495668_0052708 3300046616 Bacteria 2250
584 Ga0495668_0076011 3300046616 Bacteria 1844
585 Ga0495668_0090919 3300046616 Bacteria 1672
586 Ga0495668_0110950 3300046616 Bacteria 1500
587 Ga0495668_0140030 3300046616 Bacteria 1324
588 Ga0495634_0001729 3300046642 Bacteria 18914
589 Ga0495634_0003826 3300046642 Bacteria 11953
590 Ga0495634_0029265 3300046642 Bacteria 3814
591 Ga0495634_0076175 3300046642 Bacteria 2202
592 Ga0495611_0000793 3300046648 Bacteria 17555
593 Ga0495611_0015713 3300046648 Bacteria 3234
594 Ga0495611_0055740 3300046648 Bacteria 1788
595 Ga0495625_0002200 3300046660 Bacteria 21593
596 Ga0495625_0002701 3300046660 Bacteria 18852
597 Ga0495625_0084561 3300046660 Bacteria 2203
598 Ga0495635_0024224 3300046663 Bacteria 4231
599 Ga0495635_0039975 3300046663 Bacteria 3242
600 Ga0495661_0000923 3300046665 Bacteria 26835
601 Ga0495661_0001513 3300046665 Bacteria 19348
602 Ga0495661_0010130 3300046665 Bacteria 6442
603 Ga0495661_0125823 3300046665 Bacteria 1410
604 Ga0495661_0181494 3300046665 Bacteria 1115
605 Ga0495588_0082701 3300046674 Bacteria 1677
606 Ga0495657_0010913 3300046675 Bacteria 6815
607 Ga0495657_0100431 3300046675 Bacteria 1844
608 Ga0495657_0173736 3300046675 Bacteria 1325
609 Ga0495599_0008650 3300046678 Bacteria 6195
610 Ga0495599_0105256 3300046678 Bacteria 1758
611 Ga0495623_0028591 3300046679 Bacteria 3586
612 Ga0495646_0005821 3300046680 Bacteria 7817
613 Ga0495646_0096780 3300046680 Bacteria 1697
614 Ga0495669_0000479 3300046684 Bacteria 18564
615 Ga0495669_0004096 3300046684 Bacteria 5996
616 Ga0495613_0001087 3300046689 Bacteria 20759
617 Ga0495613_0002547 3300046689 Bacteria 13719
618 Ga0495613_0006343 3300046689 Bacteria 8846
619 Ga0495613_0014884 3300046689 Bacteria 5774
620 Ga0495613_0018858 3300046689 Bacteria 5140
621 Ga0495613_0036156 3300046689 Bacteria 3662
622 Ga0495670_0000229 3300046691 Bacteria 25517
623 Ga0495670_0013404 3300046691 Bacteria 4033
624 Ga0495670_0014792 3300046691 Bacteria 3841
625 Ga0495649_0001723 3300046694 Bacteria 16178
626 Ga0495649_0028444 3300046694 Bacteria 3098
627 Ga0495649_0127220 3300046694 Bacteria 1345
628 Ga0495589_0000610 3300046794 Bacteria 24076
629 Ga0495589_0005398 3300046794 Bacteria 6744
630 Ga0495589_0014904 3300046794 Bacteria 4000
631 Ga0495589_0015410 3300046794 Bacteria 3935
632 Ga0495589_0043427 3300046794 Bacteria 2237
633 Ga0495600_0027751 3300046809 Bacteria 3659
634 Ga0495660_0002813 3300046810 Bacteria 10948
635 Ga0495660_0008510 3300046810 Bacteria 6007
636 Ga0495581_0013715 3300047315 Bacteria 4699
637 Ga0495581_0015281 3300047315 Bacteria 4456
638 Ga0495581_0116140 3300047315 Bacteria 1556
639 Ga0495604_0002334 3300047317 Bacteria 15210
640 Ga0495604_0009084 3300047317 Bacteria 7864
641 Ga0495604_0023674 3300047317 Bacteria 4901
642 Ga0495604_0029760 3300047317 Bacteria 4343
643 Ga0495604_0039198 3300047317 Bacteria 3724
644 Ga0495604_0061766 3300047317 Bacteria 2864
645 Ga0495636_0008434 3300047318 Bacteria 4066
646 Ga0495636_0043068 3300047318 Bacteria 1877
647 Ga0495636_0070873 3300047318 Bacteria 1487
648 Ga0495674_0002692 3300047319 Bacteria 17298
649 Ga0495674_0023200 3300047319 Bacteria 5720
650 Ga0495672_0001319 3300047320 Bacteria 24677
651 Ga0495672_0001582 3300047320 Bacteria 22235
652 Ga0495672_0020626 3300047320 Bacteria 4312
653 Ga0495672_0025826 3300047320 Bacteria 3755
654 Ga0495676_0000031 3300047321 Bacteria 132364
655 Ga0495676_0000862 3300047321 Bacteria 25339
656 Ga0495676_0005345 3300047321 Bacteria 11760
657 Ga0495680_0019816 3300047322 Bacteria 5672
658 Ga0495683_0005694 3300047323 Bacteria 6883
659 Ga0495683_0018019 3300047323 Bacteria 3655
660 Ga0495683_0029973 3300047323 Bacteria 2778
661 Ga0495683_0043978 3300047323 Bacteria 2246
662 Ga0495687_001468 3300047443 Bacteria 21616
663 Ga0495687_005116 3300047443 Bacteria 8494
664 Ga0495675_0002328 3300047444 Bacteria 11351
665 Ga0495675_0010257 3300047444 Bacteria 5849
666 Ga0495675_0023769 3300047444 Bacteria 3905
667 Ga0495675_0033535 3300047444 Bacteria 3277
668 Ga0495675_0071558 3300047444 Bacteria 2188
669 Ga0495675_0119798 3300047444 Bacteria 1639
670 Ga0495677_0006349 3300047445 Bacteria 4463
671 Ga0495677_0008672 3300047445 Bacteria 3773
672 Ga0495679_009108 3300047446 Bacteria 3997
673 Ga0495685_079380 3300047447 Bacteria 1094
674 Ga0495673_0000223 3300047469 Bacteria 84150
675 Ga0495681_0000939 3300047470 Bacteria 22463
676 Ga0495681_0018579 3300047470 Bacteria 3827
677 Ga0495681_0019049 3300047470 Bacteria 3759
678 Ga0495681_0040434 3300047470 Bacteria 2270
679 Ga0495684_0064158 3300047471 Bacteria 2791
680 Ga0495684_0067687 3300047471 Bacteria 2716
681 Ga0495684_0311681 3300047471 Bacteria 1128
682 Ga0495686_0000021 3300047472 Bacteria 426560
683 Ga0495686_0002134 3300047472 Bacteria 19329
684 Ga0495686_0008657 3300047472 Bacteria 7432
685 Ga0495686_0013091 3300047472 Bacteria 5775
686 Ga0495686_0050582 3300047472 Bacteria 2611
687 Ga0495593_0004669 3300047673 Bacteria 8148
688 Ga0495593_0007232 3300047673 Bacteria 6507
689 Ga0495593_0024924 3300047673 Bacteria 3310
690 Ga0495593_0028589 3300047673 Bacteria 3062
691 Ga0495593_0060351 3300047673 Bacteria 1986
692 Ga0495602_0016473 3300048088 Bacteria 7433
693 Ga0495602_0028276 3300048088 Bacteria 5368
694 Ga0495602_0031172 3300048088 Bacteria 5045
695 Ga0495602_0086198 3300048088 Bacteria 2622
696 Ga0495614_0005393 3300048089 Bacteria 5769
697 Ga0495614_0011401 3300048089 Bacteria 3912
698 Ga0495626_0000005 3300048091 Bacteria 337534
699 Ga0495626_0015821 3300048091 Bacteria 3851
700 Ga0495626_0019890 3300048091 Bacteria 3350
701 Ga0495626_0024308 3300048091 Bacteria 2971
702 Ga0495626_0035489 3300048091 Bacteria 2380
703 Ga0495626_0040297 3300048091 Bacteria 2207
704 Ga0495626_0043398 3300048091 Bacteria 2109
705 Ga0495626_0050528 3300048091 Bacteria 1920
706 Ga0495626_0071295 3300048091 Bacteria 1562
707 Ga0496100_0011314 3300048903 Bacteria 5076
708 Ga0496100_0385481 3300048903 Bacteria 1065
709 Ga0496101_0005155 3300048904 Bacteria 8311
710 Ga0496102_0044010 3300048905 Bacteria 4049
711 Ga0496102_0093031 3300048905 Bacteria 2793
712 Ga0496102_0179800 3300048905 Bacteria 1993
713 Ga0496103_0042347 3300048906 Bacteria 2801
714 Ga0496105_0023140 3300048908 Bacteria 5038
715 Ga0496105_0102242 3300048908 Bacteria 2366
716 Ga0496106_0041301 3300048909 Bacteria 3455
717 Ga0496106_0141499 3300048909 Bacteria 1893
718 Ga0496107_0017244 3300048910 Bacteria 5078
719 Ga0496107_0050519 3300048910 Bacteria 2997
720 Ga0496108_0010303 3300048911 Bacteria 7589
721 Ga0496108_0185860 3300048911 Bacteria 1800
722 Ga0496109_0037831 3300048912 Bacteria 4361
723 Ga0496109_0326562 3300048912 Bacteria 1448
724 Ga0496109_0377124 3300048912 Bacteria 1340
725 Ga0496109_0559946 3300048912 Bacteria 1078
726 Ga0496110_0014313 3300048913 Bacteria 6582
727 Ga0496110_0035014 3300048913 Bacteria 4353
728 Ga0496110_0049348 3300048913 Bacteria 3692
729 Ga0496111_0001836 3300048914 Bacteria 12505
730 Ga0496111_0085602 3300048914 Bacteria 2305
731 Ga0496112_0001267 3300048915 Bacteria 19165
732 Ga0496112_0016434 3300048915 Bacteria 6933
733 Ga0496112_0016818 3300048915 Bacteria 6861
734 Ga0496112_0260013 3300048915 Bacteria 1685
735 Ga0496114_0045732 3300048917 Bacteria 3637
736 Ga0496115_0002726 3300048918 Bacteria 12689
737 Ga0496115_0020967 3300048918 Bacteria 5042
738 Ga0496115_0046019 3300048918 Bacteria 3485
739 Ga0496115_0064859 3300048918 Bacteria 2949
740 Ga0496117_0094846 3300048920 Bacteria 1908
741 Ga0496122_0000142 3300048925 Bacteria 168391
742 Ga0496122_0089925 3300048925 Bacteria 2097
743 Ga0496122_0155793 3300048925 Bacteria 1402
744 Ga0496123_0000148 3300048926 Bacteria 143265
745 Ga0496123_0027358 3300048926 Bacteria 4249
746 Ga0496124_0000046 3300048927 Bacteria 287043
747 Ga0496124_0381154 3300048927 Bacteria 986
748 Ga0496125_0022904 3300048928 Bacteria 5786
749 Ga0496126_0000050 3300048929 Bacteria 316466
750 Ga0495678_000256 3300049459 Bacteria 59602
751 Ga0495678_000524 3300049459 Bacteria 37449
752 Ga0495678_000732 3300049459 Bacteria 29802
753 Ga0495678_004011 3300049459 Bacteria 8782
754 Ga0495678_016975 3300049459 Bacteria 3310
755 Ga0495682_0000308 3300049460 Bacteria 36905
756 Ga0501032_0057205 3300049569 Bacteria 2620
757 Ga0501032_0090200 3300049569 Bacteria 2034
758 Ga0501033_0086063 3300049570 Bacteria 2301
759 Ga0501033_0209419 3300049570 Bacteria 1391
760 Ga0501034_0131914 3300049571 Bacteria 2481
761 Ga0501034_0178180 3300049571 Bacteria 2091
762 Ga0501034_0280811 3300049571 Bacteria 1604
763 Ga0501034_0393725 3300049571 Bacteria 1309
764 Ga0501034_0464770 3300049571 Bacteria 1182
765 Ga0501036_0013938 3300049572 Bacteria 6685
766 Ga0501036_0092149 3300049572 Bacteria 2560
767 Ga0501037_0156139 3300049573 Bacteria 1628
768 Ga0501038_0017722 3300049574 Bacteria 6436
769 Ga0501038_0060781 3300049574 Bacteria 3233
770 Ga0501038_0264471 3300049574 Bacteria 1358
771 Ga0501039_0059260 3300049575 Bacteria 2966
772 Ga0501039_0095671 3300049575 Bacteria 2315
773 Ga0501039_0110515 3300049575 Bacteria 2149
774 Ga0501042_0032063 3300049578 Bacteria 3719
775 Ga0501042_0337865 3300049578 Bacteria 1089
776 Ga0501043_0020490 3300049579 Bacteria 5188
777 Ga0501043_0051843 3300049579 Bacteria 3224
778 Ga0501043_0054164 3300049579 Bacteria 3150
779 Ga0501043_0095690 3300049579 Bacteria 2334
780 Ga0501043_0259348 3300049579 Bacteria 1337
781 Ga0501046_0071329 3300049580 Bacteria 2699
782 Ga0501046_0150064 3300049580 Bacteria 1759
783 Ga0501046_0195387 3300049580 Bacteria 1507
784 Ga0501047_0058832 3300049581 Bacteria 3712
785 Ga0501047_0061667 3300049581 Bacteria 3618
786 Ga0501047_0070748 3300049581 Bacteria 3359
787 Ga0501047_0242493 3300049581 Bacteria 1652
788 Ga0501047_0275166 3300049581 Bacteria 1529
789 Ga0501048_0100173 3300049582 Bacteria 2044
790 Ga0501048_0319774 3300049582 Bacteria 1105
791 Ga0501070_0045431 3300049586 Bacteria 3653
792 Ga0501070_0046624 3300049586 Bacteria 3604
793 Ga0501070_0050448 3300049586 Bacteria 3455
794 Ga0501070_0070803 3300049586 Bacteria 2887
795 Ga0501070_0090627 3300049586 Bacteria 2530
796 Ga0501070_0091701 3300049586 Bacteria 2514
797 Ga0501070_0163330 3300049586 Bacteria 1836
798 Ga0501072_0017620 3300049588 Bacteria 5492
799 Ga0501073_0004147 3300049589 Bacteria 10867
800 Ga0501073_0019004 3300049589 Bacteria 4965
801 Ga0501073_0023396 3300049589 Bacteria 4436
802 Ga0501074_0006780 3300049590 Bacteria 8267
803 Ga0501074_0077661 3300049590 Bacteria 2383
804 Ga0501074_0083528 3300049590 Bacteria 2290
805 Ga0501076_0245766 3300049592 Bacteria 1464
806 Ga0501257_014512 3300049686 Bacteria 1813
807 Ga0501079_0375806 3300049741 Bacteria 1114
808 Ga0501080_0029055 3300049742 Bacteria 5146
809 Ga0501080_0046968 3300049742 Bacteria 4019
810 Ga0501080_0064652 3300049742 Bacteria 3403
811 Ga0501080_0069187 3300049742 Bacteria 3283
812 Ga0501080_0111887 3300049742 Bacteria 2531
813 Ga0501080_0247844 3300049742 Bacteria 1624
814 Ga0501080_0551761 3300049742 Bacteria 1026
815 Ga0501081_0034541 3300049743 Bacteria 3441
816 Ga0501083_0000749 3300049744 Bacteria 21218
817 Ga0501083_0020618 3300049744 Bacteria 4584
818 Ga0501083_0052792 3300049744 Bacteria 2730
819 Ga0501083_0141683 3300049744 Bacteria 1574
820 Ga0501083_0149104 3300049744 Bacteria 1531
821 Ga0501269_003107 3300049766 Bacteria 2015
822 Ga0501035_0124124 3300049822 Bacteria 2255
823 Ga0501035_0173768 3300049822 Bacteria 1860
824 Ga0501044_0017691 3300049823 Bacteria 7645
825 Ga0501044_0043682 3300049823 Bacteria 4655
826 Ga0501044_0081620 3300049823 Bacteria 3272
827 Ga0501044_0101410 3300049823 Bacteria 2896
828 Ga0501044_0256423 3300049823 Bacteria 1688
829 Ga0501044_0325707 3300049823 Bacteria 1460
830 Ga0501045_0128594 3300049824 Bacteria 1883
831 Ga0501045_0148648 3300049824 Bacteria 1743
832 nmdc:mga03n38_33851_c1 3300050490 Bacteria 2177
833 nmdc:mga0yw44_282764_c1 3300050492 Bacteria 1109
834 nmdc:mga06z11_21838_c1 3300050494 Bacteria 2980
835 nmdc:mga05p37_321116_c1 3300050507 Bacteria 1833
836 nmdc:mga05p37_96330_c1 3300050507 Bacteria 3645
837 nmdc:mga09592_26300_c1 3300050508 Bacteria 4820
838 nmdc:mga0qj67_86337_c1 3300050509 Bacteria 2517
839 nmdc:mga06r32_35609_c1 3300050510 Bacteria 4697
840 nmdc:mga08y16_339701_c1 3300050511 Bacteria 1544
841 nmdc:mga08y16_456_c1 3300050511 Bacteria 38036
842 nmdc:mga0n895_152409_c1 3300050512 Bacteria 2342
843 nmdc:mga0n895_73236_c1 3300050512 Bacteria 3401
844 nmdc:mga0rr50_21985_c1 3300050513 Bacteria 4368
845 nmdc:mga08x19_209840_c1 3300050514 Bacteria 1337
846 nmdc:mga0a205_20785_c1 3300050515 Bacteria 5619
847 nmdc:mga0a205_227048_c1 3300050515 Bacteria 1752
848 Ga0495655_0027280 3300053083 Bacteria 1353
849 Ga0495655_0028742 3300053083 Bacteria 1331
850 Ga0495595_0094900 3300053084 Bacteria 1434
851 Ga0495619_0037869 3300053085 Bacteria 3145
852 Ga0495619_0203014 3300053085 Bacteria 1372
853 Ga0500578_0073503 3300053086 Bacteria 2178
854 Ga0500643_002974 3300053087 Bacteria 8394
855 Ga0500644_0009720 3300053088 Bacteria 2582
856 Ga0500566_0000273 3300053094 Bacteria 27887
857 Ga0500641_0009865 3300053096 Bacteria 3439
858 Ga0500641_0012929 3300053096 Bacteria 3058
859 Ga0500650_0003353 3300053098 Bacteria 5553
860 Ga0500553_015652 3300053101 Bacteria 3851
861 Ga0500555_012647 3300053103 Bacteria 2430
862 Ga0500556_0094566 3300053104 Bacteria 1145
863 Ga0500595_000050 3300053119 Bacteria 88696
864 Ga0500597_000191 3300053120 Bacteria 12574
865 Ga0500608_004458 3300053122 Bacteria 5428
866 Ga0500608_032876 3300053122 Bacteria 2466
867 Ga0500608_068534 3300053122 Bacteria 1689
868 Ga0500642_0001500 3300053130 Bacteria 6725
869 Ga0500652_000390 3300053131 Bacteria 15731
870 Ga0500652_086027 3300053131 Bacteria 1311
871 Ga0500658_0047555 3300053134 Bacteria 1742
872 Ga0500559_0000106 3300053136 Bacteria 65670
873 Ga0500568_0002649 3300053139 Bacteria 10390
874 Ga0500568_0002674 3300053139 Bacteria 10335
875 Ga0500588_0000462 3300053146 Bacteria 6441
876 Ga0500588_0062086 3300053146 Bacteria 1200
877 Ga0500590_022922 3300053148 Bacteria 3244
878 Ga0500604_0002621 3300053151 Bacteria 4898
879 Ga0500604_0024172 3300053151 Bacteria 1737
880 Ga0500616_0001247 3300053153 Bacteria 25504
881 Ga0500622_0000697 3300053156 Bacteria 29561
882 Ga0500622_0015301 3300053156 Bacteria 4109
883 Ga0500634_0078887 3300053161 Bacteria 1702
884 Ga0500636_0012147 3300053177 Bacteria 5043
885 Ga0500625_072208 3300053729 Bacteria 1532
886 Ga0500645_021809 3300053730 Bacteria 1974
887 Ga0500596_000127 3300053735 Bacteria 11097
888 Ga0500599_013765 3300053736 Bacteria 1097
889 Ga0501084_0250232 3300054114 Bacteria 1496
890 Ga0501084_0291171 3300054114 Bacteria 1379
891 Ga0501082_0046358 3300060353 Bacteria 3747
892 Ga0501082_0100104 3300060353 Bacteria 2507
893 Ga0501082_0152946 3300060353 Bacteria 2004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0100104 Ga0501082_0100104_1724_2497 254
2 3300046665 Ga0495661_0181494 Ga0495661_0181494_14_841 273
3 3300046535 Ga0495586_0004758 Ga0495586_0004758_6405_7238 276
4 3300003791 Ga0055530_10000180 Ga0055530_1000018021 291
5 3300003791 Ga0055530_10000371 Ga0055530_1000037123 291
6 3300003794 Ga0055531_10000844 Ga0055531_1000084425 291
7 3300025298 Ga0209050_1000034 Ga0209050_1000034373 291
8 3300025304 Ga0209257_1000052 Ga0209257_100005237 291
9 3300009551 Ga0105238_10000015 Ga0105238_1000001595 293
10 3300037471 Ga0395905_0279365 Ga0395905_0279365_309_1289 301
11 3300025929 Ga0207664_10015644 Ga0207664_100156445 304
12 3300037312 Ga0395899_0000197 Ga0395899_0000197_13593_14588 304
13 3300037418 Ga0395900_0000006 Ga0395900_0000006_188101_189096 304
14 3300037466 Ga0395898_0020812 Ga0395898_0020812_143_1138 304
15 3300037471 Ga0395905_0004212 Ga0395905_0004212_8620_9615 304
16 3300038443 Ga0395901_0000001 Ga0395901_0000001_231350_232345 304
17 3300028379 Ga0268266_10073294 Ga0268266_100732943 305
18 3300044694 Ga0466963_0052875 Ga0466963_0052875_1464_2384 306
19 3300048909 Ga0496106_0141499 Ga0496106_0141499_214_1224 306
20 3300049586 Ga0501070_0045431 Ga0501070_0045431_2406_3332 306
21 3300049742 Ga0501080_0247844 Ga0501080_0247844_499_1500 306
22 3300049822 Ga0501035_0173768 Ga0501035_0173768_607_1608 306
23 3300031456 Ga0307513_10029898 Ga0307513_100298986 307
24 iso_pu_bacteria 2767802442 2770198959 307
25 3300049766 Ga0501269_003107 Ga0501269_003107_949_1881 308
26 3300053122 Ga0500608_032876 Ga0500608_032876_431_1363 308
27 iso_pu_bacteria 8054558443 8054559917 308
28 3300005435 Ga0070714_100011159 Ga0070714_1000111597 309
29 3300009098 Ga0105245_10154098 Ga0105245_101540982 309
30 3300025224 Ga0209784_100002 Ga0209784_100002587 309
31 3300025225 Ga0209566_100003 Ga0209566_100003587 309
32 3300025226 Ga0209674_100004 Ga0209674_100004587 309
33 3300025230 Ga0209563_100006 Ga0209563_100006587 309
34 3300025253 Ga0209677_100003 Ga0209677_100003587 309
35 3300037853 Ga0436364_1558329 Ga0436364_1558329_7332_8264 309
36 3300038443 Ga0395901_0356948 Ga0395901_0356948_162_1112 309
37 3300039450 Ga0436363_0614601 Ga0436363_0614601_1825_2757 309
38 3300044901 Ga0466960_0059672 Ga0466960_0059672_400_1350 309
39 3300045836 Ga0466958_0151544 Ga0466958_0151544_174_1124 309
40 3300049823 Ga0501044_0325707 Ga0501044_0325707_476_1408 309
41 3300053134 Ga0500658_0047555 Ga0500658_0047555_61_1062 309
42 3300028794 Ga0307515_10324832 Ga0307515_103248321 310
43 3300031238 Ga0265332_10010400 Ga0265332_100104004 310
44 3300031344 Ga0265316_10048376 Ga0265316_100483763 310
45 3300037471 Ga0395905_0018788 Ga0395905_0018788_109_1044 310
46 3300039450 Ga0436363_0394091 Ga0436363_0394091_145_1080 310
47 3300046463 Ga0495653_0014171 Ga0495653_0014171_3715_4653 310
48 3300046463 Ga0495653_0058615 Ga0495653_0058615_217_1155 310
49 3300046472 Ga0495580_0017736 Ga0495580_0017736_3595_4533 310
50 3300046474 Ga0495605_0013096 Ga0495605_0013096_249_1187 310
51 3300046474 Ga0495605_0031139 Ga0495605_0031139_843_1781 310
52 3300046474 Ga0495605_0040953 Ga0495605_0040953_407_1345 310
53 3300046491 Ga0495584_0000781 Ga0495584_0000781_17372_18310 310
54 3300046491 Ga0495584_0018992 Ga0495584_0018992_246_1184 310
55 3300046499 Ga0495594_0088101 Ga0495594_0088101_575_1513 310
56 3300046500 Ga0495596_0005730 Ga0495596_0005730_2042_2980 310
57 3300046500 Ga0495596_0063786 Ga0495596_0063786_325_1263 310
58 3300046501 Ga0495607_0000876 Ga0495607_0000876_5574_6512 310
59 3300046501 Ga0495607_0023261 Ga0495607_0023261_2750_3688 310
60 3300046501 Ga0495607_0031397 Ga0495607_0031397_1668_2606 310
61 3300046506 Ga0495583_0000679 Ga0495583_0000679_21574_22512 310
62 3300046506 Ga0495583_0001028 Ga0495583_0001028_25686_26624 310
63 3300046506 Ga0495583_0015368 Ga0495583_0015368_2813_3751 310
64 3300046511 Ga0495608_0019764 Ga0495608_0019764_3639_4589 310
65 3300046513 Ga0495616_0011077 Ga0495616_0011077_2238_3176 310
66 3300046513 Ga0495616_0012884 Ga0495616_0012884_1456_2394 310
67 3300046513 Ga0495616_0088451 Ga0495616_0088451_299_1237 310
68 3300046513 Ga0495616_0090757 Ga0495616_0090757_218_1156 310
69 3300046518 Ga0495631_0009289 Ga0495631_0009289_2866_3804 310
70 3300046518 Ga0495631_0110644 Ga0495631_0110644_140_1078 310
71 3300046519 Ga0495632_0000253 Ga0495632_0000253_20413_21351 310
72 3300046519 Ga0495632_0030056 Ga0495632_0030056_451_1389 310
73 3300046520 Ga0495637_0024388 Ga0495637_0024388_986_1924 310
74 3300046522 Ga0495643_0000729 Ga0495643_0000729_12065_13003 310
75 3300046522 Ga0495643_0026408 Ga0495643_0026408_2246_3184 310
76 3300046523 Ga0495644_0005947 Ga0495644_0005947_12_950 310
77 3300046523 Ga0495644_0010053 Ga0495644_0010053_1024_1962 310
78 3300046524 Ga0495648_0030554 Ga0495648_0030554_1154_2092 310
79 3300046524 Ga0495648_0104808 Ga0495648_0104808_55_993 310
80 3300046526 Ga0495666_0001696 Ga0495666_0001696_1560_2498 310
81 3300046529 Ga0495652_0001055 Ga0495652_0001055_28494_29432 310
82 3300046531 Ga0495665_0005387 Ga0495665_0005387_5626_6564 310
83 3300046535 Ga0495586_0026453 Ga0495586_0026453_703_1641 310
84 3300046542 Ga0495597_0000439 Ga0495597_0000439_10121_11059 310
85 3300046542 Ga0495597_0002383 Ga0495597_0002383_8622_9560 310
86 3300046557 Ga0495622_0023694 Ga0495622_0023694_1883_2818 310
87 3300046557 Ga0495622_0121009 Ga0495622_0121009_25_966 310
88 3300046558 Ga0495633_0004308 Ga0495633_0004308_1391_2329 310
89 3300046616 Ga0495668_0025601 Ga0495668_0025601_279_1217 310
90 3300046642 Ga0495634_0003826 Ga0495634_0003826_6390_7328 310
91 3300046665 Ga0495661_0001513 Ga0495661_0001513_8550_9488 310
92 3300046665 Ga0495661_0010130 Ga0495661_0010130_4890_5828 310
93 3300046665 Ga0495661_0125823 Ga0495661_0125823_233_1171 310
94 3300046674 Ga0495588_0082701 Ga0495588_0082701_677_1615 310
95 3300046678 Ga0495599_0105256 Ga0495599_0105256_791_1729 310
96 3300046679 Ga0495623_0028591 Ga0495623_0028591_1698_2636 310
97 3300046689 Ga0495613_0001087 Ga0495613_0001087_2078_3013 310
98 3300046694 Ga0495649_0001723 Ga0495649_0001723_8864_9802 310
99 3300046794 Ga0495589_0000610 Ga0495589_0000610_8446_9384 310
100 3300046794 Ga0495589_0005398 Ga0495589_0005398_4890_5828 310
101 3300046794 Ga0495589_0015410 Ga0495589_0015410_34_984 310
102 3300046809 Ga0495600_0027751 Ga0495600_0027751_2529_3467 310
103 3300046810 Ga0495660_0002813 Ga0495660_0002813_320_1258 310
104 3300047317 Ga0495604_0009084 Ga0495604_0009084_771_1709 310
105 3300047318 Ga0495636_0008434 Ga0495636_0008434_1793_2731 310
106 3300047320 Ga0495672_0001319 Ga0495672_0001319_23571_24521 310
107 3300047320 Ga0495672_0025826 Ga0495672_0025826_235_1173 310
108 3300047323 Ga0495683_0018019 Ga0495683_0018019_1076_2014 310
109 3300047323 Ga0495683_0043978 Ga0495683_0043978_1045_1983 310
110 3300047443 Ga0495687_001468 Ga0495687_001468_18196_19134 310
111 3300047444 Ga0495675_0010257 Ga0495675_0010257_944_1882 310
112 3300047445 Ga0495677_0008672 Ga0495677_0008672_145_1083 310
113 3300047446 Ga0495679_009108 Ga0495679_009108_1038_1976 310
114 3300047470 Ga0495681_0019049 Ga0495681_0019049_1474_2412 310
115 3300047673 Ga0495593_0060351 Ga0495593_0060351_353_1291 310
116 3300048088 Ga0495602_0016473 Ga0495602_0016473_1119_2057 310
117 3300048091 Ga0495626_0000005 Ga0495626_0000005_290152_291090 310
118 3300048091 Ga0495626_0019890 Ga0495626_0019890_1238_2176 310
119 3300048091 Ga0495626_0024308 Ga0495626_0024308_1661_2599 310
120 3300048091 Ga0495626_0043398 Ga0495626_0043398_1148_2086 310
121 3300048091 Ga0495626_0050528 Ga0495626_0050528_910_1893 310
122 3300048905 Ga0496102_0179800 Ga0496102_0179800_254_1192 310
123 3300049459 Ga0495678_000256 Ga0495678_000256_17640_18578 310
124 3300049459 Ga0495678_000524 Ga0495678_000524_20843_21781 310
125 3300049460 Ga0495682_0000308 Ga0495682_0000308_15184_16122 310
126 3300049580 Ga0501046_0150064 Ga0501046_0150064_330_1271 310
127 3300049742 Ga0501080_0551761 Ga0501080_0551761_22_972 310
128 3300049744 Ga0501083_0000749 Ga0501083_0000749_19860_20798 310
129 3300049744 Ga0501083_0141683 Ga0501083_0141683_601_1542 310
130 3300050492 nmdc:mga0yw44_282764_c1 nmdc:mga0yw44_282764_c1_142_1077 310
131 3300053122 Ga0500608_004458 Ga0500608_004458_53_994 310
132 3300053736 Ga0500599_013765 Ga0500599_013765_12_953 310
133 3300005289 Ga0065704_10001157 Ga0065704_100011574 311
134 3300005985 Ga0081539_10000260 Ga0081539_10000260114 311
135 3300013306 Ga0163162_10063999 Ga0163162_100639992 311
136 3300021384 Ga0213876_10009202 Ga0213876_100092021 311
137 3300025924 Ga0207694_10000017 Ga0207694_10000017213 311
138 3300028381 Ga0268264_10070350 Ga0268264_100703502 311
139 3300038443 Ga0395901_0165847 Ga0395901_0165847_1334_2272 311
140 3300039437 Ga0436365_0968347 Ga0436365_0968347_927_1865 311
141 3300039437 Ga0436365_1738300 Ga0436365_1738300_1661_2599 311
142 3300039437 Ga0436365_1805460 Ga0436365_1805460_4352_5290 311
143 3300046689 Ga0495613_0006343 Ga0495613_0006343_431_1378 311
144 3300048918 Ga0496115_0064859 Ga0496115_0064859_1390_2328 311
145 3300049571 Ga0501034_0464770 Ga0501034_0464770_13_969 311
146 3300049578 Ga0501042_0337865 Ga0501042_0337865_116_1060 311
147 3300049686 Ga0501257_014512 Ga0501257_014512_683_1636 311
148 3300049743 Ga0501081_0034541 Ga0501081_0034541_2387_3331 311
149 3300050512 nmdc:mga0n895_152409_c1 nmdc:mga0n895_152409_c1_1009_1953 311
150 3300050515 nmdc:mga0a205_20785_c1 nmdc:mga0a205_20785_c1_4310_5254 311
151 3300053131 Ga0500652_086027 Ga0500652_086027_23_967 311
152 3300042005 Ga0439448_0007409 Ga0439448_0007409_218_1162 313
153 3300042012 Ga0439455_0006090 Ga0439455_0006090_291_1235 313
154 3300042533 Ga0450901_008779 Ga0450901_008779_27_971 313
155 3300046514 Ga0495618_0159371 Ga0495618_0159371_449_1393 313
156 3300046675 Ga0495657_0010913 Ga0495657_0010913_5843_6787 313
157 3300046794 Ga0495589_0014904 Ga0495589_0014904_735_1679 313
158 3300047318 Ga0495636_0043068 Ga0495636_0043068_881_1837 313
159 3300047318 Ga0495636_0070873 Ga0495636_0070873_480_1424 313
160 3300048925 Ga0496122_0155793 Ga0496122_0155793_54_1010 313
161 3300049742 Ga0501080_0069187 Ga0501080_0069187_1712_2662 313
162 3300060353 Ga0501082_0046358 Ga0501082_0046358_2600_3550 313
163 3300009036 Ga0105244_10063203 Ga0105244_100632032 314
164 3300031247 Ga0265340_10015861 Ga0265340_100158612 314
165 3300045976 Ga0466967_0053848 Ga0466967_0053848_2208_3158 314
166 3300046457 Ga0495590_0005479 Ga0495590_0005479_3403_4347 314
167 3300046542 Ga0495597_0003217 Ga0495597_0003217_5803_6747 314
168 3300046694 Ga0495649_0127220 Ga0495649_0127220_255_1199 314
169 3300047323 Ga0495683_0005694 Ga0495683_0005694_1772_2716 314
170 3300048910 Ga0496107_0050519 Ga0496107_0050519_1190_2134 314
171 3300048912 Ga0496109_0559946 Ga0496109_0559946_54_998 314
172 3300048914 Ga0496111_0001836 Ga0496111_0001836_3123_4067 314
173 3300048915 Ga0496112_0016434 Ga0496112_0016434_216_1160 314
174 3300048926 Ga0496123_0027358 Ga0496123_0027358_134_1078 314
175 3300048927 Ga0496124_0381154 Ga0496124_0381154_30_974 314
176 3300037312 Ga0395899_0000016 Ga0395899_0000016_401298_402248 315
177 3300049744 Ga0501083_0149104 Ga0501083_0149104_85_1086 316
178 3300049823 Ga0501044_0101410 Ga0501044_0101410_671_1672 316
179 3300003322 rootL2_10244431 rootL2_102444311 317
180 3300021361 Ga0213872_10100302 Ga0213872_101003022 317
181 3300039447 Ga0436361_0647556 Ga0436361_0647556_4456_5448 317
182 3300041507 Ga0451851_0679826 Ga0451851_0679826_41_1021 317
183 3300031247 Ga0265340_10011864 Ga0265340_100118644 318
184 3300046501 Ga0495607_0047494 Ga0495607_0047494_23_988 318
185 3300046506 Ga0495583_0022229 Ga0495583_0022229_1083_2048 318
186 3300048928 Ga0496125_0022904 Ga0496125_0022904_680_1645 318
187 3300053131 Ga0500652_000390 Ga0500652_000390_8250_9215 318
188 3300049586 Ga0501070_0050448 Ga0501070_0050448_932_2008 319
189 3300049590 Ga0501074_0083528 Ga0501074_0083528_827_1903 319
190 3300053735 Ga0500596_000127 Ga0500596_000127_5281_6246 319
191 3300031616 Ga0307508_10052441 Ga0307508_100524413 321
192 3300047444 Ga0495675_0033535 Ga0495675_0033535_1879_2874 321
193 3300049571 Ga0501034_0393725 Ga0501034_0393725_168_1172 321
194 3300053730 Ga0500645_021809 Ga0500645_021809_132_1124 321
195 iso_pu_bacteria 2883291878 2883295599 322
196 3300028381 Ga0268264_10229146 Ga0268264_102291462 323
197 3300028794 Ga0307515_10015071 Ga0307515_100150713 323
198 3300039447 Ga0436361_0794720 Ga0436361_0794720_19_990 323
199 3300046459 Ga0495629_0037690 Ga0495629_0037690_132_1127 323
200 3300046476 Ga0495662_0003653 Ga0495662_0003653_2890_3885 323
201 3300046689 Ga0495613_0018858 Ga0495613_0018858_517_1512 323
202 3300048911 Ga0496108_0185860 Ga0496108_0185860_775_1755 323
203 3300048912 Ga0496109_0326562 Ga0496109_0326562_262_1242 323
204 3300048913 Ga0496110_0049348 Ga0496110_0049348_2147_3127 323
205 3300048915 Ga0496112_0260013 Ga0496112_0260013_232_1212 323
206 iso_pu_bacteria 2883354860 2883358453 323
207 3300046524 Ga0495648_0011121 Ga0495648_0011121_2975_3955 324
208 3300048091 Ga0495626_0040297 Ga0495626_0040297_766_1746 324
209 iso_pu_bacteria 2509276019 2509375980 324
210 iso_pu_bacteria 2850079185 2850081901 324
211 iso_pu_bacteria 2899359706 2899360395 324
212 3300005343 Ga0070687_100033026 Ga0070687_1000330263 325
213 3300025918 Ga0207662_10023054 Ga0207662_100230543 325
214 3300028666 Ga0265336_10000664 Ga0265336_1000066418 325
215 3300028800 Ga0265338_10083232 Ga0265338_100832322 325
216 3300031239 Ga0265328_10021119 Ga0265328_100211193 325
217 3300031240 Ga0265320_10056299 Ga0265320_100562992 325
218 3300031241 Ga0265325_10016843 Ga0265325_100168432 325
219 3300031247 Ga0265340_10079455 Ga0265340_100794551 325
220 3300031344 Ga0265316_10053576 Ga0265316_100535763 325
221 3300031344 Ga0265316_10115896 Ga0265316_101158962 325
222 3300031595 Ga0265313_10009270 Ga0265313_100092704 325
223 3300031712 Ga0265342_10065193 Ga0265342_100651932 325
224 3300044693 Ga0466961_0027628 Ga0466961_0027628_874_1860 325
225 3300046474 Ga0495605_0020407 Ga0495605_0020407_493_1476 325
226 3300046491 Ga0495584_0012951 Ga0495584_0012951_404_1387 325
227 3300046528 Ga0495642_0036493 Ga0495642_0036493_301_1284 325
228 3300046616 Ga0495668_0090919 Ga0495668_0090919_198_1181 325
229 3300046794 Ga0495589_0043427 Ga0495589_0043427_492_1475 325
230 3300047323 Ga0495683_0029973 Ga0495683_0029973_132_1115 325
231 3300049586 Ga0501070_0046624 Ga0501070_0046624_2146_3159 325
232 iso_pu_bacteria 2643221614 2644088757 325
233 iso_pu_bacteria 2643221629 2644166185 325
234 iso_pu_bacteria 2643221661 2644343992 325
235 iso_pu_bacteria 2643221662 2644346810 325
236 iso_pu_bacteria 2643221666 2644368529 325
237 iso_pu_bacteria 2738541317 2738947905 325
238 iso_pu_bacteria 2913308742 2913312887 325
239 3300003781 Ga0055536_1002443 Ga0055536_100244312 326
240 3300005455 Ga0070663_100114797 Ga0070663_1001147972 326
241 3300025292 Ga0209676_1000547 Ga0209676_10005477 326
242 3300025298 Ga0209050_1014984 Ga0209050_10149843 326
243 3300049575 Ga0501039_0110515 Ga0501039_0110515_1077_2069 326
244 3300049741 Ga0501079_0375806 Ga0501079_0375806_36_1028 326
245 3300049824 Ga0501045_0128594 Ga0501045_0128594_10_1002 326
246 iso_pu_bacteria 2508501122 2509107642 326
247 iso_pu_bacteria 2510461069 2510839595 326
248 iso_pu_bacteria 2513237159 2513997787 326
249 iso_pu_bacteria 2558860100 2558868253 326
250 iso_pu_bacteria 2579778521 2579858254 326
251 iso_pu_bacteria 2582581866 2585395537 326
252 iso_pu_bacteria 2597490356 2599100367 326
253 iso_pu_bacteria 2619618881 2619855430 326
254 iso_pu_bacteria 2619619003 2620354027 326
255 iso_pu_bacteria 2643221637 2644208884 326
256 iso_pu_bacteria 2643221718 2644652414 326
257 iso_pu_bacteria 2675903060 2676487635 326
258 iso_pu_bacteria 2791355048 2792461237 326
259 iso_pu_bacteria 2791355094 2792639545 326
260 iso_pu_bacteria 2811994917 2812483263 326
261 iso_pu_bacteria 2837268691 2837271229 326
262 iso_pu_bacteria 2842521101 2842521964 326
263 iso_pu_bacteria 2842694124 2842697673 326
264 iso_pu_bacteria 2843744320 2843745306 326
265 iso_pu_bacteria 2846952575 2846956405 326
266 iso_pu_bacteria 2848858292 2848862041 326
267 iso_pu_bacteria 2849560528 2849564583 326
268 iso_pu_bacteria 2849573788 2849577694 326
269 iso_pu_bacteria 2851153111 2851155680 326
270 iso_pu_bacteria 2862290372 2862297197 326
271 iso_pu_bacteria 2873314349 2873318468 326
272 iso_pu_bacteria 2893066018 2893067222 326
273 iso_pu_bacteria 2899803654 2899804258 326
274 iso_pu_bacteria 2908756301 2908756360 326
275 iso_pu_bacteria 8003830390 8003835450 326
276 3300013105 Ga0157369_10134064 Ga0157369_101340642 327
277 3300020082 Ga0206353_10718303 Ga0206353_107183032 327
278 3300031247 Ga0265340_10000024 Ga0265340_1000002447 327
279 3300031344 Ga0265316_10010461 Ga0265316_100104619 327
280 3300049569 Ga0501032_0090200 Ga0501032_0090200_242_1315 327
281 3300049570 Ga0501033_0209419 Ga0501033_0209419_89_1075 327
282 3300049575 Ga0501039_0059260 Ga0501039_0059260_751_1824 327
283 3300049579 Ga0501043_0095690 Ga0501043_0095690_740_1735 327
284 3300049580 Ga0501046_0071329 Ga0501046_0071329_899_1885 327
285 3300049581 Ga0501047_0061667 Ga0501047_0061667_1487_2560 327
286 3300049581 Ga0501047_0275166 Ga0501047_0275166_121_1116 327
287 3300049590 Ga0501074_0077661 Ga0501074_0077661_1361_2347 327
288 3300049742 Ga0501080_0029055 Ga0501080_0029055_1074_2069 327
289 3300049744 Ga0501083_0020618 Ga0501083_0020618_3508_4500 327
290 3300054114 Ga0501084_0291171 Ga0501084_0291171_287_1282 327
291 iso_pu_bacteria 2513237104 2513719835 327
292 iso_pu_bacteria 2775506902 2776270219 327
293 iso_pu_bacteria 2775506904 2776285054 327
294 iso_pu_bacteria 2840764183 2840765932 327
295 iso_pu_bacteria 2894652903 2894654983 327
296 iso_pu_bacteria 2935777560 2935782269 327
297 iso_pu_bacteria 2989771324 2989775759 327
298 iso_pu_bacteria 3002141150 3002142490 327
299 iso_pu_bacteria 8001781756 8001786643 327
300 iso_pu_bacteria 8016530956 8016539594 327
301 iso_pu_bacteria 8016539877 8016543890 327
302 iso_pu_bacteria 8016557553 8016557837 327
303 iso_pu_bacteria 8016566248 8016569289 327
304 iso_pu_bacteria 8016595262 8016595856 327
305 iso_pu_bacteria 8016603502 8016606721 327
306 iso_pu_bacteria 8016622563 8016623367 327
307 iso_pu_bacteria 8019530166 8019530874 327
308 iso_pu_bacteria 8019538911 8019540709 327
309 iso_pu_bacteria 8019547302 8019550388 327
310 iso_pu_bacteria 8047710418 8047716355 327
311 3300003323 rootH1_10244174 rootH1_102441741 328
312 3300005355 Ga0070671_100355568 Ga0070671_1003555681 328
313 3300044706 Ga0466964_0019589 Ga0466964_0019589_43_1032 328
314 3300044706 Ga0466964_0039741 Ga0466964_0039741_598_1587 328
315 3300046460 Ga0495638_0108248 Ga0495638_0108248_507_1499 328
316 3300046616 Ga0495668_0110950 Ga0495668_0110950_143_1132 328
317 3300046648 Ga0495611_0015713 Ga0495611_0015713_547_1536 328
318 3300046694 Ga0495649_0028444 Ga0495649_0028444_1627_2619 328
319 3300049823 Ga0501044_0256423 Ga0501044_0256423_278_1288 328
320 3300053083 Ga0495655_0027280 Ga0495655_0027280_121_1119 328
321 3300053088 Ga0500644_0009720 Ga0500644_0009720_14_1006 328
322 3300053156 Ga0500622_0000697 Ga0500622_0000697_6082_7074 328
323 3300053156 Ga0500622_0015301 Ga0500622_0015301_2305_3291 328
324 iso_pu_bacteria 2751185725 2753036247 328
325 iso_pu_bacteria 2751185792 2753324118 328
326 iso_pu_bacteria 2821443989 2821447131 328
327 iso_pu_bacteria 2844533157 2844537245 328
328 3300003751 Ga0055538_1000002 Ga0055538_1000002357 329
329 3300003752 Ga0055539_1000002 Ga0055539_1000002357 329
330 3300003756 Ga0055533_1000004 Ga0055533_1000004357 329
331 3300003759 Ga0055525_1000002 Ga0055525_1000002357 329
332 3300003841 Ga0055541_1000002 Ga0055541_1000002486 329
333 3300005262 Ga0065165_1000041 Ga0065165_1000041168 329
334 3300005327 Ga0070658_10486722 Ga0070658_104867221 329
335 3300005355 Ga0070671_100148165 Ga0070671_1001481652 329
336 3300005356 Ga0070674_100058420 Ga0070674_1000584202 329
337 3300005364 Ga0070673_100043152 Ga0070673_1000431525 329
338 3300005445 Ga0070708_100001636 Ga0070708_1000016368 329
339 3300005456 Ga0070678_100067356 Ga0070678_1000673563 329
340 3300005467 Ga0070706_100078965 Ga0070706_1000789651 329
341 3300005518 Ga0070699_100108834 Ga0070699_1001088343 329
342 3300005536 Ga0070697_100018903 Ga0070697_1000189032 329
343 3300005840 Ga0068870_10027496 Ga0068870_100274962 329
344 3300005841 Ga0068863_100052519 Ga0068863_1000525192 329
345 3300006353 Ga0075370_10144723 Ga0075370_101447231 329
346 3300007076 Ga0075435_100499820 Ga0075435_1004998201 329
347 3300009101 Ga0105247_10016880 Ga0105247_100168803 329
348 3300009551 Ga0105238_10008427 Ga0105238_100084274 329
349 3300009553 Ga0105249_10152251 Ga0105249_101522512 329
350 3300013308 Ga0157375_10042148 Ga0157375_100421482 329
351 3300014325 Ga0163163_10098993 Ga0163163_100989932 329
352 3300014326 Ga0157380_10045986 Ga0157380_100459862 329
353 3300017792 Ga0163161_10068801 Ga0163161_100688011 329
354 3300025250 Ga0209026_1001674 Ga0209026_10016748 329
355 3300025304 Ga0209257_1004227 Ga0209257_10042274 329
356 3300025908 Ga0207643_10009053 Ga0207643_100090532 329
357 3300025910 Ga0207684_10174360 Ga0207684_101743602 329
358 3300025924 Ga0207694_10036175 Ga0207694_100361754 329
359 3300025938 Ga0207704_10127593 Ga0207704_101275932 329
360 3300025940 Ga0207691_10027134 Ga0207691_100271346 329
361 3300026088 Ga0207641_10019105 Ga0207641_100191056 329
362 3300026089 Ga0207648_10069754 Ga0207648_100697543 329
363 3300026121 Ga0207683_10069410 Ga0207683_100694102 329
364 3300031456 Ga0307513_10343730 Ga0307513_103437301 329
365 3300031995 Ga0307409_100145715 Ga0307409_1001457152 329
366 3300036647 Ga0316582_0062309 Ga0316582_0062309_180_1172 329
367 3300036712 Ga0316584_0104569 Ga0316584_0104569_92_1084 329
368 3300044693 Ga0466961_0051398 Ga0466961_0051398_271_1314 329
369 3300046460 Ga0495638_0070621 Ga0495638_0070621_711_1709 329
370 3300046616 Ga0495668_0140030 Ga0495668_0140030_237_1229 329
371 3300047472 Ga0495686_0013091 Ga0495686_0013091_1655_2647 329
372 3300047472 Ga0495686_0050582 Ga0495686_0050582_691_1689 329
373 3300049569 Ga0501032_0057205 Ga0501032_0057205_333_1355 329
374 3300049570 Ga0501033_0086063 Ga0501033_0086063_631_1653 329
375 3300049571 Ga0501034_0280811 Ga0501034_0280811_467_1489 329
376 3300049572 Ga0501036_0013938 Ga0501036_0013938_2008_3030 329
377 3300049572 Ga0501036_0092149 Ga0501036_0092149_133_1125 329
378 3300049573 Ga0501037_0156139 Ga0501037_0156139_107_1153 329
379 3300049574 Ga0501038_0017722 Ga0501038_0017722_4764_5786 329
380 3300049574 Ga0501038_0060781 Ga0501038_0060781_148_1194 329
381 3300049575 Ga0501039_0095671 Ga0501039_0095671_800_1792 329
382 3300049578 Ga0501042_0032063 Ga0501042_0032063_1828_2850 329
383 3300049579 Ga0501043_0020490 Ga0501043_0020490_2137_3183 329
384 3300049579 Ga0501043_0054164 Ga0501043_0054164_1269_2291 329
385 3300049580 Ga0501046_0195387 Ga0501046_0195387_44_1066 329
386 3300049581 Ga0501047_0058832 Ga0501047_0058832_624_1670 329
387 3300049581 Ga0501047_0242493 Ga0501047_0242493_165_1187 329
388 3300049582 Ga0501048_0100173 Ga0501048_0100173_980_1972 329
389 3300049582 Ga0501048_0319774 Ga0501048_0319774_33_1055 329
390 3300049586 Ga0501070_0090627 Ga0501070_0090627_1242_2288 329
391 3300049586 Ga0501070_0091701 Ga0501070_0091701_144_1166 329
392 3300049588 Ga0501072_0017620 Ga0501072_0017620_4302_5315 329
393 3300049589 Ga0501073_0004147 Ga0501073_0004147_745_1767 329
394 3300049589 Ga0501073_0023396 Ga0501073_0023396_1194_2195 329
395 3300049590 Ga0501074_0006780 Ga0501074_0006780_366_1388 329
396 3300049742 Ga0501080_0046968 Ga0501080_0046968_1845_2867 329
397 3300049742 Ga0501080_0064652 Ga0501080_0064652_646_1647 329
398 3300049744 Ga0501083_0052792 Ga0501083_0052792_218_1240 329
399 3300049822 Ga0501035_0124124 Ga0501035_0124124_1157_2158 329
400 3300049823 Ga0501044_0017691 Ga0501044_0017691_3945_4967 329
401 3300049824 Ga0501045_0148648 Ga0501045_0148648_98_1090 329
402 3300050511 nmdc:mga08y16_339701_c1 nmdc:mga08y16_339701_c1_202_1194 329
403 3300053096 Ga0500641_0012929 Ga0500641_0012929_1201_2199 329
404 3300053153 Ga0500616_0001247 Ga0500616_0001247_15153_16151 329
405 3300054114 Ga0501084_0250232 Ga0501084_0250232_258_1280 329
406 3300060353 Ga0501082_0152946 Ga0501082_0152946_332_1354 329
407 iso_pu_bacteria 2643221601 2644019731 329
408 iso_pu_bacteria 2643221631 2644180379 329
409 iso_pu_bacteria 2767802112 2768647398 329
410 iso_pu_bacteria 2857542790 2857547099 329
411 iso_pu_bacteria 3006493962 3006501053 329
412 3300002075 JGI24738J21930_10002057 JGI24738J21930_100020572 330
413 3300002077 JGI24744J21845_10020508 JGI24744J21845_100205082 330
414 3300003187 JGI25151J46595_10003611 JGI25151J46595_100036115 330
415 3300003203 JGI25406J46586_10003682 JGI25406J46586_100036827 330
416 3300003215 JGI25153J46596_10000059 JGI25153J46596_1000005918 330
417 3300003215 JGI25153J46596_10000347 JGI25153J46596_1000034729 330
418 3300003316 rootH1_10039975 rootH1_100399753 330
419 3300003322 rootL2_10042670 rootL2_100426703 330
420 3300003775 Ga0055524_1003285 Ga0055524_10032854 330
421 3300003790 Ga0055528_1003718 Ga0055528_10037183 330
422 3300003794 Ga0055531_10020550 Ga0055531_100205503 330
423 3300005327 Ga0070658_10023456 Ga0070658_100234563 330
424 3300005328 Ga0070676_10005433 Ga0070676_100054337 330
425 3300005329 Ga0070683_100044156 Ga0070683_1000441563 330
426 3300005329 Ga0070683_100543434 Ga0070683_1005434341 330
427 3300005330 Ga0070690_100000353 Ga0070690_1000003533 330
428 3300005331 Ga0070670_100022096 Ga0070670_1000220964 330
429 3300005336 Ga0070680_100040786 Ga0070680_1000407863 330
430 3300005337 Ga0070682_100002246 Ga0070682_10000224611 330
431 3300005338 Ga0068868_100016065 Ga0068868_1000160654 330
432 3300005339 Ga0070660_100001656 Ga0070660_1000016565 330
433 3300005340 Ga0070689_100001225 Ga0070689_10000122510 330
434 3300005341 Ga0070691_10000400 Ga0070691_100004004 330
435 3300005343 Ga0070687_100000797 Ga0070687_1000007978 330
436 3300005344 Ga0070661_100000384 Ga0070661_10000038425 330
437 3300005345 Ga0070692_10005510 Ga0070692_100055101 330
438 3300005347 Ga0070668_100000244 Ga0070668_10000024425 330
439 3300005353 Ga0070669_100005644 Ga0070669_1000056444 330
440 3300005354 Ga0070675_100010071 Ga0070675_1000100714 330
441 3300005355 Ga0070671_100015311 Ga0070671_1000153114 330
442 3300005356 Ga0070674_100004514 Ga0070674_1000045148 330
443 3300005356 Ga0070674_100151898 Ga0070674_1001518981 330
444 3300005364 Ga0070673_100001304 Ga0070673_10000130415 330
445 3300005366 Ga0070659_100001838 Ga0070659_10000183814 330
446 3300005367 Ga0070667_100038589 Ga0070667_1000385893 330
447 3300005406 Ga0070703_10074344 Ga0070703_100743441 330
448 3300005434 Ga0070709_10002721 Ga0070709_1000272111 330
449 3300005435 Ga0070714_100034133 Ga0070714_1000341333 330
450 3300005436 Ga0070713_100014713 Ga0070713_1000147136 330
451 3300005436 Ga0070713_100177568 Ga0070713_1001775684 330
452 3300005437 Ga0070710_10000631 Ga0070710_100006313 330
453 3300005438 Ga0070701_10000411 Ga0070701_100004112 330
454 3300005439 Ga0070711_100012991 Ga0070711_1000129913 330
455 3300005440 Ga0070705_100003021 Ga0070705_1000030211 330
456 3300005441 Ga0070700_100006086 Ga0070700_1000060865 330
457 3300005444 Ga0070694_100009526 Ga0070694_1000095264 330
458 3300005455 Ga0070663_100002295 Ga0070663_1000022951 330
459 3300005456 Ga0070678_100001330 Ga0070678_10000133010 330
460 3300005457 Ga0070662_100001264 Ga0070662_10000126411 330
461 3300005458 Ga0070681_10087479 Ga0070681_100874793 330
462 3300005459 Ga0068867_100009543 Ga0068867_1000095433 330
463 3300005535 Ga0070684_100006348 Ga0070684_1000063487 330
464 3300005536 Ga0070697_100000600 Ga0070697_10000060016 330
465 3300005539 Ga0068853_100002094 Ga0068853_10000209411 330
466 3300005543 Ga0070672_100000593 Ga0070672_10000059317 330
467 3300005544 Ga0070686_100008356 Ga0070686_1000083563 330
468 3300005545 Ga0070695_100019548 Ga0070695_1000195481 330
469 3300005546 Ga0070696_100009212 Ga0070696_1000092121 330
470 3300005547 Ga0070693_100002402 Ga0070693_1000024027 330
471 3300005548 Ga0070665_100010157 Ga0070665_1000101575 330
472 3300005548 Ga0070665_100193817 Ga0070665_1001938172 330
473 3300005549 Ga0070704_100001660 Ga0070704_1000016604 330
474 3300005563 Ga0068855_100000893 Ga0068855_1000008933 330
475 3300005564 Ga0070664_100001131 Ga0070664_10000113111 330
476 3300005577 Ga0068857_100004274 Ga0068857_10000427412 330
477 3300005578 Ga0068854_100004366 Ga0068854_1000043664 330
478 3300005614 Ga0068856_100002475 Ga0068856_1000024753 330
479 3300005615 Ga0070702_100002170 Ga0070702_1000021705 330
480 3300005616 Ga0068852_100001835 Ga0068852_1000018355 330
481 3300005617 Ga0068859_100039295 Ga0068859_1000392954 330
482 3300005618 Ga0068864_100009139 Ga0068864_1000091395 330
483 3300005718 Ga0068866_10000716 Ga0068866_100007164 330
484 3300005719 Ga0068861_100002260 Ga0068861_1000022603 330
485 3300005834 Ga0068851_10110910 Ga0068851_101109102 330
486 3300005841 Ga0068863_100006545 Ga0068863_1000065456 330
487 3300005842 Ga0068858_100002708 Ga0068858_1000027082 330
488 3300005843 Ga0068860_100001510 Ga0068860_1000015102 330
489 3300005844 Ga0068862_100001549 Ga0068862_10000154910 330
490 3300005844 Ga0068862_100037119 Ga0068862_1000371195 330
491 3300005937 Ga0081455_10160346 Ga0081455_101603461 330
492 3300005985 Ga0081539_10002379 Ga0081539_1000237911 330
493 3300005985 Ga0081539_10004993 Ga0081539_100049938 330
494 3300006038 Ga0075365_10020608 Ga0075365_100206084 330
495 3300006038 Ga0075365_10027832 Ga0075365_100278322 330
496 3300006038 Ga0075365_10090639 Ga0075365_100906392 330
497 3300006051 Ga0075364_10060179 Ga0075364_100601793 330
498 3300006163 Ga0070715_10001549 Ga0070715_100015495 330
499 3300006173 Ga0070716_100003352 Ga0070716_1000033523 330
500 3300006175 Ga0070712_100010677 Ga0070712_1000106774 330
501 3300006237 Ga0097621_100140530 Ga0097621_1001405303 330
502 3300006358 Ga0068871_100029996 Ga0068871_1000299963 330
503 3300006844 Ga0075428_100060512 Ga0075428_1000605125 330
504 3300006846 Ga0075430_100255262 Ga0075430_1002552622 330
505 3300006847 Ga0075431_100211576 Ga0075431_1002115762 330
506 3300006852 Ga0075433_10016953 Ga0075433_100169535 330
507 3300006852 Ga0075433_10043589 Ga0075433_100435893 330
508 3300006880 Ga0075429_100019359 Ga0075429_1000193595 330
509 3300006881 Ga0068865_100000336 Ga0068865_10000033617 330
510 3300006914 Ga0075436_100034897 Ga0075436_1000348974 330
511 3300006931 Ga0097620_100039295 Ga0097620_1000392954 330
512 3300007076 Ga0075435_100029485 Ga0075435_1000294853 330
513 3300009093 Ga0105240_10103548 Ga0105240_101035483 330
514 3300009094 Ga0111539_10155560 Ga0111539_101555603 330
515 3300009098 Ga0105245_10000688 Ga0105245_1000068826 330
516 3300009101 Ga0105247_10009820 Ga0105247_100098202 330
517 3300009148 Ga0105243_10000473 Ga0105243_1000047329 330
518 3300009174 Ga0105241_10002593 Ga0105241_100025939 330
519 3300009176 Ga0105242_10000217 Ga0105242_1000021724 330
520 3300009177 Ga0105248_10000487 Ga0105248_1000048722 330
521 3300009545 Ga0105237_10000638 Ga0105237_1000063825 330
522 3300009551 Ga0105238_10219096 Ga0105238_102190963 330
523 3300009553 Ga0105249_10001143 Ga0105249_1000114317 330
524 3300010159 Ga0099796_10003661 Ga0099796_100036613 330
525 3300010375 Ga0105239_10004376 Ga0105239_1000437614 330
526 3300011119 Ga0105246_10000451 Ga0105246_100004512 330
527 3300013100 Ga0157373_10027812 Ga0157373_100278123 330
528 3300013105 Ga0157369_10001385 Ga0157369_100013853 330
529 3300013296 Ga0157374_10004977 Ga0157374_100049777 330
530 3300013296 Ga0157374_10027795 Ga0157374_100277957 330
531 3300013297 Ga0157378_10001026 Ga0157378_1000102626 330
532 3300013306 Ga0163162_10000935 Ga0163162_1000093516 330
533 3300013307 Ga0157372_10003142 Ga0157372_1000314214 330
534 3300013308 Ga0157375_10012343 Ga0157375_100123435 330
535 3300014325 Ga0163163_10040262 Ga0163163_100402623 330
536 3300014326 Ga0157380_10001124 Ga0157380_1000112413 330
537 3300014745 Ga0157377_10000791 Ga0157377_100007918 330
538 3300014968 Ga0157379_10006054 Ga0157379_100060548 330
539 3300014969 Ga0157376_10000510 Ga0157376_1000051015 330
540 3300017792 Ga0163161_10025207 Ga0163161_100252073 330
541 3300021321 Ga0214542_1018224 Ga0214542_10182242 330
542 3300021327 Ga0214543_1000134 Ga0214543_100013420 330
543 3300021377 Ga0213874_10046082 Ga0213874_100460821 330
544 3300025258 Ga0209129_1000689 Ga0209129_10006899 330
545 3300025273 Ga0209673_1000010 Ga0209673_1000010358 330
546 3300025273 Ga0209673_1040467 Ga0209673_10404672 330
547 3300025294 Ga0209025_1001742 Ga0209025_100174215 330
548 3300025294 Ga0209025_1024299 Ga0209025_10242994 330
549 3300025295 Ga0209564_1007507 Ga0209564_10075071 330
550 3300025297 Ga0209758_1000095 Ga0209758_1000095214 330
551 3300025297 Ga0209758_1030482 Ga0209758_10304822 330
552 3300025298 Ga0209050_1004401 Ga0209050_10044016 330
553 3300025299 Ga0209256_1001682 Ga0209256_10016829 330
554 3300025299 Ga0209256_1009580 Ga0209256_10095802 330
555 3300025303 Ga0209051_1015616 Ga0209051_10156164 330
556 3300025303 Ga0209051_1024871 Ga0209051_10248712 330
557 3300025304 Ga0209257_1000477 Ga0209257_100047720 330
558 3300025304 Ga0209257_1019432 Ga0209257_10194322 330
559 3300025321 Ga0207656_10078840 Ga0207656_100788401 330
560 3300025900 Ga0207710_10006089 Ga0207710_100060893 330
561 3300025903 Ga0207680_10006249 Ga0207680_100062492 330
562 3300025904 Ga0207647_10003873 Ga0207647_100038733 330
563 3300025906 Ga0207699_10010704 Ga0207699_100107043 330
564 3300025907 Ga0207645_10001040 Ga0207645_100010401 330
565 3300025909 Ga0207705_10018281 Ga0207705_100182813 330
566 3300025912 Ga0207707_10054439 Ga0207707_100544393 330
567 3300025914 Ga0207671_10048751 Ga0207671_100487511 330
568 3300025915 Ga0207693_10000278 Ga0207693_1000027822 330
569 3300025916 Ga0207663_10002954 Ga0207663_100029543 330
570 3300025917 Ga0207660_10042397 Ga0207660_100423973 330
571 3300025918 Ga0207662_10005916 Ga0207662_100059164 330
572 3300025919 Ga0207657_10000047 Ga0207657_1000004724 330
573 3300025931 Ga0207644_10034679 Ga0207644_100346793 330
574 3300025933 Ga0207706_10000079 Ga0207706_1000007978 330
575 3300025934 Ga0207686_10016824 Ga0207686_100168243 330
576 3300025935 Ga0207709_10023947 Ga0207709_100239473 330
577 3300025937 Ga0207669_10009273 Ga0207669_100092733 330
578 3300025938 Ga0207704_10016264 Ga0207704_100162643 330
579 3300025939 Ga0207665_10000432 Ga0207665_100004324 330
580 3300025940 Ga0207691_10007711 Ga0207691_100077119 330
581 3300025941 Ga0207711_10051163 Ga0207711_100511633 330
582 3300025944 Ga0207661_10030887 Ga0207661_100308873 330
583 3300025960 Ga0207651_10019716 Ga0207651_100197162 330
584 3300025972 Ga0207668_10004345 Ga0207668_100043453 330
585 3300025981 Ga0207640_10007564 Ga0207640_100075644 330
586 3300025986 Ga0207658_10445490 Ga0207658_104454901 330
587 3300026041 Ga0207639_10005055 Ga0207639_100050553 330
588 3300026067 Ga0207678_10000111 Ga0207678_1000011122 330
589 3300026075 Ga0207708_10000526 Ga0207708_1000052612 330
590 3300026088 Ga0207641_10428767 Ga0207641_104287671 330
591 3300026089 Ga0207648_10011260 Ga0207648_100112609 330
592 3300026095 Ga0207676_10060990 Ga0207676_100609903 330
593 3300026116 Ga0207674_10001475 Ga0207674_1000147516 330
594 3300026118 Ga0207675_100018149 Ga0207675_1000181493 330
595 3300026121 Ga0207683_10000026 Ga0207683_1000002686 330
596 3300027907 Ga0207428_10097474 Ga0207428_100974743 330
597 3300028379 Ga0268266_10021536 Ga0268266_100215363 330
598 3300028380 Ga0268265_10001620 Ga0268265_1000162017 330
599 3300028381 Ga0268264_10018500 Ga0268264_100185003 330
600 3300028786 Ga0307517_10131954 Ga0307517_101319541 330
601 3300028794 Ga0307515_10123046 Ga0307515_101230463 330
602 3300031239 Ga0265328_10029163 Ga0265328_100291631 330
603 3300031247 Ga0265340_10011993 Ga0265340_100119935 330
604 3300031249 Ga0265339_10001398 Ga0265339_1000139810 330
605 3300031344 Ga0265316_10223758 Ga0265316_102237582 330
606 3300031456 Ga0307513_10174035 Ga0307513_101740353 330
607 3300031456 Ga0307513_10200611 Ga0307513_102006111 330
608 3300031507 Ga0307509_10263464 Ga0307509_102634642 330
609 3300031649 Ga0307514_10037737 Ga0307514_100377374 330
610 3300031711 Ga0265314_10029466 Ga0265314_100294663 330
611 3300031730 Ga0307516_10014197 Ga0307516_100141974 330
612 3300031731 Ga0307405_10033749 Ga0307405_100337492 330
613 3300031995 Ga0307409_100013759 Ga0307409_1000137593 330
614 3300031995 Ga0307409_100268444 Ga0307409_1002684442 330
615 3300032002 Ga0307416_100200071 Ga0307416_1002000712 330
616 3300032126 Ga0307415_100204657 Ga0307415_1002046572 330
617 3300035117 Ga0373953_0004923 Ga0373953_0004923_187_1212 330
618 3300035118 Ga0373954_0018234 Ga0373954_0018234_332_1357 330
619 3300035119 Ga0373956_0063556 Ga0373956_0063556_411_1436 330
620 3300035120 Ga0373957_0014754 Ga0373957_0014754_56_1081 330
621 3300035121 Ga0373960_0066121 Ga0373960_0066121_78_1082 330
622 3300035410 Ga0373924_0049670 Ga0373924_0049670_198_1223 330
623 3300035691 Ga0373931_0004176 Ga0373931_0004176_2978_3982 330
624 3300035724 Ga0373933_0140324 Ga0373933_0140324_401_1426 330
625 3300036712 Ga0316584_0106033 Ga0316584_0106033_750_1745 330
626 3300037312 Ga0395899_0032059 Ga0395899_0032059_1391_2401 330
627 3300037312 Ga0395899_0227247 Ga0395899_0227247_168_1172 330
628 3300037418 Ga0395900_0093038 Ga0395900_0093038_1093_2097 330
629 3300037466 Ga0395898_0174874 Ga0395898_0174874_919_1923 330
630 3300037471 Ga0395905_0030180 Ga0395905_0030180_2858_3868 330
631 3300037471 Ga0395905_0123707 Ga0395905_0123707_205_1209 330
632 3300038443 Ga0395901_0000683 Ga0395901_0000683_14930_15934 330
633 3300039450 Ga0436363_0338474 Ga0436363_0338474_268_1332 330
634 3300039450 Ga0436363_1644309 Ga0436363_1644309_2565_3569 330
635 3300041404 Ga0439436_0001143 Ga0439436_0001143_4604_5599 330
636 3300041407 Ga0439447_023052 Ga0439447_023052_285_1280 330
637 3300041413 Ga0439465_0003975 Ga0439465_0003975_2652_3647 330
638 3300042007 Ga0439449_0071515 Ga0439449_0071515_95_1093 330
639 3300044765 Ga0466970_0079792 Ga0466970_0079792_408_1436 330
640 3300044842 Ga0466957_0040230 Ga0466957_0040230_485_1531 330
641 3300045836 Ga0466958_0010420 Ga0466958_0010420_1063_2061 330
642 3300046452 Ga0495617_017169 Ga0495617_017169_286_1284 330
643 3300046453 Ga0495627_002901 Ga0495627_002901_3774_4772 330
644 3300046453 Ga0495627_020006 Ga0495627_020006_739_1737 330
645 3300046454 Ga0495592_0036867 Ga0495592_0036867_2335_3330 330
646 3300046455 Ga0495603_0029320 Ga0495603_0029320_50_1048 330
647 3300046457 Ga0495590_0000056 Ga0495590_0000056_45272_46270 330
648 3300046457 Ga0495590_0000181 Ga0495590_0000181_30671_31669 330
649 3300046459 Ga0495629_0051449 Ga0495629_0051449_211_1236 330
650 3300046460 Ga0495638_0000170 Ga0495638_0000170_78676_79674 330
651 3300046462 Ga0495651_0146244 Ga0495651_0146244_91_1116 330
652 3300046463 Ga0495653_0023047 Ga0495653_0023047_2779_3777 330
653 3300046471 Ga0495650_0001692 Ga0495650_0001692_9174_10172 330
654 3300046473 Ga0495582_0003999 Ga0495582_0003999_7129_8127 330
655 3300046474 Ga0495605_0024308 Ga0495605_0024308_307_1317 330
656 3300046475 Ga0495639_0027004 Ga0495639_0027004_71_1069 330
657 3300046476 Ga0495662_0098107 Ga0495662_0098107_349_1356 330
658 3300046477 Ga0495664_0030585 Ga0495664_0030585_81_1106 330
659 3300046491 Ga0495584_0004084 Ga0495584_0004084_2568_3578 330
660 3300046491 Ga0495584_0018413 Ga0495584_0018413_714_1712 330
661 3300046491 Ga0495584_0028938 Ga0495584_0028938_1124_2122 330
662 3300046491 Ga0495584_0055763 Ga0495584_0055763_338_1348 330
663 3300046492 Ga0495585_0001585 Ga0495585_0001585_16492_17490 330
664 3300046492 Ga0495585_0003957 Ga0495585_0003957_6374_7372 330
665 3300046492 Ga0495585_0007730 Ga0495585_0007730_1745_2743 330
666 3300046492 Ga0495585_0073955 Ga0495585_0073955_287_1285 330
667 3300046499 Ga0495594_0005242 Ga0495594_0005242_3849_4847 330
668 3300046499 Ga0495594_0057786 Ga0495594_0057786_115_1110 330
669 3300046500 Ga0495596_0005838 Ga0495596_0005838_874_1872 330
670 3300046500 Ga0495596_0009329 Ga0495596_0009329_1140_2138 330
671 3300046500 Ga0495596_0011210 Ga0495596_0011210_1078_2076 330
672 3300046500 Ga0495596_0021074 Ga0495596_0021074_378_1376 330
673 3300046501 Ga0495607_0008486 Ga0495607_0008486_5857_6867 330
674 3300046501 Ga0495607_0024504 Ga0495607_0024504_1115_2113 330
675 3300046501 Ga0495607_0055921 Ga0495607_0055921_972_1970 330
676 3300046506 Ga0495583_0000417 Ga0495583_0000417_48146_49144 330
677 3300046507 Ga0495606_0000149 Ga0495606_0000149_5700_6701 330
678 3300046513 Ga0495616_0015409 Ga0495616_0015409_1802_2800 330
679 3300046514 Ga0495618_0012897 Ga0495618_0012897_2131_3156 330
680 3300046516 Ga0495628_0010616 Ga0495628_0010616_3883_4908 330
681 3300046516 Ga0495628_0195200 Ga0495628_0195200_49_1044 330
682 3300046517 Ga0495630_0111574 Ga0495630_0111574_141_1166 330
683 3300046518 Ga0495631_0012663 Ga0495631_0012663_1227_2225 330
684 3300046519 Ga0495632_0000311 Ga0495632_0000311_21487_22485 330
685 3300046519 Ga0495632_0000365 Ga0495632_0000365_29173_30171 330
686 3300046522 Ga0495643_0000302 Ga0495643_0000302_22469_23467 330
687 3300046523 Ga0495644_0006899 Ga0495644_0006899_3248_4246 330
688 3300046524 Ga0495648_0000119 Ga0495648_0000119_38097_39095 330
689 3300046526 Ga0495666_0003516 Ga0495666_0003516_3600_4598 330
690 3300046528 Ga0495642_0001135 Ga0495642_0001135_5804_6802 330
691 3300046528 Ga0495642_0025039 Ga0495642_0025039_752_1762 330
692 3300046529 Ga0495652_0017628 Ga0495652_0017628_2212_3237 330
693 3300046529 Ga0495652_0071737 Ga0495652_0071737_1028_2023 330
694 3300046530 Ga0495654_0005778 Ga0495654_0005778_4964_5974 330
695 3300046533 Ga0495640_0004953 Ga0495640_0004953_1164_2162 330
696 3300046533 Ga0495640_0033080 Ga0495640_0033080_945_1940 330
697 3300046535 Ga0495586_0001960 Ga0495586_0001960_3996_4994 330
698 3300046538 Ga0495609_0001674 Ga0495609_0001674_9005_10012 330
699 3300046538 Ga0495609_0038896 Ga0495609_0038896_963_1973 330
700 3300046542 Ga0495597_0000123 Ga0495597_0000123_22139_23137 330
701 3300046542 Ga0495597_0000127 Ga0495597_0000127_18519_19517 330
702 3300046542 Ga0495597_0004061 Ga0495597_0004061_6865_7875 330
703 3300046543 Ga0495645_0046359 Ga0495645_0046359_2122_3147 330
704 3300046557 Ga0495622_0000480 Ga0495622_0000480_2254_3252 330
705 3300046558 Ga0495633_0000088 Ga0495633_0000088_87623_88621 330
706 3300046558 Ga0495633_0003948 Ga0495633_0003948_2253_3251 330
707 3300046558 Ga0495633_0004365 Ga0495633_0004365_3773_4771 330
708 3300046559 Ga0495667_0022019 Ga0495667_0022019_3049_4074 330
709 3300046616 Ga0495668_0000460 Ga0495668_0000460_18172_19170 330
710 3300046616 Ga0495668_0001529 Ga0495668_0001529_17479_18489 330
711 3300046616 Ga0495668_0025818 Ga0495668_0025818_496_1494 330
712 3300046616 Ga0495668_0052708 Ga0495668_0052708_178_1176 330
713 3300046616 Ga0495668_0076011 Ga0495668_0076011_797_1795 330
714 3300046642 Ga0495634_0029265 Ga0495634_0029265_1175_2170 330
715 3300046642 Ga0495634_0076175 Ga0495634_0076175_514_1539 330
716 3300046648 Ga0495611_0000793 Ga0495611_0000793_2832_3830 330
717 3300046648 Ga0495611_0055740 Ga0495611_0055740_152_1150 330
718 3300046660 Ga0495625_0002200 Ga0495625_0002200_16916_17914 330
719 3300046660 Ga0495625_0002701 Ga0495625_0002701_15590_16588 330
720 3300046660 Ga0495625_0084561 Ga0495625_0084561_238_1239 330
721 3300046663 Ga0495635_0024224 Ga0495635_0024224_2645_3643 330
722 3300046663 Ga0495635_0039975 Ga0495635_0039975_61_1086 330
723 3300046665 Ga0495661_0000923 Ga0495661_0000923_14871_15869 330
724 3300046675 Ga0495657_0100431 Ga0495657_0100431_86_1081 330
725 3300046675 Ga0495657_0173736 Ga0495657_0173736_199_1224 330
726 3300046678 Ga0495599_0008650 Ga0495599_0008650_2962_3987 330
727 3300046680 Ga0495646_0096780 Ga0495646_0096780_666_1664 330
728 3300046684 Ga0495669_0000479 Ga0495669_0000479_16471_17469 330
729 3300046684 Ga0495669_0004096 Ga0495669_0004096_3901_4899 330
730 3300046689 Ga0495613_0002547 Ga0495613_0002547_7078_8073 330
731 3300046689 Ga0495613_0014884 Ga0495613_0014884_954_1952 330
732 3300046689 Ga0495613_0036156 Ga0495613_0036156_2134_3132 330
733 3300046691 Ga0495670_0000229 Ga0495670_0000229_16085_17083 330
734 3300046691 Ga0495670_0013404 Ga0495670_0013404_2042_3040 330
735 3300046691 Ga0495670_0014792 Ga0495670_0014792_701_1699 330
736 3300046810 Ga0495660_0008510 Ga0495660_0008510_2760_3758 330
737 3300047315 Ga0495581_0015281 Ga0495581_0015281_2703_3701 330
738 3300047315 Ga0495581_0116140 Ga0495581_0116140_506_1501 330
739 3300047317 Ga0495604_0002334 Ga0495604_0002334_2462_3469 330
740 3300047317 Ga0495604_0023674 Ga0495604_0023674_3656_4666 330
741 3300047317 Ga0495604_0029760 Ga0495604_0029760_1418_2413 330
742 3300047317 Ga0495604_0039198 Ga0495604_0039198_2420_3418 330
743 3300047317 Ga0495604_0061766 Ga0495604_0061766_1469_2494 330
744 3300047319 Ga0495674_0023200 Ga0495674_0023200_2367_3392 330
745 3300047320 Ga0495672_0001582 Ga0495672_0001582_10990_12000 330
746 3300047321 Ga0495676_0000031 Ga0495676_0000031_17629_18627 330
747 3300047321 Ga0495676_0005345 Ga0495676_0005345_1670_2665 330
748 3300047322 Ga0495680_0019816 Ga0495680_0019816_466_1491 330
749 3300047444 Ga0495675_0002328 Ga0495675_0002328_2878_3876 330
750 3300047444 Ga0495675_0023769 Ga0495675_0023769_1701_2726 330
751 3300047444 Ga0495675_0071558 Ga0495675_0071558_493_1500 330
752 3300047445 Ga0495677_0006349 Ga0495677_0006349_2929_3927 330
753 3300047447 Ga0495685_079380 Ga0495685_079380_58_1056 330
754 3300047470 Ga0495681_0000939 Ga0495681_0000939_5959_6957 330
755 3300047470 Ga0495681_0018579 Ga0495681_0018579_1467_2465 330
756 3300047470 Ga0495681_0040434 Ga0495681_0040434_168_1169 330
757 3300047471 Ga0495684_0064158 Ga0495684_0064158_1626_2651 330
758 3300047471 Ga0495684_0311681 Ga0495684_0311681_89_1084 330
759 3300047673 Ga0495593_0007232 Ga0495593_0007232_470_1468 330
760 3300047673 Ga0495593_0024924 Ga0495593_0024924_730_1728 330
761 3300048088 Ga0495602_0028276 Ga0495602_0028276_4092_5117 330
762 3300048089 Ga0495614_0005393 Ga0495614_0005393_4665_5663 330
763 3300048091 Ga0495626_0015821 Ga0495626_0015821_334_1332 330
764 3300048091 Ga0495626_0035489 Ga0495626_0035489_616_1617 330
765 3300048091 Ga0495626_0071295 Ga0495626_0071295_422_1420 330
766 3300048903 Ga0496100_0011314 Ga0496100_0011314_2014_3018 330
767 3300048904 Ga0496101_0005155 Ga0496101_0005155_5334_6338 330
768 3300048905 Ga0496102_0044010 Ga0496102_0044010_2885_3889 330
769 3300048906 Ga0496103_0042347 Ga0496103_0042347_547_1551 330
770 3300048908 Ga0496105_0023140 Ga0496105_0023140_2187_3191 330
771 3300048909 Ga0496106_0041301 Ga0496106_0041301_153_1157 330
772 3300048910 Ga0496107_0017244 Ga0496107_0017244_2059_3063 330
773 3300048911 Ga0496108_0010303 Ga0496108_0010303_2389_3393 330
774 3300048912 Ga0496109_0377124 Ga0496109_0377124_258_1253 330
775 3300048913 Ga0496110_0014313 Ga0496110_0014313_4456_5460 330
776 3300048913 Ga0496110_0035014 Ga0496110_0035014_1930_2925 330
777 3300048915 Ga0496112_0001267 Ga0496112_0001267_12878_13873 330
778 3300048915 Ga0496112_0016818 Ga0496112_0016818_195_1199 330
779 3300048917 Ga0496114_0045732 Ga0496114_0045732_490_1494 330
780 3300048918 Ga0496115_0002726 Ga0496115_0002726_10615_11613 330
781 3300048918 Ga0496115_0020967 Ga0496115_0020967_2193_3197 330
782 3300048918 Ga0496115_0046019 Ga0496115_0046019_1319_2344 330
783 3300048925 Ga0496122_0089925 Ga0496122_0089925_230_1225 330
784 3300049459 Ga0495678_000732 Ga0495678_000732_7419_8417 330
785 3300049459 Ga0495678_004011 Ga0495678_004011_2083_3081 330
786 3300049459 Ga0495678_016975 Ga0495678_016975_371_1369 330
787 3300049574 Ga0501038_0264471 Ga0501038_0264471_190_1194 330
788 3300049579 Ga0501043_0051843 Ga0501043_0051843_2176_3177 330
789 3300049579 Ga0501043_0259348 Ga0501043_0259348_186_1187 330
790 3300049581 Ga0501047_0070748 Ga0501047_0070748_1388_2383 330
791 3300049586 Ga0501070_0070803 Ga0501070_0070803_1851_2855 330
792 3300049592 Ga0501076_0245766 Ga0501076_0245766_378_1382 330
793 3300049742 Ga0501080_0111887 Ga0501080_0111887_1226_2230 330
794 3300049823 Ga0501044_0081620 Ga0501044_0081620_892_1893 330
795 3300050507 nmdc:mga05p37_321116_c1 nmdc:mga05p37_321116_c1_541_1545 330
796 3300050508 nmdc:mga09592_26300_c1 nmdc:mga09592_26300_c1_626_1630 330
797 3300050509 nmdc:mga0qj67_86337_c1 nmdc:mga0qj67_86337_c1_1473_2477 330
798 3300050510 nmdc:mga06r32_35609_c1 nmdc:mga06r32_35609_c1_3136_4140 330
799 3300050512 nmdc:mga0n895_73236_c1 nmdc:mga0n895_73236_c1_1364_2368 330
800 3300050513 nmdc:mga0rr50_21985_c1 nmdc:mga0rr50_21985_c1_1365_2369 330
801 3300050514 nmdc:mga08x19_209840_c1 nmdc:mga08x19_209840_c1_297_1301 330
802 3300050515 nmdc:mga0a205_227048_c1 nmdc:mga0a205_227048_c1_122_1126 330
803 3300053083 Ga0495655_0028742 Ga0495655_0028742_237_1244 330
804 3300053084 Ga0495595_0094900 Ga0495595_0094900_211_1236 330
805 3300053085 Ga0495619_0203014 Ga0495619_0203014_84_1109 330
806 3300053086 Ga0500578_0073503 Ga0500578_0073503_1018_2019 330
807 3300053094 Ga0500566_0000273 Ga0500566_0000273_23541_24542 330
808 3300053096 Ga0500641_0009865 Ga0500641_0009865_958_1959 330
809 3300053098 Ga0500650_0003353 Ga0500650_0003353_11_1012 330
810 3300053103 Ga0500555_012647 Ga0500555_012647_722_1723 330
811 3300053119 Ga0500595_000050 Ga0500595_000050_69007_70008 330
812 3300053130 Ga0500642_0001500 Ga0500642_0001500_4842_5843 330
813 3300053136 Ga0500559_0000106 Ga0500559_0000106_32594_33595 330
814 3300053139 Ga0500568_0002649 Ga0500568_0002649_3104_4105 330
815 3300053139 Ga0500568_0002674 Ga0500568_0002674_3319_4320 330
816 3300053146 Ga0500588_0000462 Ga0500588_0000462_232_1233 330
817 3300053146 Ga0500588_0062086 Ga0500588_0062086_55_1056 330
818 3300053151 Ga0500604_0002621 Ga0500604_0002621_369_1370 330
819 3300053151 Ga0500604_0024172 Ga0500604_0024172_530_1531 330
820 3300053161 Ga0500634_0078887 Ga0500634_0078887_586_1587 330
821 3300053177 Ga0500636_0012147 Ga0500636_0012147_2806_3807 330
822 3300053729 Ga0500625_072208 Ga0500625_072208_249_1253 330
823 iso_pu_bacteria 2877676314 2877682067 330
824 3300005344 Ga0070661_100036544 Ga0070661_1000365443 331
825 3300005367 Ga0070667_100000032 Ga0070667_10000003250 331
826 3300005455 Ga0070663_100000213 Ga0070663_10000021321 331
827 3300005539 Ga0068853_100003586 Ga0068853_1000035865 331
828 3300005548 Ga0070665_100279887 Ga0070665_1002798871 331
829 3300005614 Ga0068856_100070159 Ga0068856_1000701594 331
830 3300005719 Ga0068861_100011313 Ga0068861_1000113137 331
831 3300005844 Ga0068862_100055189 Ga0068862_1000551892 331
832 3300005981 Ga0081538_10009878 Ga0081538_100098786 331
833 3300005983 Ga0081540_1063568 Ga0081540_10635682 331
834 3300006042 Ga0075368_10007337 Ga0075368_100073373 331
835 3300006048 Ga0075363_100044516 Ga0075363_1000445162 331
836 3300006178 Ga0075367_10203416 Ga0075367_102034161 331
837 3300009093 Ga0105240_10458571 Ga0105240_104585712 331
838 3300009094 Ga0111539_10701496 Ga0111539_107014962 331
839 3300009147 Ga0114129_10058018 Ga0114129_100580186 331
840 3300009148 Ga0105243_10106287 Ga0105243_101062874 331
841 3300009177 Ga0105248_10000143 Ga0105248_1000014356 331
842 3300009545 Ga0105237_10007897 Ga0105237_100078974 331
843 3300009553 Ga0105249_10000211 Ga0105249_1000021126 331
844 3300010375 Ga0105239_10531243 Ga0105239_105312432 331
845 3300010375 Ga0105239_10576996 Ga0105239_105769962 331
846 3300013296 Ga0157374_10001745 Ga0157374_1000174515 331
847 3300013306 Ga0163162_10037798 Ga0163162_100377983 331
848 3300021361 Ga0213872_10110791 Ga0213872_101107912 331
849 3300025913 Ga0207695_10188223 Ga0207695_101882232 331
850 3300025913 Ga0207695_10236318 Ga0207695_102363182 331
851 3300025914 Ga0207671_10046382 Ga0207671_100463822 331
852 3300025923 Ga0207681_10006557 Ga0207681_100065573 331
853 3300025923 Ga0207681_10153398 Ga0207681_101533983 331
854 3300025937 Ga0207669_10079995 Ga0207669_100799952 331
855 3300025941 Ga0207711_10001415 Ga0207711_1000141525 331
856 3300025961 Ga0207712_10004820 Ga0207712_100048206 331
857 3300025986 Ga0207658_10000048 Ga0207658_1000004889 331
858 3300026067 Ga0207678_10000877 Ga0207678_1000087721 331
859 3300026078 Ga0207702_10075114 Ga0207702_100751142 331
860 3300026118 Ga0207675_100007188 Ga0207675_10000718810 331
861 3300027866 Ga0209813_10011864 Ga0209813_100118642 331
862 3300027907 Ga0207428_10000668 Ga0207428_1000066834 331
863 3300028379 Ga0268266_10345624 Ga0268266_103456241 331
864 3300028380 Ga0268265_10000876 Ga0268265_100008763 331
865 3300028380 Ga0268265_10056529 Ga0268265_100565292 331
866 3300031852 Ga0307410_10059722 Ga0307410_100597223 331
867 3300031903 Ga0307407_10200845 Ga0307407_102008451 331
868 3300032002 Ga0307416_100077246 Ga0307416_1000772462 331
869 3300032004 Ga0307414_10239282 Ga0307414_102392822 331
870 3300032126 Ga0307415_100074593 Ga0307415_1000745933 331
871 3300037312 Ga0395899_0034053 Ga0395899_0034053_1284_2279 331
872 3300038443 Ga0395901_0472259 Ga0395901_0472259_265_1266 331
873 3300039438 Ga0436360_0359615 Ga0436360_0359615_1041_2039 331
874 3300039447 Ga0436361_0745464 Ga0436361_0745464_176_1183 331
875 3300039447 Ga0436361_0914477 Ga0436361_0914477_2028_3041 331
876 3300042007 Ga0439449_0001376 Ga0439449_0001376_5401_6414 331
877 3300044735 Ga0466968_0004993 Ga0466968_0004993_3089_4096 331
878 3300045049 Ga0466959_0003297 Ga0466959_0003297_4425_5474 331
879 3300047319 Ga0495674_0002692 Ga0495674_0002692_9906_10958 331
880 3300047320 Ga0495672_0020626 Ga0495672_0020626_2673_3677 331
881 3300047472 Ga0495686_0000021 Ga0495686_0000021_60101_61105 331
882 3300047472 Ga0495686_0002134 Ga0495686_0002134_14839_15873 331
883 3300048903 Ga0496100_0385481 Ga0496100_0385481_21_1031 331
884 3300048905 Ga0496102_0093031 Ga0496102_0093031_942_1946 331
885 3300048908 Ga0496105_0102242 Ga0496105_0102242_1270_2268 331
886 3300048912 Ga0496109_0037831 Ga0496109_0037831_80_1078 331
887 3300048914 Ga0496111_0085602 Ga0496111_0085602_778_1776 331
888 3300048920 Ga0496117_0094846 Ga0496117_0094846_107_1111 331
889 3300048925 Ga0496122_0000142 Ga0496122_0000142_21988_23022 331
890 3300048926 Ga0496123_0000148 Ga0496123_0000148_12071_13105 331
891 3300048929 Ga0496126_0000050 Ga0496126_0000050_218334_219338 331
892 3300049571 Ga0501034_0131914 Ga0501034_0131914_1174_2187 331
893 3300049589 Ga0501073_0019004 Ga0501073_0019004_1868_2881 331
894 3300050490 nmdc:mga03n38_33851_c1 nmdc:mga03n38_33851_c1_61_1209 331
895 3300050494 nmdc:mga06z11_21838_c1 nmdc:mga06z11_21838_c1_203_1201 331
896 3300050507 nmdc:mga05p37_96330_c1 nmdc:mga05p37_96330_c1_1068_2090 331
897 3300050511 nmdc:mga08y16_456_c1 nmdc:mga08y16_456_c1_2426_3445 331
898 3300053087 Ga0500643_002974 Ga0500643_002974_210_1244 331
899 3300053104 Ga0500556_0094566 Ga0500556_0094566_121_1122 331
900 3300053120 Ga0500597_000191 Ga0500597_000191_4940_5974 331
901 3300053148 Ga0500590_022922 Ga0500590_022922_1152_2165 331
902 iso_pu_bacteria 2582581313 2585304958 331
903 iso_pu_bacteria 2582581314 2585318881 331
904 iso_pu_bacteria 2643221647 2644269136 331
905 iso_pu_bacteria 2643221678 2644436256 331
906 iso_pu_bacteria 2643221714 2644625873 331
907 iso_pu_bacteria 2786546132 2786669470 331
908 iso_pu_bacteria 2808606359 2808841149 331
909 iso_pu_bacteria 2808606375 2808919658 331
910 iso_pu_bacteria 2818991472 2819739343 331
911 iso_pu_bacteria 2867428634 2867430126 331
912 iso_pu_bacteria 2912715099 2912721029 331
913 iso_pu_bacteria 2919468124 2919468552 331
914 iso_pu_bacteria 2946072368 2946075111 331
915 iso_pu_bacteria 2954380949 2954387193 331
916 iso_pu_bacteria 2954673503 2954675959 331
917 iso_pu_bacteria 2954682443 2954688207 331
918 iso_pu_bacteria 2954691527 2954698029 331
919 iso_pu_bacteria 2954701450 2954704186 331
920 iso_pu_bacteria 2954711539 2954717138 331
921 iso_pu_bacteria 2954721474 2954727106 331
922 iso_pu_bacteria 2954731030 2954734695 331
923 iso_pu_bacteria 2954740390 2954746011 331
924 iso_pu_bacteria 2954749733 2954753582 331
925 iso_pu_bacteria 2954759201 2954764981 331
926 iso_pu_bacteria 3006486233 3006489064 331
927 iso_pu_bacteria 8056829672 8056836828 331
928 3300003354 JGI25160J50197_1019999 JGI25160J50197_10199991 332
929 3300025284 Ga0209130_1000399 Ga0209130_100039910 332
930 3300025302 Ga0207426_1000046 Ga0207426_100004656 332
931 3300030522 Ga0307512_10010397 Ga0307512_100103977 332
932 3300031616 Ga0307508_10055097 Ga0307508_100550972 332
933 3300046512 Ga0495610_0014805 Ga0495610_0014805_777_1781 332
934 3300003215 JGI25153J46596_10045284 JGI25153J46596_100452841 333
935 3300003578 Ga0006562J51391_1039231 Ga0006562J51391_10392312 333
936 3300003578 Ga0006562J51391_1097249 Ga0006562J51391_10972492 333
937 3300003578 Ga0006562J51391_1097250 Ga0006562J51391_10972504 333
938 3300006042 Ga0075368_10017684 Ga0075368_100176843 333
939 3300006051 Ga0075364_10273090 Ga0075364_102730901 333
940 3300006948 Ga0099826_10058826 Ga0099826_100588261 333
941 3300015688 Ga0183367_1009 Ga0183367_100946 333
942 3300017792 Ga0163161_10268631 Ga0163161_102686311 333
943 3300030521 Ga0307511_10012485 Ga0307511_100124858 333
944 3300031456 Ga0307513_10058751 Ga0307513_100587513 333
945 3300031507 Ga0307509_10047478 Ga0307509_100474785 333
946 3300031649 Ga0307514_10070308 Ga0307514_100703081 333
947 3300031838 Ga0307518_10056055 Ga0307518_100560551 333
948 3300033180 Ga0307510_10096719 Ga0307510_100967193 333
949 3300042014 Ga0439457_000207 Ga0439457_000207_13589_14599 333
950 3300042138 Ga0450903_000278 Ga0450903_000278_9973_10983 333
951 3300044656 Ga0466969_0016382 Ga0466969_0016382_649_1677 333
952 3300046454 Ga0495592_0000576 Ga0495592_0000576_10195_11205 333
953 3300046459 Ga0495629_0024815 Ga0495629_0024815_648_1658 333
954 3300046462 Ga0495651_0001088 Ga0495651_0001088_16833_17843 333
955 3300046473 Ga0495582_0183515 Ga0495582_0183515_172_1182 333
956 3300046476 Ga0495662_0002860 Ga0495662_0002860_6603_7613 333
957 3300046477 Ga0495664_0003663 Ga0495664_0003663_6109_7119 333
958 3300046516 Ga0495628_0031356 Ga0495628_0031356_203_1213 333
959 3300046517 Ga0495630_0012548 Ga0495630_0012548_1253_2263 333
960 3300046536 Ga0495587_0001673 Ga0495587_0001673_9256_10266 333
961 3300046557 Ga0495622_0059605 Ga0495622_0059605_648_1658 333
962 3300046642 Ga0495634_0001729 Ga0495634_0001729_10021_11031 333
963 3300046680 Ga0495646_0005821 Ga0495646_0005821_1139_2149 333
964 3300047315 Ga0495581_0013715 Ga0495581_0013715_959_1969 333
965 3300047321 Ga0495676_0000862 Ga0495676_0000862_24129_25139 333
966 3300047443 Ga0495687_005116 Ga0495687_005116_5369_6391 333
967 3300047444 Ga0495675_0119798 Ga0495675_0119798_381_1391 333
968 3300047469 Ga0495673_0000223 Ga0495673_0000223_36866_37876 333
969 3300047471 Ga0495684_0067687 Ga0495684_0067687_716_1726 333
970 3300047472 Ga0495686_0008657 Ga0495686_0008657_4509_5534 333
971 3300047673 Ga0495593_0004669 Ga0495593_0004669_5058_6068 333
972 3300048088 Ga0495602_0031172 Ga0495602_0031172_3573_4583 333
973 3300048089 Ga0495614_0011401 Ga0495614_0011401_610_1620 333
974 3300048927 Ga0496124_0000046 Ga0496124_0000046_22898_23914 333
975 3300049571 Ga0501034_0178180 Ga0501034_0178180_410_1426 333
976 3300049586 Ga0501070_0163330 Ga0501070_0163330_639_1649 333
977 3300053085 Ga0495619_0037869 Ga0495619_0037869_656_1666 333
978 3300053101 Ga0500553_015652 Ga0500553_015652_2557_3567 333
979 3300053122 Ga0500608_068534 Ga0500608_068534_180_1190 333
980 iso_pu_bacteria 2862281513 2862288264 333
981 3300001990 JGI24737J22298_10051184 JGI24737J22298_100511842 334
982 3300002067 JGI24735J21928_10001861 JGI24735J21928_100018612 334
983 3300005355 Ga0070671_100156542 Ga0070671_1001565422 334
984 3300025904 Ga0207647_10043088 Ga0207647_100430882 334
985 3300025931 Ga0207644_10204472 Ga0207644_102044722 334
986 3300037471 Ga0395905_0073489 Ga0395905_0073489_201_1205 334
987 3300044693 Ga0466961_0013455 Ga0466961_0013455_1740_2744 334
988 3300044765 Ga0466970_0006844 Ga0466970_0006844_2429_3433 334
989 3300045976 Ga0466967_0040191 Ga0466967_0040191_2964_3968 334
990 3300046463 Ga0495653_0044531 Ga0495653_0044531_1552_2556 334
991 3300047673 Ga0495593_0028589 Ga0495593_0028589_640_1644 334
992 3300048088 Ga0495602_0086198 Ga0495602_0086198_1429_2433 334
993 3300049823 Ga0501044_0043682 Ga0501044_0043682_3443_4504 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

65

360

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9462 1 312
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9394 1 313
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9199 1 319
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9168 1 313
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9141 1 312
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.962 1 333 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9417 1 225 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9412 2 258 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9394 1 313 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9393 68 334 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4Q6A8B0-F1-model_v4 deleted 0.9908 2 180
AF-A0A1G9MJ32-F1-model_v4 Predicted oxidoreductase 0.9872 1 332 GO:0004033
GO:0005737
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9861 1 209 GO:0004033
GO:0005737
AF-A0A1G9MJ32-F1-model_v4 Predicted oxidoreductase 0.9812 1 332 GO:0004033
GO:0005737
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9767 1 209 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.33 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map