F487682

General Info

Members Datasets Scaffolds Average Seq Length
993 387 980 190

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10541274|Ga0105237_105412742
Length 220
Sequence MVLIEQAFNGVSISNSYKVITNSEPNLYVSMFIEPHIKGERRGWIEVICGSMFSGKTEELIRRLKRAKIANLKVEIFKPSMDIRYHEHNIVSHDESTILSSPIDNSQTILLMASDVDVIGIDEAQFFDDQLPEVCDQLAFRGIRVIVAGLDMDFTAKPFGQMPFLLAKADYITKLHAICVKCGNIANYSYRKSRADSQVLLGEKDLYEPRCRNCYYNQVP

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
233 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
234 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
293 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
312 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
313 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
314 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
315 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
316 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
317 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
318 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
319 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
320 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
321 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
324 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
325 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
326 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
327 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
328 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
329 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
330 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
331 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
332 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
333 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
334 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
335 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
336 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
341 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
342 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
343 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
344 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
345 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
346 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
350 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
360 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
361 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
362 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
365 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
373 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
374 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
375 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
376 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
377 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
378 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
381 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
382 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
383 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0
Rhizoplane 0.81
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013829 3300001979 Bacteria 2997
2 JGI24739J22299_10018562 3300001989 Bacteria 2498
3 JGI25158J39367_1005868 3300002739 Bacteria 1780
4 JGI25153J46596_10000209 3300003215 Bacteria 52915
5 JGI25153J46596_10023975 3300003215 Bacteria 2208
6 rootH2_10011602 3300003320 Bacteria 11970
7 rootH2_10087314 3300003320 Bacteria 1812
8 rootH2_10090059 3300003320 Bacteria 2516
9 rootH2_10137001 3300003320 Bacteria 6424
10 rootH1_10043692 3300003323 Bacteria 17024
11 rootH1_10137701 3300003323 Unclassified 3887
12 rootH1_10203057 3300003323 Bacteria 3559
13 JGI25160J50197_1001403 3300003354 Bacteria 12081
14 JGI25160J50197_1003289 3300003354 Bacteria 7276
15 JGI25160J50197_1009333 3300003354 Bacteria 3651
16 Ga0055542_1005560 3300003762 Bacteria 2824
17 Ga0055526_1021827 3300003771 Bacteria 2208
18 Ga0055526_1038025 3300003771 Bacteria 1247
19 Ga0055528_1000308 3300003790 Bacteria 41407
20 Ga0055528_1000809 3300003790 Bacteria 21549
21 Ga0055530_10000385 3300003791 Bacteria 39749
22 Ga0055531_10000027 3300003794 Bacteria 160284
23 Ga0065165_1000053 3300005262 Bacteria 189081
24 Ga0065165_1004556 3300005262 Bacteria 8464
25 Ga0065165_1046879 3300005262 Bacteria 1251
26 Ga0065714_10214071 3300005288 Bacteria 858
27 Ga0065704_10029955 3300005289 Bacteria 1419
28 Ga0065704_10244930 3300005289 Bacteria 1005
29 Ga0065712_10014379 3300005290 Bacteria 1582
30 Ga0065712_10019139 3300005290 Bacteria 3687
31 Ga0065712_10029565 3300005290 Unclassified 881
32 Ga0065712_10208997 3300005290 Bacteria 1080
33 Ga0065712_10263719 3300005290 Bacteria 931
34 Ga0065707_10166336 3300005295 Bacteria 1519
35 Ga0065707_10385028 3300005295 Bacteria 855
36 Ga0070676_10389108 3300005328 Bacteria 967
37 Ga0070676_10780897 3300005328 Bacteria 703
38 Ga0070683_100030331 3300005329 Bacteria 4907
39 Ga0070670_100018081 3300005331 Bacteria 6051
40 Ga0070670_100068080 3300005331 Bacteria 3055
41 Ga0070670_100092898 3300005331 Bacteria 2595
42 Ga0070670_100150457 3300005331 Bacteria 2014
43 Ga0070670_100219101 3300005331 Bacteria 1655
44 Ga0070670_100231408 3300005331 Bacteria 1608
45 Ga0070670_100490162 3300005331 Bacteria 1092
46 Ga0070677_10013451 3300005333 Unclassified 2862
47 Ga0070677_10063065 3300005333 Bacteria 1535
48 Ga0070677_10142571 3300005333 Bacteria 1107
49 Ga0068869_100006542 3300005334 Bacteria 7390
50 Ga0068869_100007079 3300005334 Bacteria 7144
51 Ga0068869_100092954 3300005334 Bacteria 2271
52 Ga0068869_100161706 3300005334 Bacteria 1743
53 Ga0068869_100167040 3300005334 Bacteria 1716
54 Ga0068869_100274879 3300005334 Unclassified 1353
55 Ga0070666_10000536 3300005335 Bacteria 22907
56 Ga0070666_10076765 3300005335 Unclassified 2280
57 Ga0070666_10211835 3300005335 Bacteria 1365
58 Ga0070682_100000628 3300005337 Bacteria 21473
59 Ga0070682_100627674 3300005337 Bacteria 852
60 Ga0068868_100006435 3300005338 Bacteria 8312
61 Ga0068868_100221867 3300005338 Bacteria 1583
62 Ga0068868_100238903 3300005338 Bacteria 1526
63 Ga0068868_100452219 3300005338 Bacteria 1117
64 Ga0068868_100564460 3300005338 Bacteria 1004
65 Ga0070660_100044390 3300005339 Bacteria 3400
66 Ga0070660_100181694 3300005339 Unclassified 1702
67 Ga0070660_100275914 3300005339 Bacteria 1375
68 Ga0070660_100858708 3300005339 Bacteria 764
69 Ga0070691_10415273 3300005341 Bacteria 761
70 Ga0070687_100011322 3300005343 Bacteria 3900
71 Ga0070687_100031401 3300005343 Bacteria 2606
72 Ga0070687_100105272 3300005343 Bacteria 1587
73 Ga0070687_100367826 3300005343 Bacteria 933
74 Ga0070661_100592694 3300005344 Bacteria 895
75 Ga0070661_101133903 3300005344 Bacteria 652
76 Ga0070668_100030711 3300005347 Bacteria 4087
77 Ga0070668_100078394 3300005347 Bacteria 2584
78 Ga0070668_100222169 3300005347 Bacteria 1558
79 Ga0070668_100391018 3300005347 Unclassified 1185
80 Ga0070669_100169400 3300005353 Bacteria 1702
81 Ga0070669_100185767 3300005353 Bacteria 1628
82 Ga0070669_100264686 3300005353 Bacteria 1373
83 Ga0070675_100017651 3300005354 Bacteria 5675
84 Ga0070675_100123475 3300005354 Bacteria 2201
85 Ga0070675_100129986 3300005354 Bacteria 2145
86 Ga0070675_100290018 3300005354 Bacteria 1440
87 Ga0070675_100770431 3300005354 Unclassified 878
88 Ga0070671_100100262 3300005355 Bacteria 2429
89 Ga0070671_100184160 3300005355 Bacteria 1769
90 Ga0070671_101091380 3300005355 Bacteria 701
91 Ga0070674_100100564 3300005356 Bacteria 2105
92 Ga0070674_100122851 3300005356 Bacteria 1924
93 Ga0070674_100178240 3300005356 Bacteria 1626
94 Ga0070674_100304792 3300005356 Bacteria 1271
95 Ga0070673_100004723 3300005364 Bacteria 8650
96 Ga0070673_100006253 3300005364 Bacteria 7723
97 Ga0070673_100013324 3300005364 Bacteria 5682
98 Ga0070673_100276452 3300005364 Unclassified 1471
99 Ga0070673_100276840 3300005364 Bacteria 1470
100 Ga0070673_100668681 3300005364 Bacteria 952
101 Ga0070688_100344574 3300005365 Bacteria 1089
102 Ga0070688_100570944 3300005365 Bacteria 862
103 Ga0070688_100645700 3300005365 Unclassified 814
104 Ga0070659_100003227 3300005366 Bacteria 11613
105 Ga0070659_100088075 3300005366 Bacteria 2486
106 Ga0070667_100005388 3300005367 Bacteria 10686
107 Ga0070667_100015282 3300005367 Bacteria 6345
108 Ga0070667_100059103 3300005367 Bacteria 3243
109 Ga0070667_100457465 3300005367 Bacteria 1167
110 Ga0070667_100460105 3300005367 Bacteria 1163
111 Ga0070667_100466195 3300005367 Bacteria 1155
112 Ga0070667_100575414 3300005367 Bacteria 1036
113 Ga0070709_10625398 3300005434 Bacteria 831
114 Ga0070713_100837017 3300005436 Bacteria 883
115 Ga0070701_10195924 3300005438 Bacteria 1191
116 Ga0070700_100010950 3300005441 Bacteria 5016
117 Ga0070700_100280319 3300005441 Bacteria 1208
118 Ga0070700_100577515 3300005441 Bacteria 877
119 Ga0070694_100129554 3300005444 Bacteria 1821
120 Ga0070708_100620020 3300005445 Bacteria 1020
121 Ga0070663_100019412 3300005455 Bacteria 4479
122 Ga0070663_100321602 3300005455 Bacteria 1244
123 Ga0070678_100056590 3300005456 Bacteria 2869
124 Ga0070678_100068026 3300005456 Unclassified 2653
125 Ga0070678_100227551 3300005456 Bacteria 1553
126 Ga0070681_10008396 3300005458 Bacteria 10112
127 Ga0070681_10024676 3300005458 Bacteria 6050
128 Ga0070681_10042169 3300005458 Bacteria 4574
129 Ga0068867_100017763 3300005459 Bacteria 5050
130 Ga0068867_100019000 3300005459 Bacteria 4893
131 Ga0068867_100023075 3300005459 Bacteria 4453
132 Ga0068867_100075165 3300005459 Bacteria 2534
133 Ga0068867_100117576 3300005459 Bacteria 2050
134 Ga0068867_100133111 3300005459 Bacteria 1935
135 Ga0068867_100451034 3300005459 Bacteria 1096
136 Ga0068867_100517768 3300005459 Bacteria 1028
137 Ga0068867_100688958 3300005459 Unclassified 901
138 Ga0068867_101344111 3300005459 Bacteria 661
139 Ga0070685_10020796 3300005466 Bacteria 3556
140 Ga0070685_10078569 3300005466 Unclassified 1973
141 Ga0070685_10093120 3300005466 Unclassified 1827
142 Ga0070685_10150879 3300005466 Bacteria 1473
143 Ga0070685_10285159 3300005466 Bacteria 1107
144 Ga0070698_100000661 3300005471 Bacteria 36847
145 Ga0070698_100005764 3300005471 Bacteria 13543
146 Ga0070679_100018252 3300005530 Bacteria 6804
147 Ga0070679_100155055 3300005530 Bacteria 2265
148 Ga0070684_100001895 3300005535 Bacteria 15325
149 Ga0070684_100803610 3300005535 Unclassified 879
150 Ga0068853_100008728 3300005539 Bacteria 8153
151 Ga0068853_100014820 3300005539 Bacteria 6400
152 Ga0068853_100088156 3300005539 Bacteria 2724
153 Ga0068853_100239648 3300005539 Bacteria 1662
154 Ga0068853_100360163 3300005539 Bacteria 1355
155 Ga0068853_100626989 3300005539 Bacteria 1022
156 Ga0068853_101435349 3300005539 Bacteria 668
157 Ga0070672_100023427 3300005543 Bacteria 4552
158 Ga0070672_100025969 3300005543 Bacteria 4351
159 Ga0070672_100047689 3300005543 Bacteria 3325
160 Ga0070672_100054432 3300005543 Bacteria 3132
161 Ga0070672_100242480 3300005543 Bacteria 1516
162 Ga0070672_100263024 3300005543 Bacteria 1455
163 Ga0070672_100313140 3300005543 Bacteria 1333
164 Ga0070672_100314732 3300005543 Unclassified 1329
165 Ga0070672_100475207 3300005543 Bacteria 1079
166 Ga0070672_100509640 3300005543 Bacteria 1041
167 Ga0070672_100961930 3300005543 Bacteria 756
168 Ga0070686_100019526 3300005544 Bacteria 3996
169 Ga0070686_100361632 3300005544 Bacteria 1093
170 Ga0070696_100133873 3300005546 Unclassified 1806
171 Ga0070693_100008596 3300005547 Bacteria 5045
172 Ga0070665_100000008 3300005548 Bacteria 606341
173 Ga0070665_100019926 3300005548 Bacteria 6736
174 Ga0070665_100890085 3300005548 Unclassified 903
175 Ga0068855_100001250 3300005563 Bacteria 31562
176 Ga0068855_100001274 3300005563 Bacteria 31259
177 Ga0068855_100025826 3300005563 Bacteria 7024
178 Ga0068855_100091452 3300005563 Bacteria 3510
179 Ga0068855_100139770 3300005563 Bacteria 2762
180 Ga0068855_100644205 3300005563 Bacteria 1138
181 Ga0070664_100108824 3300005564 Bacteria 2417
182 Ga0070664_100124998 3300005564 Unclassified 2255
183 Ga0070664_100138162 3300005564 Bacteria 2144
184 Ga0068857_100151517 3300005577 Bacteria 2101
185 Ga0068857_100281164 3300005577 Bacteria 1531
186 Ga0068857_100523938 3300005577 Bacteria 1114
187 Ga0068857_100747755 3300005577 Bacteria 931
188 Ga0068854_100014234 3300005578 Bacteria 5239
189 Ga0068854_100014439 3300005578 Bacteria 5208
190 Ga0068854_100193632 3300005578 Bacteria 1594
191 Ga0068854_100201852 3300005578 Bacteria 1563
192 Ga0068854_100416099 3300005578 Bacteria 1115
193 Ga0068854_100454151 3300005578 Bacteria 1071
194 Ga0068856_100093229 3300005614 Bacteria 2997
195 Ga0068856_100379535 3300005614 Bacteria 1433
196 Ga0070702_100022492 3300005615 Bacteria 3334
197 Ga0070702_100216324 3300005615 Bacteria 1278
198 Ga0068852_100000180 3300005616 Bacteria 43078
199 Ga0068852_100001996 3300005616 Bacteria 13908
200 Ga0068852_100303661 3300005616 Bacteria 1546
201 Ga0068852_101335593 3300005616 Unclassified 739
202 Ga0068859_100000007 3300005617 Bacteria 390070
203 Ga0068859_100001403 3300005617 Bacteria 24458
204 Ga0068859_100029222 3300005617 Bacteria 5531
205 Ga0068859_100083124 3300005617 Unclassified 3244
206 Ga0068859_100093110 3300005617 Bacteria 3065
207 Ga0068859_100384798 3300005617 Bacteria 1498
208 Ga0068859_100614679 3300005617 Bacteria 1179
209 Ga0068859_100780385 3300005617 Bacteria 1044
210 Ga0068864_100001316 3300005618 Bacteria 20650
211 Ga0068864_100145703 3300005618 Bacteria 2141
212 Ga0068864_101165821 3300005618 Bacteria 768
213 Ga0068866_10103285 3300005718 Bacteria 1577
214 Ga0068861_100080332 3300005719 Bacteria 2551
215 Ga0068861_100964043 3300005719 Bacteria 812
216 Ga0068851_10070919 3300005834 Bacteria 1802
217 Ga0068851_10090465 3300005834 Bacteria 1610
218 Ga0068851_10321220 3300005834 Bacteria 894
219 Ga0068870_10025539 3300005840 Bacteria 2934
220 Ga0068870_10197145 3300005840 Bacteria 1219
221 Ga0068863_100000444 3300005841 Bacteria 41977
222 Ga0068863_100007099 3300005841 Bacteria 10983
223 Ga0068863_100024194 3300005841 Bacteria 5793
224 Ga0068863_100215718 3300005841 Bacteria 1848
225 Ga0068863_100226590 3300005841 Bacteria 1802
226 Ga0068863_100306485 3300005841 Bacteria 1541
227 Ga0068863_100503435 3300005841 Bacteria 1193
228 Ga0068863_100650341 3300005841 Bacteria 1045
229 Ga0068863_101267734 3300005841 Unclassified 743
230 Ga0068863_101291900 3300005841 Bacteria 736
231 Ga0068858_100000829 3300005842 Bacteria 32222
232 Ga0068858_100351746 3300005842 Bacteria 1411
233 Ga0068858_100482081 3300005842 Bacteria 1197
234 Ga0068858_100530908 3300005842 Unclassified 1138
235 Ga0068858_100822543 3300005842 Bacteria 906
236 Ga0068860_100000029 3300005843 Bacteria 259192
237 Ga0068860_100005394 3300005843 Bacteria 12976
238 Ga0068860_100010234 3300005843 Bacteria 9282
239 Ga0068860_100024948 3300005843 Bacteria 5771
240 Ga0068860_100061290 3300005843 Bacteria 3574
241 Ga0068860_100121471 3300005843 Bacteria 2501
242 Ga0068860_100130163 3300005843 Bacteria 2414
243 Ga0068860_100351346 3300005843 Bacteria 1451
244 Ga0068862_100236663 3300005844 Bacteria 1658
245 Ga0081540_1074941 3300005983 Bacteria 1548
246 Ga0075366_10007240 3300006195 Bacteria 6115
247 Ga0075366_10209743 3300006195 Bacteria 1186
248 Ga0075366_10313920 3300006195 Bacteria 960
249 Ga0097621_100000711 3300006237 Bacteria 23348
250 Ga0097621_100012629 3300006237 Bacteria 6268
251 Ga0097621_100077083 3300006237 Bacteria 2766
252 Ga0097621_100092526 3300006237 Bacteria 2533
253 Ga0097621_100126956 3300006237 Bacteria 2167
254 Ga0097621_100158266 3300006237 Unclassified 1946
255 Ga0097621_100428706 3300006237 Unclassified 1188
256 Ga0097621_100627510 3300006237 Bacteria 984
257 Ga0097621_100840136 3300006237 Unclassified 853
258 Ga0075370_10159619 3300006353 Bacteria 1323
259 Ga0068871_100000351 3300006358 Bacteria 31972
260 Ga0068871_100018089 3300006358 Bacteria 5350
261 Ga0068871_100020023 3300006358 Bacteria 5119
262 Ga0068871_100075432 3300006358 Unclassified 2784
263 Ga0068871_100165258 3300006358 Bacteria 1894
264 Ga0068871_100414105 3300006358 Bacteria 1202
265 Ga0068871_100614016 3300006358 Bacteria 990
266 Ga0068871_100643525 3300006358 Bacteria 967
267 Ga0068871_101066465 3300006358 Bacteria 755
268 Ga0075428_100025171 3300006844 Bacteria 6585
269 Ga0075428_100059396 3300006844 Bacteria 4187
270 Ga0075430_100021698 3300006846 Bacteria 5457
271 Ga0075430_100030675 3300006846 Bacteria 4566
272 Ga0075433_10519812 3300006852 Bacteria 1047
273 Ga0075429_100005315 3300006880 Bacteria 11083
274 Ga0075429_100081239 3300006880 Unclassified 2826
275 Ga0068865_100020694 3300006881 Bacteria 4270
276 Ga0068865_100186132 3300006881 Bacteria 1602
277 Ga0068865_100316585 3300006881 Bacteria 1254
278 Ga0068865_100516213 3300006881 Bacteria 998
279 Ga0097620_100000007 3300006931 Bacteria 390070
280 Ga0097620_100001403 3300006931 Bacteria 24458
281 Ga0097620_100029222 3300006931 Bacteria 5531
282 Ga0097620_100083124 3300006931 Unclassified 3244
283 Ga0097620_100093114 3300006931 Bacteria 3065
284 Ga0097620_100384790 3300006931 Bacteria 1498
285 Ga0097620_100614642 3300006931 Bacteria 1179
286 Ga0097620_100780398 3300006931 Bacteria 1044
287 Ga0097620_101262741 3300006931 Bacteria 814
288 Ga0105240_10001800 3300009093 Bacteria 36076
289 Ga0105240_10003960 3300009093 Bacteria 22876
290 Ga0105240_10003982 3300009093 Bacteria 22790
291 Ga0105240_10008182 3300009093 Bacteria 14995
292 Ga0105240_10010900 3300009093 Bacteria 12735
293 Ga0105240_10050422 3300009093 Bacteria 5248
294 Ga0105240_10099692 3300009093 Bacteria 3535
295 Ga0105240_10117609 3300009093 Bacteria 3204
296 Ga0105240_10791516 3300009093 Bacteria 1028
297 Ga0111539_10125769 3300009094 Bacteria 3004
298 Ga0105247_10001984 3300009101 Bacteria 14204
299 Ga0105247_10165240 3300009101 Unclassified 1468
300 Ga0105247_10262399 3300009101 Unclassified 1185
301 Ga0114129_10153798 3300009147 Bacteria 3147
302 Ga0114129_10208548 3300009147 Unclassified 2643
303 Ga0105243_10387332 3300009148 Unclassified 1295
304 Ga0105243_10459542 3300009148 Unclassified 1197
305 Ga0105243_10520306 3300009148 Bacteria 1131
306 Ga0105241_10000206 3300009174 Bacteria 44346
307 Ga0105241_10001098 3300009174 Bacteria 20609
308 Ga0105241_10142957 3300009174 Bacteria 1950
309 Ga0105241_10275092 3300009174 Bacteria 1436
310 Ga0105241_10515071 3300009174 Bacteria 1069
311 Ga0105242_10030077 3300009176 Bacteria 4335
312 Ga0105242_10162697 3300009176 Bacteria 1955
313 Ga0105242_10350443 3300009176 Bacteria 1363
314 Ga0105242_10382148 3300009176 Bacteria 1309
315 Ga0105242_10936432 3300009176 Bacteria 869
316 Ga0105248_10046848 3300009177 Bacteria 4847
317 Ga0105248_10241525 3300009177 Unclassified 2033
318 Ga0105248_10417121 3300009177 Bacteria 1512
319 Ga0105248_10790839 3300009177 Bacteria 1071
320 Ga0105237_10000780 3300009545 Bacteria 43609
321 Ga0105237_10003152 3300009545 Bacteria 19845
322 Ga0105237_10009612 3300009545 Bacteria 10356
323 Ga0105237_10012022 3300009545 Bacteria 9143
324 Ga0105237_10013020 3300009545 Bacteria 8734
325 Ga0105237_10026858 3300009545 Bacteria 5883
326 Ga0105237_10080975 3300009545 Bacteria 3237
327 Ga0105237_10135210 3300009545 Unclassified 2460
328 Ga0105237_10200736 3300009545 Bacteria 1994
329 Ga0105237_10346499 3300009545 Bacteria 1490
330 Ga0105237_10541274 3300009545 Bacteria 1171
331 Ga0105237_11104143 3300009545 Bacteria 800
332 Ga0105238_10032669 3300009551 Bacteria 5296
333 Ga0105238_10037294 3300009551 Bacteria 4941
334 Ga0105238_10045389 3300009551 Bacteria 4439
335 Ga0105238_10056683 3300009551 Bacteria 3931
336 Ga0105238_10291713 3300009551 Bacteria 1613
337 Ga0105249_10008328 3300009553 Bacteria 9028
338 Ga0105249_10009665 3300009553 Bacteria 8450
339 Ga0105249_10042329 3300009553 Bacteria 4142
340 Ga0105249_10197991 3300009553 Bacteria 1964
341 Ga0105249_10497010 3300009553 Unclassified 1264
342 Ga0105249_10598379 3300009553 Bacteria 1157
343 Ga0105239_10000135 3300010375 Bacteria 103223
344 Ga0105239_10000337 3300010375 Bacteria 68698
345 Ga0105239_10007270 3300010375 Bacteria 12721
346 Ga0105239_10009606 3300010375 Bacteria 10882
347 Ga0105239_10011821 3300010375 Bacteria 9742
348 Ga0105239_10066192 3300010375 Bacteria 3969
349 Ga0105239_10224526 3300010375 Bacteria 2107
350 Ga0105239_10237019 3300010375 Bacteria 2048
351 Ga0105239_10278360 3300010375 Bacteria 1883
352 Ga0105239_10390573 3300010375 Bacteria 1574
353 Ga0105239_10701481 3300010375 Bacteria 1157
354 Ga0105246_10432029 3300011119 Bacteria 1102
355 Ga0157373_10048519 3300013100 Bacteria 3027
356 Ga0157373_10171891 3300013100 Bacteria 1525
357 Ga0157373_10588544 3300013100 Bacteria 809
358 Ga0157371_10036310 3300013102 Bacteria 3529
359 Ga0157371_10069202 3300013102 Bacteria 2499
360 Ga0157371_10072834 3300013102 Bacteria 2433
361 Ga0157371_10095188 3300013102 Bacteria 2110
362 Ga0157371_10107422 3300013102 Unclassified 1981
363 Ga0157371_10172210 3300013102 Bacteria 1547
364 Ga0157371_10524499 3300013102 Bacteria 876
365 Ga0157370_10000426 3300013104 Bacteria 52773
366 Ga0157370_10004831 3300013104 Bacteria 15322
367 Ga0157370_10029393 3300013104 Bacteria 5393
368 Ga0157370_10030890 3300013104 Bacteria 5246
369 Ga0157370_10150085 3300013104 Bacteria 2169
370 Ga0157370_10219831 3300013104 Bacteria 1760
371 Ga0157370_10620046 3300013104 Bacteria 990
372 Ga0157370_10981652 3300013104 Unclassified 765
373 Ga0157369_10014091 3300013105 Bacteria 9036
374 Ga0157369_10019728 3300013105 Bacteria 7544
375 Ga0157369_10040395 3300013105 Bacteria 5093
376 Ga0157369_10044422 3300013105 Bacteria 4836
377 Ga0157369_10061816 3300013105 Bacteria 4037
378 Ga0157369_10178489 3300013105 Bacteria 2235
379 Ga0157369_10224634 3300013105 Unclassified 1965
380 Ga0157369_10252953 3300013105 Bacteria 1838
381 Ga0157369_10628330 3300013105 Bacteria 1108
382 Ga0157369_10780015 3300013105 Bacteria 982
383 Ga0157374_10000009 3300013296 Bacteria 564330
384 Ga0157374_10045471 3300013296 Bacteria 4064
385 Ga0157374_10067126 3300013296 Bacteria 3371
386 Ga0157374_10087081 3300013296 Bacteria 2973
387 Ga0157374_10213072 3300013296 Bacteria 1894
388 Ga0157374_10360574 3300013296 Bacteria 1445
389 Ga0157374_10480758 3300013296 Bacteria 1245
390 Ga0157378_10000837 3300013297 Bacteria 28570
391 Ga0157378_10002924 3300013297 Bacteria 15193
392 Ga0157378_10025999 3300013297 Bacteria 5159
393 Ga0157378_11033314 3300013297 Bacteria 857
394 Ga0163162_10000795 3300013306 Bacteria 29353
395 Ga0163162_10000833 3300013306 Bacteria 28693
396 Ga0163162_10008664 3300013306 Bacteria 9901
397 Ga0163162_10041885 3300013306 Bacteria 4582
398 Ga0163162_10050448 3300013306 Bacteria 4173
399 Ga0163162_10069707 3300013306 Unclassified 3568
400 Ga0163162_10453531 3300013306 Bacteria 1414
401 Ga0163162_10924282 3300013306 Bacteria 984
402 Ga0163162_12497444 3300013306 Bacteria 594
403 Ga0157372_10000258 3300013307 Bacteria 58520
404 Ga0157372_10002260 3300013307 Bacteria 20878
405 Ga0157372_10002978 3300013307 Bacteria 18242
406 Ga0157372_10011005 3300013307 Bacteria 9628
407 Ga0157372_10023612 3300013307 Bacteria 6671
408 Ga0157372_10051584 3300013307 Bacteria 4579
409 Ga0157372_10073608 3300013307 Bacteria 3851
410 Ga0157372_10092182 3300013307 Bacteria 3446
411 Ga0157372_10144797 3300013307 Bacteria 2740
412 Ga0157372_10147167 3300013307 Bacteria 2716
413 Ga0157372_10201517 3300013307 Bacteria 2305
414 Ga0157372_10239550 3300013307 Bacteria 2105
415 Ga0157372_10305136 3300013307 Bacteria 1852
416 Ga0157372_10388125 3300013307 Bacteria 1627
417 Ga0157372_10482550 3300013307 Bacteria 1445
418 Ga0157372_10714512 3300013307 Bacteria 1166
419 Ga0157372_10777371 3300013307 Bacteria 1113
420 Ga0157372_10902539 3300013307 Bacteria 1025
421 Ga0157375_10000073 3300013308 Bacteria 105972
422 Ga0157375_10020587 3300013308 Bacteria 6029
423 Ga0157375_10057461 3300013308 Unclassified 3846
424 Ga0157375_10131910 3300013308 Bacteria 2619
425 Ga0157375_10243220 3300013308 Bacteria 1959
426 Ga0157375_10322028 3300013308 Unclassified 1711
427 Ga0157375_10748546 3300013308 Bacteria 1129
428 Ga0157375_10759834 3300013308 Bacteria 1120
429 Ga0157375_10789262 3300013308 Bacteria 1099
430 Ga0163163_10052456 3300014325 Bacteria 4023
431 Ga0163163_10166806 3300014325 Bacteria 2248
432 Ga0163163_10308727 3300014325 Bacteria 1634
433 Ga0163163_10396844 3300014325 Bacteria 1437
434 Ga0163163_11112991 3300014325 Bacteria 853
435 Ga0163163_11144436 3300014325 Bacteria 841
436 Ga0163163_11808531 3300014325 Bacteria 671
437 Ga0157380_10030099 3300014326 Bacteria 4155
438 Ga0157380_10053087 3300014326 Bacteria 3212
439 Ga0157380_10357361 3300014326 Bacteria 1369
440 Ga0157380_10437181 3300014326 Bacteria 1253
441 Ga0157380_10809469 3300014326 Unclassified 955
442 Ga0157377_10044754 3300014745 Bacteria 2469
443 Ga0157377_10137773 3300014745 Bacteria 1497
444 Ga0157379_10070073 3300014968 Bacteria 3137
445 Ga0157379_10119948 3300014968 Bacteria 2365
446 Ga0157379_10185442 3300014968 Unclassified 1880
447 Ga0157379_10186973 3300014968 Bacteria 1872
448 Ga0157379_10213085 3300014968 Unclassified 1749
449 Ga0157379_10356112 3300014968 Bacteria 1341
450 Ga0157379_10778880 3300014968 Bacteria 902
451 Ga0157379_11162181 3300014968 Bacteria 741
452 Ga0157376_10001803 3300014969 Bacteria 14251
453 Ga0157376_10001988 3300014969 Bacteria 13680
454 Ga0157376_10006687 3300014969 Bacteria 8161
455 Ga0157376_10144472 3300014969 Bacteria 2138
456 Ga0157376_10282659 3300014969 Bacteria 1563
457 Ga0157376_10378279 3300014969 Unclassified 1363
458 Ga0182005_1000081 3300015265 Bacteria 73899
459 Ga0163161_10019399 3300017792 Bacteria 4771
460 Ga0163161_10358962 3300017792 Bacteria 1160
461 Ga0209436_100566 3300025208 Bacteria 15905
462 Ga0209436_102659 3300025208 Bacteria 5200
463 Ga0209258_100041 3300025242 Bacteria 381381
464 Ga0207425_1015563 3300025245 Bacteria 1704
465 Ga0209646_1000002 3300025246 Bacteria 1425781
466 Ga0209026_1000233 3300025250 Bacteria 74825
467 Ga0209148_1000090 3300025254 Bacteria 250982
468 Ga0207666_1004090 3300025271 Bacteria 1816
469 Ga0209673_1000034 3300025273 Bacteria 328788
470 Ga0209130_1001027 3300025284 Bacteria 21399
471 Ga0209564_1040205 3300025295 Bacteria 1273
472 Ga0209564_1043670 3300025295 Bacteria 1173
473 Ga0209758_1000419 3300025297 Bacteria 72133
474 Ga0209758_1061714 3300025297 Bacteria 1232
475 Ga0209050_1000353 3300025298 Bacteria 88509
476 Ga0207426_1000002 3300025302 Bacteria 1249660
477 Ga0207426_1000177 3300025302 Bacteria 159426
478 Ga0207426_1000324 3300025302 Bacteria 91661
479 Ga0207426_1000592 3300025302 Bacteria 47901
480 Ga0209257_1000001 3300025304 Bacteria 2274655
481 Ga0209257_1002086 3300025304 Bacteria 21027
482 Ga0207656_10046417 3300025321 Bacteria 1863
483 Ga0207656_10064710 3300025321 Bacteria 1612
484 Ga0207656_10405269 3300025321 Bacteria 686
485 Ga0207682_10038675 3300025893 Bacteria 1937
486 Ga0207682_10069708 3300025893 Bacteria 1487
487 Ga0207682_10086730 3300025893 Bacteria 1351
488 Ga0207682_10109391 3300025893 Unclassified 1215
489 Ga0207642_10040607 3300025899 Bacteria 2031
490 Ga0207710_10001075 3300025900 Bacteria 14094
491 Ga0207688_10033901 3300025901 Bacteria 2825
492 Ga0207688_10165903 3300025901 Bacteria 1311
493 Ga0207680_10000067 3300025903 Bacteria 46002
494 Ga0207680_10063588 3300025903 Unclassified 2259
495 Ga0207680_10348173 3300025903 Bacteria 1040
496 Ga0207647_10000962 3300025904 Bacteria 22327
497 Ga0207647_10005595 3300025904 Bacteria 9181
498 Ga0207647_10070519 3300025904 Unclassified 2111
499 Ga0207647_10395305 3300025904 Bacteria 779
500 Ga0207645_10001205 3300025907 Bacteria 21317
501 Ga0207645_10022729 3300025907 Bacteria 4077
502 Ga0207645_10123146 3300025907 Bacteria 1684
503 Ga0207645_10412634 3300025907 Bacteria 909
504 Ga0207645_10655112 3300025907 Bacteria 713
505 Ga0207643_10038079 3300025908 Bacteria 2700
506 Ga0207643_10133312 3300025908 Bacteria 1480
507 Ga0207643_10332560 3300025908 Bacteria 951
508 Ga0207705_10001654 3300025909 Bacteria 17699
509 Ga0207705_10087634 3300025909 Bacteria 2276
510 Ga0207705_10598273 3300025909 Bacteria 858
511 Ga0207654_10000661 3300025911 Bacteria 19557
512 Ga0207654_10000842 3300025911 Bacteria 16890
513 Ga0207654_10045682 3300025911 Bacteria 2494
514 Ga0207654_10061375 3300025911 Bacteria 2199
515 Ga0207654_10269864 3300025911 Bacteria 1147
516 Ga0207707_10000111 3300025912 Bacteria 82165
517 Ga0207707_10046161 3300025912 Bacteria 3794
518 Ga0207707_10252456 3300025912 Bacteria 1532
519 Ga0207707_10842167 3300025912 Bacteria 761
520 Ga0207695_10000051 3300025913 Bacteria 399641
521 Ga0207695_10000445 3300025913 Bacteria 90509
522 Ga0207695_10003973 3300025913 Bacteria 20423
523 Ga0207695_10008615 3300025913 Bacteria 12742
524 Ga0207695_10033063 3300025913 Bacteria 5649
525 Ga0207695_10034499 3300025913 Bacteria 5501
526 Ga0207695_10035604 3300025913 Bacteria 5395
527 Ga0207695_10037199 3300025913 Bacteria 5253
528 Ga0207695_10041787 3300025913 Bacteria 4905
529 Ga0207671_10001466 3300025914 Bacteria 27257
530 Ga0207671_10001776 3300025914 Bacteria 24234
531 Ga0207671_10001778 3300025914 Bacteria 24205
532 Ga0207671_10009206 3300025914 Bacteria 8283
533 Ga0207671_10047175 3300025914 Unclassified 3188
534 Ga0207671_10062520 3300025914 Bacteria 2765
535 Ga0207671_10066698 3300025914 Bacteria 2679
536 Ga0207671_10210864 3300025914 Bacteria 1519
537 Ga0207671_10297693 3300025914 Bacteria 1274
538 Ga0207671_10708656 3300025914 Bacteria 800
539 Ga0207663_10272622 3300025916 Bacteria 1254
540 Ga0207660_10001012 3300025917 Bacteria 18631
541 Ga0207660_10008720 3300025917 Bacteria 6557
542 Ga0207662_10007855 3300025918 Bacteria 5812
543 Ga0207657_10056435 3300025919 Bacteria 3388
544 Ga0207657_10142361 3300025919 Bacteria 1959
545 Ga0207657_10527838 3300025919 Bacteria 924
546 Ga0207649_10494043 3300025920 Bacteria 930
547 Ga0207649_10611983 3300025920 Bacteria 839
548 Ga0207649_10708614 3300025920 Bacteria 781
549 Ga0207652_10000538 3300025921 Bacteria 38475
550 Ga0207652_10000960 3300025921 Bacteria 26943
551 Ga0207681_10009782 3300025923 Bacteria 5865
552 Ga0207681_10100892 3300025923 Bacteria 2081
553 Ga0207681_10284840 3300025923 Bacteria 1302
554 Ga0207694_10019774 3300025924 Bacteria 5094
555 Ga0207694_10166674 3300025924 Bacteria 1782
556 Ga0207694_10177615 3300025924 Bacteria 1725
557 Ga0207694_10208658 3300025924 Bacteria 1591
558 Ga0207650_10122178 3300025925 Bacteria 2029
559 Ga0207650_10487853 3300025925 Bacteria 1029
560 Ga0207650_10523741 3300025925 Bacteria 992
561 Ga0207659_10050963 3300025926 Bacteria 2942
562 Ga0207659_10181728 3300025926 Bacteria 1667
563 Ga0207659_10305760 3300025926 Bacteria 1308
564 Ga0207659_10337561 3300025926 Bacteria 1247
565 Ga0207659_10954483 3300025926 Unclassified 737
566 Ga0207700_10666820 3300025928 Bacteria 928
567 Ga0207644_10024795 3300025931 Unclassified 4120
568 Ga0207644_10344197 3300025931 Bacteria 1210
569 Ga0207644_10451404 3300025931 Unclassified 1056
570 Ga0207644_10453883 3300025931 Bacteria 1053
571 Ga0207690_10014400 3300025932 Bacteria 4777
572 Ga0207690_10581579 3300025932 Unclassified 913
573 Ga0207686_10000715 3300025934 Bacteria 20597
574 Ga0207686_10017723 3300025934 Bacteria 4017
575 Ga0207709_10425454 3300025935 Bacteria 1021
576 Ga0207709_10516807 3300025935 Unclassified 934
577 Ga0207670_10114999 3300025936 Bacteria 1945
578 Ga0207670_10335349 3300025936 Bacteria 1194
579 Ga0207670_10480635 3300025936 Bacteria 1006
580 Ga0207669_10532252 3300025937 Bacteria 945
581 Ga0207669_10801201 3300025937 Unclassified 781
582 Ga0207704_10008049 3300025938 Bacteria 5016
583 Ga0207704_10011913 3300025938 Unclassified 4300
584 Ga0207704_10354387 3300025938 Bacteria 1143
585 Ga0207691_10004949 3300025940 Bacteria 12848
586 Ga0207691_10022643 3300025940 Bacteria 5925
587 Ga0207691_10062073 3300025940 Bacteria 3393
588 Ga0207691_10087508 3300025940 Bacteria 2795
589 Ga0207691_10445948 3300025940 Bacteria 1102
590 Ga0207691_10451683 3300025940 Bacteria 1094
591 Ga0207691_10893658 3300025940 Bacteria 744
592 Ga0207711_10035102 3300025941 Bacteria 4249
593 Ga0207711_10428060 3300025941 Bacteria 1231
594 Ga0207689_10002959 3300025942 Bacteria 15685
595 Ga0207689_10005262 3300025942 Bacteria 11600
596 Ga0207689_10021377 3300025942 Bacteria 5441
597 Ga0207689_10049862 3300025942 Bacteria 3454
598 Ga0207689_10074987 3300025942 Bacteria 2780
599 Ga0207689_10137046 3300025942 Bacteria 2015
600 Ga0207689_10501790 3300025942 Bacteria 1017
601 Ga0207661_10048009 3300025944 Bacteria 3391
602 Ga0207661_10563327 3300025944 Bacteria 1044
603 Ga0207667_10000100 3300025949 Bacteria 138482
604 Ga0207667_10004308 3300025949 Bacteria 17437
605 Ga0207667_10010209 3300025949 Bacteria 10997
606 Ga0207667_10080669 3300025949 Bacteria 3371
607 Ga0207667_11044148 3300025949 Bacteria 803
608 Ga0207651_10040147 3300025960 Bacteria 3093
609 Ga0207651_10145062 3300025960 Bacteria 1839
610 Ga0207651_10276251 3300025960 Bacteria 1386
611 Ga0207651_10551469 3300025960 Bacteria 1002
612 Ga0207651_10679689 3300025960 Bacteria 905
613 Ga0207712_10001156 3300025961 Bacteria 18384
614 Ga0207712_10024733 3300025961 Bacteria 3982
615 Ga0207712_10066027 3300025961 Unclassified 2585
616 Ga0207712_10125385 3300025961 Bacteria 1949
617 Ga0207712_10455434 3300025961 Unclassified 1086
618 Ga0207712_10536775 3300025961 Unclassified 1004
619 Ga0207712_11091321 3300025961 Bacteria 710
620 Ga0207668_10026438 3300025972 Bacteria 3768
621 Ga0207668_10151729 3300025972 Bacteria 1795
622 Ga0207668_10156325 3300025972 Unclassified 1772
623 Ga0207640_10027653 3300025981 Bacteria 3458
624 Ga0207640_10033995 3300025981 Bacteria 3178
625 Ga0207640_10059835 3300025981 Bacteria 2515
626 Ga0207640_10108050 3300025981 Bacteria 1965
627 Ga0207640_10130167 3300025981 Bacteria 1818
628 Ga0207640_10204918 3300025981 Bacteria 1498
629 Ga0207658_10005017 3300025986 Bacteria 9121
630 Ga0207658_10115803 3300025986 Bacteria 2128
631 Ga0207658_10206859 3300025986 Bacteria 1642
632 Ga0207658_10592578 3300025986 Bacteria 995
633 Ga0207658_11129000 3300025986 Bacteria 716
634 Ga0207677_10005993 3300026023 Bacteria 6623
635 Ga0207677_10056615 3300026023 Bacteria 2687
636 Ga0207677_10081379 3300026023 Bacteria 2324
637 Ga0207677_10188221 3300026023 Bacteria 1630
638 Ga0207677_10403403 3300026023 Bacteria 1160
639 Ga0207703_10017680 3300026035 Bacteria 5567
640 Ga0207703_10116123 3300026035 Unclassified 2291
641 Ga0207703_10395002 3300026035 Bacteria 1282
642 Ga0207703_10423639 3300026035 Bacteria 1239
643 Ga0207639_10070159 3300026041 Bacteria 2736
644 Ga0207639_10073596 3300026041 Bacteria 2679
645 Ga0207639_10249225 3300026041 Bacteria 1548
646 Ga0207639_10293226 3300026041 Bacteria 1435
647 Ga0207639_10522781 3300026041 Bacteria 1087
648 Ga0207639_10814362 3300026041 Bacteria 870
649 Ga0207678_10025947 3300026067 Bacteria 5112
650 Ga0207678_10145829 3300026067 Bacteria 2020
651 Ga0207678_10195723 3300026067 Bacteria 1728
652 Ga0207708_10193239 3300026075 Bacteria 1621
653 Ga0207708_10560726 3300026075 Bacteria 964
654 Ga0207702_10068314 3300026078 Bacteria 3053
655 Ga0207702_10075567 3300026078 Bacteria 2911
656 Ga0207702_10241282 3300026078 Bacteria 1693
657 Ga0207641_10000090 3300026088 Bacteria 127735
658 Ga0207641_10000213 3300026088 Bacteria 75051
659 Ga0207641_10008579 3300026088 Bacteria 8440
660 Ga0207641_10018040 3300026088 Bacteria 5784
661 Ga0207641_10175968 3300026088 Bacteria 1957
662 Ga0207648_10000653 3300026089 Bacteria 38843
663 Ga0207648_10029361 3300026089 Bacteria 4876
664 Ga0207648_10039157 3300026089 Bacteria 4168
665 Ga0207648_10129072 3300026089 Bacteria 2225
666 Ga0207648_10304164 3300026089 Unclassified 1430
667 Ga0207648_10377254 3300026089 Bacteria 1282
668 Ga0207648_10430457 3300026089 Bacteria 1199
669 Ga0207676_10547419 3300026095 Bacteria 1105
670 Ga0207676_11347755 3300026095 Bacteria 709
671 Ga0207674_10003443 3300026116 Bacteria 19359
672 Ga0207674_10060763 3300026116 Bacteria 3821
673 Ga0207674_10065745 3300026116 Bacteria 3654
674 Ga0207674_10165009 3300026116 Bacteria 2169
675 Ga0207675_100007715 3300026118 Bacteria 10158
676 Ga0207675_100008836 3300026118 Bacteria 9455
677 Ga0207675_100081577 3300026118 Bacteria 3032
678 Ga0207675_100120696 3300026118 Bacteria 2480
679 Ga0207675_100172010 3300026118 Bacteria 2071
680 Ga0207675_100288819 3300026118 Bacteria 1595
681 Ga0207675_100879105 3300026118 Bacteria 912
682 Ga0207675_101038578 3300026118 Bacteria 838
683 Ga0207683_10048943 3300026121 Bacteria 3699
684 Ga0207683_10076782 3300026121 Bacteria 2958
685 Ga0207683_10093220 3300026121 Bacteria 2684
686 Ga0207683_10269701 3300026121 Bacteria 1555
687 Ga0207683_10326373 3300026121 Bacteria 1406
688 Ga0207698_10000108 3300026142 Bacteria 51893
689 Ga0207698_10011126 3300026142 Bacteria 5817
690 Ga0207698_10373847 3300026142 Bacteria 1354
691 Ga0268266_10000016 3300028379 Bacteria 629101
692 Ga0268266_10295182 3300028379 Unclassified 1510
693 Ga0268265_10060552 3300028380 Bacteria 2902
694 Ga0268265_10166956 3300028380 Bacteria 1877
695 Ga0268264_10000072 3300028381 Bacteria 260791
696 Ga0268264_10002720 3300028381 Bacteria 15431
697 Ga0268264_10007598 3300028381 Bacteria 9037
698 Ga0268264_10033282 3300028381 Bacteria 4233
699 Ga0268264_10063504 3300028381 Bacteria 3104
700 Ga0268264_10065820 3300028381 Bacteria 3054
701 Ga0268264_10102717 3300028381 Bacteria 2488
702 Ga0268264_10157870 3300028381 Unclassified 2040
703 Ga0268264_10487970 3300028381 Bacteria 1199
704 Ga0268264_10603980 3300028381 Bacteria 1081
705 Ga0265336_10120897 3300028666 Bacteria 780
706 Ga0307517_10000697 3300028786 Bacteria 57970
707 Ga0307515_10000078 3300028794 Bacteria 227988
708 Ga0307511_10001896 3300030521 Bacteria 21954
709 Ga0265325_10249205 3300031241 Bacteria 805
710 Ga0265327_10045037 3300031251 Bacteria 2347
711 Ga0307509_10036817 3300031507 Bacteria 5354
712 Ga0307509_10123147 3300031507 Bacteria 2566
713 Ga0265313_10153091 3300031595 Bacteria 984
714 Ga0307508_10266838 3300031616 Bacteria 1306
715 Ga0307508_10346038 3300031616 Bacteria 1078
716 Ga0307516_10265817 3300031730 Bacteria 1404
717 Ga0307413_10292765 3300031824 Bacteria 1231
718 Ga0307413_10356087 3300031824 Bacteria 1131
719 Ga0307410_10490665 3300031852 Bacteria 1009
720 Ga0307406_10642526 3300031901 Bacteria 880
721 Ga0307407_10388672 3300031903 Bacteria 998
722 Ga0307412_10466060 3300031911 Bacteria 1044
723 Ga0307416_100672015 3300032002 Bacteria 1122
724 Ga0307414_10374474 3300032004 Bacteria 1229
725 Ga0307414_10870488 3300032004 Bacteria 825
726 Ga0307411_10050097 3300032005 Bacteria 2718
727 Ga0307411_11275172 3300032005 Bacteria 669
728 Ga0307415_100132561 3300032126 Bacteria 1889
729 Ga0307510_10001712 3300033180 Bacteria 24371
730 Ga0307510_10362291 3300033180 Bacteria 898
731 Ga0373955_0241292 3300035172 Bacteria 1082
732 Ga0373927_0100179 3300035695 Bacteria 1884
733 Ga0373933_0136478 3300035724 Bacteria 1546
734 Ga0373937_0139076 3300036401 Unclassified 2271
735 Ga0373937_0459222 3300036401 Bacteria 1210
736 Ga0395899_0014889 3300037312 Bacteria 5935
737 Ga0395900_0016890 3300037418 Bacteria 7450
738 Ga0395900_0182795 3300037418 Bacteria 2130
739 Ga0395900_0525978 3300037418 Bacteria 1130
740 Ga0395900_0550511 3300037418 Bacteria 1098
741 Ga0395898_0112161 3300037466 Unclassified 2613
742 Ga0395905_0001861 3300037471 Bacteria 24297
743 Ga0395905_0065531 3300037471 Bacteria 3401
744 Ga0395901_0089556 3300038443 Bacteria 3220
745 Ga0395901_0103349 3300038443 Bacteria 2990
746 Ga0436365_0289942 3300039437 Bacteria 1350
747 Ga0439436_0006955 3300041404 Bacteria 3479
748 Ga0439436_0048147 3300041404 Bacteria 1210
749 Ga0439439_0005738 3300041406 Bacteria 2847
750 Ga0439439_0051855 3300041406 Bacteria 1076
751 Ga0451787_202726 3300041441 Bacteria 607
752 Ga0451802_1082803 3300041460 Bacteria 1150
753 Ga0451804_0420865 3300041463 Bacteria 1398
754 Ga0451807_2236118 3300041486 Bacteria 852
755 Ga0451849_0258145 3300041505 Bacteria 706
756 Ga0451853_0569222 3300041512 Bacteria 749
757 Ga0451853_1768614 3300041512 Bacteria 1577
758 Ga0451853_3831587 3300041512 Bacteria 834
759 Ga0439431_0017465 3300041997 Bacteria 1688
760 Ga0439449_0004710 3300042007 Bacteria 5267
761 Ga0439449_0138673 3300042007 Bacteria 905
762 Ga0439449_0185269 3300042007 Bacteria 778
763 Ga0439457_009584 3300042014 Bacteria 2250
764 Ga0439457_023623 3300042014 Bacteria 1360
765 Ga0439457_037992 3300042014 Bacteria 1072
766 Ga0439457_091971 3300042014 Bacteria 702
767 Ga0439462_0011206 3300042015 Bacteria 2280
768 Ga0450923_006726 3300042125 Bacteria 1917
769 Ga0451577_0025828 3300042876 Bacteria 5326
770 Ga0466969_0000754 3300044656 Bacteria 17561
771 Ga0466972_0004958 3300044658 Bacteria 6683
772 Ga0466972_0008365 3300044658 Bacteria 5184
773 Ga0466966_0000030 3300044684 Bacteria 103300
774 Ga0466966_0346352 3300044684 Bacteria 893
775 Ga0466961_0134492 3300044693 Bacteria 1549
776 Ga0466971_0009829 3300044719 Bacteria 4177
777 Ga0466971_0053325 3300044719 Bacteria 1822
778 Ga0466971_0078081 3300044719 Bacteria 1508
779 Ga0466968_0080577 3300044735 Bacteria 1430
780 Ga0466968_0081931 3300044735 Bacteria 1419
781 Ga0466968_0193259 3300044735 Bacteria 950
782 Ga0466968_0458851 3300044735 Bacteria 631
783 Ga0466957_0009182 3300044842 Bacteria 5640
784 Ga0466957_0011478 3300044842 Bacteria 5113
785 Ga0466957_0111966 3300044842 Bacteria 1732
786 Ga0466960_0406241 3300044901 Bacteria 785
787 Ga0466959_0000269 3300045049 Bacteria 31896
788 Ga0466959_0002150 3300045049 Bacteria 12505
789 Ga0466959_0045485 3300045049 Bacteria 3232
790 Ga0466958_0110840 3300045836 Bacteria 1713
791 Ga0495627_013864 3300046453 Bacteria 2828
792 Ga0495638_0017086 3300046460 Bacteria 4846
793 Ga0495638_0154815 3300046460 Bacteria 1327
794 Ga0495651_0130068 3300046462 Bacteria 1839
795 Ga0495650_0115811 3300046471 Bacteria 990
796 Ga0495580_0038332 3300046472 Bacteria 3433
797 Ga0495580_0112467 3300046472 Bacteria 1891
798 Ga0495582_0088992 3300046473 Unclassified 1720
799 Ga0495664_0341061 3300046477 Bacteria 903
800 Ga0495606_0004456 3300046507 Bacteria 13980
801 Ga0495630_0247352 3300046517 Bacteria 1362
802 Ga0495630_0252397 3300046517 Bacteria 1348
803 Ga0495632_0157321 3300046519 Bacteria 1048
804 Ga0495648_0011969 3300046524 Bacteria 6504
805 Ga0495665_0187618 3300046531 Bacteria 1073
806 Ga0495586_0145441 3300046535 Bacteria 1332
807 Ga0495587_0260229 3300046536 Bacteria 975
808 Ga0495621_0015348 3300046539 Unclassified 2442
809 Ga0495622_0374054 3300046557 Bacteria 615
810 Ga0495633_0000175 3300046558 Bacteria 83653
811 Ga0495668_0000108 3300046616 Bacteria 132593
812 Ga0495668_0005589 3300046616 Bacteria 8454
813 Ga0495634_0115218 3300046642 Unclassified 1725
814 Ga0495611_0000011 3300046648 Bacteria 146643
815 Ga0495611_0104811 3300046648 Unclassified 1315
816 Ga0495625_0475451 3300046660 Bacteria 768
817 Ga0495623_0264615 3300046679 Bacteria 962
818 Ga0495647_0237843 3300046681 Bacteria 808
819 Ga0495658_0042870 3300046683 Bacteria 2528
820 Ga0495624_0610335 3300046690 Bacteria 650
821 Ga0495670_0309935 3300046691 Bacteria 847
822 Ga0495604_0220578 3300047317 Bacteria 1305
823 Ga0495672_0014438 3300047320 Bacteria 5408
824 Ga0495672_0041053 3300047320 Bacteria 2801
825 Ga0495676_0262431 3300047321 Bacteria 1175
826 Ga0495676_0387687 3300047321 Bacteria 929
827 Ga0495687_000004 3300047443 Bacteria 779298
828 Ga0495677_0194934 3300047445 Bacteria 787
829 Ga0495686_0000165 3300047472 Bacteria 125611
830 Ga0496101_0546953 3300048904 Bacteria 915
831 Ga0496105_0099960 3300048908 Bacteria 2396
832 Ga0496115_0132318 3300048918 Bacteria 2056
833 Ga0496115_0906618 3300048918 Bacteria 679
834 Ga0496118_0278248 3300048921 Bacteria 933
835 Ga0496121_0000030 3300048924 Bacteria 412079
836 Ga0496126_0047240 3300048929 Bacteria 3942
837 Ga0496126_1017685 3300048929 Bacteria 621
838 Ga0501298_000289 3300049521 Bacteria 6655
839 Ga0501299_032352 3300049522 Bacteria 1015
840 Ga0501031_0142009 3300049568 Bacteria 1569
841 Ga0501032_0761224 3300049569 Bacteria 612
842 Ga0501034_0305168 3300049571 Bacteria 1527
843 Ga0501034_0455430 3300049571 Bacteria 1197
844 Ga0501034_0710319 3300049571 Bacteria 903
845 Ga0501036_0003520 3300049572 Bacteria 12524
846 Ga0501037_0008893 3300049573 Bacteria 7355
847 Ga0501037_0214124 3300049573 Bacteria 1358
848 Ga0501038_0009081 3300049574 Bacteria 9125
849 Ga0501038_0655038 3300049574 Bacteria 790
850 Ga0501039_0011833 3300049575 Bacteria 6644
851 Ga0501039_0600173 3300049575 Bacteria 863
852 Ga0501043_0018866 3300049579 Bacteria 5414
853 Ga0501046_0026580 3300049580 Bacteria 4727
854 Ga0501047_0030087 3300049581 Bacteria 5235
855 Ga0501047_0687940 3300049581 Bacteria 841
856 Ga0501048_0079968 3300049582 Bacteria 2307
857 Ga0501067_0149864 3300049583 Bacteria 1299
858 Ga0501068_0028446 3300049584 Bacteria 3306
859 Ga0501070_0057509 3300049586 Bacteria 3223
860 Ga0501071_0107006 3300049587 Bacteria 2065
861 Ga0501073_0054158 3300049589 Bacteria 2809
862 Ga0501073_0736801 3300049589 Bacteria 680
863 Ga0501074_0024502 3300049590 Unclassified 4386
864 Ga0501198_021314 3300049649 Bacteria 1032
865 Ga0501201_021143 3300049651 Bacteria 691
866 Ga0501202_000865 3300049652 Bacteria 4607
867 Ga0501202_006743 3300049652 Bacteria 2063
868 Ga0501202_051768 3300049652 Bacteria 911
869 Ga0501207_002781 3300049654 Bacteria 2283
870 Ga0501207_021214 3300049654 Bacteria 1042
871 Ga0501208_008248 3300049655 Bacteria 1399
872 Ga0501217_002224 3300049661 Bacteria 3785
873 Ga0501217_032587 3300049661 Bacteria 1290
874 Ga0501222_000982 3300049662 Bacteria 4085
875 Ga0501223_000157 3300049663 Bacteria 17995
876 Ga0501224_000664 3300049664 Bacteria 4275
877 Ga0501228_010121 3300049666 Bacteria 932
878 Ga0501233_000669 3300049668 Bacteria 5619
879 Ga0501235_000828 3300049669 Bacteria 6342
880 Ga0501240_002622 3300049673 Bacteria 1927
881 Ga0501242_005934 3300049674 Bacteria 1386
882 Ga0501243_000215 3300049675 Bacteria 7095
883 Ga0501250_006524 3300049680 Bacteria 1237
884 Ga0501250_007292 3300049680 Bacteria 1191
885 Ga0501252_000578 3300049682 Bacteria 2891
886 Ga0501253_000895 3300049683 Bacteria 2811
887 Ga0501257_004810 3300049686 Bacteria 2957
888 Ga0501259_000181 3300049688 Bacteria 9543
889 Ga0501259_002966 3300049688 Bacteria 2721
890 Ga0501259_071355 3300049688 Bacteria 745
891 Ga0501261_005649 3300049690 Bacteria 1579
892 Ga0501261_050559 3300049690 Bacteria 680
893 Ga0501219_000812 3300049703 Bacteria 4068
894 Ga0501221_000080 3300049704 Bacteria 10925
895 Ga0501225_0001083 3300049705 Bacteria 8547
896 Ga0501225_0002530 3300049705 Bacteria 5650
897 Ga0501225_0007474 3300049705 Bacteria 3165
898 Ga0501234_000581 3300049707 Bacteria 5611
899 Ga0501245_000311 3300049708 Bacteria 5731
900 Ga0501245_003557 3300049708 Bacteria 2119
901 Ga0501079_0076381 3300049741 Bacteria 2591
902 Ga0501080_0039984 3300049742 Bacteria 4376
903 Ga0501080_0513414 3300049742 Bacteria 1070
904 Ga0501083_0174751 3300049744 Bacteria 1403
905 Ga0501232_010289 3300049757 Bacteria 1051
906 Ga0501241_001105 3300049758 Bacteria 5686
907 Ga0501241_004302 3300049758 Bacteria 2674
908 Ga0501241_043990 3300049758 Bacteria 871
909 Ga0501266_005705 3300049763 Bacteria 1547
910 Ga0501268_052523 3300049765 Bacteria 792
911 Ga0501269_013559 3300049766 Bacteria 998
912 Ga0501271_012917 3300049768 Bacteria 910
913 Ga0501278_009862 3300049774 Bacteria 755
914 Ga0501044_0006136 3300049823 Bacteria 13269
915 Ga0501044_0019334 3300049823 Bacteria 7288
916 Ga0501044_0038980 3300049823 Bacteria 4960
917 Ga0501044_0099172 3300049823 Bacteria 2932
918 Ga0501044_0398168 3300049823 Bacteria 1290
919 Ga0501044_0512092 3300049823 Bacteria 1100
920 Ga0501045_0375742 3300049824 Bacteria 1058
921 Ga0501212_036903 3300049851 Bacteria 800
922 Ga0501284_00105 3300050005 Bacteria 17011
923 nmdc:mga0k408_11997_c1 3300050493 Bacteria 4728
924 nmdc:mga0k408_162047_c1 3300050493 Bacteria 1333
925 nmdc:mga0k408_40690_c1 3300050493 Bacteria 2675
926 nmdc:mga05p37_1130996_c1 3300050507 Bacteria 817
927 nmdc:mga05p37_194882_c1 3300050507 Unclassified 2457
928 nmdc:mga09592_12177_c1 3300050508 Bacteria 7001
929 nmdc:mga09592_14034_c1 3300050508 Bacteria 6541
930 nmdc:mga09592_553442_c1 3300050508 Bacteria 988
931 nmdc:mga0qj67_51192_c1 3300050509 Bacteria 3265
932 nmdc:mga0qj67_61545_c1 3300050509 Unclassified 2981
933 nmdc:mga08y16_260978_c1 3300050511 Bacteria 1789
934 nmdc:mga0a205_923055_c1 3300050515 Bacteria 720
935 Ga0495619_0125939 3300053085 Bacteria 1758
936 Ga0500578_0000120 3300053086 Bacteria 95463
937 Ga0500644_0129574 3300053088 Bacteria 992
938 Ga0500644_0230791 3300053088 Bacteria 775
939 Ga0500646_0010270 3300053090 Bacteria 2402
940 Ga0500583_0000120 3300053092 Bacteria 37819
941 Ga0500583_0006739 3300053092 Bacteria 3981
942 Ga0500583_0012437 3300053092 Bacteria 3246
943 Ga0500583_0064385 3300053092 Bacteria 1739
944 Ga0500651_0047942 3300053093 Bacteria 2685
945 Ga0500651_0438006 3300053093 Bacteria 729
946 Ga0500651_0467566 3300053093 Bacteria 699
947 Ga0500650_0078790 3300053098 Bacteria 1540
948 Ga0500556_0124325 3300053104 Bacteria 1008
949 Ga0500569_000517 3300053109 Bacteria 6437
950 Ga0500594_0053167 3300053118 Bacteria 1147
951 Ga0500594_0147661 3300053118 Bacteria 754
952 Ga0500642_0003619 3300053130 Bacteria 4702
953 Ga0500642_0074754 3300053130 Unclassified 1547
954 Ga0500652_006848 3300053131 Bacteria 3695
955 Ga0500652_083867 3300053131 Bacteria 1328
956 Ga0500655_013508 3300053133 Unclassified 1491
957 Ga0500655_016309 3300053133 Bacteria 1368
958 Ga0500559_0003554 3300053136 Bacteria 7625
959 Ga0500568_0083274 3300053139 Unclassified 1212
960 Ga0500568_0175869 3300053139 Bacteria 787
961 Ga0500573_0126264 3300053140 Bacteria 1420
962 Ga0500573_0171265 3300053140 Unclassified 1174
963 Ga0500577_0005167 3300053142 Bacteria 3498
964 Ga0500579_145570 3300053143 Bacteria 1053
965 Ga0500589_053266 3300053147 Bacteria 1873
966 Ga0500604_0002303 3300053151 Bacteria 5221
967 Ga0500616_0003236 3300053153 Bacteria 12618
968 Ga0500616_0004758 3300053153 Bacteria 9542
969 Ga0500616_0025280 3300053153 Bacteria 3294
970 Ga0500622_0001475 3300053156 Bacteria 18735
971 Ga0500622_0002131 3300053156 Bacteria 14740
972 Ga0500627_0194614 3300053158 Bacteria 910
973 Ga0500633_0043943 3300053160 Bacteria 1514
974 Ga0500634_0090702 3300053161 Bacteria 1552
975 Ga0500636_0007397 3300053177 Bacteria 6354
976 Ga0500611_067885 3300053727 Bacteria 861
977 Ga0500661_016479 3300055283 Bacteria 1321
978 Ga0500661_034890 3300055283 Bacteria 889
979 Ga0501082_0099557 3300060353 Bacteria 2513
980 Ga0466962_0004595 3300061719 Bacteria 6624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0041053 Ga0495672_0041053_230_805 181
2 3300048929 Ga0496126_1017685 Ga0496126_1017685_10_561 181
3 3300049569 Ga0501032_0761224 Ga0501032_0761224_13_573 183
4 iso_pu_bacteria 2738541278 2738731491 184
5 iso_pu_bacteria 2818991442 2819573238 184
6 iso_pu_bacteria 2821136567 2821136658 184
7 iso_pu_bacteria 2881955468 2881958640 184
8 iso_pu_bacteria 2904467357 2904468597 184
9 iso_pu_bacteria 2818991460 2819681930 185
10 iso_pu_bacteria 2884791551 2884795977 185
11 iso_pu_bacteria 2929177148 2929178514 185
12 iso_pu_bacteria 2929239360 2929240847 185
13 iso_pu_bacteria 2929921140 2929922888 185
14 iso_pu_bacteria 2945977869 2945980915 185
15 iso_pu_bacteria 2946013367 2946019684 185
16 iso_pu_bacteria 8003151029 8003154714 185
17 3300003320 rootH2_10087314 rootH2_100873141 187
18 3300003320 rootH2_10090059 rootH2_100900593 187
19 3300005289 Ga0065704_10029955 Ga0065704_100299552 187
20 3300005289 Ga0065704_10244930 Ga0065704_102449302 187
21 3300005290 Ga0065712_10014379 Ga0065712_100143792 187
22 3300005290 Ga0065712_10029565 Ga0065712_100295651 187
23 3300005295 Ga0065707_10385028 Ga0065707_103850282 187
24 3300005329 Ga0070683_100030331 Ga0070683_1000303314 187
25 3300005331 Ga0070670_100150457 Ga0070670_1001504573 187
26 3300005331 Ga0070670_100231408 Ga0070670_1002314082 187
27 3300005334 Ga0068869_100006542 Ga0068869_1000065421 187
28 3300005334 Ga0068869_100167040 Ga0068869_1001670403 187
29 3300005337 Ga0070682_100627674 Ga0070682_1006276741 187
30 3300005338 Ga0068868_100221867 Ga0068868_1002218672 187
31 3300005341 Ga0070691_10415273 Ga0070691_104152731 187
32 3300005343 Ga0070687_100011322 Ga0070687_1000113222 187
33 3300005344 Ga0070661_101133903 Ga0070661_1011339031 187
34 3300005354 Ga0070675_100129986 Ga0070675_1001299862 187
35 3300005354 Ga0070675_100290018 Ga0070675_1002900182 187
36 3300005354 Ga0070675_100770431 Ga0070675_1007704312 187
37 3300005364 Ga0070673_100276452 Ga0070673_1002764522 187
38 3300005364 Ga0070673_100276840 Ga0070673_1002768402 187
39 3300005365 Ga0070688_100645700 Ga0070688_1006457001 187
40 3300005367 Ga0070667_100457465 Ga0070667_1004574651 187
41 3300005367 Ga0070667_100575414 Ga0070667_1005754142 187
42 3300005441 Ga0070700_100010950 Ga0070700_1000109505 187
43 3300005444 Ga0070694_100129554 Ga0070694_1001295542 187
44 3300005458 Ga0070681_10024676 Ga0070681_100246763 187
45 3300005459 Ga0068867_100688958 Ga0068867_1006889581 187
46 3300005535 Ga0070684_100001895 Ga0070684_1000018957 187
47 3300005539 Ga0068853_100008728 Ga0068853_1000087288 187
48 3300005539 Ga0068853_100088156 Ga0068853_1000881561 187
49 3300005543 Ga0070672_100047689 Ga0070672_1000476894 187
50 3300005543 Ga0070672_100475207 Ga0070672_1004752071 187
51 3300005548 Ga0070665_100000008 Ga0070665_100000008355 187
52 3300005563 Ga0068855_100001250 Ga0068855_1000012506 187
53 3300005563 Ga0068855_100025826 Ga0068855_1000258268 187
54 3300005563 Ga0068855_100091452 Ga0068855_1000914525 187
55 3300005577 Ga0068857_100281164 Ga0068857_1002811643 187
56 3300005577 Ga0068857_100523938 Ga0068857_1005239381 187
57 3300005578 Ga0068854_100014439 Ga0068854_1000144395 187
58 3300005578 Ga0068854_100201852 Ga0068854_1002018521 187
59 3300005614 Ga0068856_100379535 Ga0068856_1003795352 187
60 3300005615 Ga0070702_100216324 Ga0070702_1002163241 187
61 3300005616 Ga0068852_100000180 Ga0068852_10000018014 187
62 3300005616 Ga0068852_100303661 Ga0068852_1003036612 187
63 3300005617 Ga0068859_100083124 Ga0068859_1000831244 187
64 3300005617 Ga0068859_100384798 Ga0068859_1003847982 187
65 3300005617 Ga0068859_100780385 Ga0068859_1007803852 187
66 3300005719 Ga0068861_100080332 Ga0068861_1000803323 187
67 3300005840 Ga0068870_10025539 Ga0068870_100255391 187
68 3300005841 Ga0068863_100503435 Ga0068863_1005034352 187
69 3300005841 Ga0068863_100650341 Ga0068863_1006503411 187
70 3300005841 Ga0068863_101267734 Ga0068863_1012677341 187
71 3300005841 Ga0068863_101291900 Ga0068863_1012919002 187
72 3300005842 Ga0068858_100822543 Ga0068858_1008225432 187
73 3300005843 Ga0068860_100000029 Ga0068860_100000029189 187
74 3300005843 Ga0068860_100130163 Ga0068860_1001301632 187
75 3300005844 Ga0068862_100236663 Ga0068862_1002366633 187
76 3300005983 Ga0081540_1074941 Ga0081540_10749412 187
77 3300006237 Ga0097621_100077083 Ga0097621_1000770832 187
78 3300006358 Ga0068871_100020023 Ga0068871_1000200234 187
79 3300006358 Ga0068871_100165258 Ga0068871_1001652583 187
80 3300006358 Ga0068871_100414105 Ga0068871_1004141052 187
81 3300006844 Ga0075428_100025171 Ga0075428_1000251715 187
82 3300006846 Ga0075430_100021698 Ga0075430_1000216985 187
83 3300006880 Ga0075429_100081239 Ga0075429_1000812393 187
84 3300006881 Ga0068865_100316585 Ga0068865_1003165852 187
85 3300006931 Ga0097620_100083124 Ga0097620_1000831244 187
86 3300006931 Ga0097620_100384790 Ga0097620_1003847902 187
87 3300006931 Ga0097620_100780398 Ga0097620_1007803981 187
88 3300009093 Ga0105240_10001800 Ga0105240_1000180018 187
89 3300009093 Ga0105240_10003982 Ga0105240_1000398210 187
90 3300009093 Ga0105240_10008182 Ga0105240_100081821 187
91 3300009093 Ga0105240_10010900 Ga0105240_100109001 187
92 3300009093 Ga0105240_10050422 Ga0105240_100504225 187
93 3300009093 Ga0105240_10099692 Ga0105240_100996923 187
94 3300009093 Ga0105240_10117609 Ga0105240_101176095 187
95 3300009147 Ga0114129_10153798 Ga0114129_101537985 187
96 3300009147 Ga0114129_10208548 Ga0114129_102085483 187
97 3300009174 Ga0105241_10001098 Ga0105241_1000109814 187
98 3300009174 Ga0105241_10275092 Ga0105241_102750922 187
99 3300009174 Ga0105241_10515071 Ga0105241_105150711 187
100 3300009176 Ga0105242_10350443 Ga0105242_103504432 187
101 3300009176 Ga0105242_10936432 Ga0105242_109364321 187
102 3300009177 Ga0105248_10417121 Ga0105248_104171212 187
103 3300009545 Ga0105237_10000780 Ga0105237_1000078014 187
104 3300009545 Ga0105237_10003152 Ga0105237_1000315218 187
105 3300009545 Ga0105237_10013020 Ga0105237_100130209 187
106 3300009545 Ga0105237_10026858 Ga0105237_100268586 187
107 3300009545 Ga0105237_10135210 Ga0105237_101352104 187
108 3300009545 Ga0105237_10346499 Ga0105237_103464992 187
109 3300009551 Ga0105238_10032669 Ga0105238_100326691 187
110 3300009551 Ga0105238_10037294 Ga0105238_100372943 187
111 3300009551 Ga0105238_10045389 Ga0105238_100453896 187
112 3300009551 Ga0105238_10056683 Ga0105238_100566834 187
113 3300009551 Ga0105238_10291713 Ga0105238_102917132 187
114 3300009553 Ga0105249_10497010 Ga0105249_104970102 187
115 3300010375 Ga0105239_10000135 Ga0105239_1000013520 187
116 3300010375 Ga0105239_10000337 Ga0105239_1000033719 187
117 3300010375 Ga0105239_10011821 Ga0105239_100118215 187
118 3300010375 Ga0105239_10066192 Ga0105239_100661922 187
119 3300011119 Ga0105246_10432029 Ga0105246_104320292 187
120 3300013100 Ga0157373_10048519 Ga0157373_100485193 187
121 3300013100 Ga0157373_10171891 Ga0157373_101718912 187
122 3300013104 Ga0157370_10029393 Ga0157370_100293933 187
123 3300013104 Ga0157370_10030890 Ga0157370_100308903 187
124 3300013104 Ga0157370_10620046 Ga0157370_106200462 187
125 3300013105 Ga0157369_10014091 Ga0157369_100140911 187
126 3300013105 Ga0157369_10044422 Ga0157369_100444222 187
127 3300013296 Ga0157374_10000009 Ga0157374_10000009306 187
128 3300013306 Ga0163162_10041885 Ga0163162_100418853 187
129 3300013306 Ga0163162_10924282 Ga0163162_109242821 187
130 3300013307 Ga0157372_10000258 Ga0157372_1000025828 187
131 3300013307 Ga0157372_10002260 Ga0157372_100022604 187
132 3300013307 Ga0157372_10011005 Ga0157372_100110054 187
133 3300013307 Ga0157372_10023612 Ga0157372_100236128 187
134 3300013307 Ga0157372_10777371 Ga0157372_107773712 187
135 3300013308 Ga0157375_10322028 Ga0157375_103220283 187
136 3300013308 Ga0157375_10789262 Ga0157375_107892621 187
137 3300014325 Ga0163163_10166806 Ga0163163_101668062 187
138 3300014325 Ga0163163_11808531 Ga0163163_118085311 187
139 3300014326 Ga0157380_10053087 Ga0157380_100530872 187
140 3300014326 Ga0157380_10809469 Ga0157380_108094691 187
141 3300014745 Ga0157377_10137773 Ga0157377_101377732 187
142 3300014968 Ga0157379_10119948 Ga0157379_101199483 187
143 3300014969 Ga0157376_10001803 Ga0157376_100018033 187
144 3300025271 Ga0207666_1004090 Ga0207666_10040902 187
145 3300025321 Ga0207656_10064710 Ga0207656_100647102 187
146 3300025893 Ga0207682_10109391 Ga0207682_101093912 187
147 3300025901 Ga0207688_10165903 Ga0207688_101659031 187
148 3300025904 Ga0207647_10005595 Ga0207647_100055956 187
149 3300025907 Ga0207645_10123146 Ga0207645_101231462 187
150 3300025908 Ga0207643_10133312 Ga0207643_101333122 187
151 3300025911 Ga0207654_10045682 Ga0207654_100456821 187
152 3300025911 Ga0207654_10061375 Ga0207654_100613753 187
153 3300025911 Ga0207654_10269864 Ga0207654_102698641 187
154 3300025912 Ga0207707_10252456 Ga0207707_102524561 187
155 3300025912 Ga0207707_10842167 Ga0207707_108421671 187
156 3300025913 Ga0207695_10000051 Ga0207695_10000051299 187
157 3300025913 Ga0207695_10000445 Ga0207695_1000044563 187
158 3300025913 Ga0207695_10003973 Ga0207695_100039736 187
159 3300025913 Ga0207695_10008615 Ga0207695_1000861511 187
160 3300025913 Ga0207695_10033063 Ga0207695_100330632 187
161 3300025913 Ga0207695_10034499 Ga0207695_100344996 187
162 3300025913 Ga0207695_10037199 Ga0207695_100371996 187
163 3300025913 Ga0207695_10041787 Ga0207695_100417872 187
164 3300025914 Ga0207671_10001466 Ga0207671_1000146621 187
165 3300025914 Ga0207671_10001778 Ga0207671_100017784 187
166 3300025914 Ga0207671_10009206 Ga0207671_100092063 187
167 3300025914 Ga0207671_10047175 Ga0207671_100471752 187
168 3300025914 Ga0207671_10062520 Ga0207671_100625202 187
169 3300025914 Ga0207671_10210864 Ga0207671_102108642 187
170 3300025918 Ga0207662_10007855 Ga0207662_100078552 187
171 3300025924 Ga0207694_10019774 Ga0207694_100197742 187
172 3300025924 Ga0207694_10166674 Ga0207694_101666743 187
173 3300025924 Ga0207694_10177615 Ga0207694_101776151 187
174 3300025924 Ga0207694_10208658 Ga0207694_102086582 187
175 3300025925 Ga0207650_10122178 Ga0207650_101221782 187
176 3300025926 Ga0207659_10050963 Ga0207659_100509633 187
177 3300025926 Ga0207659_10954483 Ga0207659_109544831 187
178 3300025931 Ga0207644_10344197 Ga0207644_103441972 187
179 3300025934 Ga0207686_10000715 Ga0207686_100007152 187
180 3300025936 Ga0207670_10114999 Ga0207670_101149992 187
181 3300025940 Ga0207691_10022643 Ga0207691_100226433 187
182 3300025940 Ga0207691_10893658 Ga0207691_108936581 187
183 3300025941 Ga0207711_10428060 Ga0207711_104280602 187
184 3300025942 Ga0207689_10021377 Ga0207689_100213774 187
185 3300025942 Ga0207689_10049862 Ga0207689_100498622 187
186 3300025944 Ga0207661_10048009 Ga0207661_100480092 187
187 3300025949 Ga0207667_10000100 Ga0207667_10000100104 187
188 3300025949 Ga0207667_10004308 Ga0207667_1000430813 187
189 3300025949 Ga0207667_10080669 Ga0207667_100806692 187
190 3300025960 Ga0207651_10145062 Ga0207651_101450622 187
191 3300025960 Ga0207651_10276251 Ga0207651_102762511 187
192 3300025961 Ga0207712_10066027 Ga0207712_100660273 187
193 3300025961 Ga0207712_10455434 Ga0207712_104554342 187
194 3300025961 Ga0207712_11091321 Ga0207712_110913212 187
195 3300025972 Ga0207668_10151729 Ga0207668_101517292 187
196 3300025981 Ga0207640_10033995 Ga0207640_100339954 187
197 3300025981 Ga0207640_10108050 Ga0207640_101080503 187
198 3300025981 Ga0207640_10204918 Ga0207640_102049181 187
199 3300025986 Ga0207658_10592578 Ga0207658_105925782 187
200 3300026023 Ga0207677_10403403 Ga0207677_104034032 187
201 3300026035 Ga0207703_10116123 Ga0207703_101161233 187
202 3300026041 Ga0207639_10249225 Ga0207639_102492252 187
203 3300026041 Ga0207639_10293226 Ga0207639_102932262 187
204 3300026075 Ga0207708_10193239 Ga0207708_101932392 187
205 3300026078 Ga0207702_10068314 Ga0207702_100683142 187
206 3300026078 Ga0207702_10075567 Ga0207702_100755672 187
207 3300026088 Ga0207641_10000213 Ga0207641_1000021375 187
208 3300026089 Ga0207648_10304164 Ga0207648_103041641 187
209 3300026089 Ga0207648_10377254 Ga0207648_103772542 187
210 3300026116 Ga0207674_10003443 Ga0207674_1000344318 187
211 3300026116 Ga0207674_10060763 Ga0207674_100607632 187
212 3300026118 Ga0207675_100007715 Ga0207675_10000771510 187
213 3300026118 Ga0207675_100172010 Ga0207675_1001720103 187
214 3300026121 Ga0207683_10326373 Ga0207683_103263732 187
215 3300026142 Ga0207698_10000108 Ga0207698_1000010829 187
216 3300028379 Ga0268266_10000016 Ga0268266_10000016353 187
217 3300028381 Ga0268264_10000072 Ga0268264_10000072190 187
218 3300028381 Ga0268264_10102717 Ga0268264_101027172 187
219 3300028381 Ga0268264_10603980 Ga0268264_106039802 187
220 3300028666 Ga0265336_10120897 Ga0265336_101208971 187
221 3300031730 Ga0307516_10265817 Ga0307516_102658171 187
222 3300033180 Ga0307510_10001712 Ga0307510_1000171211 187
223 3300036401 Ga0373937_0459222 Ga0373937_0459222_494_1057 187
224 3300042125 Ga0450923_006726 Ga0450923_006726_587_1150 187
225 3300044658 Ga0466972_0008365 Ga0466972_0008365_2788_3360 187
226 3300044684 Ga0466966_0346352 Ga0466966_0346352_286_855 187
227 3300044719 Ga0466971_0009829 Ga0466971_0009829_2954_3523 187
228 3300044735 Ga0466968_0193259 Ga0466968_0193259_224_796 187
229 3300044842 Ga0466957_0111966 Ga0466957_0111966_203_772 187
230 3300044901 Ga0466960_0406241 Ga0466960_0406241_154_726 187
231 3300045049 Ga0466959_0002150 Ga0466959_0002150_6832_7401 187
232 3300045836 Ga0466958_0110840 Ga0466958_0110840_1049_1618 187
233 3300046460 Ga0495638_0017086 Ga0495638_0017086_2678_3250 187
234 3300046507 Ga0495606_0004456 Ga0495606_0004456_7020_7589 187
235 3300046524 Ga0495648_0011969 Ga0495648_0011969_3521_4093 187
236 3300046539 Ga0495621_0015348 Ga0495621_0015348_695_1258 187
237 3300046648 Ga0495611_0000011 Ga0495611_0000011_51878_52447 187
238 3300046648 Ga0495611_0104811 Ga0495611_0104811_208_780 187
239 3300046691 Ga0495670_0309935 Ga0495670_0309935_19_582 187
240 3300047321 Ga0495676_0262431 Ga0495676_0262431_266_829 187
241 3300047443 Ga0495687_000004 Ga0495687_000004_484310_484882 187
242 3300047472 Ga0495686_0000165 Ga0495686_0000165_82492_83061 187
243 3300048918 Ga0496115_0906618 Ga0496115_0906618_75_644 187
244 3300049823 Ga0501044_0398168 Ga0501044_0398168_451_1023 187
245 3300050507 nmdc:mga05p37_1130996_c1 nmdc:mga05p37_1130996_c1_118_681 187
246 3300050507 nmdc:mga05p37_194882_c1 nmdc:mga05p37_194882_c1_126_695 187
247 3300050508 nmdc:mga09592_14034_c1 nmdc:mga09592_14034_c1_2490_3059 187
248 3300050508 nmdc:mga09592_553442_c1 nmdc:mga09592_553442_c1_413_976 187
249 3300050509 nmdc:mga0qj67_61545_c1 nmdc:mga0qj67_61545_c1_1225_1794 187
250 3300053088 Ga0500644_0230791 Ga0500644_0230791_108_680 187
251 3300053092 Ga0500583_0000120 Ga0500583_0000120_15246_15809 187
252 3300053092 Ga0500583_0006739 Ga0500583_0006739_963_1532 187
253 3300053093 Ga0500651_0467566 Ga0500651_0467566_85_660 187
254 3300053118 Ga0500594_0147661 Ga0500594_0147661_96_668 187
255 3300053130 Ga0500642_0074754 Ga0500642_0074754_908_1480 187
256 3300053133 Ga0500655_013508 Ga0500655_013508_432_1004 187
257 3300053133 Ga0500655_016309 Ga0500655_016309_756_1331 187
258 3300053139 Ga0500568_0175869 Ga0500568_0175869_17_589 187
259 3300053140 Ga0500573_0171265 Ga0500573_0171265_352_921 187
260 3300053156 Ga0500622_0002131 Ga0500622_0002131_2611_3183 187
261 3300055283 Ga0500661_034890 Ga0500661_034890_54_623 187
262 3300061719 Ga0466962_0004595 Ga0466962_0004595_4332_4901 187
263 3300002739 JGI25158J39367_1005868 JGI25158J39367_10058682 188
264 3300005262 Ga0065165_1004556 Ga0065165_10045562 188
265 3300005290 Ga0065712_10208997 Ga0065712_102089972 188
266 3300005295 Ga0065707_10166336 Ga0065707_101663361 188
267 3300005328 Ga0070676_10389108 Ga0070676_103891082 188
268 3300005331 Ga0070670_100018081 Ga0070670_1000180813 188
269 3300005333 Ga0070677_10142571 Ga0070677_101425712 188
270 3300005334 Ga0068869_100161706 Ga0068869_1001617062 188
271 3300005334 Ga0068869_100274879 Ga0068869_1002748792 188
272 3300005335 Ga0070666_10211835 Ga0070666_102118352 188
273 3300005338 Ga0068868_100452219 Ga0068868_1004522192 188
274 3300005339 Ga0070660_100858708 Ga0070660_1008587081 188
275 3300005343 Ga0070687_100031401 Ga0070687_1000314011 188
276 3300005344 Ga0070661_100592694 Ga0070661_1005926942 188
277 3300005347 Ga0070668_100078394 Ga0070668_1000783943 188
278 3300005354 Ga0070675_100017651 Ga0070675_1000176514 188
279 3300005354 Ga0070675_100123475 Ga0070675_1001234752 188
280 3300005355 Ga0070671_100100262 Ga0070671_1001002623 188
281 3300005356 Ga0070674_100122851 Ga0070674_1001228513 188
282 3300005356 Ga0070674_100178240 Ga0070674_1001782402 188
283 3300005364 Ga0070673_100004723 Ga0070673_1000047235 188
284 3300005364 Ga0070673_100668681 Ga0070673_1006686811 188
285 3300005365 Ga0070688_100570944 Ga0070688_1005709442 188
286 3300005366 Ga0070659_100088075 Ga0070659_1000880752 188
287 3300005367 Ga0070667_100059103 Ga0070667_1000591035 188
288 3300005434 Ga0070709_10625398 Ga0070709_106253981 188
289 3300005436 Ga0070713_100837017 Ga0070713_1008370172 188
290 3300005438 Ga0070701_10195924 Ga0070701_101959242 188
291 3300005445 Ga0070708_100620020 Ga0070708_1006200201 188
292 3300005456 Ga0070678_100056590 Ga0070678_1000565904 188
293 3300005456 Ga0070678_100227551 Ga0070678_1002275512 188
294 3300005459 Ga0068867_100019000 Ga0068867_1000190003 188
295 3300005459 Ga0068867_100075165 Ga0068867_1000751653 188
296 3300005459 Ga0068867_100117576 Ga0068867_1001175763 188
297 3300005459 Ga0068867_100451034 Ga0068867_1004510341 188
298 3300005459 Ga0068867_101344111 Ga0068867_1013441111 188
299 3300005466 Ga0070685_10150879 Ga0070685_101508792 188
300 3300005466 Ga0070685_10285159 Ga0070685_102851592 188
301 3300005471 Ga0070698_100000661 Ga0070698_10000066117 188
302 3300005471 Ga0070698_100005764 Ga0070698_10000576412 188
303 3300005539 Ga0068853_100626989 Ga0068853_1006269891 188
304 3300005543 Ga0070672_100025969 Ga0070672_1000259694 188
305 3300005543 Ga0070672_100054432 Ga0070672_1000544323 188
306 3300005544 Ga0070686_100019526 Ga0070686_1000195263 188
307 3300005544 Ga0070686_100361632 Ga0070686_1003616322 188
308 3300005546 Ga0070696_100133873 Ga0070696_1001338731 188
309 3300005577 Ga0068857_100151517 Ga0068857_1001515173 188
310 3300005615 Ga0070702_100022492 Ga0070702_1000224923 188
311 3300005617 Ga0068859_100093110 Ga0068859_1000931103 188
312 3300005718 Ga0068866_10103285 Ga0068866_101032852 188
313 3300005719 Ga0068861_100964043 Ga0068861_1009640432 188
314 3300005834 Ga0068851_10090465 Ga0068851_100904652 188
315 3300005841 Ga0068863_100007099 Ga0068863_1000070998 188
316 3300005842 Ga0068858_100351746 Ga0068858_1003517462 188
317 3300005843 Ga0068860_100121471 Ga0068860_1001214713 188
318 3300006195 Ga0075366_10007240 Ga0075366_100072407 188
319 3300006237 Ga0097621_100092526 Ga0097621_1000925262 188
320 3300006358 Ga0068871_101066465 Ga0068871_1010664651 188
321 3300006846 Ga0075430_100030675 Ga0075430_1000306755 188
322 3300006852 Ga0075433_10519812 Ga0075433_105198121 188
323 3300006931 Ga0097620_100093114 Ga0097620_1000931142 188
324 3300009093 Ga0105240_10791516 Ga0105240_107915162 188
325 3300009094 Ga0111539_10125769 Ga0111539_101257692 188
326 3300009101 Ga0105247_10001984 Ga0105247_100019846 188
327 3300009176 Ga0105242_10162697 Ga0105242_101626973 188
328 3300009177 Ga0105248_10790839 Ga0105248_107908392 188
329 3300009545 Ga0105237_10080975 Ga0105237_100809755 188
330 3300009545 Ga0105237_10541274 Ga0105237_105412742 188
331 3300009553 Ga0105249_10009665 Ga0105249_100096653 188
332 3300009553 Ga0105249_10042329 Ga0105249_100423292 188
333 3300009553 Ga0105249_10197991 Ga0105249_101979913 188
334 3300010375 Ga0105239_10009606 Ga0105239_1000960611 188
335 3300013102 Ga0157371_10095188 Ga0157371_100951882 188
336 3300013296 Ga0157374_10480758 Ga0157374_104807582 188
337 3300013297 Ga0157378_10000837 Ga0157378_1000083714 188
338 3300013306 Ga0163162_10050448 Ga0163162_100504485 188
339 3300013308 Ga0157375_10759834 Ga0157375_107598342 188
340 3300014325 Ga0163163_10052456 Ga0163163_100524562 188
341 3300014325 Ga0163163_10308727 Ga0163163_103087272 188
342 3300014326 Ga0157380_10357361 Ga0157380_103573612 188
343 3300014745 Ga0157377_10044754 Ga0157377_100447542 188
344 3300014968 Ga0157379_10356112 Ga0157379_103561122 188
345 3300015265 Ga0182005_1000081 Ga0182005_100008111 188
346 3300025208 Ga0209436_102659 Ga0209436_1026594 188
347 3300025893 Ga0207682_10038675 Ga0207682_100386753 188
348 3300025900 Ga0207710_10001075 Ga0207710_1000107511 188
349 3300025901 Ga0207688_10033901 Ga0207688_100339014 188
350 3300025903 Ga0207680_10348173 Ga0207680_103481731 188
351 3300025907 Ga0207645_10412634 Ga0207645_104126342 188
352 3300025916 Ga0207663_10272622 Ga0207663_102726222 188
353 3300025920 Ga0207649_10494043 Ga0207649_104940432 188
354 3300025925 Ga0207650_10487853 Ga0207650_104878532 188
355 3300025926 Ga0207659_10337561 Ga0207659_103375612 188
356 3300025928 Ga0207700_10666820 Ga0207700_106668201 188
357 3300025936 Ga0207670_10335349 Ga0207670_103353492 188
358 3300025940 Ga0207691_10004949 Ga0207691_100049495 188
359 3300025942 Ga0207689_10501790 Ga0207689_105017902 188
360 3300025960 Ga0207651_10040147 Ga0207651_100401473 188
361 3300025961 Ga0207712_10001156 Ga0207712_1000115616 188
362 3300025961 Ga0207712_10024733 Ga0207712_100247333 188
363 3300025961 Ga0207712_10536775 Ga0207712_105367752 188
364 3300025986 Ga0207658_10206859 Ga0207658_102068592 188
365 3300026023 Ga0207677_10188221 Ga0207677_101882212 188
366 3300026035 Ga0207703_10423639 Ga0207703_104236391 188
367 3300026041 Ga0207639_10522781 Ga0207639_105227812 188
368 3300026088 Ga0207641_10008579 Ga0207641_100085798 188
369 3300026089 Ga0207648_10029361 Ga0207648_100293615 188
370 3300026095 Ga0207676_10547419 Ga0207676_105474192 188
371 3300026116 Ga0207674_10065745 Ga0207674_100657454 188
372 3300026118 Ga0207675_100120696 Ga0207675_1001206963 188
373 3300026118 Ga0207675_100288819 Ga0207675_1002888192 188
374 3300026118 Ga0207675_101038578 Ga0207675_1010385782 188
375 3300026121 Ga0207683_10076782 Ga0207683_100767822 188
376 3300026121 Ga0207683_10269701 Ga0207683_102697012 188
377 3300028380 Ga0268265_10060552 Ga0268265_100605523 188
378 3300028381 Ga0268264_10063504 Ga0268264_100635042 188
379 3300031241 Ga0265325_10249205 Ga0265325_102492051 188
380 3300031507 Ga0307509_10036817 Ga0307509_100368175 188
381 3300031595 Ga0265313_10153091 Ga0265313_101530912 188
382 3300033180 Ga0307510_10362291 Ga0307510_103622911 188
383 3300041404 Ga0439436_0006955 Ga0439436_0006955_2038_2604 188
384 3300041406 Ga0439439_0005738 Ga0439439_0005738_1409_1975 188
385 3300042014 Ga0439457_091971 Ga0439457_091971_98_664 188
386 3300044693 Ga0466961_0134492 Ga0466961_0134492_861_1427 188
387 3300044719 Ga0466971_0078081 Ga0466971_0078081_896_1462 188
388 3300044735 Ga0466968_0080577 Ga0466968_0080577_732_1337 188
389 3300044735 Ga0466968_0081931 Ga0466968_0081931_348_914 188
390 3300046453 Ga0495627_013864 Ga0495627_013864_1910_2476 188
391 3300046460 Ga0495638_0154815 Ga0495638_0154815_708_1274 188
392 3300046519 Ga0495632_0157321 Ga0495632_0157321_104_670 188
393 3300046558 Ga0495633_0000175 Ga0495633_0000175_81495_82061 188
394 3300046616 Ga0495668_0000108 Ga0495668_0000108_81310_81876 188
395 3300047320 Ga0495672_0014438 Ga0495672_0014438_2454_3020 188
396 3300048918 Ga0496115_0132318 Ga0496115_0132318_1162_1734 188
397 3300048924 Ga0496121_0000030 Ga0496121_0000030_301276_301842 188
398 3300049766 Ga0501269_013559 Ga0501269_013559_303_869 188
399 3300050493 nmdc:mga0k408_11997_c1 nmdc:mga0k408_11997_c1_229_795 188
400 3300050509 nmdc:mga0qj67_51192_c1 nmdc:mga0qj67_51192_c1_1065_1631 188
401 3300050511 nmdc:mga08y16_260978_c1 nmdc:mga08y16_260978_c1_415_981 188
402 3300053092 Ga0500583_0064385 Ga0500583_0064385_57_623 188
403 3300053093 Ga0500651_0047942 Ga0500651_0047942_1180_1746 188
404 3300053104 Ga0500556_0124325 Ga0500556_0124325_27_593 188
405 3300053118 Ga0500594_0053167 Ga0500594_0053167_454_1020 188
406 3300053130 Ga0500642_0003619 Ga0500642_0003619_3491_4057 188
407 3300053131 Ga0500652_006848 Ga0500652_006848_1192_1758 188
408 3300053140 Ga0500573_0126264 Ga0500573_0126264_451_1017 188
409 3300053143 Ga0500579_145570 Ga0500579_145570_400_966 188
410 3300053151 Ga0500604_0002303 Ga0500604_0002303_2502_3068 188
411 3300053153 Ga0500616_0004758 Ga0500616_0004758_7862_8428 188
412 3300001979 JGI24740J21852_10013829 JGI24740J21852_100138292 189
413 3300001989 JGI24739J22299_10018562 JGI24739J22299_100185621 189
414 3300003215 JGI25153J46596_10000209 JGI25153J46596_1000020923 189
415 3300003215 JGI25153J46596_10023975 JGI25153J46596_100239751 189
416 3300003320 rootH2_10011602 rootH2_100116026 189
417 3300003320 rootH2_10137001 rootH2_101370016 189
418 3300003323 rootH1_10043692 rootH1_100436927 189
419 3300003323 rootH1_10137701 rootH1_101377013 189
420 3300003323 rootH1_10203057 rootH1_102030571 189
421 3300003354 JGI25160J50197_1001403 JGI25160J50197_10014036 189
422 3300003354 JGI25160J50197_1003289 JGI25160J50197_10032897 189
423 3300003354 JGI25160J50197_1009333 JGI25160J50197_10093333 189
424 3300003762 Ga0055542_1005560 Ga0055542_10055601 189
425 3300003771 Ga0055526_1021827 Ga0055526_10218271 189
426 3300003771 Ga0055526_1038025 Ga0055526_10380251 189
427 3300003790 Ga0055528_1000308 Ga0055528_100030811 189
428 3300003790 Ga0055528_1000809 Ga0055528_100080911 189
429 3300003791 Ga0055530_10000385 Ga0055530_1000038513 189
430 3300003794 Ga0055531_10000027 Ga0055531_1000002799 189
431 3300005262 Ga0065165_1000053 Ga0065165_100005358 189
432 3300005262 Ga0065165_1046879 Ga0065165_10468791 189
433 3300005288 Ga0065714_10214071 Ga0065714_102140711 189
434 3300005290 Ga0065712_10019139 Ga0065712_100191395 189
435 3300005290 Ga0065712_10263719 Ga0065712_102637191 189
436 3300005328 Ga0070676_10780897 Ga0070676_107808971 189
437 3300005331 Ga0070670_100068080 Ga0070670_1000680802 189
438 3300005331 Ga0070670_100092898 Ga0070670_1000928981 189
439 3300005331 Ga0070670_100219101 Ga0070670_1002191012 189
440 3300005331 Ga0070670_100490162 Ga0070670_1004901622 189
441 3300005333 Ga0070677_10013451 Ga0070677_100134513 189
442 3300005333 Ga0070677_10063065 Ga0070677_100630652 189
443 3300005334 Ga0068869_100007079 Ga0068869_1000070795 189
444 3300005334 Ga0068869_100092954 Ga0068869_1000929543 189
445 3300005335 Ga0070666_10000536 Ga0070666_1000053616 189
446 3300005335 Ga0070666_10076765 Ga0070666_100767653 189
447 3300005337 Ga0070682_100000628 Ga0070682_1000006287 189
448 3300005338 Ga0068868_100006435 Ga0068868_1000064356 189
449 3300005338 Ga0068868_100238903 Ga0068868_1002389032 189
450 3300005338 Ga0068868_100564460 Ga0068868_1005644601 189
451 3300005339 Ga0070660_100044390 Ga0070660_1000443902 189
452 3300005339 Ga0070660_100181694 Ga0070660_1001816942 189
453 3300005339 Ga0070660_100275914 Ga0070660_1002759142 189
454 3300005343 Ga0070687_100105272 Ga0070687_1001052722 189
455 3300005343 Ga0070687_100367826 Ga0070687_1003678261 189
456 3300005347 Ga0070668_100030711 Ga0070668_1000307113 189
457 3300005347 Ga0070668_100222169 Ga0070668_1002221693 189
458 3300005347 Ga0070668_100391018 Ga0070668_1003910182 189
459 3300005353 Ga0070669_100169400 Ga0070669_1001694002 189
460 3300005353 Ga0070669_100185767 Ga0070669_1001857672 189
461 3300005353 Ga0070669_100264686 Ga0070669_1002646862 189
462 3300005355 Ga0070671_100184160 Ga0070671_1001841602 189
463 3300005355 Ga0070671_101091380 Ga0070671_1010913801 189
464 3300005356 Ga0070674_100100564 Ga0070674_1001005643 189
465 3300005356 Ga0070674_100304792 Ga0070674_1003047921 189
466 3300005364 Ga0070673_100006253 Ga0070673_1000062539 189
467 3300005364 Ga0070673_100013324 Ga0070673_1000133244 189
468 3300005365 Ga0070688_100344574 Ga0070688_1003445742 189
469 3300005366 Ga0070659_100003227 Ga0070659_1000032272 189
470 3300005367 Ga0070667_100005388 Ga0070667_10000538811 189
471 3300005367 Ga0070667_100015282 Ga0070667_1000152825 189
472 3300005367 Ga0070667_100460105 Ga0070667_1004601052 189
473 3300005367 Ga0070667_100466195 Ga0070667_1004661952 189
474 3300005441 Ga0070700_100280319 Ga0070700_1002803192 189
475 3300005441 Ga0070700_100577515 Ga0070700_1005775152 189
476 3300005455 Ga0070663_100019412 Ga0070663_1000194121 189
477 3300005455 Ga0070663_100321602 Ga0070663_1003216021 189
478 3300005456 Ga0070678_100068026 Ga0070678_1000680262 189
479 3300005458 Ga0070681_10008396 Ga0070681_100083963 189
480 3300005458 Ga0070681_10042169 Ga0070681_100421694 189
481 3300005459 Ga0068867_100017763 Ga0068867_1000177632 189
482 3300005459 Ga0068867_100023075 Ga0068867_1000230752 189
483 3300005459 Ga0068867_100133111 Ga0068867_1001331113 189
484 3300005459 Ga0068867_100517768 Ga0068867_1005177681 189
485 3300005466 Ga0070685_10020796 Ga0070685_100207963 189
486 3300005466 Ga0070685_10078569 Ga0070685_100785693 189
487 3300005466 Ga0070685_10093120 Ga0070685_100931202 189
488 3300005530 Ga0070679_100018252 Ga0070679_1000182526 189
489 3300005530 Ga0070679_100155055 Ga0070679_1001550553 189
490 3300005535 Ga0070684_100803610 Ga0070684_1008036101 189
491 3300005539 Ga0068853_100014820 Ga0068853_1000148203 189
492 3300005539 Ga0068853_100239648 Ga0068853_1002396482 189
493 3300005539 Ga0068853_100360163 Ga0068853_1003601631 189
494 3300005539 Ga0068853_101435349 Ga0068853_1014353491 189
495 3300005543 Ga0070672_100023427 Ga0070672_1000234272 189
496 3300005543 Ga0070672_100242480 Ga0070672_1002424801 189
497 3300005543 Ga0070672_100263024 Ga0070672_1002630242 189
498 3300005543 Ga0070672_100313140 Ga0070672_1003131402 189
499 3300005543 Ga0070672_100314732 Ga0070672_1003147321 189
500 3300005543 Ga0070672_100509640 Ga0070672_1005096402 189
501 3300005543 Ga0070672_100961930 Ga0070672_1009619301 189
502 3300005547 Ga0070693_100008596 Ga0070693_1000085963 189
503 3300005548 Ga0070665_100019926 Ga0070665_1000199265 189
504 3300005548 Ga0070665_100890085 Ga0070665_1008900852 189
505 3300005563 Ga0068855_100001274 Ga0068855_10000127410 189
506 3300005563 Ga0068855_100139770 Ga0068855_1001397703 189
507 3300005563 Ga0068855_100644205 Ga0068855_1006442052 189
508 3300005564 Ga0070664_100108824 Ga0070664_1001088242 189
509 3300005564 Ga0070664_100124998 Ga0070664_1001249982 189
510 3300005564 Ga0070664_100138162 Ga0070664_1001381622 189
511 3300005577 Ga0068857_100747755 Ga0068857_1007477552 189
512 3300005578 Ga0068854_100014234 Ga0068854_1000142343 189
513 3300005578 Ga0068854_100193632 Ga0068854_1001936321 189
514 3300005578 Ga0068854_100416099 Ga0068854_1004160991 189
515 3300005578 Ga0068854_100454151 Ga0068854_1004541511 189
516 3300005614 Ga0068856_100093229 Ga0068856_1000932293 189
517 3300005616 Ga0068852_100001996 Ga0068852_10000199616 189
518 3300005616 Ga0068852_101335593 Ga0068852_1013355931 189
519 3300005617 Ga0068859_100000007 Ga0068859_100000007182 189
520 3300005617 Ga0068859_100001403 Ga0068859_10000140313 189
521 3300005617 Ga0068859_100029222 Ga0068859_1000292223 189
522 3300005617 Ga0068859_100614679 Ga0068859_1006146792 189
523 3300005618 Ga0068864_100001316 Ga0068864_10000131615 189
524 3300005618 Ga0068864_100145703 Ga0068864_1001457033 189
525 3300005618 Ga0068864_101165821 Ga0068864_1011658211 189
526 3300005834 Ga0068851_10070919 Ga0068851_100709192 189
527 3300005834 Ga0068851_10321220 Ga0068851_103212201 189
528 3300005840 Ga0068870_10197145 Ga0068870_101971451 189
529 3300005841 Ga0068863_100000444 Ga0068863_1000004442 189
530 3300005841 Ga0068863_100024194 Ga0068863_1000241946 189
531 3300005841 Ga0068863_100215718 Ga0068863_1002157182 189
532 3300005841 Ga0068863_100226590 Ga0068863_1002265902 189
533 3300005841 Ga0068863_100306485 Ga0068863_1003064851 189
534 3300005842 Ga0068858_100000829 Ga0068858_10000082924 189
535 3300005842 Ga0068858_100482081 Ga0068858_1004820812 189
536 3300005842 Ga0068858_100530908 Ga0068858_1005309082 189
537 3300005843 Ga0068860_100005394 Ga0068860_10000539411 189
538 3300005843 Ga0068860_100010234 Ga0068860_1000102343 189
539 3300005843 Ga0068860_100024948 Ga0068860_1000249482 189
540 3300005843 Ga0068860_100061290 Ga0068860_1000612902 189
541 3300005843 Ga0068860_100351346 Ga0068860_1003513462 189
542 3300006195 Ga0075366_10209743 Ga0075366_102097432 189
543 3300006195 Ga0075366_10313920 Ga0075366_103139201 189
544 3300006237 Ga0097621_100000711 Ga0097621_10000071110 189
545 3300006237 Ga0097621_100012629 Ga0097621_1000126295 189
546 3300006237 Ga0097621_100126956 Ga0097621_1001269563 189
547 3300006237 Ga0097621_100158266 Ga0097621_1001582662 189
548 3300006237 Ga0097621_100428706 Ga0097621_1004287062 189
549 3300006237 Ga0097621_100627510 Ga0097621_1006275102 189
550 3300006237 Ga0097621_100840136 Ga0097621_1008401361 189
551 3300006353 Ga0075370_10159619 Ga0075370_101596192 189
552 3300006358 Ga0068871_100000351 Ga0068871_10000035117 189
553 3300006358 Ga0068871_100018089 Ga0068871_1000180893 189
554 3300006358 Ga0068871_100075432 Ga0068871_1000754323 189
555 3300006358 Ga0068871_100614016 Ga0068871_1006140162 189
556 3300006358 Ga0068871_100643525 Ga0068871_1006435252 189
557 3300006844 Ga0075428_100059396 Ga0075428_1000593962 189
558 3300006880 Ga0075429_100005315 Ga0075429_1000053155 189
559 3300006881 Ga0068865_100020694 Ga0068865_1000206944 189
560 3300006881 Ga0068865_100186132 Ga0068865_1001861322 189
561 3300006881 Ga0068865_100516213 Ga0068865_1005162132 189
562 3300006931 Ga0097620_100000007 Ga0097620_100000007183 189
563 3300006931 Ga0097620_100001403 Ga0097620_10000140313 189
564 3300006931 Ga0097620_100029222 Ga0097620_1000292226 189
565 3300006931 Ga0097620_100614642 Ga0097620_1006146422 189
566 3300006931 Ga0097620_101262741 Ga0097620_1012627412 189
567 3300009093 Ga0105240_10003960 Ga0105240_100039609 189
568 3300009101 Ga0105247_10165240 Ga0105247_101652402 189
569 3300009101 Ga0105247_10262399 Ga0105247_102623992 189
570 3300009148 Ga0105243_10387332 Ga0105243_103873322 189
571 3300009148 Ga0105243_10459542 Ga0105243_104595421 189
572 3300009148 Ga0105243_10520306 Ga0105243_105203062 189
573 3300009174 Ga0105241_10000206 Ga0105241_1000020632 189
574 3300009174 Ga0105241_10142957 Ga0105241_101429573 189
575 3300009176 Ga0105242_10030077 Ga0105242_100300772 189
576 3300009176 Ga0105242_10382148 Ga0105242_103821482 189
577 3300009177 Ga0105248_10046848 Ga0105248_100468484 189
578 3300009177 Ga0105248_10241525 Ga0105248_102415252 189
579 3300009545 Ga0105237_10009612 Ga0105237_100096124 189
580 3300009545 Ga0105237_10012022 Ga0105237_100120227 189
581 3300009545 Ga0105237_10200736 Ga0105237_102007362 189
582 3300009545 Ga0105237_11104143 Ga0105237_111041431 189
583 3300009553 Ga0105249_10008328 Ga0105249_100083288 189
584 3300009553 Ga0105249_10598379 Ga0105249_105983791 189
585 3300010375 Ga0105239_10007270 Ga0105239_100072703 189
586 3300010375 Ga0105239_10224526 Ga0105239_102245263 189
587 3300010375 Ga0105239_10237019 Ga0105239_102370191 189
588 3300010375 Ga0105239_10278360 Ga0105239_102783602 189
589 3300010375 Ga0105239_10390573 Ga0105239_103905732 189
590 3300010375 Ga0105239_10701481 Ga0105239_107014812 189
591 3300013100 Ga0157373_10588544 Ga0157373_105885442 189
592 3300013102 Ga0157371_10036310 Ga0157371_100363105 189
593 3300013102 Ga0157371_10069202 Ga0157371_100692023 189
594 3300013102 Ga0157371_10072834 Ga0157371_100728342 189
595 3300013102 Ga0157371_10107422 Ga0157371_101074223 189
596 3300013102 Ga0157371_10172210 Ga0157371_101722102 189
597 3300013102 Ga0157371_10524499 Ga0157371_105244991 189
598 3300013104 Ga0157370_10000426 Ga0157370_1000042643 189
599 3300013104 Ga0157370_10004831 Ga0157370_100048313 189
600 3300013104 Ga0157370_10150085 Ga0157370_101500853 189
601 3300013104 Ga0157370_10219831 Ga0157370_102198313 189
602 3300013104 Ga0157370_10981652 Ga0157370_109816522 189
603 3300013105 Ga0157369_10019728 Ga0157369_100197286 189
604 3300013105 Ga0157369_10040395 Ga0157369_100403956 189
605 3300013105 Ga0157369_10061816 Ga0157369_100618163 189
606 3300013105 Ga0157369_10178489 Ga0157369_101784892 189
607 3300013105 Ga0157369_10224634 Ga0157369_102246343 189
608 3300013105 Ga0157369_10252953 Ga0157369_102529532 189
609 3300013105 Ga0157369_10628330 Ga0157369_106283302 189
610 3300013105 Ga0157369_10780015 Ga0157369_107800151 189
611 3300013296 Ga0157374_10045471 Ga0157374_100454715 189
612 3300013296 Ga0157374_10067126 Ga0157374_100671262 189
613 3300013296 Ga0157374_10087081 Ga0157374_100870813 189
614 3300013296 Ga0157374_10213072 Ga0157374_102130722 189
615 3300013296 Ga0157374_10360574 Ga0157374_103605742 189
616 3300013297 Ga0157378_10002924 Ga0157378_100029241 189
617 3300013297 Ga0157378_10025999 Ga0157378_100259996 189
618 3300013297 Ga0157378_11033314 Ga0157378_110333141 189
619 3300013306 Ga0163162_10000795 Ga0163162_1000079511 189
620 3300013306 Ga0163162_10000833 Ga0163162_1000083312 189
621 3300013306 Ga0163162_10008664 Ga0163162_100086644 189
622 3300013306 Ga0163162_10069707 Ga0163162_100697072 189
623 3300013306 Ga0163162_10453531 Ga0163162_104535311 189
624 3300013306 Ga0163162_12497444 Ga0163162_124974441 189
625 3300013307 Ga0157372_10002978 Ga0157372_1000297812 189
626 3300013307 Ga0157372_10051584 Ga0157372_100515843 189
627 3300013307 Ga0157372_10073608 Ga0157372_100736082 189
628 3300013307 Ga0157372_10092182 Ga0157372_100921824 189
629 3300013307 Ga0157372_10144797 Ga0157372_101447972 189
630 3300013307 Ga0157372_10147167 Ga0157372_101471673 189
631 3300013307 Ga0157372_10201517 Ga0157372_102015173 189
632 3300013307 Ga0157372_10239550 Ga0157372_102395502 189
633 3300013307 Ga0157372_10305136 Ga0157372_103051364 189
634 3300013307 Ga0157372_10388125 Ga0157372_103881252 189
635 3300013307 Ga0157372_10482550 Ga0157372_104825502 189
636 3300013307 Ga0157372_10714512 Ga0157372_107145121 189
637 3300013307 Ga0157372_10902539 Ga0157372_109025391 189
638 3300013308 Ga0157375_10000073 Ga0157375_1000007354 189
639 3300013308 Ga0157375_10020587 Ga0157375_100205872 189
640 3300013308 Ga0157375_10057461 Ga0157375_100574612 189
641 3300013308 Ga0157375_10131910 Ga0157375_101319103 189
642 3300013308 Ga0157375_10243220 Ga0157375_102432202 189
643 3300013308 Ga0157375_10748546 Ga0157375_107485462 189
644 3300014325 Ga0163163_10396844 Ga0163163_103968442 189
645 3300014325 Ga0163163_11112991 Ga0163163_111129911 189
646 3300014325 Ga0163163_11144436 Ga0163163_111444362 189
647 3300014326 Ga0157380_10030099 Ga0157380_100300991 189
648 3300014326 Ga0157380_10437181 Ga0157380_104371812 189
649 3300014968 Ga0157379_10070073 Ga0157379_100700732 189
650 3300014968 Ga0157379_10185442 Ga0157379_101854422 189
651 3300014968 Ga0157379_10186973 Ga0157379_101869732 189
652 3300014968 Ga0157379_10213085 Ga0157379_102130851 189
653 3300014968 Ga0157379_10778880 Ga0157379_107788801 189
654 3300014968 Ga0157379_11162181 Ga0157379_111621811 189
655 3300014969 Ga0157376_10001988 Ga0157376_1000198812 189
656 3300014969 Ga0157376_10006687 Ga0157376_100066877 189
657 3300014969 Ga0157376_10144472 Ga0157376_101444722 189
658 3300014969 Ga0157376_10282659 Ga0157376_102826592 189
659 3300014969 Ga0157376_10378279 Ga0157376_103782792 189
660 3300017792 Ga0163161_10019399 Ga0163161_100193994 189
661 3300017792 Ga0163161_10358962 Ga0163161_103589622 189
662 3300025208 Ga0209436_100566 Ga0209436_10056611 189
663 3300025242 Ga0209258_100041 Ga0209258_10004195 189
664 3300025245 Ga0207425_1015563 Ga0207425_10155632 189
665 3300025246 Ga0209646_1000002 Ga0209646_1000002171 189
666 3300025250 Ga0209026_1000233 Ga0209026_10002339 189
667 3300025254 Ga0209148_1000090 Ga0209148_1000090140 189
668 3300025273 Ga0209673_1000034 Ga0209673_1000034139 189
669 3300025284 Ga0209130_1001027 Ga0209130_100102718 189
670 3300025295 Ga0209564_1040205 Ga0209564_10402052 189
671 3300025295 Ga0209564_1043670 Ga0209564_10436702 189
672 3300025297 Ga0209758_1000419 Ga0209758_100041940 189
673 3300025297 Ga0209758_1061714 Ga0209758_10617142 189
674 3300025298 Ga0209050_1000353 Ga0209050_100035361 189
675 3300025302 Ga0207426_1000002 Ga0207426_100000225 189
676 3300025302 Ga0207426_1000177 Ga0207426_1000177118 189
677 3300025302 Ga0207426_1000324 Ga0207426_100032420 189
678 3300025302 Ga0207426_1000592 Ga0207426_100059222 189
679 3300025304 Ga0209257_1000001 Ga0209257_10000011799 189
680 3300025304 Ga0209257_1002086 Ga0209257_100208621 189
681 3300025321 Ga0207656_10046417 Ga0207656_100464172 189
682 3300025321 Ga0207656_10405269 Ga0207656_104052691 189
683 3300025893 Ga0207682_10069708 Ga0207682_100697082 189
684 3300025893 Ga0207682_10086730 Ga0207682_100867302 189
685 3300025899 Ga0207642_10040607 Ga0207642_100406072 189
686 3300025903 Ga0207680_10000067 Ga0207680_100000675 189
687 3300025903 Ga0207680_10063588 Ga0207680_100635881 189
688 3300025904 Ga0207647_10000962 Ga0207647_1000096229 189
689 3300025904 Ga0207647_10070519 Ga0207647_100705192 189
690 3300025904 Ga0207647_10395305 Ga0207647_103953051 189
691 3300025907 Ga0207645_10001205 Ga0207645_1000120516 189
692 3300025907 Ga0207645_10022729 Ga0207645_100227292 189
693 3300025907 Ga0207645_10655112 Ga0207645_106551121 189
694 3300025908 Ga0207643_10038079 Ga0207643_100380793 189
695 3300025908 Ga0207643_10332560 Ga0207643_103325601 189
696 3300025909 Ga0207705_10001654 Ga0207705_1000165411 189
697 3300025909 Ga0207705_10087634 Ga0207705_100876343 189
698 3300025909 Ga0207705_10598273 Ga0207705_105982732 189
699 3300025911 Ga0207654_10000661 Ga0207654_1000066112 189
700 3300025911 Ga0207654_10000842 Ga0207654_1000084212 189
701 3300025912 Ga0207707_10000111 Ga0207707_1000011143 189
702 3300025912 Ga0207707_10046161 Ga0207707_100461612 189
703 3300025913 Ga0207695_10035604 Ga0207695_100356043 189
704 3300025914 Ga0207671_10001776 Ga0207671_100017762 189
705 3300025914 Ga0207671_10066698 Ga0207671_100666983 189
706 3300025914 Ga0207671_10297693 Ga0207671_102976932 189
707 3300025914 Ga0207671_10708656 Ga0207671_107086561 189
708 3300025917 Ga0207660_10001012 Ga0207660_100010128 189
709 3300025917 Ga0207660_10008720 Ga0207660_100087205 189
710 3300025919 Ga0207657_10056435 Ga0207657_100564352 189
711 3300025919 Ga0207657_10142361 Ga0207657_101423612 189
712 3300025919 Ga0207657_10527838 Ga0207657_105278382 189
713 3300025920 Ga0207649_10611983 Ga0207649_106119831 189
714 3300025920 Ga0207649_10708614 Ga0207649_107086141 189
715 3300025921 Ga0207652_10000538 Ga0207652_1000053828 189
716 3300025921 Ga0207652_10000960 Ga0207652_1000096018 189
717 3300025923 Ga0207681_10009782 Ga0207681_100097828 189
718 3300025923 Ga0207681_10100892 Ga0207681_101008923 189
719 3300025923 Ga0207681_10284840 Ga0207681_102848402 189
720 3300025925 Ga0207650_10523741 Ga0207650_105237412 189
721 3300025926 Ga0207659_10181728 Ga0207659_101817282 189
722 3300025926 Ga0207659_10305760 Ga0207659_103057602 189
723 3300025931 Ga0207644_10024795 Ga0207644_100247955 189
724 3300025931 Ga0207644_10451404 Ga0207644_104514041 189
725 3300025931 Ga0207644_10453883 Ga0207644_104538832 189
726 3300025932 Ga0207690_10014400 Ga0207690_100144002 189
727 3300025932 Ga0207690_10581579 Ga0207690_105815792 189
728 3300025934 Ga0207686_10017723 Ga0207686_100177235 189
729 3300025935 Ga0207709_10425454 Ga0207709_104254541 189
730 3300025935 Ga0207709_10516807 Ga0207709_105168071 189
731 3300025936 Ga0207670_10480635 Ga0207670_104806352 189
732 3300025937 Ga0207669_10532252 Ga0207669_105322521 189
733 3300025937 Ga0207669_10801201 Ga0207669_108012012 189
734 3300025938 Ga0207704_10008049 Ga0207704_100080496 189
735 3300025938 Ga0207704_10011913 Ga0207704_100119135 189
736 3300025938 Ga0207704_10354387 Ga0207704_103543871 189
737 3300025940 Ga0207691_10062073 Ga0207691_100620733 189
738 3300025940 Ga0207691_10087508 Ga0207691_100875082 189
739 3300025940 Ga0207691_10445948 Ga0207691_104459482 189
740 3300025940 Ga0207691_10451683 Ga0207691_104516831 189
741 3300025941 Ga0207711_10035102 Ga0207711_100351026 189
742 3300025942 Ga0207689_10002959 Ga0207689_100029594 189
743 3300025942 Ga0207689_10005262 Ga0207689_100052628 189
744 3300025942 Ga0207689_10074987 Ga0207689_100749873 189
745 3300025942 Ga0207689_10137046 Ga0207689_101370463 189
746 3300025944 Ga0207661_10563327 Ga0207661_105633272 189
747 3300025949 Ga0207667_10010209 Ga0207667_100102095 189
748 3300025949 Ga0207667_11044148 Ga0207667_110441482 189
749 3300025960 Ga0207651_10551469 Ga0207651_105514691 189
750 3300025960 Ga0207651_10679689 Ga0207651_106796891 189
751 3300025961 Ga0207712_10125385 Ga0207712_101253853 189
752 3300025972 Ga0207668_10026438 Ga0207668_100264384 189
753 3300025972 Ga0207668_10156325 Ga0207668_101563252 189
754 3300025981 Ga0207640_10027653 Ga0207640_100276532 189
755 3300025981 Ga0207640_10059835 Ga0207640_100598353 189
756 3300025981 Ga0207640_10130167 Ga0207640_101301672 189
757 3300025986 Ga0207658_10005017 Ga0207658_100050175 189
758 3300025986 Ga0207658_10115803 Ga0207658_101158033 189
759 3300025986 Ga0207658_11129000 Ga0207658_111290001 189
760 3300026023 Ga0207677_10005993 Ga0207677_100059935 189
761 3300026023 Ga0207677_10056615 Ga0207677_100566153 189
762 3300026023 Ga0207677_10081379 Ga0207677_100813791 189
763 3300026035 Ga0207703_10017680 Ga0207703_100176806 189
764 3300026035 Ga0207703_10395002 Ga0207703_103950022 189
765 3300026041 Ga0207639_10070159 Ga0207639_100701593 189
766 3300026041 Ga0207639_10073596 Ga0207639_100735962 189
767 3300026041 Ga0207639_10814362 Ga0207639_108143622 189
768 3300026067 Ga0207678_10025947 Ga0207678_100259472 189
769 3300026067 Ga0207678_10145829 Ga0207678_101458292 189
770 3300026067 Ga0207678_10195723 Ga0207678_101957231 189
771 3300026075 Ga0207708_10560726 Ga0207708_105607262 189
772 3300026078 Ga0207702_10241282 Ga0207702_102412822 189
773 3300026088 Ga0207641_10000090 Ga0207641_1000009022 189
774 3300026088 Ga0207641_10018040 Ga0207641_100180402 189
775 3300026088 Ga0207641_10175968 Ga0207641_101759682 189
776 3300026089 Ga0207648_10000653 Ga0207648_1000065319 189
777 3300026089 Ga0207648_10039157 Ga0207648_100391572 189
778 3300026089 Ga0207648_10129072 Ga0207648_101290722 189
779 3300026089 Ga0207648_10430457 Ga0207648_104304571 189
780 3300026095 Ga0207676_11347755 Ga0207676_113477551 189
781 3300026116 Ga0207674_10165009 Ga0207674_101650093 189
782 3300026118 Ga0207675_100008836 Ga0207675_1000088363 189
783 3300026118 Ga0207675_100081577 Ga0207675_1000815772 189
784 3300026118 Ga0207675_100879105 Ga0207675_1008791051 189
785 3300026121 Ga0207683_10048943 Ga0207683_100489432 189
786 3300026121 Ga0207683_10093220 Ga0207683_100932203 189
787 3300026142 Ga0207698_10011126 Ga0207698_100111263 189
788 3300026142 Ga0207698_10373847 Ga0207698_103738471 189
789 3300028379 Ga0268266_10295182 Ga0268266_102951821 189
790 3300028380 Ga0268265_10166956 Ga0268265_101669563 189
791 3300028381 Ga0268264_10002720 Ga0268264_100027205 189
792 3300028381 Ga0268264_10007598 Ga0268264_100075989 189
793 3300028381 Ga0268264_10033282 Ga0268264_100332823 189
794 3300028381 Ga0268264_10065820 Ga0268264_100658202 189
795 3300028381 Ga0268264_10157870 Ga0268264_101578702 189
796 3300028381 Ga0268264_10487970 Ga0268264_104879701 189
797 3300028786 Ga0307517_10000697 Ga0307517_1000069743 189
798 3300028794 Ga0307515_10000078 Ga0307515_10000078174 189
799 3300030521 Ga0307511_10001896 Ga0307511_100018962 189
800 3300031251 Ga0265327_10045037 Ga0265327_100450373 189
801 3300031507 Ga0307509_10123147 Ga0307509_101231473 189
802 3300031616 Ga0307508_10266838 Ga0307508_102668382 189
803 3300031616 Ga0307508_10346038 Ga0307508_103460382 189
804 3300031824 Ga0307413_10292765 Ga0307413_102927652 189
805 3300031824 Ga0307413_10356087 Ga0307413_103560872 189
806 3300031852 Ga0307410_10490665 Ga0307410_104906651 189
807 3300031901 Ga0307406_10642526 Ga0307406_106425262 189
808 3300031903 Ga0307407_10388672 Ga0307407_103886721 189
809 3300031911 Ga0307412_10466060 Ga0307412_104660602 189
810 3300032002 Ga0307416_100672015 Ga0307416_1006720152 189
811 3300032004 Ga0307414_10374474 Ga0307414_103744741 189
812 3300032004 Ga0307414_10870488 Ga0307414_108704882 189
813 3300032005 Ga0307411_10050097 Ga0307411_100500971 189
814 3300032005 Ga0307411_11275172 Ga0307411_112751721 189
815 3300032126 Ga0307415_100132561 Ga0307415_1001325613 189
816 3300035172 Ga0373955_0241292 Ga0373955_0241292_230_814 189
817 3300035695 Ga0373927_0100179 Ga0373927_0100179_75_644 189
818 3300035724 Ga0373933_0136478 Ga0373933_0136478_79_663 189
819 3300036401 Ga0373937_0139076 Ga0373937_0139076_1442_2026 189
820 3300037312 Ga0395899_0014889 Ga0395899_0014889_3240_3830 189
821 3300037418 Ga0395900_0016890 Ga0395900_0016890_6708_7298 189
822 3300037418 Ga0395900_0182795 Ga0395900_0182795_1497_2066 189
823 3300037418 Ga0395900_0525978 Ga0395900_0525978_352_942 189
824 3300037418 Ga0395900_0550511 Ga0395900_0550511_242_820 189
825 3300037466 Ga0395898_0112161 Ga0395898_0112161_262_852 189
826 3300037471 Ga0395905_0001861 Ga0395905_0001861_19_597 189
827 3300037471 Ga0395905_0065531 Ga0395905_0065531_715_1293 189
828 3300038443 Ga0395901_0089556 Ga0395901_0089556_2248_2838 189
829 3300038443 Ga0395901_0103349 Ga0395901_0103349_100_678 189
830 3300039437 Ga0436365_0289942 Ga0436365_0289942_300_875 189
831 3300041404 Ga0439436_0048147 Ga0439436_0048147_389_961 189
832 3300041406 Ga0439439_0051855 Ga0439439_0051855_49_627 189
833 3300041441 Ga0451787_202726 Ga0451787_202726_13_594 189
834 3300041460 Ga0451802_1082803 Ga0451802_1082803_85_654 189
835 3300041463 Ga0451804_0420865 Ga0451804_0420865_54_635 189
836 3300041486 Ga0451807_2236118 Ga0451807_2236118_273_842 189
837 3300041505 Ga0451849_0258145 Ga0451849_0258145_106_675 189
838 3300041512 Ga0451853_0569222 Ga0451853_0569222_13_609 189
839 3300041512 Ga0451853_1768614 Ga0451853_1768614_266_838 189
840 3300041512 Ga0451853_3831587 Ga0451853_3831587_216_785 189
841 3300041997 Ga0439431_0017465 Ga0439431_0017465_567_1139 189
842 3300042007 Ga0439449_0004710 Ga0439449_0004710_1076_1654 189
843 3300042007 Ga0439449_0138673 Ga0439449_0138673_199_771 189
844 3300042007 Ga0439449_0185269 Ga0439449_0185269_60_629 189
845 3300042014 Ga0439457_009584 Ga0439457_009584_1659_2234 189
846 3300042014 Ga0439457_023623 Ga0439457_023623_751_1329 189
847 3300042014 Ga0439457_037992 Ga0439457_037992_105_677 189
848 3300042015 Ga0439462_0011206 Ga0439462_0011206_1025_1603 189
849 3300042876 Ga0451577_0025828 Ga0451577_0025828_3864_4436 189
850 3300044656 Ga0466969_0000754 Ga0466969_0000754_1664_2233 189
851 3300044658 Ga0466972_0004958 Ga0466972_0004958_6062_6670 189
852 3300044684 Ga0466966_0000030 Ga0466966_0000030_28691_29260 189
853 3300044719 Ga0466971_0053325 Ga0466971_0053325_74_646 189
854 3300044735 Ga0466968_0458851 Ga0466968_0458851_30_599 189
855 3300044842 Ga0466957_0009182 Ga0466957_0009182_3887_4459 189
856 3300044842 Ga0466957_0011478 Ga0466957_0011478_1234_1842 189
857 3300045049 Ga0466959_0000269 Ga0466959_0000269_4154_4723 189
858 3300045049 Ga0466959_0045485 Ga0466959_0045485_93_662 189
859 3300046462 Ga0495651_0130068 Ga0495651_0130068_1042_1626 189
860 3300046471 Ga0495650_0115811 Ga0495650_0115811_275_844 189
861 3300046472 Ga0495580_0038332 Ga0495580_0038332_295_879 189
862 3300046472 Ga0495580_0112467 Ga0495580_0112467_253_831 189
863 3300046473 Ga0495582_0088992 Ga0495582_0088992_916_1500 189
864 3300046477 Ga0495664_0341061 Ga0495664_0341061_65_649 189
865 3300046517 Ga0495630_0247352 Ga0495630_0247352_181_765 189
866 3300046517 Ga0495630_0252397 Ga0495630_0252397_292_870 189
867 3300046531 Ga0495665_0187618 Ga0495665_0187618_352_936 189
868 3300046535 Ga0495586_0145441 Ga0495586_0145441_540_1124 189
869 3300046536 Ga0495587_0260229 Ga0495587_0260229_138_722 189
870 3300046557 Ga0495622_0374054 Ga0495622_0374054_20_589 189
871 3300046616 Ga0495668_0005589 Ga0495668_0005589_4844_5413 189
872 3300046642 Ga0495634_0115218 Ga0495634_0115218_1040_1624 189
873 3300046660 Ga0495625_0475451 Ga0495625_0475451_173_742 189
874 3300046679 Ga0495623_0264615 Ga0495623_0264615_213_797 189
875 3300046681 Ga0495647_0237843 Ga0495647_0237843_40_618 189
876 3300046683 Ga0495658_0042870 Ga0495658_0042870_1508_2092 189
877 3300046690 Ga0495624_0610335 Ga0495624_0610335_14_592 189
878 3300047317 Ga0495604_0220578 Ga0495604_0220578_55_639 189
879 3300047321 Ga0495676_0387687 Ga0495676_0387687_96_680 189
880 3300047445 Ga0495677_0194934 Ga0495677_0194934_126_704 189
881 3300048904 Ga0496101_0546953 Ga0496101_0546953_116_688 189
882 3300048908 Ga0496105_0099960 Ga0496105_0099960_875_1453 189
883 3300048921 Ga0496118_0278248 Ga0496118_0278248_34_642 189
884 3300048929 Ga0496126_0047240 Ga0496126_0047240_1456_2028 189
885 3300049521 Ga0501298_000289 Ga0501298_000289_188_766 189
886 3300049522 Ga0501299_032352 Ga0501299_032352_245_823 189
887 3300049568 Ga0501031_0142009 Ga0501031_0142009_289_861 189
888 3300049571 Ga0501034_0305168 Ga0501034_0305168_259_831 189
889 3300049571 Ga0501034_0455430 Ga0501034_0455430_271_840 189
890 3300049571 Ga0501034_0710319 Ga0501034_0710319_272_880 189
891 3300049572 Ga0501036_0003520 Ga0501036_0003520_1703_2275 189
892 3300049573 Ga0501037_0008893 Ga0501037_0008893_2190_2762 189
893 3300049573 Ga0501037_0214124 Ga0501037_0214124_128_697 189
894 3300049574 Ga0501038_0009081 Ga0501038_0009081_2951_3523 189
895 3300049574 Ga0501038_0655038 Ga0501038_0655038_110_685 189
896 3300049575 Ga0501039_0011833 Ga0501039_0011833_5861_6433 189
897 3300049575 Ga0501039_0600173 Ga0501039_0600173_60_632 189
898 3300049579 Ga0501043_0018866 Ga0501043_0018866_1801_2373 189
899 3300049580 Ga0501046_0026580 Ga0501046_0026580_2095_2667 189
900 3300049581 Ga0501047_0030087 Ga0501047_0030087_818_1387 189
901 3300049581 Ga0501047_0687940 Ga0501047_0687940_76_648 189
902 3300049582 Ga0501048_0079968 Ga0501048_0079968_821_1399 189
903 3300049583 Ga0501067_0149864 Ga0501067_0149864_584_1162 189
904 3300049584 Ga0501068_0028446 Ga0501068_0028446_820_1398 189
905 3300049586 Ga0501070_0057509 Ga0501070_0057509_423_1001 189
906 3300049587 Ga0501071_0107006 Ga0501071_0107006_433_1011 189
907 3300049589 Ga0501073_0054158 Ga0501073_0054158_584_1162 189
908 3300049589 Ga0501073_0736801 Ga0501073_0736801_84_659 189
909 3300049590 Ga0501074_0024502 Ga0501074_0024502_3511_4089 189
910 3300049649 Ga0501198_021314 Ga0501198_021314_385_963 189
911 3300049651 Ga0501201_021143 Ga0501201_021143_102_680 189
912 3300049652 Ga0501202_000865 Ga0501202_000865_1127_1705 189
913 3300049652 Ga0501202_006743 Ga0501202_006743_1009_1587 189
914 3300049652 Ga0501202_051768 Ga0501202_051768_88_666 189
915 3300049654 Ga0501207_002781 Ga0501207_002781_58_636 189
916 3300049654 Ga0501207_021214 Ga0501207_021214_118_690 189
917 3300049655 Ga0501208_008248 Ga0501208_008248_107_685 189
918 3300049661 Ga0501217_002224 Ga0501217_002224_1262_1840 189
919 3300049661 Ga0501217_032587 Ga0501217_032587_129_707 189
920 3300049662 Ga0501222_000982 Ga0501222_000982_3013_3591 189
921 3300049663 Ga0501223_000157 Ga0501223_000157_15591_16169 189
922 3300049664 Ga0501224_000664 Ga0501224_000664_634_1212 189
923 3300049666 Ga0501228_010121 Ga0501228_010121_325_903 189
924 3300049668 Ga0501233_000669 Ga0501233_000669_4597_5175 189
925 3300049669 Ga0501235_000828 Ga0501235_000828_4444_5022 189
926 3300049673 Ga0501240_002622 Ga0501240_002622_975_1553 189
927 3300049674 Ga0501242_005934 Ga0501242_005934_617_1195 189
928 3300049675 Ga0501243_000215 Ga0501243_000215_6449_7027 189
929 3300049680 Ga0501250_006524 Ga0501250_006524_592_1170 189
930 3300049680 Ga0501250_007292 Ga0501250_007292_123_701 189
931 3300049682 Ga0501252_000578 Ga0501252_000578_1675_2253 189
932 3300049683 Ga0501253_000895 Ga0501253_000895_946_1524 189
933 3300049686 Ga0501257_004810 Ga0501257_004810_2024_2596 189
934 3300049688 Ga0501259_000181 Ga0501259_000181_4889_5467 189
935 3300049688 Ga0501259_002966 Ga0501259_002966_392_970 189
936 3300049688 Ga0501259_071355 Ga0501259_071355_98_676 189
937 3300049690 Ga0501261_005649 Ga0501261_005649_922_1500 189
938 3300049690 Ga0501261_050559 Ga0501261_050559_53_631 189
939 3300049703 Ga0501219_000812 Ga0501219_000812_2109_2678 189
940 3300049704 Ga0501221_000080 Ga0501221_000080_4628_5206 189
941 3300049705 Ga0501225_0001083 Ga0501225_0001083_7248_7826 189
942 3300049705 Ga0501225_0002530 Ga0501225_0002530_2076_2648 189
943 3300049705 Ga0501225_0007474 Ga0501225_0007474_1638_2207 189
944 3300049707 Ga0501234_000581 Ga0501234_000581_966_1544 189
945 3300049708 Ga0501245_000311 Ga0501245_000311_3901_4479 189
946 3300049708 Ga0501245_003557 Ga0501245_003557_710_1288 189
947 3300049741 Ga0501079_0076381 Ga0501079_0076381_1126_1704 189
948 3300049742 Ga0501080_0039984 Ga0501080_0039984_801_1379 189
949 3300049742 Ga0501080_0513414 Ga0501080_0513414_443_1015 189
950 3300049744 Ga0501083_0174751 Ga0501083_0174751_629_1207 189
951 3300049757 Ga0501232_010289 Ga0501232_010289_109_687 189
952 3300049758 Ga0501241_001105 Ga0501241_001105_839_1408 189
953 3300049758 Ga0501241_004302 Ga0501241_004302_760_1332 189
954 3300049758 Ga0501241_043990 Ga0501241_043990_95_673 189
955 3300049763 Ga0501266_005705 Ga0501266_005705_756_1334 189
956 3300049765 Ga0501268_052523 Ga0501268_052523_94_672 189
957 3300049768 Ga0501271_012917 Ga0501271_012917_301_879 189
958 3300049774 Ga0501278_009862 Ga0501278_009862_125_703 189
959 3300049823 Ga0501044_0006136 Ga0501044_0006136_7131_7703 189
960 3300049823 Ga0501044_0019334 Ga0501044_0019334_5438_6046 189
961 3300049823 Ga0501044_0038980 Ga0501044_0038980_2992_3567 189
962 3300049823 Ga0501044_0099172 Ga0501044_0099172_39_617 189
963 3300049823 Ga0501044_0512092 Ga0501044_0512092_332_904 189
964 3300049824 Ga0501045_0375742 Ga0501045_0375742_410_982 189
965 3300049851 Ga0501212_036903 Ga0501212_036903_71_649 189
966 3300050005 Ga0501284_00105 Ga0501284_00105_14618_15187 189
967 3300050493 nmdc:mga0k408_162047_c1 nmdc:mga0k408_162047_c1_539_1108 189
968 3300050493 nmdc:mga0k408_40690_c1 nmdc:mga0k408_40690_c1_1441_2010 189
969 3300050508 nmdc:mga09592_12177_c1 nmdc:mga09592_12177_c1_472_1056 189
970 3300050515 nmdc:mga0a205_923055_c1 nmdc:mga0a205_923055_c1_20_592 189
971 3300053085 Ga0495619_0125939 Ga0495619_0125939_282_866 189
972 3300053086 Ga0500578_0000120 Ga0500578_0000120_22271_22840 189
973 3300053088 Ga0500644_0129574 Ga0500644_0129574_281_853 189
974 3300053090 Ga0500646_0010270 Ga0500646_0010270_885_1454 189
975 3300053092 Ga0500583_0012437 Ga0500583_0012437_1268_1837 189
976 3300053093 Ga0500651_0438006 Ga0500651_0438006_32_601 189
977 3300053098 Ga0500650_0078790 Ga0500650_0078790_262_837 189
978 3300053109 Ga0500569_000517 Ga0500569_000517_3097_3666 189
979 3300053131 Ga0500652_083867 Ga0500652_083867_377_958 189
980 3300053136 Ga0500559_0003554 Ga0500559_0003554_4566_5135 189
981 3300053139 Ga0500568_0083274 Ga0500568_0083274_91_672 189
982 3300053142 Ga0500577_0005167 Ga0500577_0005167_2274_2843 189
983 3300053147 Ga0500589_053266 Ga0500589_053266_856_1425 189
984 3300053153 Ga0500616_0003236 Ga0500616_0003236_9057_9626 189
985 3300053153 Ga0500616_0025280 Ga0500616_0025280_2178_2747 189
986 3300053156 Ga0500622_0001475 Ga0500622_0001475_9834_10406 189
987 3300053158 Ga0500627_0194614 Ga0500627_0194614_309_884 189
988 3300053160 Ga0500633_0043943 Ga0500633_0043943_757_1326 189
989 3300053161 Ga0500634_0090702 Ga0500634_0090702_223_792 189
990 3300053177 Ga0500636_0007397 Ga0500636_0007397_4367_4936 189
991 3300053727 Ga0500611_067885 Ga0500611_067885_273_842 189
992 3300055283 Ga0500661_016479 Ga0500661_016479_192_761 189
993 3300060353 Ga0501082_0099557 Ga0501082_0099557_51_629 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00265

TK

Thymidine kinase

43

215

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpo-assembly1.cif.gz_D thermotoga maritima thymidine kinase in the apo form 0.8788 13 189
2qpo-assembly1.cif.gz_D thermotoga maritima thymidine kinase in the apo form 0.8678 13 189
2orw-assembly1.cif.gz_A-2 thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a 0.8596 13 189
1w4r-assembly2.cif.gz_E structure of a type ii thymidine kinase with bound dttp 0.8579 12 186
1xbt-assembly2.cif.gz_H crystal structure of human thymidine kinase 1 0.8565 12 186
ID Description Score Start End Superfamily
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 12 145 3.40.50.300
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.954 12 145 3.40.50.300
af_P27158_18_121_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9491 12 117 3.40.50.300
af_P27158_18_121_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9404 12 117 3.40.50.300
2qpoC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 13 144 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Y2T0V1-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9644 11 150 GO:0004797
GO:0005524
GO:0046104
GO:0071897
AF-X1JNW3-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9565 29 140 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A2M8KSR6-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9497 12 145 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-K1V128-F1-model_v4 thymidine kinase (EC 2.7.1.21) 0.9456 5 158 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A357HGB1-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9435 8 157 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897

Feature Viewer

pLDDT pTM Quality
82.05 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map