F487682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 387 | 980 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10541274|Ga0105237_105412742 |
| Length | 220 |
| Sequence | MVLIEQAFNGVSISNSYKVITNSEPNLYVSMFIEPHIKGERRGWIEVICGSMFSGKTEELIRRLKRAKIANLKVEIFKPSMDIRYHEHNIVSHDESTILSSPIDNSQTILLMASDVDVIGIDEAQFFDDQLPEVCDQLAFRGIRVIVAGLDMDFTAKPFGQMPFLLAKADYITKLHAICVKCGNIANYSYRKSRADSQVLLGEKDLYEPRCRNCYYNQVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 6 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 7 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 8 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 9 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 10 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 11 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 12 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 293 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 312 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 313 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 315 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 317 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 318 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 321 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 326 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 329 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 334 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 341 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 343 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 346 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 350 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 361 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 373 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 375 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 382 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 384 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 387 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.46 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 86.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013829 | 3300001979 | Bacteria | 2997 |
| 2 | JGI24739J22299_10018562 | 3300001989 | Bacteria | 2498 |
| 3 | JGI25158J39367_1005868 | 3300002739 | Bacteria | 1780 |
| 4 | JGI25153J46596_10000209 | 3300003215 | Bacteria | 52915 |
| 5 | JGI25153J46596_10023975 | 3300003215 | Bacteria | 2208 |
| 6 | rootH2_10011602 | 3300003320 | Bacteria | 11970 |
| 7 | rootH2_10087314 | 3300003320 | Bacteria | 1812 |
| 8 | rootH2_10090059 | 3300003320 | Bacteria | 2516 |
| 9 | rootH2_10137001 | 3300003320 | Bacteria | 6424 |
| 10 | rootH1_10043692 | 3300003323 | Bacteria | 17024 |
| 11 | rootH1_10137701 | 3300003323 | Unclassified | 3887 |
| 12 | rootH1_10203057 | 3300003323 | Bacteria | 3559 |
| 13 | JGI25160J50197_1001403 | 3300003354 | Bacteria | 12081 |
| 14 | JGI25160J50197_1003289 | 3300003354 | Bacteria | 7276 |
| 15 | JGI25160J50197_1009333 | 3300003354 | Bacteria | 3651 |
| 16 | Ga0055542_1005560 | 3300003762 | Bacteria | 2824 |
| 17 | Ga0055526_1021827 | 3300003771 | Bacteria | 2208 |
| 18 | Ga0055526_1038025 | 3300003771 | Bacteria | 1247 |
| 19 | Ga0055528_1000308 | 3300003790 | Bacteria | 41407 |
| 20 | Ga0055528_1000809 | 3300003790 | Bacteria | 21549 |
| 21 | Ga0055530_10000385 | 3300003791 | Bacteria | 39749 |
| 22 | Ga0055531_10000027 | 3300003794 | Bacteria | 160284 |
| 23 | Ga0065165_1000053 | 3300005262 | Bacteria | 189081 |
| 24 | Ga0065165_1004556 | 3300005262 | Bacteria | 8464 |
| 25 | Ga0065165_1046879 | 3300005262 | Bacteria | 1251 |
| 26 | Ga0065714_10214071 | 3300005288 | Bacteria | 858 |
| 27 | Ga0065704_10029955 | 3300005289 | Bacteria | 1419 |
| 28 | Ga0065704_10244930 | 3300005289 | Bacteria | 1005 |
| 29 | Ga0065712_10014379 | 3300005290 | Bacteria | 1582 |
| 30 | Ga0065712_10019139 | 3300005290 | Bacteria | 3687 |
| 31 | Ga0065712_10029565 | 3300005290 | Unclassified | 881 |
| 32 | Ga0065712_10208997 | 3300005290 | Bacteria | 1080 |
| 33 | Ga0065712_10263719 | 3300005290 | Bacteria | 931 |
| 34 | Ga0065707_10166336 | 3300005295 | Bacteria | 1519 |
| 35 | Ga0065707_10385028 | 3300005295 | Bacteria | 855 |
| 36 | Ga0070676_10389108 | 3300005328 | Bacteria | 967 |
| 37 | Ga0070676_10780897 | 3300005328 | Bacteria | 703 |
| 38 | Ga0070683_100030331 | 3300005329 | Bacteria | 4907 |
| 39 | Ga0070670_100018081 | 3300005331 | Bacteria | 6051 |
| 40 | Ga0070670_100068080 | 3300005331 | Bacteria | 3055 |
| 41 | Ga0070670_100092898 | 3300005331 | Bacteria | 2595 |
| 42 | Ga0070670_100150457 | 3300005331 | Bacteria | 2014 |
| 43 | Ga0070670_100219101 | 3300005331 | Bacteria | 1655 |
| 44 | Ga0070670_100231408 | 3300005331 | Bacteria | 1608 |
| 45 | Ga0070670_100490162 | 3300005331 | Bacteria | 1092 |
| 46 | Ga0070677_10013451 | 3300005333 | Unclassified | 2862 |
| 47 | Ga0070677_10063065 | 3300005333 | Bacteria | 1535 |
| 48 | Ga0070677_10142571 | 3300005333 | Bacteria | 1107 |
| 49 | Ga0068869_100006542 | 3300005334 | Bacteria | 7390 |
| 50 | Ga0068869_100007079 | 3300005334 | Bacteria | 7144 |
| 51 | Ga0068869_100092954 | 3300005334 | Bacteria | 2271 |
| 52 | Ga0068869_100161706 | 3300005334 | Bacteria | 1743 |
| 53 | Ga0068869_100167040 | 3300005334 | Bacteria | 1716 |
| 54 | Ga0068869_100274879 | 3300005334 | Unclassified | 1353 |
| 55 | Ga0070666_10000536 | 3300005335 | Bacteria | 22907 |
| 56 | Ga0070666_10076765 | 3300005335 | Unclassified | 2280 |
| 57 | Ga0070666_10211835 | 3300005335 | Bacteria | 1365 |
| 58 | Ga0070682_100000628 | 3300005337 | Bacteria | 21473 |
| 59 | Ga0070682_100627674 | 3300005337 | Bacteria | 852 |
| 60 | Ga0068868_100006435 | 3300005338 | Bacteria | 8312 |
| 61 | Ga0068868_100221867 | 3300005338 | Bacteria | 1583 |
| 62 | Ga0068868_100238903 | 3300005338 | Bacteria | 1526 |
| 63 | Ga0068868_100452219 | 3300005338 | Bacteria | 1117 |
| 64 | Ga0068868_100564460 | 3300005338 | Bacteria | 1004 |
| 65 | Ga0070660_100044390 | 3300005339 | Bacteria | 3400 |
| 66 | Ga0070660_100181694 | 3300005339 | Unclassified | 1702 |
| 67 | Ga0070660_100275914 | 3300005339 | Bacteria | 1375 |
| 68 | Ga0070660_100858708 | 3300005339 | Bacteria | 764 |
| 69 | Ga0070691_10415273 | 3300005341 | Bacteria | 761 |
| 70 | Ga0070687_100011322 | 3300005343 | Bacteria | 3900 |
| 71 | Ga0070687_100031401 | 3300005343 | Bacteria | 2606 |
| 72 | Ga0070687_100105272 | 3300005343 | Bacteria | 1587 |
| 73 | Ga0070687_100367826 | 3300005343 | Bacteria | 933 |
| 74 | Ga0070661_100592694 | 3300005344 | Bacteria | 895 |
| 75 | Ga0070661_101133903 | 3300005344 | Bacteria | 652 |
| 76 | Ga0070668_100030711 | 3300005347 | Bacteria | 4087 |
| 77 | Ga0070668_100078394 | 3300005347 | Bacteria | 2584 |
| 78 | Ga0070668_100222169 | 3300005347 | Bacteria | 1558 |
| 79 | Ga0070668_100391018 | 3300005347 | Unclassified | 1185 |
| 80 | Ga0070669_100169400 | 3300005353 | Bacteria | 1702 |
| 81 | Ga0070669_100185767 | 3300005353 | Bacteria | 1628 |
| 82 | Ga0070669_100264686 | 3300005353 | Bacteria | 1373 |
| 83 | Ga0070675_100017651 | 3300005354 | Bacteria | 5675 |
| 84 | Ga0070675_100123475 | 3300005354 | Bacteria | 2201 |
| 85 | Ga0070675_100129986 | 3300005354 | Bacteria | 2145 |
| 86 | Ga0070675_100290018 | 3300005354 | Bacteria | 1440 |
| 87 | Ga0070675_100770431 | 3300005354 | Unclassified | 878 |
| 88 | Ga0070671_100100262 | 3300005355 | Bacteria | 2429 |
| 89 | Ga0070671_100184160 | 3300005355 | Bacteria | 1769 |
| 90 | Ga0070671_101091380 | 3300005355 | Bacteria | 701 |
| 91 | Ga0070674_100100564 | 3300005356 | Bacteria | 2105 |
| 92 | Ga0070674_100122851 | 3300005356 | Bacteria | 1924 |
| 93 | Ga0070674_100178240 | 3300005356 | Bacteria | 1626 |
| 94 | Ga0070674_100304792 | 3300005356 | Bacteria | 1271 |
| 95 | Ga0070673_100004723 | 3300005364 | Bacteria | 8650 |
| 96 | Ga0070673_100006253 | 3300005364 | Bacteria | 7723 |
| 97 | Ga0070673_100013324 | 3300005364 | Bacteria | 5682 |
| 98 | Ga0070673_100276452 | 3300005364 | Unclassified | 1471 |
| 99 | Ga0070673_100276840 | 3300005364 | Bacteria | 1470 |
| 100 | Ga0070673_100668681 | 3300005364 | Bacteria | 952 |
| 101 | Ga0070688_100344574 | 3300005365 | Bacteria | 1089 |
| 102 | Ga0070688_100570944 | 3300005365 | Bacteria | 862 |
| 103 | Ga0070688_100645700 | 3300005365 | Unclassified | 814 |
| 104 | Ga0070659_100003227 | 3300005366 | Bacteria | 11613 |
| 105 | Ga0070659_100088075 | 3300005366 | Bacteria | 2486 |
| 106 | Ga0070667_100005388 | 3300005367 | Bacteria | 10686 |
| 107 | Ga0070667_100015282 | 3300005367 | Bacteria | 6345 |
| 108 | Ga0070667_100059103 | 3300005367 | Bacteria | 3243 |
| 109 | Ga0070667_100457465 | 3300005367 | Bacteria | 1167 |
| 110 | Ga0070667_100460105 | 3300005367 | Bacteria | 1163 |
| 111 | Ga0070667_100466195 | 3300005367 | Bacteria | 1155 |
| 112 | Ga0070667_100575414 | 3300005367 | Bacteria | 1036 |
| 113 | Ga0070709_10625398 | 3300005434 | Bacteria | 831 |
| 114 | Ga0070713_100837017 | 3300005436 | Bacteria | 883 |
| 115 | Ga0070701_10195924 | 3300005438 | Bacteria | 1191 |
| 116 | Ga0070700_100010950 | 3300005441 | Bacteria | 5016 |
| 117 | Ga0070700_100280319 | 3300005441 | Bacteria | 1208 |
| 118 | Ga0070700_100577515 | 3300005441 | Bacteria | 877 |
| 119 | Ga0070694_100129554 | 3300005444 | Bacteria | 1821 |
| 120 | Ga0070708_100620020 | 3300005445 | Bacteria | 1020 |
| 121 | Ga0070663_100019412 | 3300005455 | Bacteria | 4479 |
| 122 | Ga0070663_100321602 | 3300005455 | Bacteria | 1244 |
| 123 | Ga0070678_100056590 | 3300005456 | Bacteria | 2869 |
| 124 | Ga0070678_100068026 | 3300005456 | Unclassified | 2653 |
| 125 | Ga0070678_100227551 | 3300005456 | Bacteria | 1553 |
| 126 | Ga0070681_10008396 | 3300005458 | Bacteria | 10112 |
| 127 | Ga0070681_10024676 | 3300005458 | Bacteria | 6050 |
| 128 | Ga0070681_10042169 | 3300005458 | Bacteria | 4574 |
| 129 | Ga0068867_100017763 | 3300005459 | Bacteria | 5050 |
| 130 | Ga0068867_100019000 | 3300005459 | Bacteria | 4893 |
| 131 | Ga0068867_100023075 | 3300005459 | Bacteria | 4453 |
| 132 | Ga0068867_100075165 | 3300005459 | Bacteria | 2534 |
| 133 | Ga0068867_100117576 | 3300005459 | Bacteria | 2050 |
| 134 | Ga0068867_100133111 | 3300005459 | Bacteria | 1935 |
| 135 | Ga0068867_100451034 | 3300005459 | Bacteria | 1096 |
| 136 | Ga0068867_100517768 | 3300005459 | Bacteria | 1028 |
| 137 | Ga0068867_100688958 | 3300005459 | Unclassified | 901 |
| 138 | Ga0068867_101344111 | 3300005459 | Bacteria | 661 |
| 139 | Ga0070685_10020796 | 3300005466 | Bacteria | 3556 |
| 140 | Ga0070685_10078569 | 3300005466 | Unclassified | 1973 |
| 141 | Ga0070685_10093120 | 3300005466 | Unclassified | 1827 |
| 142 | Ga0070685_10150879 | 3300005466 | Bacteria | 1473 |
| 143 | Ga0070685_10285159 | 3300005466 | Bacteria | 1107 |
| 144 | Ga0070698_100000661 | 3300005471 | Bacteria | 36847 |
| 145 | Ga0070698_100005764 | 3300005471 | Bacteria | 13543 |
| 146 | Ga0070679_100018252 | 3300005530 | Bacteria | 6804 |
| 147 | Ga0070679_100155055 | 3300005530 | Bacteria | 2265 |
| 148 | Ga0070684_100001895 | 3300005535 | Bacteria | 15325 |
| 149 | Ga0070684_100803610 | 3300005535 | Unclassified | 879 |
| 150 | Ga0068853_100008728 | 3300005539 | Bacteria | 8153 |
| 151 | Ga0068853_100014820 | 3300005539 | Bacteria | 6400 |
| 152 | Ga0068853_100088156 | 3300005539 | Bacteria | 2724 |
| 153 | Ga0068853_100239648 | 3300005539 | Bacteria | 1662 |
| 154 | Ga0068853_100360163 | 3300005539 | Bacteria | 1355 |
| 155 | Ga0068853_100626989 | 3300005539 | Bacteria | 1022 |
| 156 | Ga0068853_101435349 | 3300005539 | Bacteria | 668 |
| 157 | Ga0070672_100023427 | 3300005543 | Bacteria | 4552 |
| 158 | Ga0070672_100025969 | 3300005543 | Bacteria | 4351 |
| 159 | Ga0070672_100047689 | 3300005543 | Bacteria | 3325 |
| 160 | Ga0070672_100054432 | 3300005543 | Bacteria | 3132 |
| 161 | Ga0070672_100242480 | 3300005543 | Bacteria | 1516 |
| 162 | Ga0070672_100263024 | 3300005543 | Bacteria | 1455 |
| 163 | Ga0070672_100313140 | 3300005543 | Bacteria | 1333 |
| 164 | Ga0070672_100314732 | 3300005543 | Unclassified | 1329 |
| 165 | Ga0070672_100475207 | 3300005543 | Bacteria | 1079 |
| 166 | Ga0070672_100509640 | 3300005543 | Bacteria | 1041 |
| 167 | Ga0070672_100961930 | 3300005543 | Bacteria | 756 |
| 168 | Ga0070686_100019526 | 3300005544 | Bacteria | 3996 |
| 169 | Ga0070686_100361632 | 3300005544 | Bacteria | 1093 |
| 170 | Ga0070696_100133873 | 3300005546 | Unclassified | 1806 |
| 171 | Ga0070693_100008596 | 3300005547 | Bacteria | 5045 |
| 172 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 173 | Ga0070665_100019926 | 3300005548 | Bacteria | 6736 |
| 174 | Ga0070665_100890085 | 3300005548 | Unclassified | 903 |
| 175 | Ga0068855_100001250 | 3300005563 | Bacteria | 31562 |
| 176 | Ga0068855_100001274 | 3300005563 | Bacteria | 31259 |
| 177 | Ga0068855_100025826 | 3300005563 | Bacteria | 7024 |
| 178 | Ga0068855_100091452 | 3300005563 | Bacteria | 3510 |
| 179 | Ga0068855_100139770 | 3300005563 | Bacteria | 2762 |
| 180 | Ga0068855_100644205 | 3300005563 | Bacteria | 1138 |
| 181 | Ga0070664_100108824 | 3300005564 | Bacteria | 2417 |
| 182 | Ga0070664_100124998 | 3300005564 | Unclassified | 2255 |
| 183 | Ga0070664_100138162 | 3300005564 | Bacteria | 2144 |
| 184 | Ga0068857_100151517 | 3300005577 | Bacteria | 2101 |
| 185 | Ga0068857_100281164 | 3300005577 | Bacteria | 1531 |
| 186 | Ga0068857_100523938 | 3300005577 | Bacteria | 1114 |
| 187 | Ga0068857_100747755 | 3300005577 | Bacteria | 931 |
| 188 | Ga0068854_100014234 | 3300005578 | Bacteria | 5239 |
| 189 | Ga0068854_100014439 | 3300005578 | Bacteria | 5208 |
| 190 | Ga0068854_100193632 | 3300005578 | Bacteria | 1594 |
| 191 | Ga0068854_100201852 | 3300005578 | Bacteria | 1563 |
| 192 | Ga0068854_100416099 | 3300005578 | Bacteria | 1115 |
| 193 | Ga0068854_100454151 | 3300005578 | Bacteria | 1071 |
| 194 | Ga0068856_100093229 | 3300005614 | Bacteria | 2997 |
| 195 | Ga0068856_100379535 | 3300005614 | Bacteria | 1433 |
| 196 | Ga0070702_100022492 | 3300005615 | Bacteria | 3334 |
| 197 | Ga0070702_100216324 | 3300005615 | Bacteria | 1278 |
| 198 | Ga0068852_100000180 | 3300005616 | Bacteria | 43078 |
| 199 | Ga0068852_100001996 | 3300005616 | Bacteria | 13908 |
| 200 | Ga0068852_100303661 | 3300005616 | Bacteria | 1546 |
| 201 | Ga0068852_101335593 | 3300005616 | Unclassified | 739 |
| 202 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 203 | Ga0068859_100001403 | 3300005617 | Bacteria | 24458 |
| 204 | Ga0068859_100029222 | 3300005617 | Bacteria | 5531 |
| 205 | Ga0068859_100083124 | 3300005617 | Unclassified | 3244 |
| 206 | Ga0068859_100093110 | 3300005617 | Bacteria | 3065 |
| 207 | Ga0068859_100384798 | 3300005617 | Bacteria | 1498 |
| 208 | Ga0068859_100614679 | 3300005617 | Bacteria | 1179 |
| 209 | Ga0068859_100780385 | 3300005617 | Bacteria | 1044 |
| 210 | Ga0068864_100001316 | 3300005618 | Bacteria | 20650 |
| 211 | Ga0068864_100145703 | 3300005618 | Bacteria | 2141 |
| 212 | Ga0068864_101165821 | 3300005618 | Bacteria | 768 |
| 213 | Ga0068866_10103285 | 3300005718 | Bacteria | 1577 |
| 214 | Ga0068861_100080332 | 3300005719 | Bacteria | 2551 |
| 215 | Ga0068861_100964043 | 3300005719 | Bacteria | 812 |
| 216 | Ga0068851_10070919 | 3300005834 | Bacteria | 1802 |
| 217 | Ga0068851_10090465 | 3300005834 | Bacteria | 1610 |
| 218 | Ga0068851_10321220 | 3300005834 | Bacteria | 894 |
| 219 | Ga0068870_10025539 | 3300005840 | Bacteria | 2934 |
| 220 | Ga0068870_10197145 | 3300005840 | Bacteria | 1219 |
| 221 | Ga0068863_100000444 | 3300005841 | Bacteria | 41977 |
| 222 | Ga0068863_100007099 | 3300005841 | Bacteria | 10983 |
| 223 | Ga0068863_100024194 | 3300005841 | Bacteria | 5793 |
| 224 | Ga0068863_100215718 | 3300005841 | Bacteria | 1848 |
| 225 | Ga0068863_100226590 | 3300005841 | Bacteria | 1802 |
| 226 | Ga0068863_100306485 | 3300005841 | Bacteria | 1541 |
| 227 | Ga0068863_100503435 | 3300005841 | Bacteria | 1193 |
| 228 | Ga0068863_100650341 | 3300005841 | Bacteria | 1045 |
| 229 | Ga0068863_101267734 | 3300005841 | Unclassified | 743 |
| 230 | Ga0068863_101291900 | 3300005841 | Bacteria | 736 |
| 231 | Ga0068858_100000829 | 3300005842 | Bacteria | 32222 |
| 232 | Ga0068858_100351746 | 3300005842 | Bacteria | 1411 |
| 233 | Ga0068858_100482081 | 3300005842 | Bacteria | 1197 |
| 234 | Ga0068858_100530908 | 3300005842 | Unclassified | 1138 |
| 235 | Ga0068858_100822543 | 3300005842 | Bacteria | 906 |
| 236 | Ga0068860_100000029 | 3300005843 | Bacteria | 259192 |
| 237 | Ga0068860_100005394 | 3300005843 | Bacteria | 12976 |
| 238 | Ga0068860_100010234 | 3300005843 | Bacteria | 9282 |
| 239 | Ga0068860_100024948 | 3300005843 | Bacteria | 5771 |
| 240 | Ga0068860_100061290 | 3300005843 | Bacteria | 3574 |
| 241 | Ga0068860_100121471 | 3300005843 | Bacteria | 2501 |
| 242 | Ga0068860_100130163 | 3300005843 | Bacteria | 2414 |
| 243 | Ga0068860_100351346 | 3300005843 | Bacteria | 1451 |
| 244 | Ga0068862_100236663 | 3300005844 | Bacteria | 1658 |
| 245 | Ga0081540_1074941 | 3300005983 | Bacteria | 1548 |
| 246 | Ga0075366_10007240 | 3300006195 | Bacteria | 6115 |
| 247 | Ga0075366_10209743 | 3300006195 | Bacteria | 1186 |
| 248 | Ga0075366_10313920 | 3300006195 | Bacteria | 960 |
| 249 | Ga0097621_100000711 | 3300006237 | Bacteria | 23348 |
| 250 | Ga0097621_100012629 | 3300006237 | Bacteria | 6268 |
| 251 | Ga0097621_100077083 | 3300006237 | Bacteria | 2766 |
| 252 | Ga0097621_100092526 | 3300006237 | Bacteria | 2533 |
| 253 | Ga0097621_100126956 | 3300006237 | Bacteria | 2167 |
| 254 | Ga0097621_100158266 | 3300006237 | Unclassified | 1946 |
| 255 | Ga0097621_100428706 | 3300006237 | Unclassified | 1188 |
| 256 | Ga0097621_100627510 | 3300006237 | Bacteria | 984 |
| 257 | Ga0097621_100840136 | 3300006237 | Unclassified | 853 |
| 258 | Ga0075370_10159619 | 3300006353 | Bacteria | 1323 |
| 259 | Ga0068871_100000351 | 3300006358 | Bacteria | 31972 |
| 260 | Ga0068871_100018089 | 3300006358 | Bacteria | 5350 |
| 261 | Ga0068871_100020023 | 3300006358 | Bacteria | 5119 |
| 262 | Ga0068871_100075432 | 3300006358 | Unclassified | 2784 |
| 263 | Ga0068871_100165258 | 3300006358 | Bacteria | 1894 |
| 264 | Ga0068871_100414105 | 3300006358 | Bacteria | 1202 |
| 265 | Ga0068871_100614016 | 3300006358 | Bacteria | 990 |
| 266 | Ga0068871_100643525 | 3300006358 | Bacteria | 967 |
| 267 | Ga0068871_101066465 | 3300006358 | Bacteria | 755 |
| 268 | Ga0075428_100025171 | 3300006844 | Bacteria | 6585 |
| 269 | Ga0075428_100059396 | 3300006844 | Bacteria | 4187 |
| 270 | Ga0075430_100021698 | 3300006846 | Bacteria | 5457 |
| 271 | Ga0075430_100030675 | 3300006846 | Bacteria | 4566 |
| 272 | Ga0075433_10519812 | 3300006852 | Bacteria | 1047 |
| 273 | Ga0075429_100005315 | 3300006880 | Bacteria | 11083 |
| 274 | Ga0075429_100081239 | 3300006880 | Unclassified | 2826 |
| 275 | Ga0068865_100020694 | 3300006881 | Bacteria | 4270 |
| 276 | Ga0068865_100186132 | 3300006881 | Bacteria | 1602 |
| 277 | Ga0068865_100316585 | 3300006881 | Bacteria | 1254 |
| 278 | Ga0068865_100516213 | 3300006881 | Bacteria | 998 |
| 279 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 280 | Ga0097620_100001403 | 3300006931 | Bacteria | 24458 |
| 281 | Ga0097620_100029222 | 3300006931 | Bacteria | 5531 |
| 282 | Ga0097620_100083124 | 3300006931 | Unclassified | 3244 |
| 283 | Ga0097620_100093114 | 3300006931 | Bacteria | 3065 |
| 284 | Ga0097620_100384790 | 3300006931 | Bacteria | 1498 |
| 285 | Ga0097620_100614642 | 3300006931 | Bacteria | 1179 |
| 286 | Ga0097620_100780398 | 3300006931 | Bacteria | 1044 |
| 287 | Ga0097620_101262741 | 3300006931 | Bacteria | 814 |
| 288 | Ga0105240_10001800 | 3300009093 | Bacteria | 36076 |
| 289 | Ga0105240_10003960 | 3300009093 | Bacteria | 22876 |
| 290 | Ga0105240_10003982 | 3300009093 | Bacteria | 22790 |
| 291 | Ga0105240_10008182 | 3300009093 | Bacteria | 14995 |
| 292 | Ga0105240_10010900 | 3300009093 | Bacteria | 12735 |
| 293 | Ga0105240_10050422 | 3300009093 | Bacteria | 5248 |
| 294 | Ga0105240_10099692 | 3300009093 | Bacteria | 3535 |
| 295 | Ga0105240_10117609 | 3300009093 | Bacteria | 3204 |
| 296 | Ga0105240_10791516 | 3300009093 | Bacteria | 1028 |
| 297 | Ga0111539_10125769 | 3300009094 | Bacteria | 3004 |
| 298 | Ga0105247_10001984 | 3300009101 | Bacteria | 14204 |
| 299 | Ga0105247_10165240 | 3300009101 | Unclassified | 1468 |
| 300 | Ga0105247_10262399 | 3300009101 | Unclassified | 1185 |
| 301 | Ga0114129_10153798 | 3300009147 | Bacteria | 3147 |
| 302 | Ga0114129_10208548 | 3300009147 | Unclassified | 2643 |
| 303 | Ga0105243_10387332 | 3300009148 | Unclassified | 1295 |
| 304 | Ga0105243_10459542 | 3300009148 | Unclassified | 1197 |
| 305 | Ga0105243_10520306 | 3300009148 | Bacteria | 1131 |
| 306 | Ga0105241_10000206 | 3300009174 | Bacteria | 44346 |
| 307 | Ga0105241_10001098 | 3300009174 | Bacteria | 20609 |
| 308 | Ga0105241_10142957 | 3300009174 | Bacteria | 1950 |
| 309 | Ga0105241_10275092 | 3300009174 | Bacteria | 1436 |
| 310 | Ga0105241_10515071 | 3300009174 | Bacteria | 1069 |
| 311 | Ga0105242_10030077 | 3300009176 | Bacteria | 4335 |
| 312 | Ga0105242_10162697 | 3300009176 | Bacteria | 1955 |
| 313 | Ga0105242_10350443 | 3300009176 | Bacteria | 1363 |
| 314 | Ga0105242_10382148 | 3300009176 | Bacteria | 1309 |
| 315 | Ga0105242_10936432 | 3300009176 | Bacteria | 869 |
| 316 | Ga0105248_10046848 | 3300009177 | Bacteria | 4847 |
| 317 | Ga0105248_10241525 | 3300009177 | Unclassified | 2033 |
| 318 | Ga0105248_10417121 | 3300009177 | Bacteria | 1512 |
| 319 | Ga0105248_10790839 | 3300009177 | Bacteria | 1071 |
| 320 | Ga0105237_10000780 | 3300009545 | Bacteria | 43609 |
| 321 | Ga0105237_10003152 | 3300009545 | Bacteria | 19845 |
| 322 | Ga0105237_10009612 | 3300009545 | Bacteria | 10356 |
| 323 | Ga0105237_10012022 | 3300009545 | Bacteria | 9143 |
| 324 | Ga0105237_10013020 | 3300009545 | Bacteria | 8734 |
| 325 | Ga0105237_10026858 | 3300009545 | Bacteria | 5883 |
| 326 | Ga0105237_10080975 | 3300009545 | Bacteria | 3237 |
| 327 | Ga0105237_10135210 | 3300009545 | Unclassified | 2460 |
| 328 | Ga0105237_10200736 | 3300009545 | Bacteria | 1994 |
| 329 | Ga0105237_10346499 | 3300009545 | Bacteria | 1490 |
| 330 | Ga0105237_10541274 | 3300009545 | Bacteria | 1171 |
| 331 | Ga0105237_11104143 | 3300009545 | Bacteria | 800 |
| 332 | Ga0105238_10032669 | 3300009551 | Bacteria | 5296 |
| 333 | Ga0105238_10037294 | 3300009551 | Bacteria | 4941 |
| 334 | Ga0105238_10045389 | 3300009551 | Bacteria | 4439 |
| 335 | Ga0105238_10056683 | 3300009551 | Bacteria | 3931 |
| 336 | Ga0105238_10291713 | 3300009551 | Bacteria | 1613 |
| 337 | Ga0105249_10008328 | 3300009553 | Bacteria | 9028 |
| 338 | Ga0105249_10009665 | 3300009553 | Bacteria | 8450 |
| 339 | Ga0105249_10042329 | 3300009553 | Bacteria | 4142 |
| 340 | Ga0105249_10197991 | 3300009553 | Bacteria | 1964 |
| 341 | Ga0105249_10497010 | 3300009553 | Unclassified | 1264 |
| 342 | Ga0105249_10598379 | 3300009553 | Bacteria | 1157 |
| 343 | Ga0105239_10000135 | 3300010375 | Bacteria | 103223 |
| 344 | Ga0105239_10000337 | 3300010375 | Bacteria | 68698 |
| 345 | Ga0105239_10007270 | 3300010375 | Bacteria | 12721 |
| 346 | Ga0105239_10009606 | 3300010375 | Bacteria | 10882 |
| 347 | Ga0105239_10011821 | 3300010375 | Bacteria | 9742 |
| 348 | Ga0105239_10066192 | 3300010375 | Bacteria | 3969 |
| 349 | Ga0105239_10224526 | 3300010375 | Bacteria | 2107 |
| 350 | Ga0105239_10237019 | 3300010375 | Bacteria | 2048 |
| 351 | Ga0105239_10278360 | 3300010375 | Bacteria | 1883 |
| 352 | Ga0105239_10390573 | 3300010375 | Bacteria | 1574 |
| 353 | Ga0105239_10701481 | 3300010375 | Bacteria | 1157 |
| 354 | Ga0105246_10432029 | 3300011119 | Bacteria | 1102 |
| 355 | Ga0157373_10048519 | 3300013100 | Bacteria | 3027 |
| 356 | Ga0157373_10171891 | 3300013100 | Bacteria | 1525 |
| 357 | Ga0157373_10588544 | 3300013100 | Bacteria | 809 |
| 358 | Ga0157371_10036310 | 3300013102 | Bacteria | 3529 |
| 359 | Ga0157371_10069202 | 3300013102 | Bacteria | 2499 |
| 360 | Ga0157371_10072834 | 3300013102 | Bacteria | 2433 |
| 361 | Ga0157371_10095188 | 3300013102 | Bacteria | 2110 |
| 362 | Ga0157371_10107422 | 3300013102 | Unclassified | 1981 |
| 363 | Ga0157371_10172210 | 3300013102 | Bacteria | 1547 |
| 364 | Ga0157371_10524499 | 3300013102 | Bacteria | 876 |
| 365 | Ga0157370_10000426 | 3300013104 | Bacteria | 52773 |
| 366 | Ga0157370_10004831 | 3300013104 | Bacteria | 15322 |
| 367 | Ga0157370_10029393 | 3300013104 | Bacteria | 5393 |
| 368 | Ga0157370_10030890 | 3300013104 | Bacteria | 5246 |
| 369 | Ga0157370_10150085 | 3300013104 | Bacteria | 2169 |
| 370 | Ga0157370_10219831 | 3300013104 | Bacteria | 1760 |
| 371 | Ga0157370_10620046 | 3300013104 | Bacteria | 990 |
| 372 | Ga0157370_10981652 | 3300013104 | Unclassified | 765 |
| 373 | Ga0157369_10014091 | 3300013105 | Bacteria | 9036 |
| 374 | Ga0157369_10019728 | 3300013105 | Bacteria | 7544 |
| 375 | Ga0157369_10040395 | 3300013105 | Bacteria | 5093 |
| 376 | Ga0157369_10044422 | 3300013105 | Bacteria | 4836 |
| 377 | Ga0157369_10061816 | 3300013105 | Bacteria | 4037 |
| 378 | Ga0157369_10178489 | 3300013105 | Bacteria | 2235 |
| 379 | Ga0157369_10224634 | 3300013105 | Unclassified | 1965 |
| 380 | Ga0157369_10252953 | 3300013105 | Bacteria | 1838 |
| 381 | Ga0157369_10628330 | 3300013105 | Bacteria | 1108 |
| 382 | Ga0157369_10780015 | 3300013105 | Bacteria | 982 |
| 383 | Ga0157374_10000009 | 3300013296 | Bacteria | 564330 |
| 384 | Ga0157374_10045471 | 3300013296 | Bacteria | 4064 |
| 385 | Ga0157374_10067126 | 3300013296 | Bacteria | 3371 |
| 386 | Ga0157374_10087081 | 3300013296 | Bacteria | 2973 |
| 387 | Ga0157374_10213072 | 3300013296 | Bacteria | 1894 |
| 388 | Ga0157374_10360574 | 3300013296 | Bacteria | 1445 |
| 389 | Ga0157374_10480758 | 3300013296 | Bacteria | 1245 |
| 390 | Ga0157378_10000837 | 3300013297 | Bacteria | 28570 |
| 391 | Ga0157378_10002924 | 3300013297 | Bacteria | 15193 |
| 392 | Ga0157378_10025999 | 3300013297 | Bacteria | 5159 |
| 393 | Ga0157378_11033314 | 3300013297 | Bacteria | 857 |
| 394 | Ga0163162_10000795 | 3300013306 | Bacteria | 29353 |
| 395 | Ga0163162_10000833 | 3300013306 | Bacteria | 28693 |
| 396 | Ga0163162_10008664 | 3300013306 | Bacteria | 9901 |
| 397 | Ga0163162_10041885 | 3300013306 | Bacteria | 4582 |
| 398 | Ga0163162_10050448 | 3300013306 | Bacteria | 4173 |
| 399 | Ga0163162_10069707 | 3300013306 | Unclassified | 3568 |
| 400 | Ga0163162_10453531 | 3300013306 | Bacteria | 1414 |
| 401 | Ga0163162_10924282 | 3300013306 | Bacteria | 984 |
| 402 | Ga0163162_12497444 | 3300013306 | Bacteria | 594 |
| 403 | Ga0157372_10000258 | 3300013307 | Bacteria | 58520 |
| 404 | Ga0157372_10002260 | 3300013307 | Bacteria | 20878 |
| 405 | Ga0157372_10002978 | 3300013307 | Bacteria | 18242 |
| 406 | Ga0157372_10011005 | 3300013307 | Bacteria | 9628 |
| 407 | Ga0157372_10023612 | 3300013307 | Bacteria | 6671 |
| 408 | Ga0157372_10051584 | 3300013307 | Bacteria | 4579 |
| 409 | Ga0157372_10073608 | 3300013307 | Bacteria | 3851 |
| 410 | Ga0157372_10092182 | 3300013307 | Bacteria | 3446 |
| 411 | Ga0157372_10144797 | 3300013307 | Bacteria | 2740 |
| 412 | Ga0157372_10147167 | 3300013307 | Bacteria | 2716 |
| 413 | Ga0157372_10201517 | 3300013307 | Bacteria | 2305 |
| 414 | Ga0157372_10239550 | 3300013307 | Bacteria | 2105 |
| 415 | Ga0157372_10305136 | 3300013307 | Bacteria | 1852 |
| 416 | Ga0157372_10388125 | 3300013307 | Bacteria | 1627 |
| 417 | Ga0157372_10482550 | 3300013307 | Bacteria | 1445 |
| 418 | Ga0157372_10714512 | 3300013307 | Bacteria | 1166 |
| 419 | Ga0157372_10777371 | 3300013307 | Bacteria | 1113 |
| 420 | Ga0157372_10902539 | 3300013307 | Bacteria | 1025 |
| 421 | Ga0157375_10000073 | 3300013308 | Bacteria | 105972 |
| 422 | Ga0157375_10020587 | 3300013308 | Bacteria | 6029 |
| 423 | Ga0157375_10057461 | 3300013308 | Unclassified | 3846 |
| 424 | Ga0157375_10131910 | 3300013308 | Bacteria | 2619 |
| 425 | Ga0157375_10243220 | 3300013308 | Bacteria | 1959 |
| 426 | Ga0157375_10322028 | 3300013308 | Unclassified | 1711 |
| 427 | Ga0157375_10748546 | 3300013308 | Bacteria | 1129 |
| 428 | Ga0157375_10759834 | 3300013308 | Bacteria | 1120 |
| 429 | Ga0157375_10789262 | 3300013308 | Bacteria | 1099 |
| 430 | Ga0163163_10052456 | 3300014325 | Bacteria | 4023 |
| 431 | Ga0163163_10166806 | 3300014325 | Bacteria | 2248 |
| 432 | Ga0163163_10308727 | 3300014325 | Bacteria | 1634 |
| 433 | Ga0163163_10396844 | 3300014325 | Bacteria | 1437 |
| 434 | Ga0163163_11112991 | 3300014325 | Bacteria | 853 |
| 435 | Ga0163163_11144436 | 3300014325 | Bacteria | 841 |
| 436 | Ga0163163_11808531 | 3300014325 | Bacteria | 671 |
| 437 | Ga0157380_10030099 | 3300014326 | Bacteria | 4155 |
| 438 | Ga0157380_10053087 | 3300014326 | Bacteria | 3212 |
| 439 | Ga0157380_10357361 | 3300014326 | Bacteria | 1369 |
| 440 | Ga0157380_10437181 | 3300014326 | Bacteria | 1253 |
| 441 | Ga0157380_10809469 | 3300014326 | Unclassified | 955 |
| 442 | Ga0157377_10044754 | 3300014745 | Bacteria | 2469 |
| 443 | Ga0157377_10137773 | 3300014745 | Bacteria | 1497 |
| 444 | Ga0157379_10070073 | 3300014968 | Bacteria | 3137 |
| 445 | Ga0157379_10119948 | 3300014968 | Bacteria | 2365 |
| 446 | Ga0157379_10185442 | 3300014968 | Unclassified | 1880 |
| 447 | Ga0157379_10186973 | 3300014968 | Bacteria | 1872 |
| 448 | Ga0157379_10213085 | 3300014968 | Unclassified | 1749 |
| 449 | Ga0157379_10356112 | 3300014968 | Bacteria | 1341 |
| 450 | Ga0157379_10778880 | 3300014968 | Bacteria | 902 |
| 451 | Ga0157379_11162181 | 3300014968 | Bacteria | 741 |
| 452 | Ga0157376_10001803 | 3300014969 | Bacteria | 14251 |
| 453 | Ga0157376_10001988 | 3300014969 | Bacteria | 13680 |
| 454 | Ga0157376_10006687 | 3300014969 | Bacteria | 8161 |
| 455 | Ga0157376_10144472 | 3300014969 | Bacteria | 2138 |
| 456 | Ga0157376_10282659 | 3300014969 | Bacteria | 1563 |
| 457 | Ga0157376_10378279 | 3300014969 | Unclassified | 1363 |
| 458 | Ga0182005_1000081 | 3300015265 | Bacteria | 73899 |
| 459 | Ga0163161_10019399 | 3300017792 | Bacteria | 4771 |
| 460 | Ga0163161_10358962 | 3300017792 | Bacteria | 1160 |
| 461 | Ga0209436_100566 | 3300025208 | Bacteria | 15905 |
| 462 | Ga0209436_102659 | 3300025208 | Bacteria | 5200 |
| 463 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 464 | Ga0207425_1015563 | 3300025245 | Bacteria | 1704 |
| 465 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 466 | Ga0209026_1000233 | 3300025250 | Bacteria | 74825 |
| 467 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 468 | Ga0207666_1004090 | 3300025271 | Bacteria | 1816 |
| 469 | Ga0209673_1000034 | 3300025273 | Bacteria | 328788 |
| 470 | Ga0209130_1001027 | 3300025284 | Bacteria | 21399 |
| 471 | Ga0209564_1040205 | 3300025295 | Bacteria | 1273 |
| 472 | Ga0209564_1043670 | 3300025295 | Bacteria | 1173 |
| 473 | Ga0209758_1000419 | 3300025297 | Bacteria | 72133 |
| 474 | Ga0209758_1061714 | 3300025297 | Bacteria | 1232 |
| 475 | Ga0209050_1000353 | 3300025298 | Bacteria | 88509 |
| 476 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 477 | Ga0207426_1000177 | 3300025302 | Bacteria | 159426 |
| 478 | Ga0207426_1000324 | 3300025302 | Bacteria | 91661 |
| 479 | Ga0207426_1000592 | 3300025302 | Bacteria | 47901 |
| 480 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 481 | Ga0209257_1002086 | 3300025304 | Bacteria | 21027 |
| 482 | Ga0207656_10046417 | 3300025321 | Bacteria | 1863 |
| 483 | Ga0207656_10064710 | 3300025321 | Bacteria | 1612 |
| 484 | Ga0207656_10405269 | 3300025321 | Bacteria | 686 |
| 485 | Ga0207682_10038675 | 3300025893 | Bacteria | 1937 |
| 486 | Ga0207682_10069708 | 3300025893 | Bacteria | 1487 |
| 487 | Ga0207682_10086730 | 3300025893 | Bacteria | 1351 |
| 488 | Ga0207682_10109391 | 3300025893 | Unclassified | 1215 |
| 489 | Ga0207642_10040607 | 3300025899 | Bacteria | 2031 |
| 490 | Ga0207710_10001075 | 3300025900 | Bacteria | 14094 |
| 491 | Ga0207688_10033901 | 3300025901 | Bacteria | 2825 |
| 492 | Ga0207688_10165903 | 3300025901 | Bacteria | 1311 |
| 493 | Ga0207680_10000067 | 3300025903 | Bacteria | 46002 |
| 494 | Ga0207680_10063588 | 3300025903 | Unclassified | 2259 |
| 495 | Ga0207680_10348173 | 3300025903 | Bacteria | 1040 |
| 496 | Ga0207647_10000962 | 3300025904 | Bacteria | 22327 |
| 497 | Ga0207647_10005595 | 3300025904 | Bacteria | 9181 |
| 498 | Ga0207647_10070519 | 3300025904 | Unclassified | 2111 |
| 499 | Ga0207647_10395305 | 3300025904 | Bacteria | 779 |
| 500 | Ga0207645_10001205 | 3300025907 | Bacteria | 21317 |
| 501 | Ga0207645_10022729 | 3300025907 | Bacteria | 4077 |
| 502 | Ga0207645_10123146 | 3300025907 | Bacteria | 1684 |
| 503 | Ga0207645_10412634 | 3300025907 | Bacteria | 909 |
| 504 | Ga0207645_10655112 | 3300025907 | Bacteria | 713 |
| 505 | Ga0207643_10038079 | 3300025908 | Bacteria | 2700 |
| 506 | Ga0207643_10133312 | 3300025908 | Bacteria | 1480 |
| 507 | Ga0207643_10332560 | 3300025908 | Bacteria | 951 |
| 508 | Ga0207705_10001654 | 3300025909 | Bacteria | 17699 |
| 509 | Ga0207705_10087634 | 3300025909 | Bacteria | 2276 |
| 510 | Ga0207705_10598273 | 3300025909 | Bacteria | 858 |
| 511 | Ga0207654_10000661 | 3300025911 | Bacteria | 19557 |
| 512 | Ga0207654_10000842 | 3300025911 | Bacteria | 16890 |
| 513 | Ga0207654_10045682 | 3300025911 | Bacteria | 2494 |
| 514 | Ga0207654_10061375 | 3300025911 | Bacteria | 2199 |
| 515 | Ga0207654_10269864 | 3300025911 | Bacteria | 1147 |
| 516 | Ga0207707_10000111 | 3300025912 | Bacteria | 82165 |
| 517 | Ga0207707_10046161 | 3300025912 | Bacteria | 3794 |
| 518 | Ga0207707_10252456 | 3300025912 | Bacteria | 1532 |
| 519 | Ga0207707_10842167 | 3300025912 | Bacteria | 761 |
| 520 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 521 | Ga0207695_10000445 | 3300025913 | Bacteria | 90509 |
| 522 | Ga0207695_10003973 | 3300025913 | Bacteria | 20423 |
| 523 | Ga0207695_10008615 | 3300025913 | Bacteria | 12742 |
| 524 | Ga0207695_10033063 | 3300025913 | Bacteria | 5649 |
| 525 | Ga0207695_10034499 | 3300025913 | Bacteria | 5501 |
| 526 | Ga0207695_10035604 | 3300025913 | Bacteria | 5395 |
| 527 | Ga0207695_10037199 | 3300025913 | Bacteria | 5253 |
| 528 | Ga0207695_10041787 | 3300025913 | Bacteria | 4905 |
| 529 | Ga0207671_10001466 | 3300025914 | Bacteria | 27257 |
| 530 | Ga0207671_10001776 | 3300025914 | Bacteria | 24234 |
| 531 | Ga0207671_10001778 | 3300025914 | Bacteria | 24205 |
| 532 | Ga0207671_10009206 | 3300025914 | Bacteria | 8283 |
| 533 | Ga0207671_10047175 | 3300025914 | Unclassified | 3188 |
| 534 | Ga0207671_10062520 | 3300025914 | Bacteria | 2765 |
| 535 | Ga0207671_10066698 | 3300025914 | Bacteria | 2679 |
| 536 | Ga0207671_10210864 | 3300025914 | Bacteria | 1519 |
| 537 | Ga0207671_10297693 | 3300025914 | Bacteria | 1274 |
| 538 | Ga0207671_10708656 | 3300025914 | Bacteria | 800 |
| 539 | Ga0207663_10272622 | 3300025916 | Bacteria | 1254 |
| 540 | Ga0207660_10001012 | 3300025917 | Bacteria | 18631 |
| 541 | Ga0207660_10008720 | 3300025917 | Bacteria | 6557 |
| 542 | Ga0207662_10007855 | 3300025918 | Bacteria | 5812 |
| 543 | Ga0207657_10056435 | 3300025919 | Bacteria | 3388 |
| 544 | Ga0207657_10142361 | 3300025919 | Bacteria | 1959 |
| 545 | Ga0207657_10527838 | 3300025919 | Bacteria | 924 |
| 546 | Ga0207649_10494043 | 3300025920 | Bacteria | 930 |
| 547 | Ga0207649_10611983 | 3300025920 | Bacteria | 839 |
| 548 | Ga0207649_10708614 | 3300025920 | Bacteria | 781 |
| 549 | Ga0207652_10000538 | 3300025921 | Bacteria | 38475 |
| 550 | Ga0207652_10000960 | 3300025921 | Bacteria | 26943 |
| 551 | Ga0207681_10009782 | 3300025923 | Bacteria | 5865 |
| 552 | Ga0207681_10100892 | 3300025923 | Bacteria | 2081 |
| 553 | Ga0207681_10284840 | 3300025923 | Bacteria | 1302 |
| 554 | Ga0207694_10019774 | 3300025924 | Bacteria | 5094 |
| 555 | Ga0207694_10166674 | 3300025924 | Bacteria | 1782 |
| 556 | Ga0207694_10177615 | 3300025924 | Bacteria | 1725 |
| 557 | Ga0207694_10208658 | 3300025924 | Bacteria | 1591 |
| 558 | Ga0207650_10122178 | 3300025925 | Bacteria | 2029 |
| 559 | Ga0207650_10487853 | 3300025925 | Bacteria | 1029 |
| 560 | Ga0207650_10523741 | 3300025925 | Bacteria | 992 |
| 561 | Ga0207659_10050963 | 3300025926 | Bacteria | 2942 |
| 562 | Ga0207659_10181728 | 3300025926 | Bacteria | 1667 |
| 563 | Ga0207659_10305760 | 3300025926 | Bacteria | 1308 |
| 564 | Ga0207659_10337561 | 3300025926 | Bacteria | 1247 |
| 565 | Ga0207659_10954483 | 3300025926 | Unclassified | 737 |
| 566 | Ga0207700_10666820 | 3300025928 | Bacteria | 928 |
| 567 | Ga0207644_10024795 | 3300025931 | Unclassified | 4120 |
| 568 | Ga0207644_10344197 | 3300025931 | Bacteria | 1210 |
| 569 | Ga0207644_10451404 | 3300025931 | Unclassified | 1056 |
| 570 | Ga0207644_10453883 | 3300025931 | Bacteria | 1053 |
| 571 | Ga0207690_10014400 | 3300025932 | Bacteria | 4777 |
| 572 | Ga0207690_10581579 | 3300025932 | Unclassified | 913 |
| 573 | Ga0207686_10000715 | 3300025934 | Bacteria | 20597 |
| 574 | Ga0207686_10017723 | 3300025934 | Bacteria | 4017 |
| 575 | Ga0207709_10425454 | 3300025935 | Bacteria | 1021 |
| 576 | Ga0207709_10516807 | 3300025935 | Unclassified | 934 |
| 577 | Ga0207670_10114999 | 3300025936 | Bacteria | 1945 |
| 578 | Ga0207670_10335349 | 3300025936 | Bacteria | 1194 |
| 579 | Ga0207670_10480635 | 3300025936 | Bacteria | 1006 |
| 580 | Ga0207669_10532252 | 3300025937 | Bacteria | 945 |
| 581 | Ga0207669_10801201 | 3300025937 | Unclassified | 781 |
| 582 | Ga0207704_10008049 | 3300025938 | Bacteria | 5016 |
| 583 | Ga0207704_10011913 | 3300025938 | Unclassified | 4300 |
| 584 | Ga0207704_10354387 | 3300025938 | Bacteria | 1143 |
| 585 | Ga0207691_10004949 | 3300025940 | Bacteria | 12848 |
| 586 | Ga0207691_10022643 | 3300025940 | Bacteria | 5925 |
| 587 | Ga0207691_10062073 | 3300025940 | Bacteria | 3393 |
| 588 | Ga0207691_10087508 | 3300025940 | Bacteria | 2795 |
| 589 | Ga0207691_10445948 | 3300025940 | Bacteria | 1102 |
| 590 | Ga0207691_10451683 | 3300025940 | Bacteria | 1094 |
| 591 | Ga0207691_10893658 | 3300025940 | Bacteria | 744 |
| 592 | Ga0207711_10035102 | 3300025941 | Bacteria | 4249 |
| 593 | Ga0207711_10428060 | 3300025941 | Bacteria | 1231 |
| 594 | Ga0207689_10002959 | 3300025942 | Bacteria | 15685 |
| 595 | Ga0207689_10005262 | 3300025942 | Bacteria | 11600 |
| 596 | Ga0207689_10021377 | 3300025942 | Bacteria | 5441 |
| 597 | Ga0207689_10049862 | 3300025942 | Bacteria | 3454 |
| 598 | Ga0207689_10074987 | 3300025942 | Bacteria | 2780 |
| 599 | Ga0207689_10137046 | 3300025942 | Bacteria | 2015 |
| 600 | Ga0207689_10501790 | 3300025942 | Bacteria | 1017 |
| 601 | Ga0207661_10048009 | 3300025944 | Bacteria | 3391 |
| 602 | Ga0207661_10563327 | 3300025944 | Bacteria | 1044 |
| 603 | Ga0207667_10000100 | 3300025949 | Bacteria | 138482 |
| 604 | Ga0207667_10004308 | 3300025949 | Bacteria | 17437 |
| 605 | Ga0207667_10010209 | 3300025949 | Bacteria | 10997 |
| 606 | Ga0207667_10080669 | 3300025949 | Bacteria | 3371 |
| 607 | Ga0207667_11044148 | 3300025949 | Bacteria | 803 |
| 608 | Ga0207651_10040147 | 3300025960 | Bacteria | 3093 |
| 609 | Ga0207651_10145062 | 3300025960 | Bacteria | 1839 |
| 610 | Ga0207651_10276251 | 3300025960 | Bacteria | 1386 |
| 611 | Ga0207651_10551469 | 3300025960 | Bacteria | 1002 |
| 612 | Ga0207651_10679689 | 3300025960 | Bacteria | 905 |
| 613 | Ga0207712_10001156 | 3300025961 | Bacteria | 18384 |
| 614 | Ga0207712_10024733 | 3300025961 | Bacteria | 3982 |
| 615 | Ga0207712_10066027 | 3300025961 | Unclassified | 2585 |
| 616 | Ga0207712_10125385 | 3300025961 | Bacteria | 1949 |
| 617 | Ga0207712_10455434 | 3300025961 | Unclassified | 1086 |
| 618 | Ga0207712_10536775 | 3300025961 | Unclassified | 1004 |
| 619 | Ga0207712_11091321 | 3300025961 | Bacteria | 710 |
| 620 | Ga0207668_10026438 | 3300025972 | Bacteria | 3768 |
| 621 | Ga0207668_10151729 | 3300025972 | Bacteria | 1795 |
| 622 | Ga0207668_10156325 | 3300025972 | Unclassified | 1772 |
| 623 | Ga0207640_10027653 | 3300025981 | Bacteria | 3458 |
| 624 | Ga0207640_10033995 | 3300025981 | Bacteria | 3178 |
| 625 | Ga0207640_10059835 | 3300025981 | Bacteria | 2515 |
| 626 | Ga0207640_10108050 | 3300025981 | Bacteria | 1965 |
| 627 | Ga0207640_10130167 | 3300025981 | Bacteria | 1818 |
| 628 | Ga0207640_10204918 | 3300025981 | Bacteria | 1498 |
| 629 | Ga0207658_10005017 | 3300025986 | Bacteria | 9121 |
| 630 | Ga0207658_10115803 | 3300025986 | Bacteria | 2128 |
| 631 | Ga0207658_10206859 | 3300025986 | Bacteria | 1642 |
| 632 | Ga0207658_10592578 | 3300025986 | Bacteria | 995 |
| 633 | Ga0207658_11129000 | 3300025986 | Bacteria | 716 |
| 634 | Ga0207677_10005993 | 3300026023 | Bacteria | 6623 |
| 635 | Ga0207677_10056615 | 3300026023 | Bacteria | 2687 |
| 636 | Ga0207677_10081379 | 3300026023 | Bacteria | 2324 |
| 637 | Ga0207677_10188221 | 3300026023 | Bacteria | 1630 |
| 638 | Ga0207677_10403403 | 3300026023 | Bacteria | 1160 |
| 639 | Ga0207703_10017680 | 3300026035 | Bacteria | 5567 |
| 640 | Ga0207703_10116123 | 3300026035 | Unclassified | 2291 |
| 641 | Ga0207703_10395002 | 3300026035 | Bacteria | 1282 |
| 642 | Ga0207703_10423639 | 3300026035 | Bacteria | 1239 |
| 643 | Ga0207639_10070159 | 3300026041 | Bacteria | 2736 |
| 644 | Ga0207639_10073596 | 3300026041 | Bacteria | 2679 |
| 645 | Ga0207639_10249225 | 3300026041 | Bacteria | 1548 |
| 646 | Ga0207639_10293226 | 3300026041 | Bacteria | 1435 |
| 647 | Ga0207639_10522781 | 3300026041 | Bacteria | 1087 |
| 648 | Ga0207639_10814362 | 3300026041 | Bacteria | 870 |
| 649 | Ga0207678_10025947 | 3300026067 | Bacteria | 5112 |
| 650 | Ga0207678_10145829 | 3300026067 | Bacteria | 2020 |
| 651 | Ga0207678_10195723 | 3300026067 | Bacteria | 1728 |
| 652 | Ga0207708_10193239 | 3300026075 | Bacteria | 1621 |
| 653 | Ga0207708_10560726 | 3300026075 | Bacteria | 964 |
| 654 | Ga0207702_10068314 | 3300026078 | Bacteria | 3053 |
| 655 | Ga0207702_10075567 | 3300026078 | Bacteria | 2911 |
| 656 | Ga0207702_10241282 | 3300026078 | Bacteria | 1693 |
| 657 | Ga0207641_10000090 | 3300026088 | Bacteria | 127735 |
| 658 | Ga0207641_10000213 | 3300026088 | Bacteria | 75051 |
| 659 | Ga0207641_10008579 | 3300026088 | Bacteria | 8440 |
| 660 | Ga0207641_10018040 | 3300026088 | Bacteria | 5784 |
| 661 | Ga0207641_10175968 | 3300026088 | Bacteria | 1957 |
| 662 | Ga0207648_10000653 | 3300026089 | Bacteria | 38843 |
| 663 | Ga0207648_10029361 | 3300026089 | Bacteria | 4876 |
| 664 | Ga0207648_10039157 | 3300026089 | Bacteria | 4168 |
| 665 | Ga0207648_10129072 | 3300026089 | Bacteria | 2225 |
| 666 | Ga0207648_10304164 | 3300026089 | Unclassified | 1430 |
| 667 | Ga0207648_10377254 | 3300026089 | Bacteria | 1282 |
| 668 | Ga0207648_10430457 | 3300026089 | Bacteria | 1199 |
| 669 | Ga0207676_10547419 | 3300026095 | Bacteria | 1105 |
| 670 | Ga0207676_11347755 | 3300026095 | Bacteria | 709 |
| 671 | Ga0207674_10003443 | 3300026116 | Bacteria | 19359 |
| 672 | Ga0207674_10060763 | 3300026116 | Bacteria | 3821 |
| 673 | Ga0207674_10065745 | 3300026116 | Bacteria | 3654 |
| 674 | Ga0207674_10165009 | 3300026116 | Bacteria | 2169 |
| 675 | Ga0207675_100007715 | 3300026118 | Bacteria | 10158 |
| 676 | Ga0207675_100008836 | 3300026118 | Bacteria | 9455 |
| 677 | Ga0207675_100081577 | 3300026118 | Bacteria | 3032 |
| 678 | Ga0207675_100120696 | 3300026118 | Bacteria | 2480 |
| 679 | Ga0207675_100172010 | 3300026118 | Bacteria | 2071 |
| 680 | Ga0207675_100288819 | 3300026118 | Bacteria | 1595 |
| 681 | Ga0207675_100879105 | 3300026118 | Bacteria | 912 |
| 682 | Ga0207675_101038578 | 3300026118 | Bacteria | 838 |
| 683 | Ga0207683_10048943 | 3300026121 | Bacteria | 3699 |
| 684 | Ga0207683_10076782 | 3300026121 | Bacteria | 2958 |
| 685 | Ga0207683_10093220 | 3300026121 | Bacteria | 2684 |
| 686 | Ga0207683_10269701 | 3300026121 | Bacteria | 1555 |
| 687 | Ga0207683_10326373 | 3300026121 | Bacteria | 1406 |
| 688 | Ga0207698_10000108 | 3300026142 | Bacteria | 51893 |
| 689 | Ga0207698_10011126 | 3300026142 | Bacteria | 5817 |
| 690 | Ga0207698_10373847 | 3300026142 | Bacteria | 1354 |
| 691 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 692 | Ga0268266_10295182 | 3300028379 | Unclassified | 1510 |
| 693 | Ga0268265_10060552 | 3300028380 | Bacteria | 2902 |
| 694 | Ga0268265_10166956 | 3300028380 | Bacteria | 1877 |
| 695 | Ga0268264_10000072 | 3300028381 | Bacteria | 260791 |
| 696 | Ga0268264_10002720 | 3300028381 | Bacteria | 15431 |
| 697 | Ga0268264_10007598 | 3300028381 | Bacteria | 9037 |
| 698 | Ga0268264_10033282 | 3300028381 | Bacteria | 4233 |
| 699 | Ga0268264_10063504 | 3300028381 | Bacteria | 3104 |
| 700 | Ga0268264_10065820 | 3300028381 | Bacteria | 3054 |
| 701 | Ga0268264_10102717 | 3300028381 | Bacteria | 2488 |
| 702 | Ga0268264_10157870 | 3300028381 | Unclassified | 2040 |
| 703 | Ga0268264_10487970 | 3300028381 | Bacteria | 1199 |
| 704 | Ga0268264_10603980 | 3300028381 | Bacteria | 1081 |
| 705 | Ga0265336_10120897 | 3300028666 | Bacteria | 780 |
| 706 | Ga0307517_10000697 | 3300028786 | Bacteria | 57970 |
| 707 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 708 | Ga0307511_10001896 | 3300030521 | Bacteria | 21954 |
| 709 | Ga0265325_10249205 | 3300031241 | Bacteria | 805 |
| 710 | Ga0265327_10045037 | 3300031251 | Bacteria | 2347 |
| 711 | Ga0307509_10036817 | 3300031507 | Bacteria | 5354 |
| 712 | Ga0307509_10123147 | 3300031507 | Bacteria | 2566 |
| 713 | Ga0265313_10153091 | 3300031595 | Bacteria | 984 |
| 714 | Ga0307508_10266838 | 3300031616 | Bacteria | 1306 |
| 715 | Ga0307508_10346038 | 3300031616 | Bacteria | 1078 |
| 716 | Ga0307516_10265817 | 3300031730 | Bacteria | 1404 |
| 717 | Ga0307413_10292765 | 3300031824 | Bacteria | 1231 |
| 718 | Ga0307413_10356087 | 3300031824 | Bacteria | 1131 |
| 719 | Ga0307410_10490665 | 3300031852 | Bacteria | 1009 |
| 720 | Ga0307406_10642526 | 3300031901 | Bacteria | 880 |
| 721 | Ga0307407_10388672 | 3300031903 | Bacteria | 998 |
| 722 | Ga0307412_10466060 | 3300031911 | Bacteria | 1044 |
| 723 | Ga0307416_100672015 | 3300032002 | Bacteria | 1122 |
| 724 | Ga0307414_10374474 | 3300032004 | Bacteria | 1229 |
| 725 | Ga0307414_10870488 | 3300032004 | Bacteria | 825 |
| 726 | Ga0307411_10050097 | 3300032005 | Bacteria | 2718 |
| 727 | Ga0307411_11275172 | 3300032005 | Bacteria | 669 |
| 728 | Ga0307415_100132561 | 3300032126 | Bacteria | 1889 |
| 729 | Ga0307510_10001712 | 3300033180 | Bacteria | 24371 |
| 730 | Ga0307510_10362291 | 3300033180 | Bacteria | 898 |
| 731 | Ga0373955_0241292 | 3300035172 | Bacteria | 1082 |
| 732 | Ga0373927_0100179 | 3300035695 | Bacteria | 1884 |
| 733 | Ga0373933_0136478 | 3300035724 | Bacteria | 1546 |
| 734 | Ga0373937_0139076 | 3300036401 | Unclassified | 2271 |
| 735 | Ga0373937_0459222 | 3300036401 | Bacteria | 1210 |
| 736 | Ga0395899_0014889 | 3300037312 | Bacteria | 5935 |
| 737 | Ga0395900_0016890 | 3300037418 | Bacteria | 7450 |
| 738 | Ga0395900_0182795 | 3300037418 | Bacteria | 2130 |
| 739 | Ga0395900_0525978 | 3300037418 | Bacteria | 1130 |
| 740 | Ga0395900_0550511 | 3300037418 | Bacteria | 1098 |
| 741 | Ga0395898_0112161 | 3300037466 | Unclassified | 2613 |
| 742 | Ga0395905_0001861 | 3300037471 | Bacteria | 24297 |
| 743 | Ga0395905_0065531 | 3300037471 | Bacteria | 3401 |
| 744 | Ga0395901_0089556 | 3300038443 | Bacteria | 3220 |
| 745 | Ga0395901_0103349 | 3300038443 | Bacteria | 2990 |
| 746 | Ga0436365_0289942 | 3300039437 | Bacteria | 1350 |
| 747 | Ga0439436_0006955 | 3300041404 | Bacteria | 3479 |
| 748 | Ga0439436_0048147 | 3300041404 | Bacteria | 1210 |
| 749 | Ga0439439_0005738 | 3300041406 | Bacteria | 2847 |
| 750 | Ga0439439_0051855 | 3300041406 | Bacteria | 1076 |
| 751 | Ga0451787_202726 | 3300041441 | Bacteria | 607 |
| 752 | Ga0451802_1082803 | 3300041460 | Bacteria | 1150 |
| 753 | Ga0451804_0420865 | 3300041463 | Bacteria | 1398 |
| 754 | Ga0451807_2236118 | 3300041486 | Bacteria | 852 |
| 755 | Ga0451849_0258145 | 3300041505 | Bacteria | 706 |
| 756 | Ga0451853_0569222 | 3300041512 | Bacteria | 749 |
| 757 | Ga0451853_1768614 | 3300041512 | Bacteria | 1577 |
| 758 | Ga0451853_3831587 | 3300041512 | Bacteria | 834 |
| 759 | Ga0439431_0017465 | 3300041997 | Bacteria | 1688 |
| 760 | Ga0439449_0004710 | 3300042007 | Bacteria | 5267 |
| 761 | Ga0439449_0138673 | 3300042007 | Bacteria | 905 |
| 762 | Ga0439449_0185269 | 3300042007 | Bacteria | 778 |
| 763 | Ga0439457_009584 | 3300042014 | Bacteria | 2250 |
| 764 | Ga0439457_023623 | 3300042014 | Bacteria | 1360 |
| 765 | Ga0439457_037992 | 3300042014 | Bacteria | 1072 |
| 766 | Ga0439457_091971 | 3300042014 | Bacteria | 702 |
| 767 | Ga0439462_0011206 | 3300042015 | Bacteria | 2280 |
| 768 | Ga0450923_006726 | 3300042125 | Bacteria | 1917 |
| 769 | Ga0451577_0025828 | 3300042876 | Bacteria | 5326 |
| 770 | Ga0466969_0000754 | 3300044656 | Bacteria | 17561 |
| 771 | Ga0466972_0004958 | 3300044658 | Bacteria | 6683 |
| 772 | Ga0466972_0008365 | 3300044658 | Bacteria | 5184 |
| 773 | Ga0466966_0000030 | 3300044684 | Bacteria | 103300 |
| 774 | Ga0466966_0346352 | 3300044684 | Bacteria | 893 |
| 775 | Ga0466961_0134492 | 3300044693 | Bacteria | 1549 |
| 776 | Ga0466971_0009829 | 3300044719 | Bacteria | 4177 |
| 777 | Ga0466971_0053325 | 3300044719 | Bacteria | 1822 |
| 778 | Ga0466971_0078081 | 3300044719 | Bacteria | 1508 |
| 779 | Ga0466968_0080577 | 3300044735 | Bacteria | 1430 |
| 780 | Ga0466968_0081931 | 3300044735 | Bacteria | 1419 |
| 781 | Ga0466968_0193259 | 3300044735 | Bacteria | 950 |
| 782 | Ga0466968_0458851 | 3300044735 | Bacteria | 631 |
| 783 | Ga0466957_0009182 | 3300044842 | Bacteria | 5640 |
| 784 | Ga0466957_0011478 | 3300044842 | Bacteria | 5113 |
| 785 | Ga0466957_0111966 | 3300044842 | Bacteria | 1732 |
| 786 | Ga0466960_0406241 | 3300044901 | Bacteria | 785 |
| 787 | Ga0466959_0000269 | 3300045049 | Bacteria | 31896 |
| 788 | Ga0466959_0002150 | 3300045049 | Bacteria | 12505 |
| 789 | Ga0466959_0045485 | 3300045049 | Bacteria | 3232 |
| 790 | Ga0466958_0110840 | 3300045836 | Bacteria | 1713 |
| 791 | Ga0495627_013864 | 3300046453 | Bacteria | 2828 |
| 792 | Ga0495638_0017086 | 3300046460 | Bacteria | 4846 |
| 793 | Ga0495638_0154815 | 3300046460 | Bacteria | 1327 |
| 794 | Ga0495651_0130068 | 3300046462 | Bacteria | 1839 |
| 795 | Ga0495650_0115811 | 3300046471 | Bacteria | 990 |
| 796 | Ga0495580_0038332 | 3300046472 | Bacteria | 3433 |
| 797 | Ga0495580_0112467 | 3300046472 | Bacteria | 1891 |
| 798 | Ga0495582_0088992 | 3300046473 | Unclassified | 1720 |
| 799 | Ga0495664_0341061 | 3300046477 | Bacteria | 903 |
| 800 | Ga0495606_0004456 | 3300046507 | Bacteria | 13980 |
| 801 | Ga0495630_0247352 | 3300046517 | Bacteria | 1362 |
| 802 | Ga0495630_0252397 | 3300046517 | Bacteria | 1348 |
| 803 | Ga0495632_0157321 | 3300046519 | Bacteria | 1048 |
| 804 | Ga0495648_0011969 | 3300046524 | Bacteria | 6504 |
| 805 | Ga0495665_0187618 | 3300046531 | Bacteria | 1073 |
| 806 | Ga0495586_0145441 | 3300046535 | Bacteria | 1332 |
| 807 | Ga0495587_0260229 | 3300046536 | Bacteria | 975 |
| 808 | Ga0495621_0015348 | 3300046539 | Unclassified | 2442 |
| 809 | Ga0495622_0374054 | 3300046557 | Bacteria | 615 |
| 810 | Ga0495633_0000175 | 3300046558 | Bacteria | 83653 |
| 811 | Ga0495668_0000108 | 3300046616 | Bacteria | 132593 |
| 812 | Ga0495668_0005589 | 3300046616 | Bacteria | 8454 |
| 813 | Ga0495634_0115218 | 3300046642 | Unclassified | 1725 |
| 814 | Ga0495611_0000011 | 3300046648 | Bacteria | 146643 |
| 815 | Ga0495611_0104811 | 3300046648 | Unclassified | 1315 |
| 816 | Ga0495625_0475451 | 3300046660 | Bacteria | 768 |
| 817 | Ga0495623_0264615 | 3300046679 | Bacteria | 962 |
| 818 | Ga0495647_0237843 | 3300046681 | Bacteria | 808 |
| 819 | Ga0495658_0042870 | 3300046683 | Bacteria | 2528 |
| 820 | Ga0495624_0610335 | 3300046690 | Bacteria | 650 |
| 821 | Ga0495670_0309935 | 3300046691 | Bacteria | 847 |
| 822 | Ga0495604_0220578 | 3300047317 | Bacteria | 1305 |
| 823 | Ga0495672_0014438 | 3300047320 | Bacteria | 5408 |
| 824 | Ga0495672_0041053 | 3300047320 | Bacteria | 2801 |
| 825 | Ga0495676_0262431 | 3300047321 | Bacteria | 1175 |
| 826 | Ga0495676_0387687 | 3300047321 | Bacteria | 929 |
| 827 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 828 | Ga0495677_0194934 | 3300047445 | Bacteria | 787 |
| 829 | Ga0495686_0000165 | 3300047472 | Bacteria | 125611 |
| 830 | Ga0496101_0546953 | 3300048904 | Bacteria | 915 |
| 831 | Ga0496105_0099960 | 3300048908 | Bacteria | 2396 |
| 832 | Ga0496115_0132318 | 3300048918 | Bacteria | 2056 |
| 833 | Ga0496115_0906618 | 3300048918 | Bacteria | 679 |
| 834 | Ga0496118_0278248 | 3300048921 | Bacteria | 933 |
| 835 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 836 | Ga0496126_0047240 | 3300048929 | Bacteria | 3942 |
| 837 | Ga0496126_1017685 | 3300048929 | Bacteria | 621 |
| 838 | Ga0501298_000289 | 3300049521 | Bacteria | 6655 |
| 839 | Ga0501299_032352 | 3300049522 | Bacteria | 1015 |
| 840 | Ga0501031_0142009 | 3300049568 | Bacteria | 1569 |
| 841 | Ga0501032_0761224 | 3300049569 | Bacteria | 612 |
| 842 | Ga0501034_0305168 | 3300049571 | Bacteria | 1527 |
| 843 | Ga0501034_0455430 | 3300049571 | Bacteria | 1197 |
| 844 | Ga0501034_0710319 | 3300049571 | Bacteria | 903 |
| 845 | Ga0501036_0003520 | 3300049572 | Bacteria | 12524 |
| 846 | Ga0501037_0008893 | 3300049573 | Bacteria | 7355 |
| 847 | Ga0501037_0214124 | 3300049573 | Bacteria | 1358 |
| 848 | Ga0501038_0009081 | 3300049574 | Bacteria | 9125 |
| 849 | Ga0501038_0655038 | 3300049574 | Bacteria | 790 |
| 850 | Ga0501039_0011833 | 3300049575 | Bacteria | 6644 |
| 851 | Ga0501039_0600173 | 3300049575 | Bacteria | 863 |
| 852 | Ga0501043_0018866 | 3300049579 | Bacteria | 5414 |
| 853 | Ga0501046_0026580 | 3300049580 | Bacteria | 4727 |
| 854 | Ga0501047_0030087 | 3300049581 | Bacteria | 5235 |
| 855 | Ga0501047_0687940 | 3300049581 | Bacteria | 841 |
| 856 | Ga0501048_0079968 | 3300049582 | Bacteria | 2307 |
| 857 | Ga0501067_0149864 | 3300049583 | Bacteria | 1299 |
| 858 | Ga0501068_0028446 | 3300049584 | Bacteria | 3306 |
| 859 | Ga0501070_0057509 | 3300049586 | Bacteria | 3223 |
| 860 | Ga0501071_0107006 | 3300049587 | Bacteria | 2065 |
| 861 | Ga0501073_0054158 | 3300049589 | Bacteria | 2809 |
| 862 | Ga0501073_0736801 | 3300049589 | Bacteria | 680 |
| 863 | Ga0501074_0024502 | 3300049590 | Unclassified | 4386 |
| 864 | Ga0501198_021314 | 3300049649 | Bacteria | 1032 |
| 865 | Ga0501201_021143 | 3300049651 | Bacteria | 691 |
| 866 | Ga0501202_000865 | 3300049652 | Bacteria | 4607 |
| 867 | Ga0501202_006743 | 3300049652 | Bacteria | 2063 |
| 868 | Ga0501202_051768 | 3300049652 | Bacteria | 911 |
| 869 | Ga0501207_002781 | 3300049654 | Bacteria | 2283 |
| 870 | Ga0501207_021214 | 3300049654 | Bacteria | 1042 |
| 871 | Ga0501208_008248 | 3300049655 | Bacteria | 1399 |
| 872 | Ga0501217_002224 | 3300049661 | Bacteria | 3785 |
| 873 | Ga0501217_032587 | 3300049661 | Bacteria | 1290 |
| 874 | Ga0501222_000982 | 3300049662 | Bacteria | 4085 |
| 875 | Ga0501223_000157 | 3300049663 | Bacteria | 17995 |
| 876 | Ga0501224_000664 | 3300049664 | Bacteria | 4275 |
| 877 | Ga0501228_010121 | 3300049666 | Bacteria | 932 |
| 878 | Ga0501233_000669 | 3300049668 | Bacteria | 5619 |
| 879 | Ga0501235_000828 | 3300049669 | Bacteria | 6342 |
| 880 | Ga0501240_002622 | 3300049673 | Bacteria | 1927 |
| 881 | Ga0501242_005934 | 3300049674 | Bacteria | 1386 |
| 882 | Ga0501243_000215 | 3300049675 | Bacteria | 7095 |
| 883 | Ga0501250_006524 | 3300049680 | Bacteria | 1237 |
| 884 | Ga0501250_007292 | 3300049680 | Bacteria | 1191 |
| 885 | Ga0501252_000578 | 3300049682 | Bacteria | 2891 |
| 886 | Ga0501253_000895 | 3300049683 | Bacteria | 2811 |
| 887 | Ga0501257_004810 | 3300049686 | Bacteria | 2957 |
| 888 | Ga0501259_000181 | 3300049688 | Bacteria | 9543 |
| 889 | Ga0501259_002966 | 3300049688 | Bacteria | 2721 |
| 890 | Ga0501259_071355 | 3300049688 | Bacteria | 745 |
| 891 | Ga0501261_005649 | 3300049690 | Bacteria | 1579 |
| 892 | Ga0501261_050559 | 3300049690 | Bacteria | 680 |
| 893 | Ga0501219_000812 | 3300049703 | Bacteria | 4068 |
| 894 | Ga0501221_000080 | 3300049704 | Bacteria | 10925 |
| 895 | Ga0501225_0001083 | 3300049705 | Bacteria | 8547 |
| 896 | Ga0501225_0002530 | 3300049705 | Bacteria | 5650 |
| 897 | Ga0501225_0007474 | 3300049705 | Bacteria | 3165 |
| 898 | Ga0501234_000581 | 3300049707 | Bacteria | 5611 |
| 899 | Ga0501245_000311 | 3300049708 | Bacteria | 5731 |
| 900 | Ga0501245_003557 | 3300049708 | Bacteria | 2119 |
| 901 | Ga0501079_0076381 | 3300049741 | Bacteria | 2591 |
| 902 | Ga0501080_0039984 | 3300049742 | Bacteria | 4376 |
| 903 | Ga0501080_0513414 | 3300049742 | Bacteria | 1070 |
| 904 | Ga0501083_0174751 | 3300049744 | Bacteria | 1403 |
| 905 | Ga0501232_010289 | 3300049757 | Bacteria | 1051 |
| 906 | Ga0501241_001105 | 3300049758 | Bacteria | 5686 |
| 907 | Ga0501241_004302 | 3300049758 | Bacteria | 2674 |
| 908 | Ga0501241_043990 | 3300049758 | Bacteria | 871 |
| 909 | Ga0501266_005705 | 3300049763 | Bacteria | 1547 |
| 910 | Ga0501268_052523 | 3300049765 | Bacteria | 792 |
| 911 | Ga0501269_013559 | 3300049766 | Bacteria | 998 |
| 912 | Ga0501271_012917 | 3300049768 | Bacteria | 910 |
| 913 | Ga0501278_009862 | 3300049774 | Bacteria | 755 |
| 914 | Ga0501044_0006136 | 3300049823 | Bacteria | 13269 |
| 915 | Ga0501044_0019334 | 3300049823 | Bacteria | 7288 |
| 916 | Ga0501044_0038980 | 3300049823 | Bacteria | 4960 |
| 917 | Ga0501044_0099172 | 3300049823 | Bacteria | 2932 |
| 918 | Ga0501044_0398168 | 3300049823 | Bacteria | 1290 |
| 919 | Ga0501044_0512092 | 3300049823 | Bacteria | 1100 |
| 920 | Ga0501045_0375742 | 3300049824 | Bacteria | 1058 |
| 921 | Ga0501212_036903 | 3300049851 | Bacteria | 800 |
| 922 | Ga0501284_00105 | 3300050005 | Bacteria | 17011 |
| 923 | nmdc:mga0k408_11997_c1 | 3300050493 | Bacteria | 4728 |
| 924 | nmdc:mga0k408_162047_c1 | 3300050493 | Bacteria | 1333 |
| 925 | nmdc:mga0k408_40690_c1 | 3300050493 | Bacteria | 2675 |
| 926 | nmdc:mga05p37_1130996_c1 | 3300050507 | Bacteria | 817 |
| 927 | nmdc:mga05p37_194882_c1 | 3300050507 | Unclassified | 2457 |
| 928 | nmdc:mga09592_12177_c1 | 3300050508 | Bacteria | 7001 |
| 929 | nmdc:mga09592_14034_c1 | 3300050508 | Bacteria | 6541 |
| 930 | nmdc:mga09592_553442_c1 | 3300050508 | Bacteria | 988 |
| 931 | nmdc:mga0qj67_51192_c1 | 3300050509 | Bacteria | 3265 |
| 932 | nmdc:mga0qj67_61545_c1 | 3300050509 | Unclassified | 2981 |
| 933 | nmdc:mga08y16_260978_c1 | 3300050511 | Bacteria | 1789 |
| 934 | nmdc:mga0a205_923055_c1 | 3300050515 | Bacteria | 720 |
| 935 | Ga0495619_0125939 | 3300053085 | Bacteria | 1758 |
| 936 | Ga0500578_0000120 | 3300053086 | Bacteria | 95463 |
| 937 | Ga0500644_0129574 | 3300053088 | Bacteria | 992 |
| 938 | Ga0500644_0230791 | 3300053088 | Bacteria | 775 |
| 939 | Ga0500646_0010270 | 3300053090 | Bacteria | 2402 |
| 940 | Ga0500583_0000120 | 3300053092 | Bacteria | 37819 |
| 941 | Ga0500583_0006739 | 3300053092 | Bacteria | 3981 |
| 942 | Ga0500583_0012437 | 3300053092 | Bacteria | 3246 |
| 943 | Ga0500583_0064385 | 3300053092 | Bacteria | 1739 |
| 944 | Ga0500651_0047942 | 3300053093 | Bacteria | 2685 |
| 945 | Ga0500651_0438006 | 3300053093 | Bacteria | 729 |
| 946 | Ga0500651_0467566 | 3300053093 | Bacteria | 699 |
| 947 | Ga0500650_0078790 | 3300053098 | Bacteria | 1540 |
| 948 | Ga0500556_0124325 | 3300053104 | Bacteria | 1008 |
| 949 | Ga0500569_000517 | 3300053109 | Bacteria | 6437 |
| 950 | Ga0500594_0053167 | 3300053118 | Bacteria | 1147 |
| 951 | Ga0500594_0147661 | 3300053118 | Bacteria | 754 |
| 952 | Ga0500642_0003619 | 3300053130 | Bacteria | 4702 |
| 953 | Ga0500642_0074754 | 3300053130 | Unclassified | 1547 |
| 954 | Ga0500652_006848 | 3300053131 | Bacteria | 3695 |
| 955 | Ga0500652_083867 | 3300053131 | Bacteria | 1328 |
| 956 | Ga0500655_013508 | 3300053133 | Unclassified | 1491 |
| 957 | Ga0500655_016309 | 3300053133 | Bacteria | 1368 |
| 958 | Ga0500559_0003554 | 3300053136 | Bacteria | 7625 |
| 959 | Ga0500568_0083274 | 3300053139 | Unclassified | 1212 |
| 960 | Ga0500568_0175869 | 3300053139 | Bacteria | 787 |
| 961 | Ga0500573_0126264 | 3300053140 | Bacteria | 1420 |
| 962 | Ga0500573_0171265 | 3300053140 | Unclassified | 1174 |
| 963 | Ga0500577_0005167 | 3300053142 | Bacteria | 3498 |
| 964 | Ga0500579_145570 | 3300053143 | Bacteria | 1053 |
| 965 | Ga0500589_053266 | 3300053147 | Bacteria | 1873 |
| 966 | Ga0500604_0002303 | 3300053151 | Bacteria | 5221 |
| 967 | Ga0500616_0003236 | 3300053153 | Bacteria | 12618 |
| 968 | Ga0500616_0004758 | 3300053153 | Bacteria | 9542 |
| 969 | Ga0500616_0025280 | 3300053153 | Bacteria | 3294 |
| 970 | Ga0500622_0001475 | 3300053156 | Bacteria | 18735 |
| 971 | Ga0500622_0002131 | 3300053156 | Bacteria | 14740 |
| 972 | Ga0500627_0194614 | 3300053158 | Bacteria | 910 |
| 973 | Ga0500633_0043943 | 3300053160 | Bacteria | 1514 |
| 974 | Ga0500634_0090702 | 3300053161 | Bacteria | 1552 |
| 975 | Ga0500636_0007397 | 3300053177 | Bacteria | 6354 |
| 976 | Ga0500611_067885 | 3300053727 | Bacteria | 861 |
| 977 | Ga0500661_016479 | 3300055283 | Bacteria | 1321 |
| 978 | Ga0500661_034890 | 3300055283 | Bacteria | 889 |
| 979 | Ga0501082_0099557 | 3300060353 | Bacteria | 2513 |
| 980 | Ga0466962_0004595 | 3300061719 | Bacteria | 6624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0041053 | Ga0495672_0041053_230_805 | 181 |
| 2 | 3300048929 | Ga0496126_1017685 | Ga0496126_1017685_10_561 | 181 |
| 3 | 3300049569 | Ga0501032_0761224 | Ga0501032_0761224_13_573 | 183 |
| 4 | iso_pu_bacteria | 2738541278 | 2738731491 | 184 |
| 5 | iso_pu_bacteria | 2818991442 | 2819573238 | 184 |
| 6 | iso_pu_bacteria | 2821136567 | 2821136658 | 184 |
| 7 | iso_pu_bacteria | 2881955468 | 2881958640 | 184 |
| 8 | iso_pu_bacteria | 2904467357 | 2904468597 | 184 |
| 9 | iso_pu_bacteria | 2818991460 | 2819681930 | 185 |
| 10 | iso_pu_bacteria | 2884791551 | 2884795977 | 185 |
| 11 | iso_pu_bacteria | 2929177148 | 2929178514 | 185 |
| 12 | iso_pu_bacteria | 2929239360 | 2929240847 | 185 |
| 13 | iso_pu_bacteria | 2929921140 | 2929922888 | 185 |
| 14 | iso_pu_bacteria | 2945977869 | 2945980915 | 185 |
| 15 | iso_pu_bacteria | 2946013367 | 2946019684 | 185 |
| 16 | iso_pu_bacteria | 8003151029 | 8003154714 | 185 |
| 17 | 3300003320 | rootH2_10087314 | rootH2_100873141 | 187 |
| 18 | 3300003320 | rootH2_10090059 | rootH2_100900593 | 187 |
| 19 | 3300005289 | Ga0065704_10029955 | Ga0065704_100299552 | 187 |
| 20 | 3300005289 | Ga0065704_10244930 | Ga0065704_102449302 | 187 |
| 21 | 3300005290 | Ga0065712_10014379 | Ga0065712_100143792 | 187 |
| 22 | 3300005290 | Ga0065712_10029565 | Ga0065712_100295651 | 187 |
| 23 | 3300005295 | Ga0065707_10385028 | Ga0065707_103850282 | 187 |
| 24 | 3300005329 | Ga0070683_100030331 | Ga0070683_1000303314 | 187 |
| 25 | 3300005331 | Ga0070670_100150457 | Ga0070670_1001504573 | 187 |
| 26 | 3300005331 | Ga0070670_100231408 | Ga0070670_1002314082 | 187 |
| 27 | 3300005334 | Ga0068869_100006542 | Ga0068869_1000065421 | 187 |
| 28 | 3300005334 | Ga0068869_100167040 | Ga0068869_1001670403 | 187 |
| 29 | 3300005337 | Ga0070682_100627674 | Ga0070682_1006276741 | 187 |
| 30 | 3300005338 | Ga0068868_100221867 | Ga0068868_1002218672 | 187 |
| 31 | 3300005341 | Ga0070691_10415273 | Ga0070691_104152731 | 187 |
| 32 | 3300005343 | Ga0070687_100011322 | Ga0070687_1000113222 | 187 |
| 33 | 3300005344 | Ga0070661_101133903 | Ga0070661_1011339031 | 187 |
| 34 | 3300005354 | Ga0070675_100129986 | Ga0070675_1001299862 | 187 |
| 35 | 3300005354 | Ga0070675_100290018 | Ga0070675_1002900182 | 187 |
| 36 | 3300005354 | Ga0070675_100770431 | Ga0070675_1007704312 | 187 |
| 37 | 3300005364 | Ga0070673_100276452 | Ga0070673_1002764522 | 187 |
| 38 | 3300005364 | Ga0070673_100276840 | Ga0070673_1002768402 | 187 |
| 39 | 3300005365 | Ga0070688_100645700 | Ga0070688_1006457001 | 187 |
| 40 | 3300005367 | Ga0070667_100457465 | Ga0070667_1004574651 | 187 |
| 41 | 3300005367 | Ga0070667_100575414 | Ga0070667_1005754142 | 187 |
| 42 | 3300005441 | Ga0070700_100010950 | Ga0070700_1000109505 | 187 |
| 43 | 3300005444 | Ga0070694_100129554 | Ga0070694_1001295542 | 187 |
| 44 | 3300005458 | Ga0070681_10024676 | Ga0070681_100246763 | 187 |
| 45 | 3300005459 | Ga0068867_100688958 | Ga0068867_1006889581 | 187 |
| 46 | 3300005535 | Ga0070684_100001895 | Ga0070684_1000018957 | 187 |
| 47 | 3300005539 | Ga0068853_100008728 | Ga0068853_1000087288 | 187 |
| 48 | 3300005539 | Ga0068853_100088156 | Ga0068853_1000881561 | 187 |
| 49 | 3300005543 | Ga0070672_100047689 | Ga0070672_1000476894 | 187 |
| 50 | 3300005543 | Ga0070672_100475207 | Ga0070672_1004752071 | 187 |
| 51 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008355 | 187 |
| 52 | 3300005563 | Ga0068855_100001250 | Ga0068855_1000012506 | 187 |
| 53 | 3300005563 | Ga0068855_100025826 | Ga0068855_1000258268 | 187 |
| 54 | 3300005563 | Ga0068855_100091452 | Ga0068855_1000914525 | 187 |
| 55 | 3300005577 | Ga0068857_100281164 | Ga0068857_1002811643 | 187 |
| 56 | 3300005577 | Ga0068857_100523938 | Ga0068857_1005239381 | 187 |
| 57 | 3300005578 | Ga0068854_100014439 | Ga0068854_1000144395 | 187 |
| 58 | 3300005578 | Ga0068854_100201852 | Ga0068854_1002018521 | 187 |
| 59 | 3300005614 | Ga0068856_100379535 | Ga0068856_1003795352 | 187 |
| 60 | 3300005615 | Ga0070702_100216324 | Ga0070702_1002163241 | 187 |
| 61 | 3300005616 | Ga0068852_100000180 | Ga0068852_10000018014 | 187 |
| 62 | 3300005616 | Ga0068852_100303661 | Ga0068852_1003036612 | 187 |
| 63 | 3300005617 | Ga0068859_100083124 | Ga0068859_1000831244 | 187 |
| 64 | 3300005617 | Ga0068859_100384798 | Ga0068859_1003847982 | 187 |
| 65 | 3300005617 | Ga0068859_100780385 | Ga0068859_1007803852 | 187 |
| 66 | 3300005719 | Ga0068861_100080332 | Ga0068861_1000803323 | 187 |
| 67 | 3300005840 | Ga0068870_10025539 | Ga0068870_100255391 | 187 |
| 68 | 3300005841 | Ga0068863_100503435 | Ga0068863_1005034352 | 187 |
| 69 | 3300005841 | Ga0068863_100650341 | Ga0068863_1006503411 | 187 |
| 70 | 3300005841 | Ga0068863_101267734 | Ga0068863_1012677341 | 187 |
| 71 | 3300005841 | Ga0068863_101291900 | Ga0068863_1012919002 | 187 |
| 72 | 3300005842 | Ga0068858_100822543 | Ga0068858_1008225432 | 187 |
| 73 | 3300005843 | Ga0068860_100000029 | Ga0068860_100000029189 | 187 |
| 74 | 3300005843 | Ga0068860_100130163 | Ga0068860_1001301632 | 187 |
| 75 | 3300005844 | Ga0068862_100236663 | Ga0068862_1002366633 | 187 |
| 76 | 3300005983 | Ga0081540_1074941 | Ga0081540_10749412 | 187 |
| 77 | 3300006237 | Ga0097621_100077083 | Ga0097621_1000770832 | 187 |
| 78 | 3300006358 | Ga0068871_100020023 | Ga0068871_1000200234 | 187 |
| 79 | 3300006358 | Ga0068871_100165258 | Ga0068871_1001652583 | 187 |
| 80 | 3300006358 | Ga0068871_100414105 | Ga0068871_1004141052 | 187 |
| 81 | 3300006844 | Ga0075428_100025171 | Ga0075428_1000251715 | 187 |
| 82 | 3300006846 | Ga0075430_100021698 | Ga0075430_1000216985 | 187 |
| 83 | 3300006880 | Ga0075429_100081239 | Ga0075429_1000812393 | 187 |
| 84 | 3300006881 | Ga0068865_100316585 | Ga0068865_1003165852 | 187 |
| 85 | 3300006931 | Ga0097620_100083124 | Ga0097620_1000831244 | 187 |
| 86 | 3300006931 | Ga0097620_100384790 | Ga0097620_1003847902 | 187 |
| 87 | 3300006931 | Ga0097620_100780398 | Ga0097620_1007803981 | 187 |
| 88 | 3300009093 | Ga0105240_10001800 | Ga0105240_1000180018 | 187 |
| 89 | 3300009093 | Ga0105240_10003982 | Ga0105240_1000398210 | 187 |
| 90 | 3300009093 | Ga0105240_10008182 | Ga0105240_100081821 | 187 |
| 91 | 3300009093 | Ga0105240_10010900 | Ga0105240_100109001 | 187 |
| 92 | 3300009093 | Ga0105240_10050422 | Ga0105240_100504225 | 187 |
| 93 | 3300009093 | Ga0105240_10099692 | Ga0105240_100996923 | 187 |
| 94 | 3300009093 | Ga0105240_10117609 | Ga0105240_101176095 | 187 |
| 95 | 3300009147 | Ga0114129_10153798 | Ga0114129_101537985 | 187 |
| 96 | 3300009147 | Ga0114129_10208548 | Ga0114129_102085483 | 187 |
| 97 | 3300009174 | Ga0105241_10001098 | Ga0105241_1000109814 | 187 |
| 98 | 3300009174 | Ga0105241_10275092 | Ga0105241_102750922 | 187 |
| 99 | 3300009174 | Ga0105241_10515071 | Ga0105241_105150711 | 187 |
| 100 | 3300009176 | Ga0105242_10350443 | Ga0105242_103504432 | 187 |
| 101 | 3300009176 | Ga0105242_10936432 | Ga0105242_109364321 | 187 |
| 102 | 3300009177 | Ga0105248_10417121 | Ga0105248_104171212 | 187 |
| 103 | 3300009545 | Ga0105237_10000780 | Ga0105237_1000078014 | 187 |
| 104 | 3300009545 | Ga0105237_10003152 | Ga0105237_1000315218 | 187 |
| 105 | 3300009545 | Ga0105237_10013020 | Ga0105237_100130209 | 187 |
| 106 | 3300009545 | Ga0105237_10026858 | Ga0105237_100268586 | 187 |
| 107 | 3300009545 | Ga0105237_10135210 | Ga0105237_101352104 | 187 |
| 108 | 3300009545 | Ga0105237_10346499 | Ga0105237_103464992 | 187 |
| 109 | 3300009551 | Ga0105238_10032669 | Ga0105238_100326691 | 187 |
| 110 | 3300009551 | Ga0105238_10037294 | Ga0105238_100372943 | 187 |
| 111 | 3300009551 | Ga0105238_10045389 | Ga0105238_100453896 | 187 |
| 112 | 3300009551 | Ga0105238_10056683 | Ga0105238_100566834 | 187 |
| 113 | 3300009551 | Ga0105238_10291713 | Ga0105238_102917132 | 187 |
| 114 | 3300009553 | Ga0105249_10497010 | Ga0105249_104970102 | 187 |
| 115 | 3300010375 | Ga0105239_10000135 | Ga0105239_1000013520 | 187 |
| 116 | 3300010375 | Ga0105239_10000337 | Ga0105239_1000033719 | 187 |
| 117 | 3300010375 | Ga0105239_10011821 | Ga0105239_100118215 | 187 |
| 118 | 3300010375 | Ga0105239_10066192 | Ga0105239_100661922 | 187 |
| 119 | 3300011119 | Ga0105246_10432029 | Ga0105246_104320292 | 187 |
| 120 | 3300013100 | Ga0157373_10048519 | Ga0157373_100485193 | 187 |
| 121 | 3300013100 | Ga0157373_10171891 | Ga0157373_101718912 | 187 |
| 122 | 3300013104 | Ga0157370_10029393 | Ga0157370_100293933 | 187 |
| 123 | 3300013104 | Ga0157370_10030890 | Ga0157370_100308903 | 187 |
| 124 | 3300013104 | Ga0157370_10620046 | Ga0157370_106200462 | 187 |
| 125 | 3300013105 | Ga0157369_10014091 | Ga0157369_100140911 | 187 |
| 126 | 3300013105 | Ga0157369_10044422 | Ga0157369_100444222 | 187 |
| 127 | 3300013296 | Ga0157374_10000009 | Ga0157374_10000009306 | 187 |
| 128 | 3300013306 | Ga0163162_10041885 | Ga0163162_100418853 | 187 |
| 129 | 3300013306 | Ga0163162_10924282 | Ga0163162_109242821 | 187 |
| 130 | 3300013307 | Ga0157372_10000258 | Ga0157372_1000025828 | 187 |
| 131 | 3300013307 | Ga0157372_10002260 | Ga0157372_100022604 | 187 |
| 132 | 3300013307 | Ga0157372_10011005 | Ga0157372_100110054 | 187 |
| 133 | 3300013307 | Ga0157372_10023612 | Ga0157372_100236128 | 187 |
| 134 | 3300013307 | Ga0157372_10777371 | Ga0157372_107773712 | 187 |
| 135 | 3300013308 | Ga0157375_10322028 | Ga0157375_103220283 | 187 |
| 136 | 3300013308 | Ga0157375_10789262 | Ga0157375_107892621 | 187 |
| 137 | 3300014325 | Ga0163163_10166806 | Ga0163163_101668062 | 187 |
| 138 | 3300014325 | Ga0163163_11808531 | Ga0163163_118085311 | 187 |
| 139 | 3300014326 | Ga0157380_10053087 | Ga0157380_100530872 | 187 |
| 140 | 3300014326 | Ga0157380_10809469 | Ga0157380_108094691 | 187 |
| 141 | 3300014745 | Ga0157377_10137773 | Ga0157377_101377732 | 187 |
| 142 | 3300014968 | Ga0157379_10119948 | Ga0157379_101199483 | 187 |
| 143 | 3300014969 | Ga0157376_10001803 | Ga0157376_100018033 | 187 |
| 144 | 3300025271 | Ga0207666_1004090 | Ga0207666_10040902 | 187 |
| 145 | 3300025321 | Ga0207656_10064710 | Ga0207656_100647102 | 187 |
| 146 | 3300025893 | Ga0207682_10109391 | Ga0207682_101093912 | 187 |
| 147 | 3300025901 | Ga0207688_10165903 | Ga0207688_101659031 | 187 |
| 148 | 3300025904 | Ga0207647_10005595 | Ga0207647_100055956 | 187 |
| 149 | 3300025907 | Ga0207645_10123146 | Ga0207645_101231462 | 187 |
| 150 | 3300025908 | Ga0207643_10133312 | Ga0207643_101333122 | 187 |
| 151 | 3300025911 | Ga0207654_10045682 | Ga0207654_100456821 | 187 |
| 152 | 3300025911 | Ga0207654_10061375 | Ga0207654_100613753 | 187 |
| 153 | 3300025911 | Ga0207654_10269864 | Ga0207654_102698641 | 187 |
| 154 | 3300025912 | Ga0207707_10252456 | Ga0207707_102524561 | 187 |
| 155 | 3300025912 | Ga0207707_10842167 | Ga0207707_108421671 | 187 |
| 156 | 3300025913 | Ga0207695_10000051 | Ga0207695_10000051299 | 187 |
| 157 | 3300025913 | Ga0207695_10000445 | Ga0207695_1000044563 | 187 |
| 158 | 3300025913 | Ga0207695_10003973 | Ga0207695_100039736 | 187 |
| 159 | 3300025913 | Ga0207695_10008615 | Ga0207695_1000861511 | 187 |
| 160 | 3300025913 | Ga0207695_10033063 | Ga0207695_100330632 | 187 |
| 161 | 3300025913 | Ga0207695_10034499 | Ga0207695_100344996 | 187 |
| 162 | 3300025913 | Ga0207695_10037199 | Ga0207695_100371996 | 187 |
| 163 | 3300025913 | Ga0207695_10041787 | Ga0207695_100417872 | 187 |
| 164 | 3300025914 | Ga0207671_10001466 | Ga0207671_1000146621 | 187 |
| 165 | 3300025914 | Ga0207671_10001778 | Ga0207671_100017784 | 187 |
| 166 | 3300025914 | Ga0207671_10009206 | Ga0207671_100092063 | 187 |
| 167 | 3300025914 | Ga0207671_10047175 | Ga0207671_100471752 | 187 |
| 168 | 3300025914 | Ga0207671_10062520 | Ga0207671_100625202 | 187 |
| 169 | 3300025914 | Ga0207671_10210864 | Ga0207671_102108642 | 187 |
| 170 | 3300025918 | Ga0207662_10007855 | Ga0207662_100078552 | 187 |
| 171 | 3300025924 | Ga0207694_10019774 | Ga0207694_100197742 | 187 |
| 172 | 3300025924 | Ga0207694_10166674 | Ga0207694_101666743 | 187 |
| 173 | 3300025924 | Ga0207694_10177615 | Ga0207694_101776151 | 187 |
| 174 | 3300025924 | Ga0207694_10208658 | Ga0207694_102086582 | 187 |
| 175 | 3300025925 | Ga0207650_10122178 | Ga0207650_101221782 | 187 |
| 176 | 3300025926 | Ga0207659_10050963 | Ga0207659_100509633 | 187 |
| 177 | 3300025926 | Ga0207659_10954483 | Ga0207659_109544831 | 187 |
| 178 | 3300025931 | Ga0207644_10344197 | Ga0207644_103441972 | 187 |
| 179 | 3300025934 | Ga0207686_10000715 | Ga0207686_100007152 | 187 |
| 180 | 3300025936 | Ga0207670_10114999 | Ga0207670_101149992 | 187 |
| 181 | 3300025940 | Ga0207691_10022643 | Ga0207691_100226433 | 187 |
| 182 | 3300025940 | Ga0207691_10893658 | Ga0207691_108936581 | 187 |
| 183 | 3300025941 | Ga0207711_10428060 | Ga0207711_104280602 | 187 |
| 184 | 3300025942 | Ga0207689_10021377 | Ga0207689_100213774 | 187 |
| 185 | 3300025942 | Ga0207689_10049862 | Ga0207689_100498622 | 187 |
| 186 | 3300025944 | Ga0207661_10048009 | Ga0207661_100480092 | 187 |
| 187 | 3300025949 | Ga0207667_10000100 | Ga0207667_10000100104 | 187 |
| 188 | 3300025949 | Ga0207667_10004308 | Ga0207667_1000430813 | 187 |
| 189 | 3300025949 | Ga0207667_10080669 | Ga0207667_100806692 | 187 |
| 190 | 3300025960 | Ga0207651_10145062 | Ga0207651_101450622 | 187 |
| 191 | 3300025960 | Ga0207651_10276251 | Ga0207651_102762511 | 187 |
| 192 | 3300025961 | Ga0207712_10066027 | Ga0207712_100660273 | 187 |
| 193 | 3300025961 | Ga0207712_10455434 | Ga0207712_104554342 | 187 |
| 194 | 3300025961 | Ga0207712_11091321 | Ga0207712_110913212 | 187 |
| 195 | 3300025972 | Ga0207668_10151729 | Ga0207668_101517292 | 187 |
| 196 | 3300025981 | Ga0207640_10033995 | Ga0207640_100339954 | 187 |
| 197 | 3300025981 | Ga0207640_10108050 | Ga0207640_101080503 | 187 |
| 198 | 3300025981 | Ga0207640_10204918 | Ga0207640_102049181 | 187 |
| 199 | 3300025986 | Ga0207658_10592578 | Ga0207658_105925782 | 187 |
| 200 | 3300026023 | Ga0207677_10403403 | Ga0207677_104034032 | 187 |
| 201 | 3300026035 | Ga0207703_10116123 | Ga0207703_101161233 | 187 |
| 202 | 3300026041 | Ga0207639_10249225 | Ga0207639_102492252 | 187 |
| 203 | 3300026041 | Ga0207639_10293226 | Ga0207639_102932262 | 187 |
| 204 | 3300026075 | Ga0207708_10193239 | Ga0207708_101932392 | 187 |
| 205 | 3300026078 | Ga0207702_10068314 | Ga0207702_100683142 | 187 |
| 206 | 3300026078 | Ga0207702_10075567 | Ga0207702_100755672 | 187 |
| 207 | 3300026088 | Ga0207641_10000213 | Ga0207641_1000021375 | 187 |
| 208 | 3300026089 | Ga0207648_10304164 | Ga0207648_103041641 | 187 |
| 209 | 3300026089 | Ga0207648_10377254 | Ga0207648_103772542 | 187 |
| 210 | 3300026116 | Ga0207674_10003443 | Ga0207674_1000344318 | 187 |
| 211 | 3300026116 | Ga0207674_10060763 | Ga0207674_100607632 | 187 |
| 212 | 3300026118 | Ga0207675_100007715 | Ga0207675_10000771510 | 187 |
| 213 | 3300026118 | Ga0207675_100172010 | Ga0207675_1001720103 | 187 |
| 214 | 3300026121 | Ga0207683_10326373 | Ga0207683_103263732 | 187 |
| 215 | 3300026142 | Ga0207698_10000108 | Ga0207698_1000010829 | 187 |
| 216 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016353 | 187 |
| 217 | 3300028381 | Ga0268264_10000072 | Ga0268264_10000072190 | 187 |
| 218 | 3300028381 | Ga0268264_10102717 | Ga0268264_101027172 | 187 |
| 219 | 3300028381 | Ga0268264_10603980 | Ga0268264_106039802 | 187 |
| 220 | 3300028666 | Ga0265336_10120897 | Ga0265336_101208971 | 187 |
| 221 | 3300031730 | Ga0307516_10265817 | Ga0307516_102658171 | 187 |
| 222 | 3300033180 | Ga0307510_10001712 | Ga0307510_1000171211 | 187 |
| 223 | 3300036401 | Ga0373937_0459222 | Ga0373937_0459222_494_1057 | 187 |
| 224 | 3300042125 | Ga0450923_006726 | Ga0450923_006726_587_1150 | 187 |
| 225 | 3300044658 | Ga0466972_0008365 | Ga0466972_0008365_2788_3360 | 187 |
| 226 | 3300044684 | Ga0466966_0346352 | Ga0466966_0346352_286_855 | 187 |
| 227 | 3300044719 | Ga0466971_0009829 | Ga0466971_0009829_2954_3523 | 187 |
| 228 | 3300044735 | Ga0466968_0193259 | Ga0466968_0193259_224_796 | 187 |
| 229 | 3300044842 | Ga0466957_0111966 | Ga0466957_0111966_203_772 | 187 |
| 230 | 3300044901 | Ga0466960_0406241 | Ga0466960_0406241_154_726 | 187 |
| 231 | 3300045049 | Ga0466959_0002150 | Ga0466959_0002150_6832_7401 | 187 |
| 232 | 3300045836 | Ga0466958_0110840 | Ga0466958_0110840_1049_1618 | 187 |
| 233 | 3300046460 | Ga0495638_0017086 | Ga0495638_0017086_2678_3250 | 187 |
| 234 | 3300046507 | Ga0495606_0004456 | Ga0495606_0004456_7020_7589 | 187 |
| 235 | 3300046524 | Ga0495648_0011969 | Ga0495648_0011969_3521_4093 | 187 |
| 236 | 3300046539 | Ga0495621_0015348 | Ga0495621_0015348_695_1258 | 187 |
| 237 | 3300046648 | Ga0495611_0000011 | Ga0495611_0000011_51878_52447 | 187 |
| 238 | 3300046648 | Ga0495611_0104811 | Ga0495611_0104811_208_780 | 187 |
| 239 | 3300046691 | Ga0495670_0309935 | Ga0495670_0309935_19_582 | 187 |
| 240 | 3300047321 | Ga0495676_0262431 | Ga0495676_0262431_266_829 | 187 |
| 241 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_484310_484882 | 187 |
| 242 | 3300047472 | Ga0495686_0000165 | Ga0495686_0000165_82492_83061 | 187 |
| 243 | 3300048918 | Ga0496115_0906618 | Ga0496115_0906618_75_644 | 187 |
| 244 | 3300049823 | Ga0501044_0398168 | Ga0501044_0398168_451_1023 | 187 |
| 245 | 3300050507 | nmdc:mga05p37_1130996_c1 | nmdc:mga05p37_1130996_c1_118_681 | 187 |
| 246 | 3300050507 | nmdc:mga05p37_194882_c1 | nmdc:mga05p37_194882_c1_126_695 | 187 |
| 247 | 3300050508 | nmdc:mga09592_14034_c1 | nmdc:mga09592_14034_c1_2490_3059 | 187 |
| 248 | 3300050508 | nmdc:mga09592_553442_c1 | nmdc:mga09592_553442_c1_413_976 | 187 |
| 249 | 3300050509 | nmdc:mga0qj67_61545_c1 | nmdc:mga0qj67_61545_c1_1225_1794 | 187 |
| 250 | 3300053088 | Ga0500644_0230791 | Ga0500644_0230791_108_680 | 187 |
| 251 | 3300053092 | Ga0500583_0000120 | Ga0500583_0000120_15246_15809 | 187 |
| 252 | 3300053092 | Ga0500583_0006739 | Ga0500583_0006739_963_1532 | 187 |
| 253 | 3300053093 | Ga0500651_0467566 | Ga0500651_0467566_85_660 | 187 |
| 254 | 3300053118 | Ga0500594_0147661 | Ga0500594_0147661_96_668 | 187 |
| 255 | 3300053130 | Ga0500642_0074754 | Ga0500642_0074754_908_1480 | 187 |
| 256 | 3300053133 | Ga0500655_013508 | Ga0500655_013508_432_1004 | 187 |
| 257 | 3300053133 | Ga0500655_016309 | Ga0500655_016309_756_1331 | 187 |
| 258 | 3300053139 | Ga0500568_0175869 | Ga0500568_0175869_17_589 | 187 |
| 259 | 3300053140 | Ga0500573_0171265 | Ga0500573_0171265_352_921 | 187 |
| 260 | 3300053156 | Ga0500622_0002131 | Ga0500622_0002131_2611_3183 | 187 |
| 261 | 3300055283 | Ga0500661_034890 | Ga0500661_034890_54_623 | 187 |
| 262 | 3300061719 | Ga0466962_0004595 | Ga0466962_0004595_4332_4901 | 187 |
| 263 | 3300002739 | JGI25158J39367_1005868 | JGI25158J39367_10058682 | 188 |
| 264 | 3300005262 | Ga0065165_1004556 | Ga0065165_10045562 | 188 |
| 265 | 3300005290 | Ga0065712_10208997 | Ga0065712_102089972 | 188 |
| 266 | 3300005295 | Ga0065707_10166336 | Ga0065707_101663361 | 188 |
| 267 | 3300005328 | Ga0070676_10389108 | Ga0070676_103891082 | 188 |
| 268 | 3300005331 | Ga0070670_100018081 | Ga0070670_1000180813 | 188 |
| 269 | 3300005333 | Ga0070677_10142571 | Ga0070677_101425712 | 188 |
| 270 | 3300005334 | Ga0068869_100161706 | Ga0068869_1001617062 | 188 |
| 271 | 3300005334 | Ga0068869_100274879 | Ga0068869_1002748792 | 188 |
| 272 | 3300005335 | Ga0070666_10211835 | Ga0070666_102118352 | 188 |
| 273 | 3300005338 | Ga0068868_100452219 | Ga0068868_1004522192 | 188 |
| 274 | 3300005339 | Ga0070660_100858708 | Ga0070660_1008587081 | 188 |
| 275 | 3300005343 | Ga0070687_100031401 | Ga0070687_1000314011 | 188 |
| 276 | 3300005344 | Ga0070661_100592694 | Ga0070661_1005926942 | 188 |
| 277 | 3300005347 | Ga0070668_100078394 | Ga0070668_1000783943 | 188 |
| 278 | 3300005354 | Ga0070675_100017651 | Ga0070675_1000176514 | 188 |
| 279 | 3300005354 | Ga0070675_100123475 | Ga0070675_1001234752 | 188 |
| 280 | 3300005355 | Ga0070671_100100262 | Ga0070671_1001002623 | 188 |
| 281 | 3300005356 | Ga0070674_100122851 | Ga0070674_1001228513 | 188 |
| 282 | 3300005356 | Ga0070674_100178240 | Ga0070674_1001782402 | 188 |
| 283 | 3300005364 | Ga0070673_100004723 | Ga0070673_1000047235 | 188 |
| 284 | 3300005364 | Ga0070673_100668681 | Ga0070673_1006686811 | 188 |
| 285 | 3300005365 | Ga0070688_100570944 | Ga0070688_1005709442 | 188 |
| 286 | 3300005366 | Ga0070659_100088075 | Ga0070659_1000880752 | 188 |
| 287 | 3300005367 | Ga0070667_100059103 | Ga0070667_1000591035 | 188 |
| 288 | 3300005434 | Ga0070709_10625398 | Ga0070709_106253981 | 188 |
| 289 | 3300005436 | Ga0070713_100837017 | Ga0070713_1008370172 | 188 |
| 290 | 3300005438 | Ga0070701_10195924 | Ga0070701_101959242 | 188 |
| 291 | 3300005445 | Ga0070708_100620020 | Ga0070708_1006200201 | 188 |
| 292 | 3300005456 | Ga0070678_100056590 | Ga0070678_1000565904 | 188 |
| 293 | 3300005456 | Ga0070678_100227551 | Ga0070678_1002275512 | 188 |
| 294 | 3300005459 | Ga0068867_100019000 | Ga0068867_1000190003 | 188 |
| 295 | 3300005459 | Ga0068867_100075165 | Ga0068867_1000751653 | 188 |
| 296 | 3300005459 | Ga0068867_100117576 | Ga0068867_1001175763 | 188 |
| 297 | 3300005459 | Ga0068867_100451034 | Ga0068867_1004510341 | 188 |
| 298 | 3300005459 | Ga0068867_101344111 | Ga0068867_1013441111 | 188 |
| 299 | 3300005466 | Ga0070685_10150879 | Ga0070685_101508792 | 188 |
| 300 | 3300005466 | Ga0070685_10285159 | Ga0070685_102851592 | 188 |
| 301 | 3300005471 | Ga0070698_100000661 | Ga0070698_10000066117 | 188 |
| 302 | 3300005471 | Ga0070698_100005764 | Ga0070698_10000576412 | 188 |
| 303 | 3300005539 | Ga0068853_100626989 | Ga0068853_1006269891 | 188 |
| 304 | 3300005543 | Ga0070672_100025969 | Ga0070672_1000259694 | 188 |
| 305 | 3300005543 | Ga0070672_100054432 | Ga0070672_1000544323 | 188 |
| 306 | 3300005544 | Ga0070686_100019526 | Ga0070686_1000195263 | 188 |
| 307 | 3300005544 | Ga0070686_100361632 | Ga0070686_1003616322 | 188 |
| 308 | 3300005546 | Ga0070696_100133873 | Ga0070696_1001338731 | 188 |
| 309 | 3300005577 | Ga0068857_100151517 | Ga0068857_1001515173 | 188 |
| 310 | 3300005615 | Ga0070702_100022492 | Ga0070702_1000224923 | 188 |
| 311 | 3300005617 | Ga0068859_100093110 | Ga0068859_1000931103 | 188 |
| 312 | 3300005718 | Ga0068866_10103285 | Ga0068866_101032852 | 188 |
| 313 | 3300005719 | Ga0068861_100964043 | Ga0068861_1009640432 | 188 |
| 314 | 3300005834 | Ga0068851_10090465 | Ga0068851_100904652 | 188 |
| 315 | 3300005841 | Ga0068863_100007099 | Ga0068863_1000070998 | 188 |
| 316 | 3300005842 | Ga0068858_100351746 | Ga0068858_1003517462 | 188 |
| 317 | 3300005843 | Ga0068860_100121471 | Ga0068860_1001214713 | 188 |
| 318 | 3300006195 | Ga0075366_10007240 | Ga0075366_100072407 | 188 |
| 319 | 3300006237 | Ga0097621_100092526 | Ga0097621_1000925262 | 188 |
| 320 | 3300006358 | Ga0068871_101066465 | Ga0068871_1010664651 | 188 |
| 321 | 3300006846 | Ga0075430_100030675 | Ga0075430_1000306755 | 188 |
| 322 | 3300006852 | Ga0075433_10519812 | Ga0075433_105198121 | 188 |
| 323 | 3300006931 | Ga0097620_100093114 | Ga0097620_1000931142 | 188 |
| 324 | 3300009093 | Ga0105240_10791516 | Ga0105240_107915162 | 188 |
| 325 | 3300009094 | Ga0111539_10125769 | Ga0111539_101257692 | 188 |
| 326 | 3300009101 | Ga0105247_10001984 | Ga0105247_100019846 | 188 |
| 327 | 3300009176 | Ga0105242_10162697 | Ga0105242_101626973 | 188 |
| 328 | 3300009177 | Ga0105248_10790839 | Ga0105248_107908392 | 188 |
| 329 | 3300009545 | Ga0105237_10080975 | Ga0105237_100809755 | 188 |
| 330 | 3300009545 | Ga0105237_10541274 | Ga0105237_105412742 | 188 |
| 331 | 3300009553 | Ga0105249_10009665 | Ga0105249_100096653 | 188 |
| 332 | 3300009553 | Ga0105249_10042329 | Ga0105249_100423292 | 188 |
| 333 | 3300009553 | Ga0105249_10197991 | Ga0105249_101979913 | 188 |
| 334 | 3300010375 | Ga0105239_10009606 | Ga0105239_1000960611 | 188 |
| 335 | 3300013102 | Ga0157371_10095188 | Ga0157371_100951882 | 188 |
| 336 | 3300013296 | Ga0157374_10480758 | Ga0157374_104807582 | 188 |
| 337 | 3300013297 | Ga0157378_10000837 | Ga0157378_1000083714 | 188 |
| 338 | 3300013306 | Ga0163162_10050448 | Ga0163162_100504485 | 188 |
| 339 | 3300013308 | Ga0157375_10759834 | Ga0157375_107598342 | 188 |
| 340 | 3300014325 | Ga0163163_10052456 | Ga0163163_100524562 | 188 |
| 341 | 3300014325 | Ga0163163_10308727 | Ga0163163_103087272 | 188 |
| 342 | 3300014326 | Ga0157380_10357361 | Ga0157380_103573612 | 188 |
| 343 | 3300014745 | Ga0157377_10044754 | Ga0157377_100447542 | 188 |
| 344 | 3300014968 | Ga0157379_10356112 | Ga0157379_103561122 | 188 |
| 345 | 3300015265 | Ga0182005_1000081 | Ga0182005_100008111 | 188 |
| 346 | 3300025208 | Ga0209436_102659 | Ga0209436_1026594 | 188 |
| 347 | 3300025893 | Ga0207682_10038675 | Ga0207682_100386753 | 188 |
| 348 | 3300025900 | Ga0207710_10001075 | Ga0207710_1000107511 | 188 |
| 349 | 3300025901 | Ga0207688_10033901 | Ga0207688_100339014 | 188 |
| 350 | 3300025903 | Ga0207680_10348173 | Ga0207680_103481731 | 188 |
| 351 | 3300025907 | Ga0207645_10412634 | Ga0207645_104126342 | 188 |
| 352 | 3300025916 | Ga0207663_10272622 | Ga0207663_102726222 | 188 |
| 353 | 3300025920 | Ga0207649_10494043 | Ga0207649_104940432 | 188 |
| 354 | 3300025925 | Ga0207650_10487853 | Ga0207650_104878532 | 188 |
| 355 | 3300025926 | Ga0207659_10337561 | Ga0207659_103375612 | 188 |
| 356 | 3300025928 | Ga0207700_10666820 | Ga0207700_106668201 | 188 |
| 357 | 3300025936 | Ga0207670_10335349 | Ga0207670_103353492 | 188 |
| 358 | 3300025940 | Ga0207691_10004949 | Ga0207691_100049495 | 188 |
| 359 | 3300025942 | Ga0207689_10501790 | Ga0207689_105017902 | 188 |
| 360 | 3300025960 | Ga0207651_10040147 | Ga0207651_100401473 | 188 |
| 361 | 3300025961 | Ga0207712_10001156 | Ga0207712_1000115616 | 188 |
| 362 | 3300025961 | Ga0207712_10024733 | Ga0207712_100247333 | 188 |
| 363 | 3300025961 | Ga0207712_10536775 | Ga0207712_105367752 | 188 |
| 364 | 3300025986 | Ga0207658_10206859 | Ga0207658_102068592 | 188 |
| 365 | 3300026023 | Ga0207677_10188221 | Ga0207677_101882212 | 188 |
| 366 | 3300026035 | Ga0207703_10423639 | Ga0207703_104236391 | 188 |
| 367 | 3300026041 | Ga0207639_10522781 | Ga0207639_105227812 | 188 |
| 368 | 3300026088 | Ga0207641_10008579 | Ga0207641_100085798 | 188 |
| 369 | 3300026089 | Ga0207648_10029361 | Ga0207648_100293615 | 188 |
| 370 | 3300026095 | Ga0207676_10547419 | Ga0207676_105474192 | 188 |
| 371 | 3300026116 | Ga0207674_10065745 | Ga0207674_100657454 | 188 |
| 372 | 3300026118 | Ga0207675_100120696 | Ga0207675_1001206963 | 188 |
| 373 | 3300026118 | Ga0207675_100288819 | Ga0207675_1002888192 | 188 |
| 374 | 3300026118 | Ga0207675_101038578 | Ga0207675_1010385782 | 188 |
| 375 | 3300026121 | Ga0207683_10076782 | Ga0207683_100767822 | 188 |
| 376 | 3300026121 | Ga0207683_10269701 | Ga0207683_102697012 | 188 |
| 377 | 3300028380 | Ga0268265_10060552 | Ga0268265_100605523 | 188 |
| 378 | 3300028381 | Ga0268264_10063504 | Ga0268264_100635042 | 188 |
| 379 | 3300031241 | Ga0265325_10249205 | Ga0265325_102492051 | 188 |
| 380 | 3300031507 | Ga0307509_10036817 | Ga0307509_100368175 | 188 |
| 381 | 3300031595 | Ga0265313_10153091 | Ga0265313_101530912 | 188 |
| 382 | 3300033180 | Ga0307510_10362291 | Ga0307510_103622911 | 188 |
| 383 | 3300041404 | Ga0439436_0006955 | Ga0439436_0006955_2038_2604 | 188 |
| 384 | 3300041406 | Ga0439439_0005738 | Ga0439439_0005738_1409_1975 | 188 |
| 385 | 3300042014 | Ga0439457_091971 | Ga0439457_091971_98_664 | 188 |
| 386 | 3300044693 | Ga0466961_0134492 | Ga0466961_0134492_861_1427 | 188 |
| 387 | 3300044719 | Ga0466971_0078081 | Ga0466971_0078081_896_1462 | 188 |
| 388 | 3300044735 | Ga0466968_0080577 | Ga0466968_0080577_732_1337 | 188 |
| 389 | 3300044735 | Ga0466968_0081931 | Ga0466968_0081931_348_914 | 188 |
| 390 | 3300046453 | Ga0495627_013864 | Ga0495627_013864_1910_2476 | 188 |
| 391 | 3300046460 | Ga0495638_0154815 | Ga0495638_0154815_708_1274 | 188 |
| 392 | 3300046519 | Ga0495632_0157321 | Ga0495632_0157321_104_670 | 188 |
| 393 | 3300046558 | Ga0495633_0000175 | Ga0495633_0000175_81495_82061 | 188 |
| 394 | 3300046616 | Ga0495668_0000108 | Ga0495668_0000108_81310_81876 | 188 |
| 395 | 3300047320 | Ga0495672_0014438 | Ga0495672_0014438_2454_3020 | 188 |
| 396 | 3300048918 | Ga0496115_0132318 | Ga0496115_0132318_1162_1734 | 188 |
| 397 | 3300048924 | Ga0496121_0000030 | Ga0496121_0000030_301276_301842 | 188 |
| 398 | 3300049766 | Ga0501269_013559 | Ga0501269_013559_303_869 | 188 |
| 399 | 3300050493 | nmdc:mga0k408_11997_c1 | nmdc:mga0k408_11997_c1_229_795 | 188 |
| 400 | 3300050509 | nmdc:mga0qj67_51192_c1 | nmdc:mga0qj67_51192_c1_1065_1631 | 188 |
| 401 | 3300050511 | nmdc:mga08y16_260978_c1 | nmdc:mga08y16_260978_c1_415_981 | 188 |
| 402 | 3300053092 | Ga0500583_0064385 | Ga0500583_0064385_57_623 | 188 |
| 403 | 3300053093 | Ga0500651_0047942 | Ga0500651_0047942_1180_1746 | 188 |
| 404 | 3300053104 | Ga0500556_0124325 | Ga0500556_0124325_27_593 | 188 |
| 405 | 3300053118 | Ga0500594_0053167 | Ga0500594_0053167_454_1020 | 188 |
| 406 | 3300053130 | Ga0500642_0003619 | Ga0500642_0003619_3491_4057 | 188 |
| 407 | 3300053131 | Ga0500652_006848 | Ga0500652_006848_1192_1758 | 188 |
| 408 | 3300053140 | Ga0500573_0126264 | Ga0500573_0126264_451_1017 | 188 |
| 409 | 3300053143 | Ga0500579_145570 | Ga0500579_145570_400_966 | 188 |
| 410 | 3300053151 | Ga0500604_0002303 | Ga0500604_0002303_2502_3068 | 188 |
| 411 | 3300053153 | Ga0500616_0004758 | Ga0500616_0004758_7862_8428 | 188 |
| 412 | 3300001979 | JGI24740J21852_10013829 | JGI24740J21852_100138292 | 189 |
| 413 | 3300001989 | JGI24739J22299_10018562 | JGI24739J22299_100185621 | 189 |
| 414 | 3300003215 | JGI25153J46596_10000209 | JGI25153J46596_1000020923 | 189 |
| 415 | 3300003215 | JGI25153J46596_10023975 | JGI25153J46596_100239751 | 189 |
| 416 | 3300003320 | rootH2_10011602 | rootH2_100116026 | 189 |
| 417 | 3300003320 | rootH2_10137001 | rootH2_101370016 | 189 |
| 418 | 3300003323 | rootH1_10043692 | rootH1_100436927 | 189 |
| 419 | 3300003323 | rootH1_10137701 | rootH1_101377013 | 189 |
| 420 | 3300003323 | rootH1_10203057 | rootH1_102030571 | 189 |
| 421 | 3300003354 | JGI25160J50197_1001403 | JGI25160J50197_10014036 | 189 |
| 422 | 3300003354 | JGI25160J50197_1003289 | JGI25160J50197_10032897 | 189 |
| 423 | 3300003354 | JGI25160J50197_1009333 | JGI25160J50197_10093333 | 189 |
| 424 | 3300003762 | Ga0055542_1005560 | Ga0055542_10055601 | 189 |
| 425 | 3300003771 | Ga0055526_1021827 | Ga0055526_10218271 | 189 |
| 426 | 3300003771 | Ga0055526_1038025 | Ga0055526_10380251 | 189 |
| 427 | 3300003790 | Ga0055528_1000308 | Ga0055528_100030811 | 189 |
| 428 | 3300003790 | Ga0055528_1000809 | Ga0055528_100080911 | 189 |
| 429 | 3300003791 | Ga0055530_10000385 | Ga0055530_1000038513 | 189 |
| 430 | 3300003794 | Ga0055531_10000027 | Ga0055531_1000002799 | 189 |
| 431 | 3300005262 | Ga0065165_1000053 | Ga0065165_100005358 | 189 |
| 432 | 3300005262 | Ga0065165_1046879 | Ga0065165_10468791 | 189 |
| 433 | 3300005288 | Ga0065714_10214071 | Ga0065714_102140711 | 189 |
| 434 | 3300005290 | Ga0065712_10019139 | Ga0065712_100191395 | 189 |
| 435 | 3300005290 | Ga0065712_10263719 | Ga0065712_102637191 | 189 |
| 436 | 3300005328 | Ga0070676_10780897 | Ga0070676_107808971 | 189 |
| 437 | 3300005331 | Ga0070670_100068080 | Ga0070670_1000680802 | 189 |
| 438 | 3300005331 | Ga0070670_100092898 | Ga0070670_1000928981 | 189 |
| 439 | 3300005331 | Ga0070670_100219101 | Ga0070670_1002191012 | 189 |
| 440 | 3300005331 | Ga0070670_100490162 | Ga0070670_1004901622 | 189 |
| 441 | 3300005333 | Ga0070677_10013451 | Ga0070677_100134513 | 189 |
| 442 | 3300005333 | Ga0070677_10063065 | Ga0070677_100630652 | 189 |
| 443 | 3300005334 | Ga0068869_100007079 | Ga0068869_1000070795 | 189 |
| 444 | 3300005334 | Ga0068869_100092954 | Ga0068869_1000929543 | 189 |
| 445 | 3300005335 | Ga0070666_10000536 | Ga0070666_1000053616 | 189 |
| 446 | 3300005335 | Ga0070666_10076765 | Ga0070666_100767653 | 189 |
| 447 | 3300005337 | Ga0070682_100000628 | Ga0070682_1000006287 | 189 |
| 448 | 3300005338 | Ga0068868_100006435 | Ga0068868_1000064356 | 189 |
| 449 | 3300005338 | Ga0068868_100238903 | Ga0068868_1002389032 | 189 |
| 450 | 3300005338 | Ga0068868_100564460 | Ga0068868_1005644601 | 189 |
| 451 | 3300005339 | Ga0070660_100044390 | Ga0070660_1000443902 | 189 |
| 452 | 3300005339 | Ga0070660_100181694 | Ga0070660_1001816942 | 189 |
| 453 | 3300005339 | Ga0070660_100275914 | Ga0070660_1002759142 | 189 |
| 454 | 3300005343 | Ga0070687_100105272 | Ga0070687_1001052722 | 189 |
| 455 | 3300005343 | Ga0070687_100367826 | Ga0070687_1003678261 | 189 |
| 456 | 3300005347 | Ga0070668_100030711 | Ga0070668_1000307113 | 189 |
| 457 | 3300005347 | Ga0070668_100222169 | Ga0070668_1002221693 | 189 |
| 458 | 3300005347 | Ga0070668_100391018 | Ga0070668_1003910182 | 189 |
| 459 | 3300005353 | Ga0070669_100169400 | Ga0070669_1001694002 | 189 |
| 460 | 3300005353 | Ga0070669_100185767 | Ga0070669_1001857672 | 189 |
| 461 | 3300005353 | Ga0070669_100264686 | Ga0070669_1002646862 | 189 |
| 462 | 3300005355 | Ga0070671_100184160 | Ga0070671_1001841602 | 189 |
| 463 | 3300005355 | Ga0070671_101091380 | Ga0070671_1010913801 | 189 |
| 464 | 3300005356 | Ga0070674_100100564 | Ga0070674_1001005643 | 189 |
| 465 | 3300005356 | Ga0070674_100304792 | Ga0070674_1003047921 | 189 |
| 466 | 3300005364 | Ga0070673_100006253 | Ga0070673_1000062539 | 189 |
| 467 | 3300005364 | Ga0070673_100013324 | Ga0070673_1000133244 | 189 |
| 468 | 3300005365 | Ga0070688_100344574 | Ga0070688_1003445742 | 189 |
| 469 | 3300005366 | Ga0070659_100003227 | Ga0070659_1000032272 | 189 |
| 470 | 3300005367 | Ga0070667_100005388 | Ga0070667_10000538811 | 189 |
| 471 | 3300005367 | Ga0070667_100015282 | Ga0070667_1000152825 | 189 |
| 472 | 3300005367 | Ga0070667_100460105 | Ga0070667_1004601052 | 189 |
| 473 | 3300005367 | Ga0070667_100466195 | Ga0070667_1004661952 | 189 |
| 474 | 3300005441 | Ga0070700_100280319 | Ga0070700_1002803192 | 189 |
| 475 | 3300005441 | Ga0070700_100577515 | Ga0070700_1005775152 | 189 |
| 476 | 3300005455 | Ga0070663_100019412 | Ga0070663_1000194121 | 189 |
| 477 | 3300005455 | Ga0070663_100321602 | Ga0070663_1003216021 | 189 |
| 478 | 3300005456 | Ga0070678_100068026 | Ga0070678_1000680262 | 189 |
| 479 | 3300005458 | Ga0070681_10008396 | Ga0070681_100083963 | 189 |
| 480 | 3300005458 | Ga0070681_10042169 | Ga0070681_100421694 | 189 |
| 481 | 3300005459 | Ga0068867_100017763 | Ga0068867_1000177632 | 189 |
| 482 | 3300005459 | Ga0068867_100023075 | Ga0068867_1000230752 | 189 |
| 483 | 3300005459 | Ga0068867_100133111 | Ga0068867_1001331113 | 189 |
| 484 | 3300005459 | Ga0068867_100517768 | Ga0068867_1005177681 | 189 |
| 485 | 3300005466 | Ga0070685_10020796 | Ga0070685_100207963 | 189 |
| 486 | 3300005466 | Ga0070685_10078569 | Ga0070685_100785693 | 189 |
| 487 | 3300005466 | Ga0070685_10093120 | Ga0070685_100931202 | 189 |
| 488 | 3300005530 | Ga0070679_100018252 | Ga0070679_1000182526 | 189 |
| 489 | 3300005530 | Ga0070679_100155055 | Ga0070679_1001550553 | 189 |
| 490 | 3300005535 | Ga0070684_100803610 | Ga0070684_1008036101 | 189 |
| 491 | 3300005539 | Ga0068853_100014820 | Ga0068853_1000148203 | 189 |
| 492 | 3300005539 | Ga0068853_100239648 | Ga0068853_1002396482 | 189 |
| 493 | 3300005539 | Ga0068853_100360163 | Ga0068853_1003601631 | 189 |
| 494 | 3300005539 | Ga0068853_101435349 | Ga0068853_1014353491 | 189 |
| 495 | 3300005543 | Ga0070672_100023427 | Ga0070672_1000234272 | 189 |
| 496 | 3300005543 | Ga0070672_100242480 | Ga0070672_1002424801 | 189 |
| 497 | 3300005543 | Ga0070672_100263024 | Ga0070672_1002630242 | 189 |
| 498 | 3300005543 | Ga0070672_100313140 | Ga0070672_1003131402 | 189 |
| 499 | 3300005543 | Ga0070672_100314732 | Ga0070672_1003147321 | 189 |
| 500 | 3300005543 | Ga0070672_100509640 | Ga0070672_1005096402 | 189 |
| 501 | 3300005543 | Ga0070672_100961930 | Ga0070672_1009619301 | 189 |
| 502 | 3300005547 | Ga0070693_100008596 | Ga0070693_1000085963 | 189 |
| 503 | 3300005548 | Ga0070665_100019926 | Ga0070665_1000199265 | 189 |
| 504 | 3300005548 | Ga0070665_100890085 | Ga0070665_1008900852 | 189 |
| 505 | 3300005563 | Ga0068855_100001274 | Ga0068855_10000127410 | 189 |
| 506 | 3300005563 | Ga0068855_100139770 | Ga0068855_1001397703 | 189 |
| 507 | 3300005563 | Ga0068855_100644205 | Ga0068855_1006442052 | 189 |
| 508 | 3300005564 | Ga0070664_100108824 | Ga0070664_1001088242 | 189 |
| 509 | 3300005564 | Ga0070664_100124998 | Ga0070664_1001249982 | 189 |
| 510 | 3300005564 | Ga0070664_100138162 | Ga0070664_1001381622 | 189 |
| 511 | 3300005577 | Ga0068857_100747755 | Ga0068857_1007477552 | 189 |
| 512 | 3300005578 | Ga0068854_100014234 | Ga0068854_1000142343 | 189 |
| 513 | 3300005578 | Ga0068854_100193632 | Ga0068854_1001936321 | 189 |
| 514 | 3300005578 | Ga0068854_100416099 | Ga0068854_1004160991 | 189 |
| 515 | 3300005578 | Ga0068854_100454151 | Ga0068854_1004541511 | 189 |
| 516 | 3300005614 | Ga0068856_100093229 | Ga0068856_1000932293 | 189 |
| 517 | 3300005616 | Ga0068852_100001996 | Ga0068852_10000199616 | 189 |
| 518 | 3300005616 | Ga0068852_101335593 | Ga0068852_1013355931 | 189 |
| 519 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007182 | 189 |
| 520 | 3300005617 | Ga0068859_100001403 | Ga0068859_10000140313 | 189 |
| 521 | 3300005617 | Ga0068859_100029222 | Ga0068859_1000292223 | 189 |
| 522 | 3300005617 | Ga0068859_100614679 | Ga0068859_1006146792 | 189 |
| 523 | 3300005618 | Ga0068864_100001316 | Ga0068864_10000131615 | 189 |
| 524 | 3300005618 | Ga0068864_100145703 | Ga0068864_1001457033 | 189 |
| 525 | 3300005618 | Ga0068864_101165821 | Ga0068864_1011658211 | 189 |
| 526 | 3300005834 | Ga0068851_10070919 | Ga0068851_100709192 | 189 |
| 527 | 3300005834 | Ga0068851_10321220 | Ga0068851_103212201 | 189 |
| 528 | 3300005840 | Ga0068870_10197145 | Ga0068870_101971451 | 189 |
| 529 | 3300005841 | Ga0068863_100000444 | Ga0068863_1000004442 | 189 |
| 530 | 3300005841 | Ga0068863_100024194 | Ga0068863_1000241946 | 189 |
| 531 | 3300005841 | Ga0068863_100215718 | Ga0068863_1002157182 | 189 |
| 532 | 3300005841 | Ga0068863_100226590 | Ga0068863_1002265902 | 189 |
| 533 | 3300005841 | Ga0068863_100306485 | Ga0068863_1003064851 | 189 |
| 534 | 3300005842 | Ga0068858_100000829 | Ga0068858_10000082924 | 189 |
| 535 | 3300005842 | Ga0068858_100482081 | Ga0068858_1004820812 | 189 |
| 536 | 3300005842 | Ga0068858_100530908 | Ga0068858_1005309082 | 189 |
| 537 | 3300005843 | Ga0068860_100005394 | Ga0068860_10000539411 | 189 |
| 538 | 3300005843 | Ga0068860_100010234 | Ga0068860_1000102343 | 189 |
| 539 | 3300005843 | Ga0068860_100024948 | Ga0068860_1000249482 | 189 |
| 540 | 3300005843 | Ga0068860_100061290 | Ga0068860_1000612902 | 189 |
| 541 | 3300005843 | Ga0068860_100351346 | Ga0068860_1003513462 | 189 |
| 542 | 3300006195 | Ga0075366_10209743 | Ga0075366_102097432 | 189 |
| 543 | 3300006195 | Ga0075366_10313920 | Ga0075366_103139201 | 189 |
| 544 | 3300006237 | Ga0097621_100000711 | Ga0097621_10000071110 | 189 |
| 545 | 3300006237 | Ga0097621_100012629 | Ga0097621_1000126295 | 189 |
| 546 | 3300006237 | Ga0097621_100126956 | Ga0097621_1001269563 | 189 |
| 547 | 3300006237 | Ga0097621_100158266 | Ga0097621_1001582662 | 189 |
| 548 | 3300006237 | Ga0097621_100428706 | Ga0097621_1004287062 | 189 |
| 549 | 3300006237 | Ga0097621_100627510 | Ga0097621_1006275102 | 189 |
| 550 | 3300006237 | Ga0097621_100840136 | Ga0097621_1008401361 | 189 |
| 551 | 3300006353 | Ga0075370_10159619 | Ga0075370_101596192 | 189 |
| 552 | 3300006358 | Ga0068871_100000351 | Ga0068871_10000035117 | 189 |
| 553 | 3300006358 | Ga0068871_100018089 | Ga0068871_1000180893 | 189 |
| 554 | 3300006358 | Ga0068871_100075432 | Ga0068871_1000754323 | 189 |
| 555 | 3300006358 | Ga0068871_100614016 | Ga0068871_1006140162 | 189 |
| 556 | 3300006358 | Ga0068871_100643525 | Ga0068871_1006435252 | 189 |
| 557 | 3300006844 | Ga0075428_100059396 | Ga0075428_1000593962 | 189 |
| 558 | 3300006880 | Ga0075429_100005315 | Ga0075429_1000053155 | 189 |
| 559 | 3300006881 | Ga0068865_100020694 | Ga0068865_1000206944 | 189 |
| 560 | 3300006881 | Ga0068865_100186132 | Ga0068865_1001861322 | 189 |
| 561 | 3300006881 | Ga0068865_100516213 | Ga0068865_1005162132 | 189 |
| 562 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007183 | 189 |
| 563 | 3300006931 | Ga0097620_100001403 | Ga0097620_10000140313 | 189 |
| 564 | 3300006931 | Ga0097620_100029222 | Ga0097620_1000292226 | 189 |
| 565 | 3300006931 | Ga0097620_100614642 | Ga0097620_1006146422 | 189 |
| 566 | 3300006931 | Ga0097620_101262741 | Ga0097620_1012627412 | 189 |
| 567 | 3300009093 | Ga0105240_10003960 | Ga0105240_100039609 | 189 |
| 568 | 3300009101 | Ga0105247_10165240 | Ga0105247_101652402 | 189 |
| 569 | 3300009101 | Ga0105247_10262399 | Ga0105247_102623992 | 189 |
| 570 | 3300009148 | Ga0105243_10387332 | Ga0105243_103873322 | 189 |
| 571 | 3300009148 | Ga0105243_10459542 | Ga0105243_104595421 | 189 |
| 572 | 3300009148 | Ga0105243_10520306 | Ga0105243_105203062 | 189 |
| 573 | 3300009174 | Ga0105241_10000206 | Ga0105241_1000020632 | 189 |
| 574 | 3300009174 | Ga0105241_10142957 | Ga0105241_101429573 | 189 |
| 575 | 3300009176 | Ga0105242_10030077 | Ga0105242_100300772 | 189 |
| 576 | 3300009176 | Ga0105242_10382148 | Ga0105242_103821482 | 189 |
| 577 | 3300009177 | Ga0105248_10046848 | Ga0105248_100468484 | 189 |
| 578 | 3300009177 | Ga0105248_10241525 | Ga0105248_102415252 | 189 |
| 579 | 3300009545 | Ga0105237_10009612 | Ga0105237_100096124 | 189 |
| 580 | 3300009545 | Ga0105237_10012022 | Ga0105237_100120227 | 189 |
| 581 | 3300009545 | Ga0105237_10200736 | Ga0105237_102007362 | 189 |
| 582 | 3300009545 | Ga0105237_11104143 | Ga0105237_111041431 | 189 |
| 583 | 3300009553 | Ga0105249_10008328 | Ga0105249_100083288 | 189 |
| 584 | 3300009553 | Ga0105249_10598379 | Ga0105249_105983791 | 189 |
| 585 | 3300010375 | Ga0105239_10007270 | Ga0105239_100072703 | 189 |
| 586 | 3300010375 | Ga0105239_10224526 | Ga0105239_102245263 | 189 |
| 587 | 3300010375 | Ga0105239_10237019 | Ga0105239_102370191 | 189 |
| 588 | 3300010375 | Ga0105239_10278360 | Ga0105239_102783602 | 189 |
| 589 | 3300010375 | Ga0105239_10390573 | Ga0105239_103905732 | 189 |
| 590 | 3300010375 | Ga0105239_10701481 | Ga0105239_107014812 | 189 |
| 591 | 3300013100 | Ga0157373_10588544 | Ga0157373_105885442 | 189 |
| 592 | 3300013102 | Ga0157371_10036310 | Ga0157371_100363105 | 189 |
| 593 | 3300013102 | Ga0157371_10069202 | Ga0157371_100692023 | 189 |
| 594 | 3300013102 | Ga0157371_10072834 | Ga0157371_100728342 | 189 |
| 595 | 3300013102 | Ga0157371_10107422 | Ga0157371_101074223 | 189 |
| 596 | 3300013102 | Ga0157371_10172210 | Ga0157371_101722102 | 189 |
| 597 | 3300013102 | Ga0157371_10524499 | Ga0157371_105244991 | 189 |
| 598 | 3300013104 | Ga0157370_10000426 | Ga0157370_1000042643 | 189 |
| 599 | 3300013104 | Ga0157370_10004831 | Ga0157370_100048313 | 189 |
| 600 | 3300013104 | Ga0157370_10150085 | Ga0157370_101500853 | 189 |
| 601 | 3300013104 | Ga0157370_10219831 | Ga0157370_102198313 | 189 |
| 602 | 3300013104 | Ga0157370_10981652 | Ga0157370_109816522 | 189 |
| 603 | 3300013105 | Ga0157369_10019728 | Ga0157369_100197286 | 189 |
| 604 | 3300013105 | Ga0157369_10040395 | Ga0157369_100403956 | 189 |
| 605 | 3300013105 | Ga0157369_10061816 | Ga0157369_100618163 | 189 |
| 606 | 3300013105 | Ga0157369_10178489 | Ga0157369_101784892 | 189 |
| 607 | 3300013105 | Ga0157369_10224634 | Ga0157369_102246343 | 189 |
| 608 | 3300013105 | Ga0157369_10252953 | Ga0157369_102529532 | 189 |
| 609 | 3300013105 | Ga0157369_10628330 | Ga0157369_106283302 | 189 |
| 610 | 3300013105 | Ga0157369_10780015 | Ga0157369_107800151 | 189 |
| 611 | 3300013296 | Ga0157374_10045471 | Ga0157374_100454715 | 189 |
| 612 | 3300013296 | Ga0157374_10067126 | Ga0157374_100671262 | 189 |
| 613 | 3300013296 | Ga0157374_10087081 | Ga0157374_100870813 | 189 |
| 614 | 3300013296 | Ga0157374_10213072 | Ga0157374_102130722 | 189 |
| 615 | 3300013296 | Ga0157374_10360574 | Ga0157374_103605742 | 189 |
| 616 | 3300013297 | Ga0157378_10002924 | Ga0157378_100029241 | 189 |
| 617 | 3300013297 | Ga0157378_10025999 | Ga0157378_100259996 | 189 |
| 618 | 3300013297 | Ga0157378_11033314 | Ga0157378_110333141 | 189 |
| 619 | 3300013306 | Ga0163162_10000795 | Ga0163162_1000079511 | 189 |
| 620 | 3300013306 | Ga0163162_10000833 | Ga0163162_1000083312 | 189 |
| 621 | 3300013306 | Ga0163162_10008664 | Ga0163162_100086644 | 189 |
| 622 | 3300013306 | Ga0163162_10069707 | Ga0163162_100697072 | 189 |
| 623 | 3300013306 | Ga0163162_10453531 | Ga0163162_104535311 | 189 |
| 624 | 3300013306 | Ga0163162_12497444 | Ga0163162_124974441 | 189 |
| 625 | 3300013307 | Ga0157372_10002978 | Ga0157372_1000297812 | 189 |
| 626 | 3300013307 | Ga0157372_10051584 | Ga0157372_100515843 | 189 |
| 627 | 3300013307 | Ga0157372_10073608 | Ga0157372_100736082 | 189 |
| 628 | 3300013307 | Ga0157372_10092182 | Ga0157372_100921824 | 189 |
| 629 | 3300013307 | Ga0157372_10144797 | Ga0157372_101447972 | 189 |
| 630 | 3300013307 | Ga0157372_10147167 | Ga0157372_101471673 | 189 |
| 631 | 3300013307 | Ga0157372_10201517 | Ga0157372_102015173 | 189 |
| 632 | 3300013307 | Ga0157372_10239550 | Ga0157372_102395502 | 189 |
| 633 | 3300013307 | Ga0157372_10305136 | Ga0157372_103051364 | 189 |
| 634 | 3300013307 | Ga0157372_10388125 | Ga0157372_103881252 | 189 |
| 635 | 3300013307 | Ga0157372_10482550 | Ga0157372_104825502 | 189 |
| 636 | 3300013307 | Ga0157372_10714512 | Ga0157372_107145121 | 189 |
| 637 | 3300013307 | Ga0157372_10902539 | Ga0157372_109025391 | 189 |
| 638 | 3300013308 | Ga0157375_10000073 | Ga0157375_1000007354 | 189 |
| 639 | 3300013308 | Ga0157375_10020587 | Ga0157375_100205872 | 189 |
| 640 | 3300013308 | Ga0157375_10057461 | Ga0157375_100574612 | 189 |
| 641 | 3300013308 | Ga0157375_10131910 | Ga0157375_101319103 | 189 |
| 642 | 3300013308 | Ga0157375_10243220 | Ga0157375_102432202 | 189 |
| 643 | 3300013308 | Ga0157375_10748546 | Ga0157375_107485462 | 189 |
| 644 | 3300014325 | Ga0163163_10396844 | Ga0163163_103968442 | 189 |
| 645 | 3300014325 | Ga0163163_11112991 | Ga0163163_111129911 | 189 |
| 646 | 3300014325 | Ga0163163_11144436 | Ga0163163_111444362 | 189 |
| 647 | 3300014326 | Ga0157380_10030099 | Ga0157380_100300991 | 189 |
| 648 | 3300014326 | Ga0157380_10437181 | Ga0157380_104371812 | 189 |
| 649 | 3300014968 | Ga0157379_10070073 | Ga0157379_100700732 | 189 |
| 650 | 3300014968 | Ga0157379_10185442 | Ga0157379_101854422 | 189 |
| 651 | 3300014968 | Ga0157379_10186973 | Ga0157379_101869732 | 189 |
| 652 | 3300014968 | Ga0157379_10213085 | Ga0157379_102130851 | 189 |
| 653 | 3300014968 | Ga0157379_10778880 | Ga0157379_107788801 | 189 |
| 654 | 3300014968 | Ga0157379_11162181 | Ga0157379_111621811 | 189 |
| 655 | 3300014969 | Ga0157376_10001988 | Ga0157376_1000198812 | 189 |
| 656 | 3300014969 | Ga0157376_10006687 | Ga0157376_100066877 | 189 |
| 657 | 3300014969 | Ga0157376_10144472 | Ga0157376_101444722 | 189 |
| 658 | 3300014969 | Ga0157376_10282659 | Ga0157376_102826592 | 189 |
| 659 | 3300014969 | Ga0157376_10378279 | Ga0157376_103782792 | 189 |
| 660 | 3300017792 | Ga0163161_10019399 | Ga0163161_100193994 | 189 |
| 661 | 3300017792 | Ga0163161_10358962 | Ga0163161_103589622 | 189 |
| 662 | 3300025208 | Ga0209436_100566 | Ga0209436_10056611 | 189 |
| 663 | 3300025242 | Ga0209258_100041 | Ga0209258_10004195 | 189 |
| 664 | 3300025245 | Ga0207425_1015563 | Ga0207425_10155632 | 189 |
| 665 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002171 | 189 |
| 666 | 3300025250 | Ga0209026_1000233 | Ga0209026_10002339 | 189 |
| 667 | 3300025254 | Ga0209148_1000090 | Ga0209148_1000090140 | 189 |
| 668 | 3300025273 | Ga0209673_1000034 | Ga0209673_1000034139 | 189 |
| 669 | 3300025284 | Ga0209130_1001027 | Ga0209130_100102718 | 189 |
| 670 | 3300025295 | Ga0209564_1040205 | Ga0209564_10402052 | 189 |
| 671 | 3300025295 | Ga0209564_1043670 | Ga0209564_10436702 | 189 |
| 672 | 3300025297 | Ga0209758_1000419 | Ga0209758_100041940 | 189 |
| 673 | 3300025297 | Ga0209758_1061714 | Ga0209758_10617142 | 189 |
| 674 | 3300025298 | Ga0209050_1000353 | Ga0209050_100035361 | 189 |
| 675 | 3300025302 | Ga0207426_1000002 | Ga0207426_100000225 | 189 |
| 676 | 3300025302 | Ga0207426_1000177 | Ga0207426_1000177118 | 189 |
| 677 | 3300025302 | Ga0207426_1000324 | Ga0207426_100032420 | 189 |
| 678 | 3300025302 | Ga0207426_1000592 | Ga0207426_100059222 | 189 |
| 679 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011799 | 189 |
| 680 | 3300025304 | Ga0209257_1002086 | Ga0209257_100208621 | 189 |
| 681 | 3300025321 | Ga0207656_10046417 | Ga0207656_100464172 | 189 |
| 682 | 3300025321 | Ga0207656_10405269 | Ga0207656_104052691 | 189 |
| 683 | 3300025893 | Ga0207682_10069708 | Ga0207682_100697082 | 189 |
| 684 | 3300025893 | Ga0207682_10086730 | Ga0207682_100867302 | 189 |
| 685 | 3300025899 | Ga0207642_10040607 | Ga0207642_100406072 | 189 |
| 686 | 3300025903 | Ga0207680_10000067 | Ga0207680_100000675 | 189 |
| 687 | 3300025903 | Ga0207680_10063588 | Ga0207680_100635881 | 189 |
| 688 | 3300025904 | Ga0207647_10000962 | Ga0207647_1000096229 | 189 |
| 689 | 3300025904 | Ga0207647_10070519 | Ga0207647_100705192 | 189 |
| 690 | 3300025904 | Ga0207647_10395305 | Ga0207647_103953051 | 189 |
| 691 | 3300025907 | Ga0207645_10001205 | Ga0207645_1000120516 | 189 |
| 692 | 3300025907 | Ga0207645_10022729 | Ga0207645_100227292 | 189 |
| 693 | 3300025907 | Ga0207645_10655112 | Ga0207645_106551121 | 189 |
| 694 | 3300025908 | Ga0207643_10038079 | Ga0207643_100380793 | 189 |
| 695 | 3300025908 | Ga0207643_10332560 | Ga0207643_103325601 | 189 |
| 696 | 3300025909 | Ga0207705_10001654 | Ga0207705_1000165411 | 189 |
| 697 | 3300025909 | Ga0207705_10087634 | Ga0207705_100876343 | 189 |
| 698 | 3300025909 | Ga0207705_10598273 | Ga0207705_105982732 | 189 |
| 699 | 3300025911 | Ga0207654_10000661 | Ga0207654_1000066112 | 189 |
| 700 | 3300025911 | Ga0207654_10000842 | Ga0207654_1000084212 | 189 |
| 701 | 3300025912 | Ga0207707_10000111 | Ga0207707_1000011143 | 189 |
| 702 | 3300025912 | Ga0207707_10046161 | Ga0207707_100461612 | 189 |
| 703 | 3300025913 | Ga0207695_10035604 | Ga0207695_100356043 | 189 |
| 704 | 3300025914 | Ga0207671_10001776 | Ga0207671_100017762 | 189 |
| 705 | 3300025914 | Ga0207671_10066698 | Ga0207671_100666983 | 189 |
| 706 | 3300025914 | Ga0207671_10297693 | Ga0207671_102976932 | 189 |
| 707 | 3300025914 | Ga0207671_10708656 | Ga0207671_107086561 | 189 |
| 708 | 3300025917 | Ga0207660_10001012 | Ga0207660_100010128 | 189 |
| 709 | 3300025917 | Ga0207660_10008720 | Ga0207660_100087205 | 189 |
| 710 | 3300025919 | Ga0207657_10056435 | Ga0207657_100564352 | 189 |
| 711 | 3300025919 | Ga0207657_10142361 | Ga0207657_101423612 | 189 |
| 712 | 3300025919 | Ga0207657_10527838 | Ga0207657_105278382 | 189 |
| 713 | 3300025920 | Ga0207649_10611983 | Ga0207649_106119831 | 189 |
| 714 | 3300025920 | Ga0207649_10708614 | Ga0207649_107086141 | 189 |
| 715 | 3300025921 | Ga0207652_10000538 | Ga0207652_1000053828 | 189 |
| 716 | 3300025921 | Ga0207652_10000960 | Ga0207652_1000096018 | 189 |
| 717 | 3300025923 | Ga0207681_10009782 | Ga0207681_100097828 | 189 |
| 718 | 3300025923 | Ga0207681_10100892 | Ga0207681_101008923 | 189 |
| 719 | 3300025923 | Ga0207681_10284840 | Ga0207681_102848402 | 189 |
| 720 | 3300025925 | Ga0207650_10523741 | Ga0207650_105237412 | 189 |
| 721 | 3300025926 | Ga0207659_10181728 | Ga0207659_101817282 | 189 |
| 722 | 3300025926 | Ga0207659_10305760 | Ga0207659_103057602 | 189 |
| 723 | 3300025931 | Ga0207644_10024795 | Ga0207644_100247955 | 189 |
| 724 | 3300025931 | Ga0207644_10451404 | Ga0207644_104514041 | 189 |
| 725 | 3300025931 | Ga0207644_10453883 | Ga0207644_104538832 | 189 |
| 726 | 3300025932 | Ga0207690_10014400 | Ga0207690_100144002 | 189 |
| 727 | 3300025932 | Ga0207690_10581579 | Ga0207690_105815792 | 189 |
| 728 | 3300025934 | Ga0207686_10017723 | Ga0207686_100177235 | 189 |
| 729 | 3300025935 | Ga0207709_10425454 | Ga0207709_104254541 | 189 |
| 730 | 3300025935 | Ga0207709_10516807 | Ga0207709_105168071 | 189 |
| 731 | 3300025936 | Ga0207670_10480635 | Ga0207670_104806352 | 189 |
| 732 | 3300025937 | Ga0207669_10532252 | Ga0207669_105322521 | 189 |
| 733 | 3300025937 | Ga0207669_10801201 | Ga0207669_108012012 | 189 |
| 734 | 3300025938 | Ga0207704_10008049 | Ga0207704_100080496 | 189 |
| 735 | 3300025938 | Ga0207704_10011913 | Ga0207704_100119135 | 189 |
| 736 | 3300025938 | Ga0207704_10354387 | Ga0207704_103543871 | 189 |
| 737 | 3300025940 | Ga0207691_10062073 | Ga0207691_100620733 | 189 |
| 738 | 3300025940 | Ga0207691_10087508 | Ga0207691_100875082 | 189 |
| 739 | 3300025940 | Ga0207691_10445948 | Ga0207691_104459482 | 189 |
| 740 | 3300025940 | Ga0207691_10451683 | Ga0207691_104516831 | 189 |
| 741 | 3300025941 | Ga0207711_10035102 | Ga0207711_100351026 | 189 |
| 742 | 3300025942 | Ga0207689_10002959 | Ga0207689_100029594 | 189 |
| 743 | 3300025942 | Ga0207689_10005262 | Ga0207689_100052628 | 189 |
| 744 | 3300025942 | Ga0207689_10074987 | Ga0207689_100749873 | 189 |
| 745 | 3300025942 | Ga0207689_10137046 | Ga0207689_101370463 | 189 |
| 746 | 3300025944 | Ga0207661_10563327 | Ga0207661_105633272 | 189 |
| 747 | 3300025949 | Ga0207667_10010209 | Ga0207667_100102095 | 189 |
| 748 | 3300025949 | Ga0207667_11044148 | Ga0207667_110441482 | 189 |
| 749 | 3300025960 | Ga0207651_10551469 | Ga0207651_105514691 | 189 |
| 750 | 3300025960 | Ga0207651_10679689 | Ga0207651_106796891 | 189 |
| 751 | 3300025961 | Ga0207712_10125385 | Ga0207712_101253853 | 189 |
| 752 | 3300025972 | Ga0207668_10026438 | Ga0207668_100264384 | 189 |
| 753 | 3300025972 | Ga0207668_10156325 | Ga0207668_101563252 | 189 |
| 754 | 3300025981 | Ga0207640_10027653 | Ga0207640_100276532 | 189 |
| 755 | 3300025981 | Ga0207640_10059835 | Ga0207640_100598353 | 189 |
| 756 | 3300025981 | Ga0207640_10130167 | Ga0207640_101301672 | 189 |
| 757 | 3300025986 | Ga0207658_10005017 | Ga0207658_100050175 | 189 |
| 758 | 3300025986 | Ga0207658_10115803 | Ga0207658_101158033 | 189 |
| 759 | 3300025986 | Ga0207658_11129000 | Ga0207658_111290001 | 189 |
| 760 | 3300026023 | Ga0207677_10005993 | Ga0207677_100059935 | 189 |
| 761 | 3300026023 | Ga0207677_10056615 | Ga0207677_100566153 | 189 |
| 762 | 3300026023 | Ga0207677_10081379 | Ga0207677_100813791 | 189 |
| 763 | 3300026035 | Ga0207703_10017680 | Ga0207703_100176806 | 189 |
| 764 | 3300026035 | Ga0207703_10395002 | Ga0207703_103950022 | 189 |
| 765 | 3300026041 | Ga0207639_10070159 | Ga0207639_100701593 | 189 |
| 766 | 3300026041 | Ga0207639_10073596 | Ga0207639_100735962 | 189 |
| 767 | 3300026041 | Ga0207639_10814362 | Ga0207639_108143622 | 189 |
| 768 | 3300026067 | Ga0207678_10025947 | Ga0207678_100259472 | 189 |
| 769 | 3300026067 | Ga0207678_10145829 | Ga0207678_101458292 | 189 |
| 770 | 3300026067 | Ga0207678_10195723 | Ga0207678_101957231 | 189 |
| 771 | 3300026075 | Ga0207708_10560726 | Ga0207708_105607262 | 189 |
| 772 | 3300026078 | Ga0207702_10241282 | Ga0207702_102412822 | 189 |
| 773 | 3300026088 | Ga0207641_10000090 | Ga0207641_1000009022 | 189 |
| 774 | 3300026088 | Ga0207641_10018040 | Ga0207641_100180402 | 189 |
| 775 | 3300026088 | Ga0207641_10175968 | Ga0207641_101759682 | 189 |
| 776 | 3300026089 | Ga0207648_10000653 | Ga0207648_1000065319 | 189 |
| 777 | 3300026089 | Ga0207648_10039157 | Ga0207648_100391572 | 189 |
| 778 | 3300026089 | Ga0207648_10129072 | Ga0207648_101290722 | 189 |
| 779 | 3300026089 | Ga0207648_10430457 | Ga0207648_104304571 | 189 |
| 780 | 3300026095 | Ga0207676_11347755 | Ga0207676_113477551 | 189 |
| 781 | 3300026116 | Ga0207674_10165009 | Ga0207674_101650093 | 189 |
| 782 | 3300026118 | Ga0207675_100008836 | Ga0207675_1000088363 | 189 |
| 783 | 3300026118 | Ga0207675_100081577 | Ga0207675_1000815772 | 189 |
| 784 | 3300026118 | Ga0207675_100879105 | Ga0207675_1008791051 | 189 |
| 785 | 3300026121 | Ga0207683_10048943 | Ga0207683_100489432 | 189 |
| 786 | 3300026121 | Ga0207683_10093220 | Ga0207683_100932203 | 189 |
| 787 | 3300026142 | Ga0207698_10011126 | Ga0207698_100111263 | 189 |
| 788 | 3300026142 | Ga0207698_10373847 | Ga0207698_103738471 | 189 |
| 789 | 3300028379 | Ga0268266_10295182 | Ga0268266_102951821 | 189 |
| 790 | 3300028380 | Ga0268265_10166956 | Ga0268265_101669563 | 189 |
| 791 | 3300028381 | Ga0268264_10002720 | Ga0268264_100027205 | 189 |
| 792 | 3300028381 | Ga0268264_10007598 | Ga0268264_100075989 | 189 |
| 793 | 3300028381 | Ga0268264_10033282 | Ga0268264_100332823 | 189 |
| 794 | 3300028381 | Ga0268264_10065820 | Ga0268264_100658202 | 189 |
| 795 | 3300028381 | Ga0268264_10157870 | Ga0268264_101578702 | 189 |
| 796 | 3300028381 | Ga0268264_10487970 | Ga0268264_104879701 | 189 |
| 797 | 3300028786 | Ga0307517_10000697 | Ga0307517_1000069743 | 189 |
| 798 | 3300028794 | Ga0307515_10000078 | Ga0307515_10000078174 | 189 |
| 799 | 3300030521 | Ga0307511_10001896 | Ga0307511_100018962 | 189 |
| 800 | 3300031251 | Ga0265327_10045037 | Ga0265327_100450373 | 189 |
| 801 | 3300031507 | Ga0307509_10123147 | Ga0307509_101231473 | 189 |
| 802 | 3300031616 | Ga0307508_10266838 | Ga0307508_102668382 | 189 |
| 803 | 3300031616 | Ga0307508_10346038 | Ga0307508_103460382 | 189 |
| 804 | 3300031824 | Ga0307413_10292765 | Ga0307413_102927652 | 189 |
| 805 | 3300031824 | Ga0307413_10356087 | Ga0307413_103560872 | 189 |
| 806 | 3300031852 | Ga0307410_10490665 | Ga0307410_104906651 | 189 |
| 807 | 3300031901 | Ga0307406_10642526 | Ga0307406_106425262 | 189 |
| 808 | 3300031903 | Ga0307407_10388672 | Ga0307407_103886721 | 189 |
| 809 | 3300031911 | Ga0307412_10466060 | Ga0307412_104660602 | 189 |
| 810 | 3300032002 | Ga0307416_100672015 | Ga0307416_1006720152 | 189 |
| 811 | 3300032004 | Ga0307414_10374474 | Ga0307414_103744741 | 189 |
| 812 | 3300032004 | Ga0307414_10870488 | Ga0307414_108704882 | 189 |
| 813 | 3300032005 | Ga0307411_10050097 | Ga0307411_100500971 | 189 |
| 814 | 3300032005 | Ga0307411_11275172 | Ga0307411_112751721 | 189 |
| 815 | 3300032126 | Ga0307415_100132561 | Ga0307415_1001325613 | 189 |
| 816 | 3300035172 | Ga0373955_0241292 | Ga0373955_0241292_230_814 | 189 |
| 817 | 3300035695 | Ga0373927_0100179 | Ga0373927_0100179_75_644 | 189 |
| 818 | 3300035724 | Ga0373933_0136478 | Ga0373933_0136478_79_663 | 189 |
| 819 | 3300036401 | Ga0373937_0139076 | Ga0373937_0139076_1442_2026 | 189 |
| 820 | 3300037312 | Ga0395899_0014889 | Ga0395899_0014889_3240_3830 | 189 |
| 821 | 3300037418 | Ga0395900_0016890 | Ga0395900_0016890_6708_7298 | 189 |
| 822 | 3300037418 | Ga0395900_0182795 | Ga0395900_0182795_1497_2066 | 189 |
| 823 | 3300037418 | Ga0395900_0525978 | Ga0395900_0525978_352_942 | 189 |
| 824 | 3300037418 | Ga0395900_0550511 | Ga0395900_0550511_242_820 | 189 |
| 825 | 3300037466 | Ga0395898_0112161 | Ga0395898_0112161_262_852 | 189 |
| 826 | 3300037471 | Ga0395905_0001861 | Ga0395905_0001861_19_597 | 189 |
| 827 | 3300037471 | Ga0395905_0065531 | Ga0395905_0065531_715_1293 | 189 |
| 828 | 3300038443 | Ga0395901_0089556 | Ga0395901_0089556_2248_2838 | 189 |
| 829 | 3300038443 | Ga0395901_0103349 | Ga0395901_0103349_100_678 | 189 |
| 830 | 3300039437 | Ga0436365_0289942 | Ga0436365_0289942_300_875 | 189 |
| 831 | 3300041404 | Ga0439436_0048147 | Ga0439436_0048147_389_961 | 189 |
| 832 | 3300041406 | Ga0439439_0051855 | Ga0439439_0051855_49_627 | 189 |
| 833 | 3300041441 | Ga0451787_202726 | Ga0451787_202726_13_594 | 189 |
| 834 | 3300041460 | Ga0451802_1082803 | Ga0451802_1082803_85_654 | 189 |
| 835 | 3300041463 | Ga0451804_0420865 | Ga0451804_0420865_54_635 | 189 |
| 836 | 3300041486 | Ga0451807_2236118 | Ga0451807_2236118_273_842 | 189 |
| 837 | 3300041505 | Ga0451849_0258145 | Ga0451849_0258145_106_675 | 189 |
| 838 | 3300041512 | Ga0451853_0569222 | Ga0451853_0569222_13_609 | 189 |
| 839 | 3300041512 | Ga0451853_1768614 | Ga0451853_1768614_266_838 | 189 |
| 840 | 3300041512 | Ga0451853_3831587 | Ga0451853_3831587_216_785 | 189 |
| 841 | 3300041997 | Ga0439431_0017465 | Ga0439431_0017465_567_1139 | 189 |
| 842 | 3300042007 | Ga0439449_0004710 | Ga0439449_0004710_1076_1654 | 189 |
| 843 | 3300042007 | Ga0439449_0138673 | Ga0439449_0138673_199_771 | 189 |
| 844 | 3300042007 | Ga0439449_0185269 | Ga0439449_0185269_60_629 | 189 |
| 845 | 3300042014 | Ga0439457_009584 | Ga0439457_009584_1659_2234 | 189 |
| 846 | 3300042014 | Ga0439457_023623 | Ga0439457_023623_751_1329 | 189 |
| 847 | 3300042014 | Ga0439457_037992 | Ga0439457_037992_105_677 | 189 |
| 848 | 3300042015 | Ga0439462_0011206 | Ga0439462_0011206_1025_1603 | 189 |
| 849 | 3300042876 | Ga0451577_0025828 | Ga0451577_0025828_3864_4436 | 189 |
| 850 | 3300044656 | Ga0466969_0000754 | Ga0466969_0000754_1664_2233 | 189 |
| 851 | 3300044658 | Ga0466972_0004958 | Ga0466972_0004958_6062_6670 | 189 |
| 852 | 3300044684 | Ga0466966_0000030 | Ga0466966_0000030_28691_29260 | 189 |
| 853 | 3300044719 | Ga0466971_0053325 | Ga0466971_0053325_74_646 | 189 |
| 854 | 3300044735 | Ga0466968_0458851 | Ga0466968_0458851_30_599 | 189 |
| 855 | 3300044842 | Ga0466957_0009182 | Ga0466957_0009182_3887_4459 | 189 |
| 856 | 3300044842 | Ga0466957_0011478 | Ga0466957_0011478_1234_1842 | 189 |
| 857 | 3300045049 | Ga0466959_0000269 | Ga0466959_0000269_4154_4723 | 189 |
| 858 | 3300045049 | Ga0466959_0045485 | Ga0466959_0045485_93_662 | 189 |
| 859 | 3300046462 | Ga0495651_0130068 | Ga0495651_0130068_1042_1626 | 189 |
| 860 | 3300046471 | Ga0495650_0115811 | Ga0495650_0115811_275_844 | 189 |
| 861 | 3300046472 | Ga0495580_0038332 | Ga0495580_0038332_295_879 | 189 |
| 862 | 3300046472 | Ga0495580_0112467 | Ga0495580_0112467_253_831 | 189 |
| 863 | 3300046473 | Ga0495582_0088992 | Ga0495582_0088992_916_1500 | 189 |
| 864 | 3300046477 | Ga0495664_0341061 | Ga0495664_0341061_65_649 | 189 |
| 865 | 3300046517 | Ga0495630_0247352 | Ga0495630_0247352_181_765 | 189 |
| 866 | 3300046517 | Ga0495630_0252397 | Ga0495630_0252397_292_870 | 189 |
| 867 | 3300046531 | Ga0495665_0187618 | Ga0495665_0187618_352_936 | 189 |
| 868 | 3300046535 | Ga0495586_0145441 | Ga0495586_0145441_540_1124 | 189 |
| 869 | 3300046536 | Ga0495587_0260229 | Ga0495587_0260229_138_722 | 189 |
| 870 | 3300046557 | Ga0495622_0374054 | Ga0495622_0374054_20_589 | 189 |
| 871 | 3300046616 | Ga0495668_0005589 | Ga0495668_0005589_4844_5413 | 189 |
| 872 | 3300046642 | Ga0495634_0115218 | Ga0495634_0115218_1040_1624 | 189 |
| 873 | 3300046660 | Ga0495625_0475451 | Ga0495625_0475451_173_742 | 189 |
| 874 | 3300046679 | Ga0495623_0264615 | Ga0495623_0264615_213_797 | 189 |
| 875 | 3300046681 | Ga0495647_0237843 | Ga0495647_0237843_40_618 | 189 |
| 876 | 3300046683 | Ga0495658_0042870 | Ga0495658_0042870_1508_2092 | 189 |
| 877 | 3300046690 | Ga0495624_0610335 | Ga0495624_0610335_14_592 | 189 |
| 878 | 3300047317 | Ga0495604_0220578 | Ga0495604_0220578_55_639 | 189 |
| 879 | 3300047321 | Ga0495676_0387687 | Ga0495676_0387687_96_680 | 189 |
| 880 | 3300047445 | Ga0495677_0194934 | Ga0495677_0194934_126_704 | 189 |
| 881 | 3300048904 | Ga0496101_0546953 | Ga0496101_0546953_116_688 | 189 |
| 882 | 3300048908 | Ga0496105_0099960 | Ga0496105_0099960_875_1453 | 189 |
| 883 | 3300048921 | Ga0496118_0278248 | Ga0496118_0278248_34_642 | 189 |
| 884 | 3300048929 | Ga0496126_0047240 | Ga0496126_0047240_1456_2028 | 189 |
| 885 | 3300049521 | Ga0501298_000289 | Ga0501298_000289_188_766 | 189 |
| 886 | 3300049522 | Ga0501299_032352 | Ga0501299_032352_245_823 | 189 |
| 887 | 3300049568 | Ga0501031_0142009 | Ga0501031_0142009_289_861 | 189 |
| 888 | 3300049571 | Ga0501034_0305168 | Ga0501034_0305168_259_831 | 189 |
| 889 | 3300049571 | Ga0501034_0455430 | Ga0501034_0455430_271_840 | 189 |
| 890 | 3300049571 | Ga0501034_0710319 | Ga0501034_0710319_272_880 | 189 |
| 891 | 3300049572 | Ga0501036_0003520 | Ga0501036_0003520_1703_2275 | 189 |
| 892 | 3300049573 | Ga0501037_0008893 | Ga0501037_0008893_2190_2762 | 189 |
| 893 | 3300049573 | Ga0501037_0214124 | Ga0501037_0214124_128_697 | 189 |
| 894 | 3300049574 | Ga0501038_0009081 | Ga0501038_0009081_2951_3523 | 189 |
| 895 | 3300049574 | Ga0501038_0655038 | Ga0501038_0655038_110_685 | 189 |
| 896 | 3300049575 | Ga0501039_0011833 | Ga0501039_0011833_5861_6433 | 189 |
| 897 | 3300049575 | Ga0501039_0600173 | Ga0501039_0600173_60_632 | 189 |
| 898 | 3300049579 | Ga0501043_0018866 | Ga0501043_0018866_1801_2373 | 189 |
| 899 | 3300049580 | Ga0501046_0026580 | Ga0501046_0026580_2095_2667 | 189 |
| 900 | 3300049581 | Ga0501047_0030087 | Ga0501047_0030087_818_1387 | 189 |
| 901 | 3300049581 | Ga0501047_0687940 | Ga0501047_0687940_76_648 | 189 |
| 902 | 3300049582 | Ga0501048_0079968 | Ga0501048_0079968_821_1399 | 189 |
| 903 | 3300049583 | Ga0501067_0149864 | Ga0501067_0149864_584_1162 | 189 |
| 904 | 3300049584 | Ga0501068_0028446 | Ga0501068_0028446_820_1398 | 189 |
| 905 | 3300049586 | Ga0501070_0057509 | Ga0501070_0057509_423_1001 | 189 |
| 906 | 3300049587 | Ga0501071_0107006 | Ga0501071_0107006_433_1011 | 189 |
| 907 | 3300049589 | Ga0501073_0054158 | Ga0501073_0054158_584_1162 | 189 |
| 908 | 3300049589 | Ga0501073_0736801 | Ga0501073_0736801_84_659 | 189 |
| 909 | 3300049590 | Ga0501074_0024502 | Ga0501074_0024502_3511_4089 | 189 |
| 910 | 3300049649 | Ga0501198_021314 | Ga0501198_021314_385_963 | 189 |
| 911 | 3300049651 | Ga0501201_021143 | Ga0501201_021143_102_680 | 189 |
| 912 | 3300049652 | Ga0501202_000865 | Ga0501202_000865_1127_1705 | 189 |
| 913 | 3300049652 | Ga0501202_006743 | Ga0501202_006743_1009_1587 | 189 |
| 914 | 3300049652 | Ga0501202_051768 | Ga0501202_051768_88_666 | 189 |
| 915 | 3300049654 | Ga0501207_002781 | Ga0501207_002781_58_636 | 189 |
| 916 | 3300049654 | Ga0501207_021214 | Ga0501207_021214_118_690 | 189 |
| 917 | 3300049655 | Ga0501208_008248 | Ga0501208_008248_107_685 | 189 |
| 918 | 3300049661 | Ga0501217_002224 | Ga0501217_002224_1262_1840 | 189 |
| 919 | 3300049661 | Ga0501217_032587 | Ga0501217_032587_129_707 | 189 |
| 920 | 3300049662 | Ga0501222_000982 | Ga0501222_000982_3013_3591 | 189 |
| 921 | 3300049663 | Ga0501223_000157 | Ga0501223_000157_15591_16169 | 189 |
| 922 | 3300049664 | Ga0501224_000664 | Ga0501224_000664_634_1212 | 189 |
| 923 | 3300049666 | Ga0501228_010121 | Ga0501228_010121_325_903 | 189 |
| 924 | 3300049668 | Ga0501233_000669 | Ga0501233_000669_4597_5175 | 189 |
| 925 | 3300049669 | Ga0501235_000828 | Ga0501235_000828_4444_5022 | 189 |
| 926 | 3300049673 | Ga0501240_002622 | Ga0501240_002622_975_1553 | 189 |
| 927 | 3300049674 | Ga0501242_005934 | Ga0501242_005934_617_1195 | 189 |
| 928 | 3300049675 | Ga0501243_000215 | Ga0501243_000215_6449_7027 | 189 |
| 929 | 3300049680 | Ga0501250_006524 | Ga0501250_006524_592_1170 | 189 |
| 930 | 3300049680 | Ga0501250_007292 | Ga0501250_007292_123_701 | 189 |
| 931 | 3300049682 | Ga0501252_000578 | Ga0501252_000578_1675_2253 | 189 |
| 932 | 3300049683 | Ga0501253_000895 | Ga0501253_000895_946_1524 | 189 |
| 933 | 3300049686 | Ga0501257_004810 | Ga0501257_004810_2024_2596 | 189 |
| 934 | 3300049688 | Ga0501259_000181 | Ga0501259_000181_4889_5467 | 189 |
| 935 | 3300049688 | Ga0501259_002966 | Ga0501259_002966_392_970 | 189 |
| 936 | 3300049688 | Ga0501259_071355 | Ga0501259_071355_98_676 | 189 |
| 937 | 3300049690 | Ga0501261_005649 | Ga0501261_005649_922_1500 | 189 |
| 938 | 3300049690 | Ga0501261_050559 | Ga0501261_050559_53_631 | 189 |
| 939 | 3300049703 | Ga0501219_000812 | Ga0501219_000812_2109_2678 | 189 |
| 940 | 3300049704 | Ga0501221_000080 | Ga0501221_000080_4628_5206 | 189 |
| 941 | 3300049705 | Ga0501225_0001083 | Ga0501225_0001083_7248_7826 | 189 |
| 942 | 3300049705 | Ga0501225_0002530 | Ga0501225_0002530_2076_2648 | 189 |
| 943 | 3300049705 | Ga0501225_0007474 | Ga0501225_0007474_1638_2207 | 189 |
| 944 | 3300049707 | Ga0501234_000581 | Ga0501234_000581_966_1544 | 189 |
| 945 | 3300049708 | Ga0501245_000311 | Ga0501245_000311_3901_4479 | 189 |
| 946 | 3300049708 | Ga0501245_003557 | Ga0501245_003557_710_1288 | 189 |
| 947 | 3300049741 | Ga0501079_0076381 | Ga0501079_0076381_1126_1704 | 189 |
| 948 | 3300049742 | Ga0501080_0039984 | Ga0501080_0039984_801_1379 | 189 |
| 949 | 3300049742 | Ga0501080_0513414 | Ga0501080_0513414_443_1015 | 189 |
| 950 | 3300049744 | Ga0501083_0174751 | Ga0501083_0174751_629_1207 | 189 |
| 951 | 3300049757 | Ga0501232_010289 | Ga0501232_010289_109_687 | 189 |
| 952 | 3300049758 | Ga0501241_001105 | Ga0501241_001105_839_1408 | 189 |
| 953 | 3300049758 | Ga0501241_004302 | Ga0501241_004302_760_1332 | 189 |
| 954 | 3300049758 | Ga0501241_043990 | Ga0501241_043990_95_673 | 189 |
| 955 | 3300049763 | Ga0501266_005705 | Ga0501266_005705_756_1334 | 189 |
| 956 | 3300049765 | Ga0501268_052523 | Ga0501268_052523_94_672 | 189 |
| 957 | 3300049768 | Ga0501271_012917 | Ga0501271_012917_301_879 | 189 |
| 958 | 3300049774 | Ga0501278_009862 | Ga0501278_009862_125_703 | 189 |
| 959 | 3300049823 | Ga0501044_0006136 | Ga0501044_0006136_7131_7703 | 189 |
| 960 | 3300049823 | Ga0501044_0019334 | Ga0501044_0019334_5438_6046 | 189 |
| 961 | 3300049823 | Ga0501044_0038980 | Ga0501044_0038980_2992_3567 | 189 |
| 962 | 3300049823 | Ga0501044_0099172 | Ga0501044_0099172_39_617 | 189 |
| 963 | 3300049823 | Ga0501044_0512092 | Ga0501044_0512092_332_904 | 189 |
| 964 | 3300049824 | Ga0501045_0375742 | Ga0501045_0375742_410_982 | 189 |
| 965 | 3300049851 | Ga0501212_036903 | Ga0501212_036903_71_649 | 189 |
| 966 | 3300050005 | Ga0501284_00105 | Ga0501284_00105_14618_15187 | 189 |
| 967 | 3300050493 | nmdc:mga0k408_162047_c1 | nmdc:mga0k408_162047_c1_539_1108 | 189 |
| 968 | 3300050493 | nmdc:mga0k408_40690_c1 | nmdc:mga0k408_40690_c1_1441_2010 | 189 |
| 969 | 3300050508 | nmdc:mga09592_12177_c1 | nmdc:mga09592_12177_c1_472_1056 | 189 |
| 970 | 3300050515 | nmdc:mga0a205_923055_c1 | nmdc:mga0a205_923055_c1_20_592 | 189 |
| 971 | 3300053085 | Ga0495619_0125939 | Ga0495619_0125939_282_866 | 189 |
| 972 | 3300053086 | Ga0500578_0000120 | Ga0500578_0000120_22271_22840 | 189 |
| 973 | 3300053088 | Ga0500644_0129574 | Ga0500644_0129574_281_853 | 189 |
| 974 | 3300053090 | Ga0500646_0010270 | Ga0500646_0010270_885_1454 | 189 |
| 975 | 3300053092 | Ga0500583_0012437 | Ga0500583_0012437_1268_1837 | 189 |
| 976 | 3300053093 | Ga0500651_0438006 | Ga0500651_0438006_32_601 | 189 |
| 977 | 3300053098 | Ga0500650_0078790 | Ga0500650_0078790_262_837 | 189 |
| 978 | 3300053109 | Ga0500569_000517 | Ga0500569_000517_3097_3666 | 189 |
| 979 | 3300053131 | Ga0500652_083867 | Ga0500652_083867_377_958 | 189 |
| 980 | 3300053136 | Ga0500559_0003554 | Ga0500559_0003554_4566_5135 | 189 |
| 981 | 3300053139 | Ga0500568_0083274 | Ga0500568_0083274_91_672 | 189 |
| 982 | 3300053142 | Ga0500577_0005167 | Ga0500577_0005167_2274_2843 | 189 |
| 983 | 3300053147 | Ga0500589_053266 | Ga0500589_053266_856_1425 | 189 |
| 984 | 3300053153 | Ga0500616_0003236 | Ga0500616_0003236_9057_9626 | 189 |
| 985 | 3300053153 | Ga0500616_0025280 | Ga0500616_0025280_2178_2747 | 189 |
| 986 | 3300053156 | Ga0500622_0001475 | Ga0500622_0001475_9834_10406 | 189 |
| 987 | 3300053158 | Ga0500627_0194614 | Ga0500627_0194614_309_884 | 189 |
| 988 | 3300053160 | Ga0500633_0043943 | Ga0500633_0043943_757_1326 | 189 |
| 989 | 3300053161 | Ga0500634_0090702 | Ga0500634_0090702_223_792 | 189 |
| 990 | 3300053177 | Ga0500636_0007397 | Ga0500636_0007397_4367_4936 | 189 |
| 991 | 3300053727 | Ga0500611_067885 | Ga0500611_067885_273_842 | 189 |
| 992 | 3300055283 | Ga0500661_016479 | Ga0500661_016479_192_761 | 189 |
| 993 | 3300060353 | Ga0501082_0099557 | Ga0501082_0099557_51_629 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpo-assembly1.cif.gz_D | thermotoga maritima thymidine kinase in the apo form | 0.8788 | 13 | 189 |
| 2qpo-assembly1.cif.gz_D | thermotoga maritima thymidine kinase in the apo form | 0.8678 | 13 | 189 |
| 2orw-assembly1.cif.gz_A-2 | thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a | 0.8596 | 13 | 189 |
| 1w4r-assembly2.cif.gz_E | structure of a type ii thymidine kinase with bound dttp | 0.8579 | 12 | 186 |
| 1xbt-assembly2.cif.gz_H | crystal structure of human thymidine kinase 1 | 0.8565 | 12 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wvjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9618 | 12 | 145 | 3.40.50.300 |
| 2wvjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.954 | 12 | 145 | 3.40.50.300 |
| af_P27158_18_121_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9491 | 12 | 117 | 3.40.50.300 |
| af_P27158_18_121_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9404 | 12 | 117 | 3.40.50.300 |
| 2qpoC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9335 | 13 | 144 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y2T0V1-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9644 | 11 | 150 |
GO:0004797
GO:0005524 GO:0046104 GO:0071897 |
| AF-X1JNW3-F1-model_v4 | thymidine kinase (EC 2.7.1.21) | 0.9565 | 29 | 140 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A2M8KSR6-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9497 | 12 | 145 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-K1V128-F1-model_v4 | thymidine kinase (EC 2.7.1.21) | 0.9456 | 5 | 158 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A357HGB1-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9435 | 8 | 157 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar