F487669

General Info

Members Datasets Scaffolds Average Seq Length
992 373 953 372

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0010962|Ga0496105_0010962_522_1787
Length 421
Sequence LLPAALADPHNQPAPESPARPLISPVTSPRHLPNRAAFPYPPAMPAPAIQSLADLGDATRAPRIVIKVGSALLVDATGARRAWLAALVAELAQARARGQQVIVVSSGAIALGARKLGLEKGGRASLADAQAAAAVGQIALSGLWAELLEAHGLTAAQLLLTLDDLEDRRRYLNATATLTRLLDAGAVPVINENDSVATQEIRFGDNDRLAARIAQAARASAVVLLSDIDGLYDRHPSDPGAKRLPLVKAITPEIRAMASPVSGSGMGSGGMISKLQAAEIAQLAGIALAIGNGHVEAPLARIAAGEGTLFPARQRTAARKAWLGGRLRLKGELVVDQGAAVALANGSSLLARGITASSGQFHRGDAVAIRNQAGETLAHGLAEYDAAECALLIGRHSSEHADLLGYAPRPAIVHRDQLVLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
12 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
13 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
14 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
15 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
16 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
17 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
18 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
19 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
20 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
21 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
22 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
23 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
24 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
25 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
26 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
27 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
28 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
29 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
30 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
31 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
32 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
33 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
34 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
35 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
36 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
37 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
38 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
39 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
40 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
41 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
42 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
47 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
48 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
49 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
50 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
51 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
52 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
53 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
319 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
320 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
321 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
326 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
327 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
330 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
331 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
349 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
350 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
351 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
352 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
353 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
359 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
368 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
369 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
370 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
373 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 11.49
Nodule 0.2
Rhizoplane 4.94
Rhizosphere 72.08
Stem 0
Stem Tuber 0
Unclassified 11.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2235436 2162886007 Bacteria 72815
2 JGI24736J21556_1000256 3300001904 Bacteria 9743
3 JGI24741J21665_1001032 3300001915 Bacteria 8381
4 JGI24741J21665_1001215 3300001915 Bacteria 7580
5 JGI24752J21851_1000062 3300001976 Bacteria 13721
6 JGI24752J21851_1001369 3300001976 Bacteria 3295
7 JGI24752J21851_1007004 3300001976 Bacteria 1473
8 JGI24740J21852_10000540 3300001979 Bacteria 16192
9 JGI24740J21852_10005886 3300001979 Bacteria 5139
10 JGI24740J21852_10011274 3300001979 Bacteria 3408
11 JGI24739J22299_10001027 3300001989 Bacteria 10334
12 JGI24739J22299_10003942 3300001989 Bacteria 5678
13 JGI24739J22299_10004578 3300001989 Bacteria 5287
14 JGI24737J22298_10002455 3300001990 Bacteria 6602
15 JGI24737J22298_10004191 3300001990 Bacteria 5041
16 JGI24735J21928_10000861 3300002067 Bacteria 10803
17 JGI24735J21928_10003084 3300002067 Bacteria 5704
18 JGI24750J21931_1000036 3300002070 Bacteria 18006
19 JGI24748J21848_1000103 3300002074 Bacteria 18872
20 JGI24738J21930_10001565 3300002075 Bacteria 6314
21 JGI24749J21850_1000087 3300002076 Bacteria 16750
22 JGI24034J26672_10000057 3300002239 Bacteria 42515
23 JGI24742J22300_10004425 3300002244 Bacteria 2300
24 JGI24751J29686_10000054 3300002459 Bacteria 65209
25 JGI24751J29686_10000140 3300002459 Bacteria 35958
26 JGI25165J46597_1000012 3300003214 Bacteria 421074
27 JGI25153J46596_10000005 3300003215 Bacteria 492839
28 Ga0055525_1000012 3300003759 Bacteria 486564
29 Ga0055542_1000355 3300003762 Bacteria 48043
30 Ga0055529_1000045 3300003763 Bacteria 209617
31 Ga0065165_1004400 3300005262 Bacteria 8781
32 Ga0065704_10001493 3300005289 Bacteria 12929
33 Ga0065704_10007473 3300005289 Bacteria 6245
34 Ga0065704_10070176 3300005289 Bacteria 138803
35 Ga0065704_10105609 3300005289 Bacteria 2101
36 Ga0065707_10083253 3300005295 Bacteria 9789
37 Ga0070658_10000067 3300005327 Bacteria 103026
38 Ga0070658_10001571 3300005327 Bacteria 19350
39 Ga0070658_10032881 3300005327 Bacteria 4171
40 Ga0070658_10032902 3300005327 Bacteria 4169
41 Ga0070658_10105365 3300005327 Bacteria 2333
42 Ga0070683_100170222 3300005329 Bacteria 2068
43 Ga0070683_100172906 3300005329 Bacteria 2051
44 Ga0070690_100000011 3300005330 Bacteria 95472
45 Ga0070690_100046244 3300005330 Bacteria 2767
46 Ga0070670_100000003 3300005331 Bacteria 529510
47 Ga0070670_100000210 3300005331 Bacteria 54177
48 Ga0070670_100000965 3300005331 Bacteria 22582
49 Ga0070670_100009509 3300005331 Bacteria 8297
50 Ga0070670_100018785 3300005331 Bacteria 5926
51 Ga0070670_100190597 3300005331 Bacteria 1781
52 Ga0070670_100240614 3300005331 Bacteria 1576
53 Ga0070666_10000035 3300005335 Bacteria 121458
54 Ga0070666_10000089 3300005335 Bacteria 64147
55 Ga0070666_10013840 3300005335 Bacteria 5127
56 Ga0070666_10036618 3300005335 Bacteria 3259
57 Ga0070666_10158615 3300005335 Bacteria 1581
58 Ga0070666_10198050 3300005335 Bacteria 1413
59 Ga0070680_100011845 3300005336 Bacteria 6763
60 Ga0070660_100075680 3300005339 Bacteria 2636
61 Ga0070660_100148168 3300005339 Bacteria 1886
62 Ga0070689_100002742 3300005340 Bacteria 11551
63 Ga0070661_100011173 3300005344 Bacteria 6255
64 Ga0070668_100000003 3300005347 Bacteria 195738
65 Ga0070668_100000014 3300005347 Bacteria 112374
66 Ga0070668_100003251 3300005347 Bacteria 11982
67 Ga0070668_100007280 3300005347 Bacteria 8209
68 Ga0070668_100042436 3300005347 Bacteria 3487
69 Ga0070669_100000020 3300005353 Bacteria 181297
70 Ga0070669_100000024 3300005353 Bacteria 173107
71 Ga0070669_100000334 3300005353 Bacteria 36683
72 Ga0070669_100000473 3300005353 Bacteria 30554
73 Ga0070669_100000712 3300005353 Bacteria 24397
74 Ga0070669_100002131 3300005353 Bacteria 14306
75 Ga0070669_100003995 3300005353 Bacteria 10660
76 Ga0070669_100024149 3300005353 Bacteria 4357
77 Ga0070669_100034312 3300005353 Bacteria 3673
78 Ga0070669_100050393 3300005353 Bacteria 3041
79 Ga0070669_100157764 3300005353 Bacteria 1761
80 Ga0070671_100000006 3300005355 Bacteria 250635
81 Ga0070671_100000138 3300005355 Bacteria 46941
82 Ga0070671_100000435 3300005355 Bacteria 28993
83 Ga0070671_100000542 3300005355 Bacteria 26647
84 Ga0070671_100002625 3300005355 Bacteria 13916
85 Ga0070671_100039115 3300005355 Bacteria 3937
86 Ga0070671_100210640 3300005355 Bacteria 1648
87 Ga0070674_100011307 3300005356 Bacteria 5430
88 Ga0070688_100001328 3300005365 Bacteria 12256
89 Ga0070659_100008121 3300005366 Bacteria 7656
90 Ga0070659_100070457 3300005366 Bacteria 2777
91 Ga0070659_100216272 3300005366 Bacteria 1581
92 Ga0070667_100000051 3300005367 Bacteria 155117
93 Ga0070667_100000128 3300005367 Bacteria 95780
94 Ga0070667_100000298 3300005367 Bacteria 55786
95 Ga0070667_100000851 3300005367 Bacteria 28385
96 Ga0070667_100001003 3300005367 Bacteria 25848
97 Ga0070667_100002068 3300005367 Bacteria 17765
98 Ga0070667_100004204 3300005367 Bacteria 12158
99 Ga0070667_100011284 3300005367 Bacteria 7391
100 Ga0070667_100014546 3300005367 Bacteria 6503
101 Ga0070667_100040604 3300005367 Bacteria 3902
102 Ga0070667_100049569 3300005367 Bacteria 3537
103 Ga0070667_100104253 3300005367 Bacteria 2453
104 Ga0070705_100004759 3300005440 Bacteria 6608
105 Ga0070705_100099149 3300005440 Bacteria 1835
106 Ga0070708_100094332 3300005445 Bacteria 2730
107 Ga0070663_100017417 3300005455 Bacteria 4689
108 Ga0070663_100100915 3300005455 Bacteria 2153
109 Ga0070663_100129135 3300005455 Bacteria 1917
110 Ga0070678_100012555 3300005456 Bacteria 5274
111 Ga0070662_100012698 3300005457 Bacteria 5590
112 Ga0070681_10005668 3300005458 Bacteria 12071
113 Ga0068867_100007513 3300005459 Bacteria 7706
114 Ga0068867_100235491 3300005459 Bacteria 1482
115 Ga0070685_10000168 3300005466 Bacteria 43369
116 Ga0070679_100008282 3300005530 Bacteria 9782
117 Ga0068853_100004036 3300005539 Bacteria 11295
118 Ga0068853_100009085 3300005539 Bacteria 8003
119 Ga0068853_100019326 3300005539 Bacteria 5648
120 Ga0068853_100025577 3300005539 Bacteria 4954
121 Ga0068853_100174305 3300005539 Bacteria 1947
122 Ga0070672_100315773 3300005543 Bacteria 1327
123 Ga0070686_100001324 3300005544 Bacteria 14003
124 Ga0070686_100017427 3300005544 Bacteria 4197
125 Ga0070665_100000161 3300005548 Bacteria 122088
126 Ga0070665_100000206 3300005548 Bacteria 102989
127 Ga0070665_100001356 3300005548 Bacteria 28943
128 Ga0070665_100010985 3300005548 Bacteria 9156
129 Ga0070665_100012580 3300005548 Bacteria 8522
130 Ga0070665_100088252 3300005548 Bacteria 3107
131 Ga0070665_100137757 3300005548 Bacteria 2444
132 Ga0070665_100287580 3300005548 Bacteria 1646
133 Ga0068855_100000962 3300005563 Bacteria 35800
134 Ga0068855_100014816 3300005563 Bacteria 9389
135 Ga0068855_100015135 3300005563 Bacteria 9288
136 Ga0068855_100040224 3300005563 Bacteria 5549
137 Ga0068855_100060879 3300005563 Bacteria 4412
138 Ga0070664_100013946 3300005564 Bacteria 6552
139 Ga0070664_100020427 3300005564 Bacteria 5453
140 Ga0070664_100102464 3300005564 Bacteria 2490
141 Ga0068857_100009607 3300005577 Bacteria 8404
142 Ga0068857_100018029 3300005577 Bacteria 6193
143 Ga0068857_100065228 3300005577 Bacteria 3237
144 Ga0068857_100069212 3300005577 Bacteria 3143
145 Ga0068857_100084922 3300005577 Bacteria 2829
146 Ga0068857_100194718 3300005577 Bacteria 1847
147 Ga0068857_100245112 3300005577 Bacteria 1641
148 Ga0068854_100003154 3300005578 Bacteria 10274
149 Ga0068854_100010741 3300005578 Bacteria 5941
150 Ga0068854_100012195 3300005578 Bacteria 5624
151 Ga0068854_100019472 3300005578 Bacteria 4574
152 Ga0068854_100305493 3300005578 Bacteria 1288
153 Ga0068856_100004323 3300005614 Bacteria 14177
154 Ga0068856_100011400 3300005614 Bacteria 8622
155 Ga0068856_100142927 3300005614 Bacteria 2400
156 Ga0068856_100332962 3300005614 Bacteria 1536
157 Ga0068856_100494178 3300005614 Bacteria 1244
158 Ga0070702_100028407 3300005615 Bacteria 3031
159 Ga0068852_100000075 3300005616 Bacteria 69379
160 Ga0068852_100108194 3300005616 Bacteria 2523
161 Ga0068852_100183379 3300005616 Bacteria 1970
162 Ga0068859_100000256 3300005617 Bacteria 52870
163 Ga0068859_100001299 3300005617 Bacteria 25520
164 Ga0068859_100006610 3300005617 Bacteria 11774
165 Ga0068859_100025168 3300005617 Bacteria 5973
166 Ga0068864_100000005 3300005618 Bacteria 400840
167 Ga0068864_100000332 3300005618 Bacteria 41671
168 Ga0068864_100000642 3300005618 Bacteria 29378
169 Ga0068864_100001753 3300005618 Bacteria 17839
170 Ga0068864_100025454 3300005618 Bacteria 4983
171 Ga0068864_100053335 3300005618 Bacteria 3488
172 Ga0068864_100118219 3300005618 Bacteria 2367
173 Ga0068861_100001329 3300005719 Bacteria 15509
174 Ga0068861_100015879 3300005719 Bacteria 5317
175 Ga0068861_100088296 3300005719 Bacteria 2441
176 Ga0068851_10011445 3300005834 Bacteria 4161
177 Ga0068851_10042184 3300005834 Bacteria 2296
178 Ga0068863_100000016 3300005841 Bacteria 213575
179 Ga0068863_100000028 3300005841 Bacteria 181662
180 Ga0068863_100000060 3300005841 Bacteria 122123
181 Ga0068863_100000456 3300005841 Bacteria 41671
182 Ga0068863_100000719 3300005841 Bacteria 33262
183 Ga0068863_100005237 3300005841 Bacteria 12796
184 Ga0068863_100010358 3300005841 Bacteria 9058
185 Ga0068863_100017269 3300005841 Bacteria 6922
186 Ga0068863_100028865 3300005841 Bacteria 5298
187 Ga0068863_100415980 3300005841 Bacteria 1316
188 Ga0068858_100000304 3300005842 Bacteria 52470
189 Ga0068858_100000472 3300005842 Bacteria 41922
190 Ga0068858_100002895 3300005842 Bacteria 17259
191 Ga0068858_100004091 3300005842 Bacteria 14368
192 Ga0068858_100016712 3300005842 Bacteria 6891
193 Ga0068858_100022636 3300005842 Bacteria 5860
194 Ga0068858_100104346 3300005842 Bacteria 2644
195 Ga0068860_100000126 3300005843 Bacteria 122923
196 Ga0068860_100000143 3300005843 Bacteria 116787
197 Ga0068860_100000168 3300005843 Bacteria 107408
198 Ga0068860_100000412 3300005843 Bacteria 55786
199 Ga0068860_100001698 3300005843 Bacteria 23527
200 Ga0068860_100006149 3300005843 Bacteria 12074
201 Ga0068860_100007410 3300005843 Bacteria 10976
202 Ga0068860_100017637 3300005843 Bacteria 6956
203 Ga0068860_100174989 3300005843 Bacteria 2074
204 Ga0068862_100000001 3300005844 Bacteria 523031
205 Ga0068862_100000085 3300005844 Bacteria 110879
206 Ga0068862_100000168 3300005844 Bacteria 72749
207 Ga0068862_100000310 3300005844 Bacteria 53315
208 Ga0068862_100000506 3300005844 Bacteria 41538
209 Ga0068862_100001574 3300005844 Bacteria 20794
210 Ga0068862_100010705 3300005844 Bacteria 7573
211 Ga0068862_100010728 3300005844 Bacteria 7566
212 Ga0068862_100040836 3300005844 Bacteria 3945
213 Ga0068862_100089890 3300005844 Bacteria 2673
214 Ga0081455_10000131 3300005937 Bacteria 87553
215 Ga0075368_10001483 3300006042 Bacteria 7519
216 Ga0075368_10041808 3300006042 Bacteria 1801
217 Ga0075363_100003377 3300006048 Bacteria 6781
218 Ga0075363_100003814 3300006048 Bacteria 6495
219 Ga0075364_10016692 3300006051 Bacteria 4572
220 Ga0075432_10004187 3300006058 Bacteria 4911
221 Ga0075362_10000234 3300006177 Bacteria 15472
222 Ga0075362_10000526 3300006177 Bacteria 11123
223 Ga0075367_10000092 3300006178 Bacteria 24598
224 Ga0075366_10000168 3300006195 Bacteria 28069
225 Ga0075366_10006887 3300006195 Bacteria 6254
226 Ga0075366_10021504 3300006195 Bacteria 3750
227 Ga0097621_100136045 3300006237 Bacteria 2096
228 Ga0075370_10000032 3300006353 Bacteria 44839
229 Ga0075370_10045379 3300006353 Bacteria 2486
230 Ga0075429_100039568 3300006880 Bacteria 4103
231 Ga0075429_100102528 3300006880 Bacteria 2498
232 Ga0097620_100000256 3300006931 Bacteria 52870
233 Ga0097620_100001299 3300006931 Bacteria 25520
234 Ga0097620_100006610 3300006931 Bacteria 11774
235 Ga0097620_100025168 3300006931 Bacteria 5973
236 Ga0079104_1008150 3300006946 Bacteria 3705
237 Ga0105251_10001625 3300009011 Bacteria 19048
238 Ga0105251_10001861 3300009011 Bacteria 17335
239 Ga0105251_10010467 3300009011 Bacteria 5379
240 Ga0105251_10061191 3300009011 Bacteria 1771
241 Ga0105251_10069374 3300009011 Bacteria 1643
242 Ga0105240_10001848 3300009093 Bacteria 35437
243 Ga0105240_10010488 3300009093 Bacteria 13024
244 Ga0105240_10035481 3300009093 Bacteria 6426
245 Ga0105240_10070426 3300009093 Bacteria 4326
246 Ga0105240_10078303 3300009093 Bacteria 4071
247 Ga0105245_10001108 3300009098 Bacteria 24360
248 Ga0105247_10000644 3300009101 Bacteria 27956
249 Ga0105247_10037912 3300009101 Bacteria 2941
250 Ga0114129_10021496 3300009147 Bacteria 9159
251 Ga0105243_10000423 3300009148 Bacteria 44393
252 Ga0105243_10075604 3300009148 Bacteria 2734
253 Ga0105243_10261150 3300009148 Bacteria 1550
254 Ga0105241_10000997 3300009174 Bacteria 21452
255 Ga0105241_10166400 3300009174 Bacteria 1817
256 Ga0105248_10000029 3300009177 Bacteria 223366
257 Ga0105248_10000086 3300009177 Bacteria 106349
258 Ga0105248_10013528 3300009177 Bacteria 8982
259 Ga0105248_10024262 3300009177 Bacteria 6743
260 Ga0105248_10031271 3300009177 Bacteria 5949
261 Ga0105248_10120069 3300009177 Bacteria 2965
262 Ga0105248_10175942 3300009177 Bacteria 2412
263 Ga0105237_10002073 3300009545 Bacteria 25405
264 Ga0105237_10007129 3300009545 Bacteria 12280
265 Ga0105237_10009460 3300009545 Bacteria 10438
266 Ga0105237_10140837 3300009545 Bacteria 2406
267 Ga0105238_10017115 3300009551 Bacteria 7359
268 Ga0105238_10182143 3300009551 Bacteria 2077
269 Ga0105238_10203403 3300009551 Bacteria 1956
270 Ga0105238_10254974 3300009551 Bacteria 1733
271 Ga0105249_10000024 3300009553 Bacteria 232947
272 Ga0105249_10000038 3300009553 Bacteria 196425
273 Ga0105249_10000094 3300009553 Bacteria 122611
274 Ga0105249_10002324 3300009553 Bacteria 16499
275 Ga0105249_10348210 3300009553 Bacteria 1500
276 Ga0105148_100059 3300009978 Bacteria 17255
277 Ga0105239_10027686 3300010375 Bacteria 6236
278 Ga0105239_10067612 3300010375 Bacteria 3925
279 Ga0105239_10618628 3300010375 Bacteria 1236
280 Ga0157326_1000001 3300012513 Bacteria 19397
281 Ga0157373_10003358 3300013100 Bacteria 12096
282 Ga0157371_10000032 3300013102 Bacteria 230252
283 Ga0157371_10003665 3300013102 Bacteria 13817
284 Ga0157371_10140860 3300013102 Bacteria 1718
285 Ga0157370_10013758 3300013104 Bacteria 8315
286 Ga0157370_10051407 3300013104 Bacteria 3937
287 Ga0157370_10053190 3300013104 Bacteria 3862
288 Ga0157370_10330811 3300013104 Bacteria 1405
289 Ga0157369_10115578 3300013105 Bacteria 2849
290 Ga0157369_10289035 3300013105 Bacteria 1707
291 Ga0157378_10187768 3300013297 Bacteria 1947
292 Ga0163162_10003527 3300013306 Bacteria 14967
293 Ga0163162_10012124 3300013306 Bacteria 8412
294 Ga0163162_10015484 3300013306 Bacteria 7452
295 Ga0163162_10044800 3300013306 Bacteria 4432
296 Ga0157372_10035441 3300013307 Bacteria 5494
297 Ga0157372_10242033 3300013307 Bacteria 2093
298 Ga0157372_10328848 3300013307 Bacteria 1780
299 Ga0163163_10008504 3300014325 Bacteria 9122
300 Ga0163163_10172430 3300014325 Bacteria 2210
301 Ga0157380_10000060 3300014326 Bacteria 62248
302 Ga0157380_10000542 3300014326 Bacteria 23239
303 Ga0157380_10148878 3300014326 Bacteria 2021
304 Ga0157379_10004525 3300014968 Bacteria 11922
305 Ga0157379_10042529 3300014968 Bacteria 4057
306 Ga0183363_1004 3300015690 Bacteria 416766
307 Ga0163161_10000716 3300017792 Bacteria 26178
308 Ga0163161_10082721 3300017792 Bacteria 2366
309 Ga0213875_10000264 3300021388 Bacteria 52435
310 Ga0209147_104064 3300025229 Bacteria 2558
311 Ga0209563_100030 3300025230 Bacteria 489259
312 Ga0209677_104116 3300025253 Bacteria 4355
313 Ga0209148_1000011 3300025254 Bacteria 1196503
314 Ga0209233_1000058 3300025261 Bacteria 421872
315 Ga0209455_1000006 3300025272 Bacteria 1196503
316 Ga0209758_1000001 3300025297 Bacteria 1981790
317 Ga0209050_1000441 3300025298 Bacteria 75474
318 Ga0207697_10000419 3300025315 Bacteria 24002
319 Ga0207697_10012242 3300025315 Bacteria 3602
320 Ga0207697_10015555 3300025315 Bacteria 3142
321 Ga0207656_10000378 3300025321 Bacteria 14923
322 Ga0207656_10005981 3300025321 Bacteria 4347
323 Ga0207713_1002460 3300025735 Bacteria 13462
324 Ga0207713_1016496 3300025735 Bacteria 3746
325 Ga0207710_10006923 3300025900 Bacteria 4823
326 Ga0207710_10035134 3300025900 Bacteria 2205
327 Ga0207680_10000007 3300025903 Bacteria 623574
328 Ga0207680_10000517 3300025903 Bacteria 18430
329 Ga0207680_10003829 3300025903 Bacteria 7085
330 Ga0207680_10125961 3300025903 Bacteria 1682
331 Ga0207680_10140440 3300025903 Bacteria 1601
332 Ga0207680_10155143 3300025903 Bacteria 1530
333 Ga0207647_10008366 3300025904 Bacteria 7421
334 Ga0207647_10026599 3300025904 Bacteria 3783
335 Ga0207647_10064805 3300025904 Bacteria 2219
336 Ga0207645_10165005 3300025907 Bacteria 1450
337 Ga0207705_10000075 3300025909 Bacteria 123551
338 Ga0207705_10000122 3300025909 Bacteria 86442
339 Ga0207705_10090342 3300025909 Bacteria 2242
340 Ga0207705_10123396 3300025909 Bacteria 1924
341 Ga0207654_10002907 3300025911 Bacteria 8680
342 Ga0207707_10069377 3300025912 Bacteria 3072
343 Ga0207707_10141338 3300025912 Bacteria 2105
344 Ga0207695_10000288 3300025913 Bacteria 125085
345 Ga0207695_10006069 3300025913 Bacteria 15766
346 Ga0207695_10015610 3300025913 Bacteria 8933
347 Ga0207695_10036202 3300025913 Bacteria 5338
348 Ga0207695_10055082 3300025913 Bacteria 4147
349 Ga0207695_10075297 3300025913 Bacteria 3435
350 Ga0207695_10095696 3300025913 Bacteria 2973
351 Ga0207695_10150591 3300025913 Bacteria 2266
352 Ga0207671_10001439 3300025914 Bacteria 27570
353 Ga0207671_10006770 3300025914 Bacteria 10131
354 Ga0207671_10018947 3300025914 Bacteria 5272
355 Ga0207657_10000408 3300025919 Bacteria 45400
356 Ga0207657_10002471 3300025919 Bacteria 19998
357 Ga0207657_10007801 3300025919 Bacteria 10926
358 Ga0207657_10011633 3300025919 Bacteria 8727
359 Ga0207657_10085021 3300025919 Bacteria 2651
360 Ga0207657_10186792 3300025919 Bacteria 1673
361 Ga0207649_10000482 3300025920 Bacteria 28301
362 Ga0207649_10159200 3300025920 Bacteria 1563
363 Ga0207652_10008597 3300025921 Bacteria 8216
364 Ga0207652_10114171 3300025921 Bacteria 2398
365 Ga0207681_10000004 3300025923 Bacteria 559005
366 Ga0207681_10000005 3300025923 Bacteria 555724
367 Ga0207681_10000089 3300025923 Bacteria 79526
368 Ga0207681_10000503 3300025923 Bacteria 27243
369 Ga0207681_10000663 3300025923 Bacteria 22786
370 Ga0207681_10001365 3300025923 Bacteria 15750
371 Ga0207681_10004407 3300025923 Bacteria 8674
372 Ga0207681_10018758 3300025923 Bacteria 4363
373 Ga0207681_10041605 3300025923 Bacteria 3065
374 Ga0207681_10140268 3300025923 Bacteria 1799
375 Ga0207694_10005621 3300025924 Bacteria 9610
376 Ga0207694_10009731 3300025924 Bacteria 7251
377 Ga0207694_10018966 3300025924 Bacteria 5200
378 Ga0207694_10061619 3300025924 Bacteria 2920
379 Ga0207694_10175781 3300025924 Bacteria 1735
380 Ga0207694_10182713 3300025924 Bacteria 1701
381 Ga0207694_10237460 3300025924 Bacteria 1489
382 Ga0207650_10000004 3300025925 Bacteria 743372
383 Ga0207650_10000545 3300025925 Bacteria 30685
384 Ga0207650_10010295 3300025925 Bacteria 6409
385 Ga0207650_10015807 3300025925 Bacteria 5262
386 Ga0207650_10047790 3300025925 Bacteria 3154
387 Ga0207650_10083091 3300025925 Bacteria 2432
388 Ga0207687_10000853 3300025927 Bacteria 20620
389 Ga0207644_10000005 3300025931 Bacteria 441948
390 Ga0207644_10000009 3300025931 Bacteria 251643
391 Ga0207644_10000447 3300025931 Bacteria 26636
392 Ga0207644_10001520 3300025931 Bacteria 14966
393 Ga0207644_10003216 3300025931 Bacteria 10526
394 Ga0207644_10020323 3300025931 Bacteria 4515
395 Ga0207644_10021357 3300025931 Bacteria 4409
396 Ga0207644_10070832 3300025931 Bacteria 2549
397 Ga0207690_10000696 3300025932 Bacteria 21652
398 Ga0207690_10023275 3300025932 Bacteria 3865
399 Ga0207690_10031743 3300025932 Bacteria 3383
400 Ga0207690_10225677 3300025932 Bacteria 1436
401 Ga0207706_10002919 3300025933 Bacteria 16521
402 Ga0207706_10004237 3300025933 Bacteria 13507
403 Ga0207706_10012315 3300025933 Bacteria 7791
404 Ga0207706_10075750 3300025933 Bacteria 2959
405 Ga0207709_10000574 3300025935 Bacteria 30979
406 Ga0207709_10193909 3300025935 Bacteria 1445
407 Ga0207670_10013004 3300025936 Bacteria 4894
408 Ga0207669_10006239 3300025937 Bacteria 5431
409 Ga0207711_10000004 3300025941 Bacteria 870636
410 Ga0207711_10000310 3300025941 Bacteria 52175
411 Ga0207711_10002363 3300025941 Bacteria 16902
412 Ga0207711_10019413 3300025941 Bacteria 5661
413 Ga0207711_10024128 3300025941 Bacteria 5090
414 Ga0207711_10048966 3300025941 Bacteria 3617
415 Ga0207661_10256435 3300025944 Bacteria 1556
416 Ga0207679_10100238 3300025945 Bacteria 2263
417 Ga0207667_10000002 3300025949 Bacteria 895662
418 Ga0207667_10004952 3300025949 Bacteria 16269
419 Ga0207667_10008229 3300025949 Bacteria 12408
420 Ga0207667_10013795 3300025949 Bacteria 9232
421 Ga0207667_10118401 3300025949 Bacteria 2729
422 Ga0207667_10301320 3300025949 Bacteria 1638
423 Ga0207712_10000002 3300025961 Bacteria 706628
424 Ga0207712_10000004 3300025961 Bacteria 614655
425 Ga0207712_10000034 3300025961 Bacteria 202320
426 Ga0207668_10000006 3300025972 Bacteria 191468
427 Ga0207668_10000047 3300025972 Bacteria 101453
428 Ga0207668_10003433 3300025972 Bacteria 9293
429 Ga0207668_10003815 3300025972 Bacteria 8882
430 Ga0207668_10004706 3300025972 Bacteria 8024
431 Ga0207668_10009940 3300025972 Bacteria 5722
432 Ga0207668_10316619 3300025972 Bacteria 1293
433 Ga0207640_10000570 3300025981 Bacteria 21973
434 Ga0207640_10000586 3300025981 Bacteria 21662
435 Ga0207640_10002545 3300025981 Bacteria 9776
436 Ga0207640_10018948 3300025981 Bacteria 4054
437 Ga0207640_10070046 3300025981 Bacteria 2357
438 Ga0207658_10000026 3300025986 Bacteria 178292
439 Ga0207658_10000057 3300025986 Bacteria 124003
440 Ga0207658_10000254 3300025986 Bacteria 55800
441 Ga0207658_10000434 3300025986 Bacteria 39528
442 Ga0207658_10001330 3300025986 Bacteria 19356
443 Ga0207658_10002894 3300025986 Bacteria 12306
444 Ga0207658_10002944 3300025986 Bacteria 12197
445 Ga0207658_10003250 3300025986 Bacteria 11554
446 Ga0207658_10007629 3300025986 Bacteria 7368
447 Ga0207658_10025127 3300025986 Bacteria 4169
448 Ga0207658_10031477 3300025986 Bacteria 3767
449 Ga0207658_10110014 3300025986 Bacteria 2176
450 Ga0207703_10000435 3300026035 Bacteria 43900
451 Ga0207703_10000568 3300026035 Bacteria 37997
452 Ga0207703_10001463 3300026035 Bacteria 21547
453 Ga0207703_10001946 3300026035 Bacteria 18263
454 Ga0207703_10001956 3300026035 Bacteria 18195
455 Ga0207703_10012521 3300026035 Bacteria 6612
456 Ga0207703_10070059 3300026035 Bacteria 2894
457 Ga0207703_10109986 3300026035 Bacteria 2350
458 Ga0207703_10126510 3300026035 Bacteria 2201
459 Ga0207639_10000777 3300026041 Bacteria 21710
460 Ga0207639_10003342 3300026041 Bacteria 10792
461 Ga0207639_10018070 3300026041 Bacteria 5005
462 Ga0207639_10020172 3300026041 Bacteria 4768
463 Ga0207639_10045628 3300026041 Bacteria 3302
464 Ga0207639_10074344 3300026041 Bacteria 2668
465 Ga0207639_10224291 3300026041 Bacteria 1625
466 Ga0207678_10000324 3300026067 Bacteria 42936
467 Ga0207678_10005545 3300026067 Bacteria 11277
468 Ga0207678_10013334 3300026067 Bacteria 7212
469 Ga0207678_10041873 3300026067 Bacteria 3970
470 Ga0207702_10005910 3300026078 Bacteria 10640
471 Ga0207702_10006661 3300026078 Bacteria 9934
472 Ga0207702_10037147 3300026078 Bacteria 4076
473 Ga0207702_10113339 3300026078 Bacteria 2414
474 Ga0207702_10113370 3300026078 Bacteria 2414
475 Ga0207702_10255571 3300026078 Bacteria 1647
476 Ga0207641_10000010 3300026088 Bacteria 402193
477 Ga0207641_10000014 3300026088 Bacteria 336170
478 Ga0207641_10000100 3300026088 Bacteria 122664
479 Ga0207641_10000315 3300026088 Bacteria 60017
480 Ga0207641_10000346 3300026088 Bacteria 55535
481 Ga0207641_10002472 3300026088 Bacteria 17065
482 Ga0207641_10002944 3300026088 Bacteria 15396
483 Ga0207641_10017728 3300026088 Bacteria 5832
484 Ga0207641_10022838 3300026088 Bacteria 5151
485 Ga0207641_10025121 3300026088 Bacteria 4911
486 Ga0207641_10025885 3300026088 Bacteria 4839
487 Ga0207676_10000006 3300026095 Bacteria 681936
488 Ga0207676_10000036 3300026095 Bacteria 198447
489 Ga0207676_10000603 3300026095 Bacteria 29490
490 Ga0207676_10002760 3300026095 Bacteria 12487
491 Ga0207676_10003853 3300026095 Bacteria 10592
492 Ga0207676_10004588 3300026095 Bacteria 9784
493 Ga0207676_10011106 3300026095 Bacteria 6428
494 Ga0207676_10028724 3300026095 Bacteria 4158
495 Ga0207674_10003143 3300026116 Bacteria 20360
496 Ga0207674_10004472 3300026116 Bacteria 16807
497 Ga0207674_10009082 3300026116 Bacteria 11411
498 Ga0207674_10012390 3300026116 Bacteria 9533
499 Ga0207674_10014452 3300026116 Bacteria 8719
500 Ga0207674_10085003 3300026116 Bacteria 3161
501 Ga0207674_10100585 3300026116 Bacteria 2873
502 Ga0207674_10161876 3300026116 Bacteria 2192
503 Ga0207674_10330920 3300026116 Bacteria 1473
504 Ga0207675_100000740 3300026118 Bacteria 32427
505 Ga0207675_100003757 3300026118 Bacteria 14793
506 Ga0207675_100020136 3300026118 Bacteria 6222
507 Ga0207683_10022042 3300026121 Bacteria 5465
508 Ga0207698_10000005 3300026142 Bacteria 295687
509 Ga0207698_10027376 3300026142 Bacteria 4046
510 Ga0209281_1010835 3300027111 Bacteria 2063
511 Ga0209983_1009114 3300027665 Bacteria 2028
512 Ga0209813_10000114 3300027866 Bacteria 29415
513 Ga0209813_10000530 3300027866 Bacteria 9004
514 Ga0207428_10036711 3300027907 Bacteria 3994
515 Ga0268266_10000002 3300028379 Bacteria 3059047
516 Ga0268266_10000040 3300028379 Bacteria 323843
517 Ga0268266_10000534 3300028379 Bacteria 53027
518 Ga0268266_10008419 3300028379 Bacteria 9172
519 Ga0268266_10015509 3300028379 Bacteria 6536
520 Ga0268266_10029365 3300028379 Bacteria 4675
521 Ga0268265_10000001 3300028380 Bacteria 1230727
522 Ga0268265_10000059 3300028380 Bacteria 152531
523 Ga0268265_10000104 3300028380 Bacteria 105776
524 Ga0268265_10000986 3300028380 Bacteria 25848
525 Ga0268265_10001459 3300028380 Bacteria 19860
526 Ga0268265_10002264 3300028380 Bacteria 14694
527 Ga0268265_10002795 3300028380 Bacteria 12867
528 Ga0268265_10013635 3300028380 Bacteria 5527
529 Ga0268265_10070580 3300028380 Bacteria 2717
530 Ga0268265_10107211 3300028380 Bacteria 2271
531 Ga0268264_10000003 3300028381 Bacteria 1141976
532 Ga0268264_10000040 3300028381 Bacteria 373714
533 Ga0268264_10000069 3300028381 Bacteria 270492
534 Ga0268264_10000076 3300028381 Bacteria 255518
535 Ga0268264_10000083 3300028381 Bacteria 245366
536 Ga0268264_10004451 3300028381 Bacteria 11955
537 Ga0268264_10012761 3300028381 Bacteria 6914
538 Ga0268264_10029925 3300028381 Bacteria 4464
539 Ga0268264_10146421 3300028381 Bacteria 2112
540 Ga0265323_10023219 3300028653 Bacteria 2366
541 Ga0307517_10076293 3300028786 Bacteria 2929
542 Ga0265330_10009538 3300031235 Unclassified 4608
543 Ga0265331_10064820 3300031250 Bacteria 1719
544 Ga0265327_10034616 3300031251 Bacteria 2801
545 Ga0265316_10002067 3300031344 Bacteria 21137
546 Ga0307513_10006540 3300031456 Bacteria 15221
547 Ga0307513_10040993 3300031456 Bacteria 5114
548 Ga0307408_100024261 3300031548 Bacteria 4139
549 Ga0307408_100062683 3300031548 Bacteria 2717
550 Ga0307408_100069487 3300031548 Bacteria 2597
551 Ga0307508_10001821 3300031616 Bacteria 23580
552 Ga0265342_10103895 3300031712 Bacteria 1615
553 Ga0307405_10003814 3300031731 Bacteria 7008
554 Ga0307413_10061015 3300031824 Bacteria 2324
555 Ga0307413_10246634 3300031824 Bacteria 1322
556 Ga0307410_10032147 3300031852 Bacteria 3374
557 Ga0307410_10131432 3300031852 Bacteria 1839
558 Ga0307406_10043622 3300031901 Bacteria 2806
559 Ga0307412_10000457 3300031911 Bacteria 24624
560 Ga0307412_10002757 3300031911 Bacteria 9760
561 Ga0307412_10004671 3300031911 Bacteria 7639
562 Ga0307412_10025366 3300031911 Bacteria 3671
563 Ga0307412_10025379 3300031911 Bacteria 3671
564 Ga0307412_10043331 3300031911 Bacteria 2929
565 Ga0307412_10066770 3300031911 Bacteria 2439
566 Ga0307412_10086777 3300031911 Bacteria 2179
567 Ga0307409_100108884 3300031995 Bacteria 2318
568 Ga0307416_100046276 3300032002 Bacteria 3432
569 Ga0307416_100080150 3300032002 Bacteria 2754
570 Ga0307416_100111520 3300032002 Bacteria 2412
571 Ga0307414_10000070 3300032004 Bacteria 96231
572 Ga0307414_10000288 3300032004 Bacteria 29634
573 Ga0307414_10000359 3300032004 Bacteria 25279
574 Ga0307411_10007009 3300032005 Bacteria 5696
575 Ga0307411_10230582 3300032005 Bacteria 1443
576 Ga0307415_100206526 3300032126 Bacteria 1563
577 Ga0316583_10008936 3300032133 Bacteria 3612
578 Ga0307510_10008642 3300033180 Bacteria 12135
579 Ga0373937_0071330 3300036401 Bacteria 3204
580 Ga0316582_0014476 3300036647 Bacteria 4477
581 Ga0316584_0074383 3300036712 Bacteria 2547
582 Ga0316584_0087070 3300036712 Bacteria 2338
583 Ga0395900_0044548 3300037418 Bacteria 4571
584 Ga0395898_0018073 3300037466 Bacteria 7193
585 Ga0436364_1200653 3300037853 Bacteria 55826
586 Ga0395901_0018063 3300038443 Bacteria 7199
587 Ga0439436_0009476 3300041404 Bacteria 2986
588 Ga0439436_0018522 3300041404 Bacteria 2082
589 Ga0439461_0000086 3300041410 Bacteria 12130
590 Ga0439465_0001125 3300041413 Bacteria 8568
591 Ga0439465_0016622 3300041413 Bacteria 2295
592 Ga0451802_1561412 3300041460 Bacteria 1770
593 Ga0439431_0000491 3300041997 Bacteria 8366
594 Ga0439431_0020680 3300041997 Bacteria 1574
595 Ga0439445_0011274 3300042004 Bacteria 2129
596 Ga0439432_005779 3300042006 Bacteria 4444
597 Ga0439452_025280 3300042010 Bacteria 1509
598 Ga0439462_0002734 3300042015 Bacteria 4143
599 Ga0453684_0260886 3300044712 Bacteria 1985
600 Ga0451576_0000588 3300045051 Bacteria 77026
601 Ga0451576_0215241 3300045051 Bacteria 2006
602 Ga0466967_0082472 3300045976 Bacteria 2906
603 Ga0495617_025936 3300046452 Bacteria 1974
604 Ga0495627_000094 3300046453 Bacteria 108256
605 Ga0495627_000391 3300046453 Bacteria 39764
606 Ga0495627_001469 3300046453 Bacteria 13724
607 Ga0495629_0046040 3300046459 Bacteria 3060
608 Ga0495638_0000018 3300046460 Bacteria 389696
609 Ga0495638_0001145 3300046460 Bacteria 25617
610 Ga0495638_0006816 3300046460 Bacteria 8247
611 Ga0495638_0015526 3300046460 Bacteria 5113
612 Ga0495638_0017047 3300046460 Bacteria 4853
613 Ga0495638_0043711 3300046460 Bacteria 2825
614 Ga0495638_0111145 3300046460 Bacteria 1628
615 Ga0495650_0000158 3300046471 Bacteria 154681
616 Ga0495650_0001135 3300046471 Bacteria 28922
617 Ga0495650_0021897 3300046471 Bacteria 3074
618 Ga0495585_0007224 3300046492 Bacteria 6825
619 Ga0495585_0070263 3300046492 Bacteria 1910
620 Ga0495585_0107265 3300046492 Bacteria 1488
621 Ga0495596_0000054 3300046500 Bacteria 83068
622 Ga0495596_0001629 3300046500 Bacteria 12750
623 Ga0495607_0011251 3300046501 Bacteria 5969
624 Ga0495583_0000139 3300046506 Bacteria 123464
625 Ga0495583_0000187 3300046506 Bacteria 104971
626 Ga0495583_0000631 3300046506 Bacteria 46958
627 Ga0495583_0010716 3300046506 Bacteria 5321
628 Ga0495583_0032633 3300046506 Bacteria 2512
629 Ga0495606_0000672 3300046507 Bacteria 53500
630 Ga0495606_0000685 3300046507 Bacteria 52815
631 Ga0495606_0033566 3300046507 Bacteria 3538
632 Ga0495610_0000022 3300046512 Bacteria 317107
633 Ga0495610_0000081 3300046512 Bacteria 113513
634 Ga0495610_0000886 3300046512 Bacteria 27808
635 Ga0495610_0002317 3300046512 Bacteria 16092
636 Ga0495610_0020645 3300046512 Bacteria 3652
637 Ga0495616_0000024 3300046513 Bacteria 145530
638 Ga0495620_0017938 3300046515 Bacteria 3516
639 Ga0495620_0076391 3300046515 Bacteria 1361
640 Ga0495631_0023064 3300046518 Bacteria 2889
641 Ga0495632_0000383 3300046519 Bacteria 42267
642 Ga0495632_0000948 3300046519 Bacteria 25335
643 Ga0495632_0008112 3300046519 Bacteria 6498
644 Ga0495632_0027220 3300046519 Bacteria 2997
645 Ga0495632_0052730 3300046519 Bacteria 1999
646 Ga0495637_0008273 3300046520 Bacteria 5115
647 Ga0495637_0040095 3300046520 Bacteria 2018
648 Ga0495643_0000030 3300046522 Bacteria 260229
649 Ga0495643_0000077 3300046522 Bacteria 163843
650 Ga0495643_0006700 3300046522 Bacteria 7542
651 Ga0495643_0008719 3300046522 Bacteria 6395
652 Ga0495643_0012069 3300046522 Bacteria 5226
653 Ga0495643_0015150 3300046522 Bacteria 4566
654 Ga0495643_0122045 3300046522 Bacteria 1315
655 Ga0495648_0000018 3300046524 Bacteria 282490
656 Ga0495648_0000143 3300046524 Bacteria 85539
657 Ga0495648_0039704 3300046524 Bacteria 2992
658 Ga0495663_0000003 3300046525 Bacteria 362694
659 Ga0495663_0007556 3300046525 Bacteria 3008
660 Ga0495654_0005346 3300046530 Bacteria 7482
661 Ga0495654_0041315 3300046530 Bacteria 2294
662 Ga0495587_0019617 3300046536 Bacteria 4183
663 Ga0495598_0015882 3300046537 Bacteria 1910
664 Ga0495609_0015133 3300046538 Bacteria 3614
665 Ga0495621_0016225 3300046539 Bacteria 2387
666 Ga0495633_0000184 3300046558 Bacteria 81757
667 Ga0495633_0000892 3300046558 Bacteria 25551
668 Ga0495633_0011496 3300046558 Bacteria 4768
669 Ga0495668_0000016 3300046616 Bacteria 438197
670 Ga0495668_0010303 3300046616 Bacteria 5666
671 Ga0495668_0011827 3300046616 Bacteria 5202
672 Ga0495668_0041896 3300046616 Bacteria 2549
673 Ga0495668_0082368 3300046616 Bacteria 1765
674 Ga0495625_0000150 3300046660 Bacteria 106314
675 Ga0495625_0000153 3300046660 Bacteria 105123
676 Ga0495625_0003185 3300046660 Bacteria 16701
677 Ga0495625_0008151 3300046660 Bacteria 8975
678 Ga0495625_0025768 3300046660 Bacteria 4453
679 Ga0495625_0093400 3300046660 Bacteria 2077
680 Ga0495661_0038909 3300046665 Bacteria 2958
681 Ga0495661_0068431 3300046665 Bacteria 2083
682 Ga0495669_0000050 3300046684 Bacteria 80688
683 Ga0495670_0059556 3300046691 Bacteria 1917
684 Ga0495671_0000011 3300046692 Bacteria 365582
685 Ga0495671_0000072 3300046692 Bacteria 97315
686 Ga0495671_0005155 3300046692 Bacteria 7687
687 Ga0495600_0000690 3300046809 Bacteria 17650
688 Ga0495683_0000963 3300047323 Bacteria 20180
689 Ga0495687_001845 3300047443 Bacteria 18538
690 Ga0495687_002183 3300047443 Bacteria 16292
691 Ga0495673_0000013 3300047469 Bacteria 612902
692 Ga0495673_0014606 3300047469 Bacteria 4079
693 Ga0495673_0018818 3300047469 Bacteria 3474
694 Ga0495681_0000010 3300047470 Bacteria 203548
695 Ga0495681_0000342 3300047470 Bacteria 36568
696 Ga0495681_0011835 3300047470 Bacteria 5164
697 Ga0495686_0000182 3300047472 Bacteria 119682
698 Ga0495686_0000363 3300047472 Bacteria 73366
699 Ga0495686_0005716 3300047472 Bacteria 9717
700 Ga0495686_0010474 3300047472 Bacteria 6591
701 Ga0495686_0023442 3300047472 Bacteria 4070
702 Ga0495686_0039832 3300047472 Bacteria 2999
703 Ga0495686_0043044 3300047472 Bacteria 2866
704 Ga0495686_0099114 3300047472 Bacteria 1759
705 Ga0495615_0000150 3300048090 Bacteria 17571
706 Ga0495626_0001895 3300048091 Bacteria 15617
707 Ga0496100_0147390 3300048903 Bacteria 1675
708 Ga0496101_0029318 3300048904 Bacteria 3849
709 Ga0496101_0041543 3300048904 Bacteria 3279
710 Ga0496101_0047847 3300048904 Bacteria 3071
711 Ga0496102_0000199 3300048905 Bacteria 81435
712 Ga0496102_0000243 3300048905 Bacteria 71427
713 Ga0496102_0000570 3300048905 Bacteria 39156
714 Ga0496102_0043153 3300048905 Bacteria 4088
715 Ga0496102_0369014 3300048905 Bacteria 1351
716 Ga0496103_0000201 3300048906 Bacteria 59837
717 Ga0496103_0000479 3300048906 Bacteria 33569
718 Ga0496103_0000633 3300048906 Bacteria 26944
719 Ga0496103_0001160 3300048906 Bacteria 18172
720 Ga0496103_0010198 3300048906 Bacteria 5556
721 Ga0496103_0018844 3300048906 Bacteria 4143
722 Ga0496103_0050435 3300048906 Bacteria 2575
723 Ga0496104_0000078 3300048907 Bacteria 100203
724 Ga0496104_0014211 3300048907 Bacteria 7185
725 Ga0496104_0038825 3300048907 Bacteria 4457
726 Ga0496104_0090818 3300048907 Bacteria 2919
727 Ga0496104_0103178 3300048907 Bacteria 2732
728 Ga0496105_0000241 3300048908 Bacteria 36833
729 Ga0496105_0000690 3300048908 Bacteria 22731
730 Ga0496105_0010962 3300048908 Bacteria 7142
731 Ga0496105_0026430 3300048908 Bacteria 4733
732 Ga0496105_0115218 3300048908 Bacteria 2217
733 Ga0496105_0131538 3300048908 Bacteria 2063
734 Ga0496105_0275811 3300048908 Bacteria 1357
735 Ga0496106_0017827 3300048909 Bacteria 5251
736 Ga0496107_0000794 3300048910 Bacteria 18300
737 Ga0496107_0026839 3300048910 Bacteria 4087
738 Ga0496108_0036958 3300048911 Bacteria 4065
739 Ga0496109_0069384 3300048912 Bacteria 3232
740 Ga0496109_0076132 3300048912 Bacteria 3086
741 Ga0496109_0122522 3300048912 Bacteria 2423
742 Ga0496110_0017737 3300048913 Bacteria 5956
743 Ga0496110_0063880 3300048913 Bacteria 3253
744 Ga0496111_0061819 3300048914 Bacteria 2715
745 Ga0496112_0112199 3300048915 Bacteria 2696
746 Ga0496112_0629436 3300048915 Bacteria 1003
747 Ga0496113_0003620 3300048916 Bacteria 9287
748 Ga0496113_0004827 3300048916 Bacteria 8339
749 Ga0496113_0017588 3300048916 Bacteria 4966
750 Ga0496113_0141577 3300048916 Bacteria 1893
751 Ga0496114_0019776 3300048917 Bacteria 5459
752 Ga0496114_0074792 3300048917 Bacteria 2852
753 Ga0496115_0000131 3300048918 Bacteria 68111
754 Ga0496116_0000017 3300048919 Bacteria 554463
755 Ga0496116_0002567 3300048919 Bacteria 18955
756 Ga0496116_0034167 3300048919 Bacteria 3593
757 Ga0496117_0000179 3300048920 Bacteria 130966
758 Ga0496117_0000352 3300048920 Bacteria 81089
759 Ga0496117_0003444 3300048920 Bacteria 18406
760 Ga0496117_0006507 3300048920 Bacteria 11782
761 Ga0496117_0006558 3300048920 Bacteria 11712
762 Ga0496117_0012763 3300048920 Bacteria 7371
763 Ga0496117_0013579 3300048920 Bacteria 7095
764 Ga0496117_0013905 3300048920 Bacteria 6976
765 Ga0496117_0021332 3300048920 Bacteria 5244
766 Ga0496118_0000030 3300048921 Bacteria 339946
767 Ga0496118_0000092 3300048921 Bacteria 169106
768 Ga0496118_0004591 3300048921 Bacteria 16240
769 Ga0496118_0007285 3300048921 Bacteria 11778
770 Ga0496118_0007538 3300048921 Bacteria 11492
771 Ga0496118_0012741 3300048921 Bacteria 8034
772 Ga0496118_0031432 3300048921 Bacteria 4401
773 Ga0496118_0094030 3300048921 Bacteria 2051
774 Ga0496118_0179622 3300048921 Bacteria 1280
775 Ga0496119_0000114 3300048922 Bacteria 114495
776 Ga0496119_0004697 3300048922 Bacteria 13438
777 Ga0496119_0023936 3300048922 Bacteria 4313
778 Ga0496119_0090783 3300048922 Bacteria 1736
779 Ga0496120_0000266 3300048923 Bacteria 87412
780 Ga0496120_0047341 3300048923 Bacteria 2480
781 Ga0496120_0051004 3300048923 Bacteria 2366
782 Ga0496121_0000017 3300048924 Bacteria 546415
783 Ga0496121_0000228 3300048924 Bacteria 120653
784 Ga0496121_0000526 3300048924 Bacteria 72764
785 Ga0496121_0000675 3300048924 Bacteria 63670
786 Ga0496121_0001839 3300048924 Bacteria 34202
787 Ga0496121_0001919 3300048924 Bacteria 33213
788 Ga0496121_0003164 3300048924 Bacteria 23728
789 Ga0496121_0009156 3300048924 Bacteria 11446
790 Ga0496121_0012385 3300048924 Bacteria 9312
791 Ga0496121_0023268 3300048924 Bacteria 5973
792 Ga0496121_0045089 3300048924 Bacteria 3793
793 Ga0496121_0081421 3300048924 Bacteria 2563
794 Ga0496121_0086801 3300048924 Bacteria 2458
795 Ga0496122_0000176 3300048925 Bacteria 152190
796 Ga0496122_0013037 3300048925 Bacteria 8187
797 Ga0496122_0016897 3300048925 Bacteria 6861
798 Ga0496122_0041018 3300048925 Bacteria 3669
799 Ga0496122_0082928 3300048925 Bacteria 2225
800 Ga0496122_0096877 3300048925 Bacteria 1987
801 Ga0496123_0000291 3300048926 Bacteria 97989
802 Ga0496123_0001706 3300048926 Bacteria 29346
803 Ga0496123_0001817 3300048926 Bacteria 28073
804 Ga0496123_0010209 3300048926 Bacteria 8332
805 Ga0496123_0011704 3300048926 Bacteria 7568
806 Ga0496123_0016103 3300048926 Bacteria 6092
807 Ga0496123_0023217 3300048926 Bacteria 4752
808 Ga0496123_0040904 3300048926 Bacteria 3221
809 Ga0496123_0050151 3300048926 Bacteria 2791
810 Ga0496123_0079366 3300048926 Bacteria 2006
811 Ga0496124_0000081 3300048927 Bacteria 208413
812 Ga0496124_0000264 3300048927 Bacteria 101377
813 Ga0496124_0000684 3300048927 Bacteria 55763
814 Ga0496124_0001890 3300048927 Bacteria 28794
815 Ga0496124_0002608 3300048927 Bacteria 23273
816 Ga0496124_0003283 3300048927 Bacteria 19954
817 Ga0496124_0035004 3300048927 Bacteria 4398
818 Ga0496124_0066690 3300048927 Bacteria 2996
819 Ga0496124_0138686 3300048927 Bacteria 1922
820 Ga0496124_0149687 3300048927 Bacteria 1833
821 Ga0496125_0000980 3300048928 Bacteria 44624
822 Ga0496125_0009124 3300048928 Bacteria 10260
823 Ga0496125_0022628 3300048928 Bacteria 5830
824 Ga0496125_0037129 3300048928 Bacteria 4239
825 Ga0496125_0053383 3300048928 Bacteria 3313
826 Ga0496125_0088882 3300048928 Bacteria 2326
827 Ga0496125_0095291 3300048928 Bacteria 2214
828 Ga0496125_0129831 3300048928 Bacteria 1776
829 Ga0496126_0000173 3300048929 Bacteria 146490
830 Ga0496126_0000283 3300048929 Bacteria 107129
831 Ga0496126_0001284 3300048929 Bacteria 40249
832 Ga0496126_0095437 3300048929 Bacteria 2609
833 Ga0496126_0140487 3300048929 Bacteria 2079
834 Ga0496126_0142783 3300048929 Bacteria 2059
835 Ga0496126_0148654 3300048929 Bacteria 2010
836 Ga0496126_0166748 3300048929 Bacteria 1879
837 Ga0496126_0274736 3300048929 Bacteria 1397
838 Ga0501292_000247 3300049515 Bacteria 8012
839 Ga0501032_0060590 3300049569 Bacteria 2538
840 Ga0501033_0065135 3300049570 Bacteria 2681
841 Ga0501038_0047716 3300049574 Bacteria 3709
842 Ga0501043_0051084 3300049579 Bacteria 3249
843 Ga0501047_0000447 3300049581 Bacteria 45607
844 Ga0501070_0159647 3300049586 Bacteria 1859
845 Ga0501211_000821 3300049658 Bacteria 3224
846 Ga0501223_000010 3300049663 Bacteria 106901
847 Ga0501223_000112 3300049663 Bacteria 23415
848 Ga0501223_002105 3300049663 Bacteria 4464
849 Ga0501224_000020 3300049664 Bacteria 74346
850 Ga0501224_009536 3300049664 Bacteria 1421
851 Ga0501233_001867 3300049668 Bacteria 3656
852 Ga0501235_001604 3300049669 Bacteria 4846
853 Ga0501235_002575 3300049669 Bacteria 3902
854 Ga0501246_000669 3300049676 Bacteria 2516
855 Ga0501257_000029 3300049686 Bacteria 42945
856 Ga0501261_000214 3300049690 Bacteria 7972
857 Ga0501225_0000008 3300049705 Bacteria 95521
858 Ga0501225_0000135 3300049705 Bacteria 22383
859 Ga0501225_0003339 3300049705 Bacteria 4887
860 Ga0501245_000464 3300049708 Bacteria 4912
861 Ga0501083_0079449 3300049744 Bacteria 2175
862 Ga0501279_000220 3300049775 Bacteria 7984
863 Ga0501280_000649 3300049776 Bacteria 7803
864 Ga0501282_000493 3300049778 Bacteria 4700
865 Ga0501035_0168692 3300049822 Bacteria 1892
866 Ga0501044_0006548 3300049823 Bacteria 12857
867 Ga0501044_0010061 3300049823 Bacteria 10279
868 Ga0501226_000044 3300049853 Bacteria 56354
869 nmdc:mga03683_229_c1 3300050489 Bacteria 17517
870 nmdc:mga03683_463_c1 3300050489 Bacteria 11717
871 nmdc:mga03n38_5700_c1 3300050490 Bacteria 4265
872 nmdc:mga00v17_3081_c2 3300050491 Bacteria 3920
873 nmdc:mga00v17_39430_c1 3300050491 Bacteria 2829
874 nmdc:mga0k408_110078_c1 3300050493 Bacteria 1628
875 nmdc:mga0k408_1430_c1 3300050493 Bacteria 12925
876 nmdc:mga0k408_51841_c1 3300050493 Bacteria 2377
877 nmdc:mga06z11_3692_c1 3300050494 Bacteria 5945
878 nmdc:mga06z11_519_c1 3300050494 Bacteria 14218
879 nmdc:mga04h51_69_c1 3300050495 Bacteria 33095
880 nmdc:mga04h51_7426_c1 3300050495 Bacteria 2892
881 nmdc:mga07m45_30503_c1 3300050496 Bacteria 2986
882 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
883 nmdc:mga07m45_50847_c1 3300050496 Bacteria 2336
884 nmdc:mga07m45_73112_c1 3300050496 Bacteria 1952
885 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
886 nmdc:mga0sz30_15458_c1 3300050516 Bacteria 3016
887 nmdc:mga0sz30_585_c1 3300050516 Bacteria 13728
888 Ga0500610_0013948 3300053079 Bacteria 3756
889 Ga0500643_000004 3300053087 Bacteria 857484
890 Ga0500643_000283 3300053087 Bacteria 43805
891 Ga0500643_000330 3300053087 Bacteria 37938
892 Ga0500643_000513 3300053087 Bacteria 27509
893 Ga0500643_000620 3300053087 Bacteria 24035
894 Ga0500643_001124 3300053087 Bacteria 15971
895 Ga0500643_001505 3300053087 Bacteria 13338
896 Ga0500643_006824 3300053087 Bacteria 4704
897 Ga0500643_009073 3300053087 Bacteria 3835
898 Ga0500651_0021296 3300053093 Bacteria 4041
899 Ga0500555_003466 3300053103 Bacteria 4493
900 Ga0500556_0000144 3300053104 Bacteria 59354
901 Ga0500562_000252 3300053108 Bacteria 13785
902 Ga0500592_000568 3300053116 Bacteria 6104
903 Ga0500592_001514 3300053116 Bacteria 3762
904 Ga0500592_003121 3300053116 Bacteria 2648
905 Ga0500592_011306 3300053116 Bacteria 1427
906 Ga0500607_000098 3300053121 Bacteria 65919
907 Ga0500607_000381 3300053121 Bacteria 42415
908 Ga0500608_000054 3300053122 Bacteria 51067
909 Ga0500614_022454 3300053123 Bacteria 1473
910 Ga0500618_000803 3300053125 Bacteria 17291
911 Ga0500618_017176 3300053125 Bacteria 1803
912 Ga0500642_0000001 3300053130 Bacteria 1468402
913 Ga0500642_0017110 3300053130 Bacteria 2771
914 Ga0500655_000561 3300053133 Bacteria 7469
915 Ga0500658_0001466 3300053134 Bacteria 9439
916 Ga0500658_0001655 3300053134 Bacteria 8866
917 Ga0500559_0000607 3300053136 Bacteria 24382
918 Ga0500559_0001427 3300053136 Bacteria 13559
919 Ga0500559_0011941 3300053136 Bacteria 3702
920 Ga0500559_0012105 3300053136 Bacteria 3674
921 Ga0500559_0024336 3300053136 Bacteria 2576
922 Ga0500559_0054494 3300053136 Bacteria 1771
923 Ga0500559_0054945 3300053136 Bacteria 1765
924 Ga0500573_0000278 3300053140 Bacteria 21754
925 Ga0500573_0119818 3300053140 Bacteria 1466
926 Ga0500590_000301 3300053148 Bacteria 15719
927 Ga0500590_017734 3300053148 Bacteria 3680
928 Ga0500604_0002278 3300053151 Bacteria 5253
929 Ga0500616_0001893 3300053153 Bacteria 18825
930 Ga0500622_0001014 3300053156 Bacteria 23572
931 Ga0500622_0057718 3300053156 Bacteria 1985
932 Ga0500624_000015 3300053157 Bacteria 161928
933 Ga0500624_000023 3300053157 Bacteria 114997
934 Ga0500624_000289 3300053157 Bacteria 17376
935 Ga0500627_0000104 3300053158 Bacteria 28060
936 Ga0500627_0000488 3300053158 Bacteria 10673
937 Ga0500627_0000778 3300053158 Bacteria 8492
938 Ga0500636_0003237 3300053177 Bacteria 9121
939 Ga0500636_0011030 3300053177 Bacteria 5286
940 Ga0500636_0026651 3300053177 Bacteria 3414
941 Ga0500637_0000013 3300053178 Bacteria 73168
942 Ga0500637_0057843 3300053178 Bacteria 2217
943 Ga0500567_007512 3300053723 Bacteria 5134
944 Ga0500570_006332 3300053724 Bacteria 6424
945 Ga0500611_002591 3300053727 Bacteria 2194
946 Ga0500625_000002 3300053729 Bacteria 371909
947 Ga0500645_000002 3300053730 Bacteria 388892
948 Ga0500645_000780 3300053730 Bacteria 19276
949 Ga0500645_006477 3300053730 Bacteria 4171
950 Ga0500645_013828 3300053730 Bacteria 2583
951 Ga0500645_018269 3300053730 Bacteria 2191
952 Ga0500645_021520 3300053730 Bacteria 1990
953 Ga0500596_002731 3300053735 Bacteria 3458

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042010 Ga0439452_025280 Ga0439452_025280_507_1421 280
2 3300048915 Ga0496112_0629436 Ga0496112_0629436_16_984 315
3 3300013306 Ga0163162_10015484 Ga0163162_100154842 335
4 3300010375 Ga0105239_10618628 Ga0105239_106186282 336
5 3300015690 Ga0183363_1004 Ga0183363_1004199 337
6 3300053134 Ga0500658_0001655 Ga0500658_0001655_1452_2558 337
7 3300005618 Ga0068864_100000642 Ga0068864_10000064230 338
8 3300005842 Ga0068858_100000304 Ga0068858_1000003048 338
9 3300026035 Ga0207703_10000435 Ga0207703_100004352 338
10 3300026095 Ga0207676_10000603 Ga0207676_100006032 338
11 3300025972 Ga0207668_10316619 Ga0207668_103166191 339
12 3300041404 Ga0439436_0018522 Ga0439436_0018522_845_1951 341
13 3300041413 Ga0439465_0016622 Ga0439465_0016622_353_1465 342
14 3300042004 Ga0439445_0011274 Ga0439445_0011274_977_2089 342
15 3300046519 Ga0495632_0052730 Ga0495632_0052730_15_1043 342
16 3300025924 Ga0207694_10175781 Ga0207694_101757812 343
17 3300053730 Ga0500645_018269 Ga0500645_018269_124_1230 343
18 3300041404 Ga0439436_0009476 Ga0439436_0009476_722_1834 344
19 3300041410 Ga0439461_0000086 Ga0439461_0000086_4710_5822 344
20 3300041413 Ga0439465_0001125 Ga0439465_0001125_6314_7426 344
21 3300041997 Ga0439431_0000491 Ga0439431_0000491_897_2009 344
22 3300042006 Ga0439432_005779 Ga0439432_005779_2006_3118 344
23 3300048920 Ga0496117_0012763 Ga0496117_0012763_2782_3906 345
24 3300048921 Ga0496118_0007285 Ga0496118_0007285_6370_7494 345
25 3300005539 Ga0068853_100019326 Ga0068853_1000193264 348
26 3300049658 Ga0501211_000821 Ga0501211_000821_168_1253 349
27 3300049669 Ga0501235_002575 Ga0501235_002575_860_1945 349
28 3300049686 Ga0501257_000029 Ga0501257_000029_34340_35464 349
29 3300048903 Ga0496100_0147390 Ga0496100_0147390_414_1502 351
30 3300049663 Ga0501223_000010 Ga0501223_000010_19444_20505 351
31 3300049676 Ga0501246_000669 Ga0501246_000669_63_1124 351
32 3300049705 Ga0501225_0000008 Ga0501225_0000008_7813_8874 351
33 3300027665 Ga0209983_1009114 Ga0209983_10091142 352
34 3300045051 Ga0451576_0000588 Ga0451576_0000588_30101_31216 352
35 3300005530 Ga0070679_100008282 Ga0070679_1000082827 353
36 3300025921 Ga0207652_10008597 Ga0207652_100085978 353
37 3300031548 Ga0307408_100024261 Ga0307408_1000242614 353
38 3300031911 Ga0307412_10043331 Ga0307412_100433312 353
39 3300032002 Ga0307416_100046276 Ga0307416_1000462762 353
40 3300053136 Ga0500559_0054494 Ga0500559_0054494_144_1256 353
41 3300026088 Ga0207641_10025885 Ga0207641_100258853 354
42 3300005618 Ga0068864_100001753 Ga0068864_10000175314 355
43 3300005841 Ga0068863_100017269 Ga0068863_1000172698 355
44 3300026088 Ga0207641_10000346 Ga0207641_1000034659 355
45 3300026095 Ga0207676_10003853 Ga0207676_1000385310 355
46 3300045051 Ga0451576_0215241 Ga0451576_0215241_239_1384 355
47 3300046492 Ga0495585_0070263 Ga0495585_0070263_289_1401 355
48 3300053140 Ga0500573_0000278 Ga0500573_0000278_2329_3441 355
49 3300005331 Ga0070670_100240614 Ga0070670_1002406141 356
50 3300005355 Ga0070671_100039115 Ga0070671_1000391153 356
51 3300005367 Ga0070667_100104253 Ga0070667_1001042531 356
52 3300005842 Ga0068858_100016712 Ga0068858_1000167124 356
53 3300009177 Ga0105248_10175942 Ga0105248_101759422 356
54 3300025931 Ga0207644_10021357 Ga0207644_100213573 356
55 3300025941 Ga0207711_10048966 Ga0207711_100489662 356
56 3300026035 Ga0207703_10001956 Ga0207703_100019564 356
57 3300041997 Ga0439431_0020680 Ga0439431_0020680_27_1133 356
58 3300048912 Ga0496109_0076132 Ga0496109_0076132_1227_2372 356
59 3300048917 Ga0496114_0074792 Ga0496114_0074792_1348_2493 356
60 3300048927 Ga0496124_0149687 Ga0496124_0149687_504_1649 356
61 3300048929 Ga0496126_0140487 Ga0496126_0140487_139_1284 356
62 3300050493 nmdc:mga0k408_51841_c1 nmdc:mga0k408_51841_c1_1273_2349 357
63 3300053087 Ga0500643_009073 Ga0500643_009073_1829_2935 357
64 3300002076 JGI24749J21850_1000087 JGI24749J21850_100008718 359
65 3300002459 JGI24751J29686_10000054 JGI24751J29686_1000005475 359
66 3300005331 Ga0070670_100000003 Ga0070670_100000003392 359
67 3300005335 Ga0070666_10198050 Ga0070666_101980501 359
68 3300005353 Ga0070669_100000020 Ga0070669_100000020141 359
69 3300005367 Ga0070667_100000851 Ga0070667_10000085123 359
70 3300005617 Ga0068859_100001299 Ga0068859_10000129927 359
71 3300005618 Ga0068864_100000005 Ga0068864_100000005260 359
72 3300005719 Ga0068861_100088296 Ga0068861_1000882963 359
73 3300005844 Ga0068862_100000001 Ga0068862_100000001181 359
74 3300006880 Ga0075429_100039568 Ga0075429_1000395683 359
75 3300006880 Ga0075429_100102528 Ga0075429_1001025282 359
76 3300006931 Ga0097620_100001299 Ga0097620_10000129927 359
77 3300009177 Ga0105248_10000086 Ga0105248_10000086121 359
78 3300014326 Ga0157380_10000060 Ga0157380_1000006018 359
79 3300025923 Ga0207681_10000005 Ga0207681_10000005332 359
80 3300025925 Ga0207650_10000004 Ga0207650_10000004390 359
81 3300025941 Ga0207711_10000310 Ga0207711_1000031041 359
82 3300025986 Ga0207658_10001330 Ga0207658_100013306 359
83 3300026095 Ga0207676_10000006 Ga0207676_10000006322 359
84 3300026118 Ga0207675_100020136 Ga0207675_1000201362 359
85 3300028380 Ga0268265_10000001 Ga0268265_10000001850 359
86 3300031616 Ga0307508_10001821 Ga0307508_100018212 359
87 3300046460 Ga0495638_0000018 Ga0495638_0000018_120498_121646 359
88 3300046460 Ga0495638_0001145 Ga0495638_0001145_9288_10400 359
89 3300046506 Ga0495583_0000187 Ga0495583_0000187_8221_9369 359
90 3300046524 Ga0495648_0000018 Ga0495648_0000018_160845_161993 359
91 3300046616 Ga0495668_0041896 Ga0495668_0041896_816_1964 359
92 3300046660 Ga0495625_0000153 Ga0495625_0000153_49737_50855 359
93 3300046692 Ga0495671_0000011 Ga0495671_0000011_184548_185696 359
94 3300047469 Ga0495673_0000013 Ga0495673_0000013_452612_453760 359
95 3300048928 Ga0496125_0088882 Ga0496125_0088882_1084_2169 359
96 3300053116 Ga0500592_003121 Ga0500592_003121_984_2132 359
97 3300053134 Ga0500658_0001466 Ga0500658_0001466_791_1903 359
98 3300001976 JGI24752J21851_1001369 JGI24752J21851_10013693 360
99 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012106 360
100 3300005331 Ga0070670_100000965 Ga0070670_1000009659 360
101 3300005367 Ga0070667_100002068 Ga0070667_1000020688 360
102 3300005618 Ga0068864_100000332 Ga0068864_10000033240 360
103 3300005841 Ga0068863_100000456 Ga0068863_1000004569 360
104 3300005844 Ga0068862_100000506 Ga0068862_10000050640 360
105 3300009011 Ga0105251_10001625 Ga0105251_1000162510 360
106 3300009177 Ga0105248_10000029 Ga0105248_1000002940 360
107 3300009551 Ga0105238_10254974 Ga0105238_102549741 360
108 3300009553 Ga0105249_10000024 Ga0105249_1000002423 360
109 3300025261 Ga0209233_1000058 Ga0209233_1000058313 360
110 3300025919 Ga0207657_10186792 Ga0207657_101867921 360
111 3300025925 Ga0207650_10000545 Ga0207650_1000054516 360
112 3300025941 Ga0207711_10000004 Ga0207711_10000004467 360
113 3300025961 Ga0207712_10000034 Ga0207712_1000003424 360
114 3300025986 Ga0207658_10000434 Ga0207658_1000043425 360
115 3300026088 Ga0207641_10000010 Ga0207641_10000010118 360
116 3300026095 Ga0207676_10000036 Ga0207676_10000036160 360
117 3300028380 Ga0268265_10000059 Ga0268265_10000059113 360
118 3300046513 Ga0495616_0000024 Ga0495616_0000024_75619_76767 360
119 3300046616 Ga0495668_0010303 Ga0495668_0010303_3926_5074 360
120 3300048904 Ga0496101_0029318 Ga0496101_0029318_514_1656 360
121 3300048906 Ga0496103_0010198 Ga0496103_0010198_3956_5098 360
122 3300048920 Ga0496117_0006558 Ga0496117_0006558_7406_8548 360
123 3300048920 Ga0496117_0013579 Ga0496117_0013579_3131_4252 360
124 3300048921 Ga0496118_0004591 Ga0496118_0004591_7428_8570 360
125 3300053136 Ga0500559_0054945 Ga0500559_0054945_340_1452 360
126 3300053151 Ga0500604_0002278 Ga0500604_0002278_2752_3900 360
127 3300053158 Ga0500627_0000488 Ga0500627_0000488_9079_10227 360
128 iso_pu_bacteria 2830075706 2830078125 361
129 3300026035 Ga0207703_10109986 Ga0207703_101099862 362
130 3300032004 Ga0307414_10000070 Ga0307414_1000007050 362
131 3300042015 Ga0439462_0002734 Ga0439462_0002734_675_1808 362
132 3300049569 Ga0501032_0060590 Ga0501032_0060590_845_1987 362
133 3300049579 Ga0501043_0051084 Ga0501043_0051084_574_1716 362
134 3300049581 Ga0501047_0000447 Ga0501047_0000447_466_1608 362
135 3300001915 JGI24741J21665_1001215 JGI24741J21665_10012157 363
136 3300001979 JGI24740J21852_10000540 JGI24740J21852_1000054017 363
137 3300001989 JGI24739J22299_10003942 JGI24739J22299_100039426 363
138 3300001990 JGI24737J22298_10004191 JGI24737J22298_100041911 363
139 3300002067 JGI24735J21928_10000861 JGI24735J21928_100008618 363
140 3300005289 Ga0065704_10105609 Ga0065704_101056092 363
141 3300005327 Ga0070658_10032881 Ga0070658_100328812 363
142 3300005327 Ga0070658_10032902 Ga0070658_100329024 363
143 3300005336 Ga0070680_100011845 Ga0070680_1000118454 363
144 3300005347 Ga0070668_100042436 Ga0070668_1000424363 363
145 3300005353 Ga0070669_100050393 Ga0070669_1000503932 363
146 3300005355 Ga0070671_100002625 Ga0070671_1000026256 363
147 3300005366 Ga0070659_100008121 Ga0070659_1000081218 363
148 3300005455 Ga0070663_100129135 Ga0070663_1001291352 363
149 3300005458 Ga0070681_10005668 Ga0070681_1000566812 363
150 3300005459 Ga0068867_100235491 Ga0068867_1002354912 363
151 3300005548 Ga0070665_100137757 Ga0070665_1001377572 363
152 3300005563 Ga0068855_100014816 Ga0068855_1000148162 363
153 3300005564 Ga0070664_100020427 Ga0070664_1000204275 363
154 3300005564 Ga0070664_100102464 Ga0070664_1001024641 363
155 3300005577 Ga0068857_100009607 Ga0068857_1000096072 363
156 3300005577 Ga0068857_100069212 Ga0068857_1000692122 363
157 3300005614 Ga0068856_100011400 Ga0068856_1000114003 363
158 3300005834 Ga0068851_10042184 Ga0068851_100421842 363
159 3300005842 Ga0068858_100000472 Ga0068858_1000004726 363
160 3300009093 Ga0105240_10070426 Ga0105240_100704264 363
161 3300009098 Ga0105245_10001108 Ga0105245_1000110817 363
162 3300009147 Ga0114129_10021496 Ga0114129_100214968 363
163 3300009174 Ga0105241_10000997 Ga0105241_1000099714 363
164 3300009174 Ga0105241_10166400 Ga0105241_101664002 363
165 3300009545 Ga0105237_10007129 Ga0105237_100071294 363
166 3300010375 Ga0105239_10067612 Ga0105239_100676124 363
167 3300013100 Ga0157373_10003358 Ga0157373_100033585 363
168 3300013102 Ga0157371_10003665 Ga0157371_100036659 363
169 3300013102 Ga0157371_10140860 Ga0157371_101408602 363
170 3300013104 Ga0157370_10013758 Ga0157370_100137585 363
171 3300013104 Ga0157370_10330811 Ga0157370_103308111 363
172 3300013105 Ga0157369_10115578 Ga0157369_101155782 363
173 3300013307 Ga0157372_10242033 Ga0157372_102420331 363
174 3300013307 Ga0157372_10328848 Ga0157372_103288482 363
175 3300014326 Ga0157380_10148878 Ga0157380_101488782 363
176 3300025904 Ga0207647_10008366 Ga0207647_100083662 363
177 3300025912 Ga0207707_10069377 Ga0207707_100693772 363
178 3300025913 Ga0207695_10095696 Ga0207695_100956962 363
179 3300025919 Ga0207657_10000408 Ga0207657_1000040848 363
180 3300025919 Ga0207657_10002471 Ga0207657_100024718 363
181 3300025920 Ga0207649_10159200 Ga0207649_101592001 363
182 3300025924 Ga0207694_10182713 Ga0207694_101827132 363
183 3300025927 Ga0207687_10000853 Ga0207687_1000085314 363
184 3300025931 Ga0207644_10070832 Ga0207644_100708322 363
185 3300025932 Ga0207690_10023275 Ga0207690_100232753 363
186 3300025932 Ga0207690_10031743 Ga0207690_100317434 363
187 3300025933 Ga0207706_10002919 Ga0207706_100029198 363
188 3300025933 Ga0207706_10004237 Ga0207706_100042378 363
189 3300025944 Ga0207661_10256435 Ga0207661_102564351 363
190 3300025945 Ga0207679_10100238 Ga0207679_101002382 363
191 3300025949 Ga0207667_10118401 Ga0207667_101184012 363
192 3300025981 Ga0207640_10018948 Ga0207640_100189483 363
193 3300026035 Ga0207703_10000568 Ga0207703_1000056835 363
194 3300026041 Ga0207639_10045628 Ga0207639_100456282 363
195 3300026041 Ga0207639_10074344 Ga0207639_100743443 363
196 3300026041 Ga0207639_10224291 Ga0207639_102242912 363
197 3300026067 Ga0207678_10000324 Ga0207678_1000032425 363
198 3300026078 Ga0207702_10005910 Ga0207702_100059103 363
199 3300026116 Ga0207674_10003143 Ga0207674_100031439 363
200 3300026116 Ga0207674_10009082 Ga0207674_1000908211 363
201 3300026116 Ga0207674_10085003 Ga0207674_100850032 363
202 3300031548 Ga0307408_100062683 Ga0307408_1000626832 363
203 3300031911 Ga0307412_10025366 Ga0307412_100253662 363
204 3300032002 Ga0307416_100080150 Ga0307416_1000801502 363
205 3300037418 Ga0395900_0044548 Ga0395900_0044548_991_2103 363
206 3300037466 Ga0395898_0018073 Ga0395898_0018073_1584_2696 363
207 3300038443 Ga0395901_0018063 Ga0395901_0018063_5503_6615 363
208 3300045976 Ga0466967_0082472 Ga0466967_0082472_1273_2385 363
209 3300046530 Ga0495654_0005346 Ga0495654_0005346_5259_6407 363
210 3300046616 Ga0495668_0000016 Ga0495668_0000016_292480_293598 363
211 3300046616 Ga0495668_0011827 Ga0495668_0011827_1706_2854 363
212 3300047472 Ga0495686_0039832 Ga0495686_0039832_163_1293 363
213 3300048905 Ga0496102_0369014 Ga0496102_0369014_109_1260 363
214 3300048912 Ga0496109_0069384 Ga0496109_0069384_562_1713 363
215 3300048913 Ga0496110_0017737 Ga0496110_0017737_4422_5573 363
216 3300048916 Ga0496113_0004827 Ga0496113_0004827_6535_7686 363
217 3300048919 Ga0496116_0034167 Ga0496116_0034167_516_1643 363
218 3300048924 Ga0496121_0003164 Ga0496121_0003164_6272_7399 363
219 3300048924 Ga0496121_0009156 Ga0496121_0009156_8806_9936 363
220 3300048928 Ga0496125_0095291 Ga0496125_0095291_216_1367 363
221 3300048928 Ga0496125_0129831 Ga0496125_0129831_351_1478 363
222 3300049515 Ga0501292_000247 Ga0501292_000247_3984_5123 363
223 3300049663 Ga0501223_002105 Ga0501223_002105_1387_2526 363
224 3300049664 Ga0501224_009536 Ga0501224_009536_272_1411 363
225 3300049690 Ga0501261_000214 Ga0501261_000214_4138_5277 363
226 3300049708 Ga0501245_000464 Ga0501245_000464_2443_3582 363
227 3300049775 Ga0501279_000220 Ga0501279_000220_4152_5291 363
228 3300049776 Ga0501280_000649 Ga0501280_000649_2624_3763 363
229 3300049778 Ga0501282_000493 Ga0501282_000493_1820_2959 363
230 3300053093 Ga0500651_0021296 Ga0500651_0021296_1594_2718 363
231 3300053123 Ga0500614_022454 Ga0500614_022454_202_1326 363
232 3300053156 Ga0500622_0057718 Ga0500622_0057718_768_1892 363
233 3300053158 Ga0500627_0000778 Ga0500627_0000778_5236_6384 363
234 iso_pu_bacteria 2990265787 2990266443 363
235 iso_pu_bacteria 2993693658 2993695764 363
236 3300001904 JGI24736J21556_1000256 JGI24736J21556_10002562 365
237 3300001976 JGI24752J21851_1000062 JGI24752J21851_100006212 365
238 3300001979 JGI24740J21852_10005886 JGI24740J21852_100058864 365
239 3300001989 JGI24739J22299_10004578 JGI24739J22299_100045782 365
240 3300002067 JGI24735J21928_10003084 JGI24735J21928_100030843 365
241 3300002070 JGI24750J21931_1000036 JGI24750J21931_10000368 365
242 3300002074 JGI24748J21848_1000103 JGI24748J21848_10001038 365
243 3300002075 JGI24738J21930_10001565 JGI24738J21930_100015653 365
244 3300002239 JGI24034J26672_10000057 JGI24034J26672_1000005740 365
245 3300002244 JGI24742J22300_10004425 JGI24742J22300_100044252 365
246 3300005329 Ga0070683_100170222 Ga0070683_1001702222 365
247 3300005330 Ga0070690_100000011 Ga0070690_10000001195 365
248 3300005331 Ga0070670_100018785 Ga0070670_1000187856 365
249 3300005335 Ga0070666_10000035 Ga0070666_10000035119 365
250 3300005340 Ga0070689_100002742 Ga0070689_1000027424 365
251 3300005353 Ga0070669_100000712 Ga0070669_1000007128 365
252 3300005365 Ga0070688_100001328 Ga0070688_1000013288 365
253 3300005366 Ga0070659_100070457 Ga0070659_1000704572 365
254 3300005455 Ga0070663_100017417 Ga0070663_1000174175 365
255 3300005466 Ga0070685_10000168 Ga0070685_100001688 365
256 3300005544 Ga0070686_100001324 Ga0070686_1000013246 365
257 3300005548 Ga0070665_100000161 Ga0070665_1000001618 365
258 3300005577 Ga0068857_100245112 Ga0068857_1002451121 365
259 3300005578 Ga0068854_100305493 Ga0068854_1003054931 365
260 3300005614 Ga0068856_100494178 Ga0068856_1004941781 365
261 3300005616 Ga0068852_100108194 Ga0068852_1001081943 365
262 3300005617 Ga0068859_100006610 Ga0068859_10000661012 365
263 3300005618 Ga0068864_100025454 Ga0068864_1000254544 365
264 3300005719 Ga0068861_100015879 Ga0068861_1000158792 365
265 3300005841 Ga0068863_100000060 Ga0068863_1000000608 365
266 3300005842 Ga0068858_100022636 Ga0068858_1000226361 365
267 3300005843 Ga0068860_100000126 Ga0068860_1000001268 365
268 3300005844 Ga0068862_100001574 Ga0068862_1000015744 365
269 3300006931 Ga0097620_100006610 Ga0097620_10000661012 365
270 3300009553 Ga0105249_10000094 Ga0105249_10000094121 365
271 3300013104 Ga0157370_10051407 Ga0157370_100514074 365
272 3300013307 Ga0157372_10035441 Ga0157372_100354413 365
273 3300014325 Ga0163163_10008504 Ga0163163_100085046 365
274 3300014326 Ga0157380_10000542 Ga0157380_100005422 365
275 3300014968 Ga0157379_10004525 Ga0157379_100045258 365
276 3300017792 Ga0163161_10000716 Ga0163161_100007166 365
277 3300025321 Ga0207656_10005981 Ga0207656_100059814 365
278 3300025903 Ga0207680_10000007 Ga0207680_10000007397 365
279 3300025911 Ga0207654_10002907 Ga0207654_100029073 365
280 3300025913 Ga0207695_10075297 Ga0207695_100752974 365
281 3300025914 Ga0207671_10018947 Ga0207671_100189474 365
282 3300025919 Ga0207657_10011633 Ga0207657_100116332 365
283 3300025923 Ga0207681_10000089 Ga0207681_100000894 365
284 3300025924 Ga0207694_10005621 Ga0207694_100056216 365
285 3300025931 Ga0207644_10003216 Ga0207644_100032168 365
286 3300025936 Ga0207670_10013004 Ga0207670_100130044 365
287 3300025941 Ga0207711_10024128 Ga0207711_100241282 365
288 3300025949 Ga0207667_10008229 Ga0207667_100082294 365
289 3300025961 Ga0207712_10000004 Ga0207712_10000004385 365
290 3300025986 Ga0207658_10002894 Ga0207658_100028948 365
291 3300026035 Ga0207703_10012521 Ga0207703_100125216 365
292 3300026067 Ga0207678_10041873 Ga0207678_100418733 365
293 3300026078 Ga0207702_10113370 Ga0207702_101133702 365
294 3300026088 Ga0207641_10000100 Ga0207641_10000100124 365
295 3300026095 Ga0207676_10002760 Ga0207676_100027604 365
296 3300026118 Ga0207675_100003757 Ga0207675_1000037578 365
297 3300026142 Ga0207698_10027376 Ga0207698_100273762 365
298 3300028379 Ga0268266_10000040 Ga0268266_10000040309 365
299 3300028380 Ga0268265_10002795 Ga0268265_1000279510 365
300 3300028381 Ga0268264_10000003 Ga0268264_10000003399 365
301 3300048906 Ga0496103_0001160 Ga0496103_0001160_7186_8334 365
302 3300048907 Ga0496104_0103178 Ga0496104_0103178_551_1699 365
303 3300048908 Ga0496105_0115218 Ga0496105_0115218_776_1924 365
304 3300048909 Ga0496106_0017827 Ga0496106_0017827_3294_4442 365
305 3300048910 Ga0496107_0026839 Ga0496107_0026839_2846_3994 365
306 3300048920 Ga0496117_0003444 Ga0496117_0003444_447_1595 365
307 3300048922 Ga0496119_0090783 Ga0496119_0090783_295_1443 365
308 3300048927 Ga0496124_0138686 Ga0496124_0138686_729_1877 365
309 3300005327 Ga0070658_10105365 Ga0070658_101053652 366
310 3300005331 Ga0070670_100000210 Ga0070670_10000021010 366
311 3300005335 Ga0070666_10013840 Ga0070666_100138406 366
312 3300005347 Ga0070668_100000014 Ga0070668_10000001460 366
313 3300005353 Ga0070669_100003995 Ga0070669_10000399512 366
314 3300005366 Ga0070659_100216272 Ga0070659_1002162722 366
315 3300005367 Ga0070667_100000051 Ga0070667_100000051110 366
316 3300005367 Ga0070667_100011284 Ga0070667_1000112849 366
317 3300005440 Ga0070705_100004759 Ga0070705_1000047592 366
318 3300005445 Ga0070708_100094332 Ga0070708_1000943322 366
319 3300005564 Ga0070664_100013946 Ga0070664_1000139464 366
320 3300005577 Ga0068857_100084922 Ga0068857_1000849222 366
321 3300005578 Ga0068854_100010741 Ga0068854_1000107416 366
322 3300005617 Ga0068859_100000256 Ga0068859_10000025644 366
323 3300005841 Ga0068863_100000028 Ga0068863_100000028140 366
324 3300005843 Ga0068860_100007410 Ga0068860_10000741013 366
325 3300006931 Ga0097620_100000256 Ga0097620_10000025644 366
326 3300009101 Ga0105247_10000644 Ga0105247_1000064412 366
327 3300009148 Ga0105243_10261150 Ga0105243_102611502 366
328 3300009553 Ga0105249_10002324 Ga0105249_100023247 366
329 3300014968 Ga0157379_10042529 Ga0157379_100425292 366
330 3300025900 Ga0207710_10006923 Ga0207710_100069236 366
331 3300025903 Ga0207680_10003829 Ga0207680_100038299 366
332 3300025909 Ga0207705_10090342 Ga0207705_100903422 366
333 3300025923 Ga0207681_10041605 Ga0207681_100416052 366
334 3300025925 Ga0207650_10010295 Ga0207650_100102958 366
335 3300025932 Ga0207690_10225677 Ga0207690_102256771 366
336 3300025935 Ga0207709_10193909 Ga0207709_101939092 366
337 3300025941 Ga0207711_10019413 Ga0207711_100194132 366
338 3300025972 Ga0207668_10000047 Ga0207668_1000004758 366
339 3300025981 Ga0207640_10002545 Ga0207640_100025456 366
340 3300025986 Ga0207658_10000057 Ga0207658_10000057111 366
341 3300026067 Ga0207678_10013334 Ga0207678_100133342 366
342 3300026088 Ga0207641_10000014 Ga0207641_10000014286 366
343 3300026116 Ga0207674_10100585 Ga0207674_101005852 366
344 3300028380 Ga0268265_10070580 Ga0268265_100705803 366
345 3300028381 Ga0268264_10004451 Ga0268264_100044514 366
346 3300046471 Ga0495650_0021897 Ga0495650_0021897_1349_2491 366
347 3300049574 Ga0501038_0047716 Ga0501038_0047716_1185_2315 366
348 3300005339 Ga0070660_100075680 Ga0070660_1000756803 367
349 3300005539 Ga0068853_100009085 Ga0068853_1000090856 367
350 3300005563 Ga0068855_100000962 Ga0068855_10000096211 367
351 3300005614 Ga0068856_100332962 Ga0068856_1003329621 367
352 3300009093 Ga0105240_10078303 Ga0105240_100783034 367
353 3300009551 Ga0105238_10203403 Ga0105238_102034032 367
354 3300013297 Ga0157378_10187768 Ga0157378_101877682 367
355 3300013306 Ga0163162_10012124 Ga0163162_100121243 367
356 3300025912 Ga0207707_10141338 Ga0207707_101413382 367
357 3300025913 Ga0207695_10055082 Ga0207695_100550822 367
358 3300025919 Ga0207657_10085021 Ga0207657_100850214 367
359 3300025921 Ga0207652_10114171 Ga0207652_101141712 367
360 3300025924 Ga0207694_10061619 Ga0207694_100616194 367
361 3300025949 Ga0207667_10004952 Ga0207667_100049528 367
362 3300026041 Ga0207639_10018070 Ga0207639_100180704 367
363 3300026078 Ga0207702_10255571 Ga0207702_102555712 367
364 3300028653 Ga0265323_10023219 Ga0265323_100232192 367
365 3300031344 Ga0265316_10002067 Ga0265316_100020678 367
366 3300031712 Ga0265342_10103895 Ga0265342_101038951 367
367 3300031852 Ga0307410_10131432 Ga0307410_101314322 367
368 3300031901 Ga0307406_10043622 Ga0307406_100436222 367
369 3300046524 Ga0495648_0039704 Ga0495648_0039704_1330_2442 367
370 3300046537 Ga0495598_0015882 Ga0495598_0015882_531_1664 367
371 3300046539 Ga0495621_0016225 Ga0495621_0016225_1224_2357 367
372 3300048917 Ga0496114_0019776 Ga0496114_0019776_2249_3385 367
373 3300053148 Ga0500590_017734 Ga0500590_017734_1819_2961 367
374 3300001976 JGI24752J21851_1007004 JGI24752J21851_10070042 368
375 3300005335 Ga0070666_10000089 Ga0070666_1000008926 368
376 3300005353 Ga0070669_100000024 Ga0070669_100000024154 368
377 3300005355 Ga0070671_100000006 Ga0070671_10000000698 368
378 3300005543 Ga0070672_100315773 Ga0070672_1003157732 368
379 3300005548 Ga0070665_100012580 Ga0070665_1000125804 368
380 3300005615 Ga0070702_100028407 Ga0070702_1000284073 368
381 3300005618 Ga0068864_100053335 Ga0068864_1000533353 368
382 3300005719 Ga0068861_100001329 Ga0068861_1000013295 368
383 3300005841 Ga0068863_100000719 Ga0068863_10000071913 368
384 3300005842 Ga0068858_100002895 Ga0068858_10000289515 368
385 3300005843 Ga0068860_100001698 Ga0068860_1000016985 368
386 3300005844 Ga0068862_100000310 Ga0068862_10000031039 368
387 3300009011 Ga0105251_10069374 Ga0105251_100693742 368
388 3300013306 Ga0163162_10003527 Ga0163162_100035275 368
389 3300025315 Ga0207697_10000419 Ga0207697_1000041923 368
390 3300025903 Ga0207680_10000517 Ga0207680_1000051715 368
391 3300025923 Ga0207681_10000004 Ga0207681_10000004328 368
392 3300025931 Ga0207644_10000009 Ga0207644_10000009152 368
393 3300025972 Ga0207668_10009940 Ga0207668_100099403 368
394 3300025986 Ga0207658_10003250 Ga0207658_100032507 368
395 3300026035 Ga0207703_10001946 Ga0207703_100019467 368
396 3300026088 Ga0207641_10002944 Ga0207641_1000294410 368
397 3300026095 Ga0207676_10004588 Ga0207676_1000458812 368
398 3300026118 Ga0207675_100000740 Ga0207675_10000074027 368
399 3300028379 Ga0268266_10029365 Ga0268266_100293656 368
400 3300028380 Ga0268265_10002264 Ga0268265_1000226415 368
401 3300028381 Ga0268264_10000069 Ga0268264_1000006994 368
402 3300028786 Ga0307517_10076293 Ga0307517_100762932 368
403 3300031235 Ga0265330_10009538 Ga0265330_100095382 368
404 3300033180 Ga0307510_10008642 Ga0307510_1000864210 368
405 3300036712 Ga0316584_0087070 Ga0316584_0087070_975_2111 368
406 3300046492 Ga0495585_0107265 Ga0495585_0107265_254_1363 368
407 3300046660 Ga0495625_0003185 Ga0495625_0003185_14843_15955 368
408 3300048905 Ga0496102_0000199 Ga0496102_0000199_10651_11760 368
409 3300048906 Ga0496103_0000633 Ga0496103_0000633_15314_16423 368
410 3300048907 Ga0496104_0038825 Ga0496104_0038825_2453_3562 368
411 3300048908 Ga0496105_0000690 Ga0496105_0000690_10770_11879 368
412 3300048913 Ga0496110_0063880 Ga0496110_0063880_635_1744 368
413 3300048914 Ga0496111_0061819 Ga0496111_0061819_501_1610 368
414 3300048916 Ga0496113_0141577 Ga0496113_0141577_17_1126 368
415 3300048918 Ga0496115_0000131 Ga0496115_0000131_48867_49976 368
416 3300048920 Ga0496117_0000352 Ga0496117_0000352_69604_70713 368
417 3300048921 Ga0496118_0000092 Ga0496118_0000092_157437_158546 368
418 3300048922 Ga0496119_0004697 Ga0496119_0004697_8772_9881 368
419 3300048924 Ga0496121_0000228 Ga0496121_0000228_48904_50013 368
420 3300048926 Ga0496123_0040904 Ga0496123_0040904_15_1124 368
421 3300048927 Ga0496124_0000081 Ga0496124_0000081_49796_50905 368
422 3300048928 Ga0496125_0000980 Ga0496125_0000980_11506_12615 368
423 3300048929 Ga0496126_0000283 Ga0496126_0000283_10569_11678 368
424 3300053087 Ga0500643_000620 Ga0500643_000620_14039_15151 368
425 3300053730 Ga0500645_021520 Ga0500645_021520_208_1320 368
426 iso_pu_bacteria 2643221605 2644038908 368
427 3300005330 Ga0070690_100046244 Ga0070690_1000462442 369
428 3300005331 Ga0070670_100190597 Ga0070670_1001905972 369
429 3300005353 Ga0070669_100000334 Ga0070669_10000033415 369
430 3300005355 Ga0070671_100000138 Ga0070671_10000013837 369
431 3300005367 Ga0070667_100040604 Ga0070667_1000406044 369
432 3300005544 Ga0070686_100017427 Ga0070686_1000174272 369
433 3300005563 Ga0068855_100040224 Ga0068855_1000402244 369
434 3300005617 Ga0068859_100025168 Ga0068859_1000251682 369
435 3300005618 Ga0068864_100118219 Ga0068864_1001182192 369
436 3300005842 Ga0068858_100104346 Ga0068858_1001043463 369
437 3300005843 Ga0068860_100006149 Ga0068860_10000614912 369
438 3300005843 Ga0068860_100174989 Ga0068860_1001749892 369
439 3300005844 Ga0068862_100000085 Ga0068862_10000008591 369
440 3300006931 Ga0097620_100025168 Ga0097620_1000251688 369
441 3300009177 Ga0105248_10120069 Ga0105248_101200692 369
442 3300009553 Ga0105249_10000038 Ga0105249_10000038167 369
443 3300014325 Ga0163163_10172430 Ga0163163_101724302 369
444 3300025315 Ga0207697_10012242 Ga0207697_100122422 369
445 3300025923 Ga0207681_10001365 Ga0207681_100013659 369
446 3300025925 Ga0207650_10083091 Ga0207650_100830912 369
447 3300025931 Ga0207644_10000005 Ga0207644_10000005182 369
448 3300025961 Ga0207712_10000002 Ga0207712_10000002167 369
449 3300026035 Ga0207703_10126510 Ga0207703_101265101 369
450 3300026095 Ga0207676_10028724 Ga0207676_100287243 369
451 3300026116 Ga0207674_10161876 Ga0207674_101618761 369
452 3300028380 Ga0268265_10000104 Ga0268265_1000010477 369
453 3300028381 Ga0268264_10012761 Ga0268264_100127616 369
454 3300028381 Ga0268264_10146421 Ga0268264_101464212 369
455 3300031456 Ga0307513_10040993 Ga0307513_100409932 369
456 3300048904 Ga0496101_0047847 Ga0496101_0047847_1872_3017 369
457 3300048905 Ga0496102_0043153 Ga0496102_0043153_1960_3105 369
458 3300048906 Ga0496103_0050435 Ga0496103_0050435_300_1445 369
459 3300048908 Ga0496105_0026430 Ga0496105_0026430_201_1346 369
460 3300048908 Ga0496105_0275811 Ga0496105_0275811_66_1211 369
461 3300048910 Ga0496107_0000794 Ga0496107_0000794_4708_5853 369
462 3300048911 Ga0496108_0036958 Ga0496108_0036958_225_1370 369
463 3300048916 Ga0496113_0003620 Ga0496113_0003620_6432_7577 369
464 3300048924 Ga0496121_0086801 Ga0496121_0086801_455_1600 369
465 iso_pu_bacteria 2880518877 2880522326 369
466 3300001915 JGI24741J21665_1001032 JGI24741J21665_10010323 370
467 3300001979 JGI24740J21852_10011274 JGI24740J21852_100112742 370
468 3300001990 JGI24737J22298_10002455 JGI24737J22298_100024554 370
469 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005278 370
470 3300003759 Ga0055525_1000012 Ga0055525_1000012320 370
471 3300003762 Ga0055542_1000355 Ga0055542_100035539 370
472 3300003763 Ga0055529_1000045 Ga0055529_1000045169 370
473 3300005327 Ga0070658_10001571 Ga0070658_1000157118 370
474 3300005339 Ga0070660_100148168 Ga0070660_1001481682 370
475 3300005344 Ga0070661_100011173 Ga0070661_1000111734 370
476 3300005356 Ga0070674_100011307 Ga0070674_1000113075 370
477 3300005455 Ga0070663_100100915 Ga0070663_1001009152 370
478 3300005456 Ga0070678_100012555 Ga0070678_1000125552 370
479 3300005459 Ga0068867_100007513 Ga0068867_1000075138 370
480 3300005539 Ga0068853_100174305 Ga0068853_1001743052 370
481 3300005548 Ga0070665_100000206 Ga0070665_10000020633 370
482 3300005563 Ga0068855_100060879 Ga0068855_1000608793 370
483 3300005834 Ga0068851_10011445 Ga0068851_100114454 370
484 3300006237 Ga0097621_100136045 Ga0097621_1001360452 370
485 3300009148 Ga0105243_10000423 Ga0105243_1000042316 370
486 3300013102 Ga0157371_10000032 Ga0157371_1000003277 370
487 3300025230 Ga0209563_100030 Ga0209563_100030130 370
488 3300025253 Ga0209677_104116 Ga0209677_1041165 370
489 3300025254 Ga0209148_1000011 Ga0209148_1000011596 370
490 3300025272 Ga0209455_1000006 Ga0209455_1000006598 370
491 3300025297 Ga0209758_1000001 Ga0209758_1000001281 370
492 3300025321 Ga0207656_10000378 Ga0207656_100003783 370
493 3300025904 Ga0207647_10026599 Ga0207647_100265993 370
494 3300025904 Ga0207647_10064805 Ga0207647_100648052 370
495 3300025907 Ga0207645_10165005 Ga0207645_101650051 370
496 3300025909 Ga0207705_10000122 Ga0207705_100001225 370
497 3300025913 Ga0207695_10015610 Ga0207695_100156107 370
498 3300025919 Ga0207657_10007801 Ga0207657_100078014 370
499 3300025920 Ga0207649_10000482 Ga0207649_100004827 370
500 3300025924 Ga0207694_10018966 Ga0207694_100189665 370
501 3300025932 Ga0207690_10000696 Ga0207690_1000069621 370
502 3300025935 Ga0207709_10000574 Ga0207709_1000057429 370
503 3300025937 Ga0207669_10006239 Ga0207669_100062395 370
504 3300025949 Ga0207667_10000002 Ga0207667_10000002327 370
505 3300025981 Ga0207640_10000586 Ga0207640_1000058619 370
506 3300026041 Ga0207639_10000777 Ga0207639_100007775 370
507 3300026067 Ga0207678_10005545 Ga0207678_1000554511 370
508 3300026078 Ga0207702_10006661 Ga0207702_100066619 370
509 3300026116 Ga0207674_10012390 Ga0207674_100123908 370
510 3300026121 Ga0207683_10022042 Ga0207683_100220426 370
511 3300028379 Ga0268266_10000002 Ga0268266_100000021698 370
512 3300031456 Ga0307513_10006540 Ga0307513_100065403 370
513 3300031852 Ga0307410_10032147 Ga0307410_100321472 370
514 3300031995 Ga0307409_100108884 Ga0307409_1001088842 370
515 3300032004 Ga0307414_10000359 Ga0307414_1000035912 370
516 3300032005 Ga0307411_10230582 Ga0307411_102305822 370
517 3300032126 Ga0307415_100206526 Ga0307415_1002065262 370
518 3300046459 Ga0495629_0046040 Ga0495629_0046040_714_1832 370
519 3300046460 Ga0495638_0111145 Ga0495638_0111145_497_1615 370
520 3300046471 Ga0495650_0000158 Ga0495650_0000158_49935_51053 370
521 3300046492 Ga0495585_0007224 Ga0495585_0007224_2456_3574 370
522 3300046506 Ga0495583_0000631 Ga0495583_0000631_4124_5242 370
523 3300046506 Ga0495583_0010716 Ga0495583_0010716_2011_3129 370
524 3300046507 Ga0495606_0000672 Ga0495606_0000672_27160_28278 370
525 3300046518 Ga0495631_0023064 Ga0495631_0023064_1113_2231 370
526 3300046520 Ga0495637_0040095 Ga0495637_0040095_708_1826 370
527 3300046522 Ga0495643_0008719 Ga0495643_0008719_2672_3790 370
528 3300046522 Ga0495643_0012069 Ga0495643_0012069_1274_2392 370
529 3300046524 Ga0495648_0000143 Ga0495648_0000143_37081_38199 370
530 3300046525 Ga0495663_0007556 Ga0495663_0007556_1774_2892 370
531 3300046536 Ga0495587_0019617 Ga0495587_0019617_617_1735 370
532 3300046558 Ga0495633_0011496 Ga0495633_0011496_2652_3770 370
533 3300046660 Ga0495625_0000150 Ga0495625_0000150_49079_50197 370
534 3300046660 Ga0495625_0025768 Ga0495625_0025768_994_2112 370
535 3300046665 Ga0495661_0068431 Ga0495661_0068431_382_1500 370
536 3300046684 Ga0495669_0000050 Ga0495669_0000050_7162_8280 370
537 3300046809 Ga0495600_0000690 Ga0495600_0000690_2441_3559 370
538 3300047323 Ga0495683_0000963 Ga0495683_0000963_3418_4536 370
539 3300047443 Ga0495687_001845 Ga0495687_001845_3850_4968 370
540 3300047443 Ga0495687_002183 Ga0495687_002183_2728_3846 370
541 3300047470 Ga0495681_0011835 Ga0495681_0011835_1024_2142 370
542 3300048912 Ga0496109_0122522 Ga0496109_0122522_93_1211 370
543 3300053079 Ga0500610_0013948 Ga0500610_0013948_757_1875 370
544 3300053087 Ga0500643_001505 Ga0500643_001505_10025_11146 370
545 3300053130 Ga0500642_0017110 Ga0500642_0017110_631_1749 370
546 3300053177 Ga0500636_0011030 Ga0500636_0011030_1699_2817 370
547 3300053730 Ga0500645_000002 Ga0500645_000002_26318_27436 370
548 3300053735 Ga0500596_002731 Ga0500596_002731_392_1510 370
549 iso_pu_bacteria 2582581305 2585261175 370
550 iso_pu_bacteria 2775507255 2778125010 370
551 iso_pu_bacteria 2919709256 2919709701 370
552 3300005331 Ga0070670_100009509 Ga0070670_1000095093 371
553 3300005335 Ga0070666_10036618 Ga0070666_100366182 371
554 3300005335 Ga0070666_10158615 Ga0070666_101586151 371
555 3300005347 Ga0070668_100000003 Ga0070668_100000003184 371
556 3300005347 Ga0070668_100007280 Ga0070668_1000072807 371
557 3300005353 Ga0070669_100034312 Ga0070669_1000343123 371
558 3300005353 Ga0070669_100157764 Ga0070669_1001577642 371
559 3300005355 Ga0070671_100000435 Ga0070671_10000043521 371
560 3300005355 Ga0070671_100210640 Ga0070671_1002106402 371
561 3300005367 Ga0070667_100000298 Ga0070667_10000029844 371
562 3300005367 Ga0070667_100001003 Ga0070667_1000010035 371
563 3300005548 Ga0070665_100287580 Ga0070665_1002875802 371
564 3300005577 Ga0068857_100018029 Ga0068857_1000180293 371
565 3300005577 Ga0068857_100194718 Ga0068857_1001947182 371
566 3300005578 Ga0068854_100012195 Ga0068854_1000121954 371
567 3300005578 Ga0068854_100019472 Ga0068854_1000194724 371
568 3300005841 Ga0068863_100005237 Ga0068863_1000052378 371
569 3300005841 Ga0068863_100415980 Ga0068863_1004159801 371
570 3300005842 Ga0068858_100004091 Ga0068858_1000040918 371
571 3300005843 Ga0068860_100000143 Ga0068860_10000014362 371
572 3300005843 Ga0068860_100000412 Ga0068860_10000041245 371
573 3300005844 Ga0068862_100000168 Ga0068862_1000001682 371
574 3300005844 Ga0068862_100010705 Ga0068862_1000107058 371
575 3300009093 Ga0105240_10001848 Ga0105240_100018484 371
576 3300009093 Ga0105240_10035481 Ga0105240_100354815 371
577 3300009177 Ga0105248_10031271 Ga0105248_100312714 371
578 3300009545 Ga0105237_10002073 Ga0105237_100020735 371
579 3300010375 Ga0105239_10027686 Ga0105239_100276863 371
580 3300012513 Ga0157326_1000001 Ga0157326_10000015 371
581 3300025903 Ga0207680_10125961 Ga0207680_101259612 371
582 3300025903 Ga0207680_10140440 Ga0207680_101404401 371
583 3300025903 Ga0207680_10155143 Ga0207680_101551432 371
584 3300025913 Ga0207695_10000288 Ga0207695_1000028819 371
585 3300025913 Ga0207695_10036202 Ga0207695_100362021 371
586 3300025914 Ga0207671_10001439 Ga0207671_1000143928 371
587 3300025923 Ga0207681_10004407 Ga0207681_100044079 371
588 3300025923 Ga0207681_10140268 Ga0207681_101402682 371
589 3300025925 Ga0207650_10015807 Ga0207650_100158075 371
590 3300025931 Ga0207644_10000447 Ga0207644_1000044716 371
591 3300025933 Ga0207706_10075750 Ga0207706_100757503 371
592 3300025972 Ga0207668_10000006 Ga0207668_10000006180 371
593 3300025972 Ga0207668_10004706 Ga0207668_100047065 371
594 3300025986 Ga0207658_10000026 Ga0207658_10000026125 371
595 3300025986 Ga0207658_10000254 Ga0207658_1000025443 371
596 3300026035 Ga0207703_10001463 Ga0207703_100014638 371
597 3300026088 Ga0207641_10002472 Ga0207641_1000247215 371
598 3300026088 Ga0207641_10017728 Ga0207641_100177287 371
599 3300026116 Ga0207674_10330920 Ga0207674_103309202 371
600 3300028380 Ga0268265_10000986 Ga0268265_1000098619 371
601 3300028380 Ga0268265_10107211 Ga0268265_101072112 371
602 3300028381 Ga0268264_10000076 Ga0268264_1000007662 371
603 3300028381 Ga0268264_10000083 Ga0268264_1000008343 371
604 3300031911 Ga0307412_10000457 Ga0307412_100004573 371
605 3300031911 Ga0307412_10002757 Ga0307412_100027574 371
606 3300031911 Ga0307412_10025379 Ga0307412_100253792 371
607 3300031911 Ga0307412_10086777 Ga0307412_100867772 371
608 3300032002 Ga0307416_100111520 Ga0307416_1001115202 371
609 3300048905 Ga0496102_0000243 Ga0496102_0000243_10117_11238 371
610 3300048906 Ga0496103_0000479 Ga0496103_0000479_30582_31703 371
611 3300048907 Ga0496104_0090818 Ga0496104_0090818_236_1357 371
612 3300048908 Ga0496105_0131538 Ga0496105_0131538_825_1946 371
613 3300048919 Ga0496116_0002567 Ga0496116_0002567_16032_17153 371
614 3300048920 Ga0496117_0000179 Ga0496117_0000179_40087_41208 371
615 3300048920 Ga0496117_0013905 Ga0496117_0013905_4154_5275 371
616 3300048921 Ga0496118_0000030 Ga0496118_0000030_298739_299860 371
617 3300048921 Ga0496118_0007538 Ga0496118_0007538_10029_11171 371
618 3300048921 Ga0496118_0179622 Ga0496118_0179622_56_1177 371
619 3300048924 Ga0496121_0001839 Ga0496121_0001839_1278_2402 371
620 3300048924 Ga0496121_0001919 Ga0496121_0001919_31464_32588 371
621 3300048924 Ga0496121_0023268 Ga0496121_0023268_1642_2763 371
622 3300048925 Ga0496122_0096877 Ga0496122_0096877_217_1338 371
623 3300048926 Ga0496123_0023217 Ga0496123_0023217_2818_3939 371
624 3300048926 Ga0496123_0079366 Ga0496123_0079366_640_1782 371
625 3300048927 Ga0496124_0000264 Ga0496124_0000264_40087_41208 371
626 3300048929 Ga0496126_0142783 Ga0496126_0142783_495_1619 371
627 3300053087 Ga0500643_000283 Ga0500643_000283_34580_35704 371
628 3300053116 Ga0500592_000568 Ga0500592_000568_777_1901 371
629 3300053125 Ga0500618_000803 Ga0500618_000803_11842_12969 371
630 3300053133 Ga0500655_000561 Ga0500655_000561_1370_2494 371
631 3300053148 Ga0500590_000301 Ga0500590_000301_8777_9901 371
632 3300053157 Ga0500624_000023 Ga0500624_000023_47707_48828 371
633 3300053158 Ga0500627_0000104 Ga0500627_0000104_2206_3330 371
634 3300053178 Ga0500637_0000013 Ga0500637_0000013_39593_40714 371
635 3300053724 Ga0500570_006332 Ga0500570_006332_872_1996 371
636 iso_pu_bacteria 2599185359 2600227764 371
637 iso_pu_bacteria 2643221541 2643728122 371
638 iso_pu_bacteria 2643221588 2643950313 371
639 iso_pu_bacteria 2643221606 2644042929 371
640 iso_pu_bacteria 2643221671 2644395640 371
641 iso_pu_bacteria 2808606401 2809062414 371
642 iso_pu_bacteria 2808606404 2809078246 371
643 iso_pu_bacteria 2808606405 2809082803 371
644 iso_pu_bacteria 2818991466 2819714197 371
645 iso_pu_bacteria 2879163058 2879166507 371
646 iso_pu_bacteria 2882806704 2882808499 371
647 iso_pu_bacteria 2928526807 2928530411 371
648 iso_pu_bacteria 2928968154 2928968207 371
649 3300005262 Ga0065165_1004400 Ga0065165_100440010 372
650 3300009148 Ga0105243_10075604 Ga0105243_100756042 372
651 3300009545 Ga0105237_10009460 Ga0105237_100094604 372
652 3300017792 Ga0163161_10082721 Ga0163161_100827212 372
653 3300025914 Ga0207671_10006770 Ga0207671_100067709 372
654 3300047469 Ga0495673_0018818 Ga0495673_0018818_1242_2369 372
655 3300047472 Ga0495686_0000363 Ga0495686_0000363_56041_57168 372
656 3300047472 Ga0495686_0043044 Ga0495686_0043044_1278_2405 372
657 3300048923 Ga0496120_0051004 Ga0496120_0051004_185_1312 372
658 3300048925 Ga0496122_0041018 Ga0496122_0041018_753_1928 372
659 3300048926 Ga0496123_0011704 Ga0496123_0011704_6036_7211 372
660 3300048926 Ga0496123_0050151 Ga0496123_0050151_225_1400 372
661 3300048927 Ga0496124_0000684 Ga0496124_0000684_28474_29646 372
662 3300048927 Ga0496124_0003283 Ga0496124_0003283_3405_4580 372
663 3300048927 Ga0496124_0035004 Ga0496124_0035004_1890_3065 372
664 3300049823 Ga0501044_0010061 Ga0501044_0010061_4224_5351 372
665 3300053087 Ga0500643_000513 Ga0500643_000513_24971_26101 372
666 iso_pu_bacteria 2510917021 2511127888 372
667 iso_pu_bacteria 2738541275 2738709712 372
668 iso_pu_bacteria 2738541301 2738848137 372
669 iso_pu_bacteria 2738541304 2738863866 372
670 iso_pu_bacteria 2738543022 2739296384 372
671 iso_pu_bacteria 2738543033 2739358062 372
672 iso_pu_bacteria 2739367664 2739651933 372
673 iso_pu_bacteria 2739367865 2740030407 372
674 iso_pu_bacteria 2818991438 2819552456 372
675 iso_pu_bacteria 2848297114 2848297489 372
676 iso_pu_bacteria 2895880812 2895884209 372
677 iso_pu_bacteria 2896184354 2896186822 372
678 iso_pu_bacteria 2919138771 2919142784 372
679 iso_pu_bacteria 2928100450 2928101268 372
680 iso_pu_bacteria 2928959182 2928960321 372
681 iso_pu_bacteria 3000865235 3000866560 372
682 iso_pu_bacteria 8054302542 8054304953 372
683 3300001989 JGI24739J22299_10001027 JGI24739J22299_100010279 373
684 3300005289 Ga0065704_10007473 Ga0065704_100074732 373
685 3300005295 Ga0065707_10083253 Ga0065707_100832536 373
686 3300005353 Ga0070669_100024149 Ga0070669_1000241492 373
687 3300005457 Ga0070662_100012698 Ga0070662_1000126984 373
688 3300005539 Ga0068853_100004036 Ga0068853_1000040366 373
689 3300005539 Ga0068853_100025577 Ga0068853_1000255774 373
690 3300005577 Ga0068857_100065228 Ga0068857_1000652282 373
691 3300005614 Ga0068856_100142927 Ga0068856_1001429272 373
692 3300005616 Ga0068852_100183379 Ga0068852_1001833792 373
693 3300005937 Ga0081455_10000131 Ga0081455_1000013127 373
694 3300006042 Ga0075368_10041808 Ga0075368_100418082 373
695 3300006048 Ga0075363_100003814 Ga0075363_1000038143 373
696 3300006178 Ga0075367_10000092 Ga0075367_1000009223 373
697 3300006353 Ga0075370_10045379 Ga0075370_100453792 373
698 3300009011 Ga0105251_10010467 Ga0105251_100104673 373
699 3300009545 Ga0105237_10140837 Ga0105237_101408372 373
700 3300009551 Ga0105238_10182143 Ga0105238_101821432 373
701 3300009978 Ga0105148_100059 Ga0105148_1000596 373
702 3300013105 Ga0157369_10289035 Ga0157369_102890352 373
703 3300021388 Ga0213875_10000264 Ga0213875_1000026421 373
704 3300025229 Ga0209147_104064 Ga0209147_1040642 373
705 3300025913 Ga0207695_10150591 Ga0207695_101505911 373
706 3300025923 Ga0207681_10018758 Ga0207681_100187585 373
707 3300025924 Ga0207694_10237460 Ga0207694_102374602 373
708 3300025933 Ga0207706_10012315 Ga0207706_100123155 373
709 3300025981 Ga0207640_10070046 Ga0207640_100700462 373
710 3300026041 Ga0207639_10003342 Ga0207639_1000334210 373
711 3300026041 Ga0207639_10020172 Ga0207639_100201723 373
712 3300026078 Ga0207702_10113339 Ga0207702_101133392 373
713 3300026116 Ga0207674_10004472 Ga0207674_100044726 373
714 3300026116 Ga0207674_10014452 Ga0207674_100144526 373
715 3300027866 Ga0209813_10000114 Ga0209813_100001145 373
716 3300031548 Ga0307408_100069487 Ga0307408_1000694873 373
717 3300031911 Ga0307412_10004671 Ga0307412_100046714 373
718 3300031911 Ga0307412_10066770 Ga0307412_100667702 373
719 3300032004 Ga0307414_10000288 Ga0307414_100002887 373
720 3300037853 Ga0436364_1200653 Ga0436364_1200653_9234_10373 373
721 3300041460 Ga0451802_1561412 Ga0451802_1561412_370_1506 373
722 3300046452 Ga0495617_025936 Ga0495617_025936_14_1144 373
723 3300046453 Ga0495627_000094 Ga0495627_000094_71464_72594 373
724 3300046453 Ga0495627_000391 Ga0495627_000391_23640_24770 373
725 3300046460 Ga0495638_0006816 Ga0495638_0006816_4574_5713 373
726 3300046460 Ga0495638_0017047 Ga0495638_0017047_838_1968 373
727 3300046506 Ga0495583_0000139 Ga0495583_0000139_59108_60247 373
728 3300046507 Ga0495606_0000685 Ga0495606_0000685_12341_13480 373
729 3300046507 Ga0495606_0033566 Ga0495606_0033566_2173_3312 373
730 3300046512 Ga0495610_0000886 Ga0495610_0000886_11737_12867 373
731 3300046512 Ga0495610_0020645 Ga0495610_0020645_788_1918 373
732 3300046519 Ga0495632_0000383 Ga0495632_0000383_21286_22416 373
733 3300046520 Ga0495637_0008273 Ga0495637_0008273_775_1905 373
734 3300046522 Ga0495643_0000030 Ga0495643_0000030_166276_167406 373
735 3300046525 Ga0495663_0000003 Ga0495663_0000003_340279_341409 373
736 3300046558 Ga0495633_0000184 Ga0495633_0000184_16724_17854 373
737 3300046558 Ga0495633_0000892 Ga0495633_0000892_7889_9019 373
738 3300046660 Ga0495625_0093400 Ga0495625_0093400_16_1146 373
739 3300046665 Ga0495661_0038909 Ga0495661_0038909_466_1605 373
740 3300046691 Ga0495670_0059556 Ga0495670_0059556_361_1500 373
741 3300046692 Ga0495671_0000072 Ga0495671_0000072_3362_4492 373
742 3300047469 Ga0495673_0014606 Ga0495673_0014606_2255_3394 373
743 3300047470 Ga0495681_0000342 Ga0495681_0000342_22726_23856 373
744 3300047472 Ga0495686_0000182 Ga0495686_0000182_21472_22614 373
745 3300047472 Ga0495686_0005716 Ga0495686_0005716_7961_9100 373
746 3300047472 Ga0495686_0010474 Ga0495686_0010474_1698_2828 373
747 3300047472 Ga0495686_0023442 Ga0495686_0023442_1611_2747 373
748 3300047472 Ga0495686_0099114 Ga0495686_0099114_174_1310 373
749 3300048921 Ga0496118_0094030 Ga0496118_0094030_453_1589 373
750 3300048922 Ga0496119_0023936 Ga0496119_0023936_1439_2575 373
751 3300048924 Ga0496121_0045089 Ga0496121_0045089_403_1533 373
752 3300048924 Ga0496121_0081421 Ga0496121_0081421_922_2058 373
753 3300048925 Ga0496122_0082928 Ga0496122_0082928_928_2058 373
754 3300048927 Ga0496124_0066690 Ga0496124_0066690_1832_2962 373
755 3300048928 Ga0496125_0009124 Ga0496125_0009124_8988_10124 373
756 3300048928 Ga0496125_0053383 Ga0496125_0053383_1754_2884 373
757 3300048929 Ga0496126_0148654 Ga0496126_0148654_461_1597 373
758 3300048929 Ga0496126_0166748 Ga0496126_0166748_434_1564 373
759 3300049663 Ga0501223_000112 Ga0501223_000112_9442_10572 373
760 3300049664 Ga0501224_000020 Ga0501224_000020_60349_61479 373
761 3300049668 Ga0501233_001867 Ga0501233_001867_1089_2219 373
762 3300049669 Ga0501235_001604 Ga0501235_001604_2034_3164 373
763 3300049705 Ga0501225_0000135 Ga0501225_0000135_9604_10734 373
764 3300049705 Ga0501225_0003339 Ga0501225_0003339_1167_2318 373
765 3300049853 Ga0501226_000044 Ga0501226_000044_12865_13995 373
766 3300050490 nmdc:mga03n38_5700_c1 nmdc:mga03n38_5700_c1_987_2117 373
767 3300050494 nmdc:mga06z11_3692_c1 nmdc:mga06z11_3692_c1_4662_5792 373
768 3300050495 nmdc:mga04h51_69_c1 nmdc:mga04h51_69_c1_22412_23542 373
769 3300050496 nmdc:mga07m45_73112_c1 nmdc:mga07m45_73112_c1_281_1411 373
770 3300053087 Ga0500643_000330 Ga0500643_000330_18611_19741 373
771 3300053087 Ga0500643_001124 Ga0500643_001124_8932_10080 373
772 3300053087 Ga0500643_006824 Ga0500643_006824_2502_3632 373
773 3300053103 Ga0500555_003466 Ga0500555_003466_1056_2195 373
774 3300053116 Ga0500592_001514 Ga0500592_001514_1752_2900 373
775 3300053125 Ga0500618_017176 Ga0500618_017176_91_1230 373
776 3300053136 Ga0500559_0001427 Ga0500559_0001427_1492_2622 373
777 3300053136 Ga0500559_0011941 Ga0500559_0011941_657_1793 373
778 3300053157 Ga0500624_000015 Ga0500624_000015_105788_106918 373
779 3300053157 Ga0500624_000289 Ga0500624_000289_832_1962 373
780 3300053177 Ga0500636_0003237 Ga0500636_0003237_7831_8961 373
781 3300053727 Ga0500611_002591 Ga0500611_002591_626_1774 373
782 3300053730 Ga0500645_013828 Ga0500645_013828_125_1279 373
783 3300005841 Ga0068863_100028865 Ga0068863_1000288656 374
784 3300006058 Ga0075432_10004187 Ga0075432_100041874 374
785 3300026088 Ga0207641_10025121 Ga0207641_100251212 374
786 3300027907 Ga0207428_10036711 Ga0207428_100367114 374
787 3300036401 Ga0373937_0071330 Ga0373937_0071330_527_1726 374
788 3300048924 Ga0496121_0000017 Ga0496121_0000017_122224_123366 374
789 3300049586 Ga0501070_0159647 Ga0501070_0159647_164_1294 374
790 3300050496 nmdc:mga07m45_50847_c1 nmdc:mga07m45_50847_c1_756_1886 374
791 3300053108 Ga0500562_000252 Ga0500562_000252_8502_9638 374
792 3300053177 Ga0500636_0026651 Ga0500636_0026651_1027_2163 374
793 3300005367 Ga0070667_100014546 Ga0070667_1000145463 375
794 3300005548 Ga0070665_100088252 Ga0070665_1000882523 375
795 3300005841 Ga0068863_100000016 Ga0068863_10000001691 375
796 3300005843 Ga0068860_100000168 Ga0068860_10000016816 375
797 3300006042 Ga0075368_10001483 Ga0075368_100014832 375
798 3300006177 Ga0075362_10000526 Ga0075362_100005264 375
799 3300006195 Ga0075366_10006887 Ga0075366_100068874 375
800 3300025909 Ga0207705_10123396 Ga0207705_101233962 375
801 3300025986 Ga0207658_10007629 Ga0207658_100076293 375
802 3300026035 Ga0207703_10070059 Ga0207703_100700593 375
803 3300026088 Ga0207641_10000315 Ga0207641_1000031523 375
804 3300026095 Ga0207676_10011106 Ga0207676_100111063 375
805 3300027866 Ga0209813_10000530 Ga0209813_100005304 375
806 3300028379 Ga0268266_10015509 Ga0268266_100155096 375
807 3300028381 Ga0268264_10000040 Ga0268264_10000040120 375
808 3300031250 Ga0265331_10064820 Ga0265331_100648202 375
809 3300031731 Ga0307405_10003814 Ga0307405_100038144 375
810 3300032133 Ga0316583_10008936 Ga0316583_100089364 375
811 3300036647 Ga0316582_0014476 Ga0316582_0014476_1718_2851 375
812 3300036712 Ga0316584_0074383 Ga0316584_0074383_561_1694 375
813 3300046616 Ga0495668_0082368 Ga0495668_0082368_600_1739 375
814 3300046660 Ga0495625_0008151 Ga0495625_0008151_2007_3146 375
815 3300046692 Ga0495671_0005155 Ga0495671_0005155_4502_5641 375
816 3300048907 Ga0496104_0014211 Ga0496104_0014211_43_1179 375
817 3300048908 Ga0496105_0010962 Ga0496105_0010962_522_1787 375
818 3300048921 Ga0496118_0031432 Ga0496118_0031432_2552_3688 375
819 3300048923 Ga0496120_0047341 Ga0496120_0047341_940_2205 375
820 3300048924 Ga0496121_0000526 Ga0496121_0000526_9474_10610 375
821 3300048925 Ga0496122_0000176 Ga0496122_0000176_131717_132856 375
822 3300048926 Ga0496123_0000291 Ga0496123_0000291_22588_23727 375
823 3300048929 Ga0496126_0274736 Ga0496126_0274736_38_1177 375
824 3300050489 nmdc:mga03683_229_c1 nmdc:mga03683_229_c1_5422_6552 375
825 3300050491 nmdc:mga00v17_3081_c2 nmdc:mga00v17_3081_c2_127_1257 375
826 3300050494 nmdc:mga06z11_519_c1 nmdc:mga06z11_519_c1_10422_11552 375
827 3300050495 nmdc:mga04h51_7426_c1 nmdc:mga04h51_7426_c1_1097_2227 375
828 3300050496 nmdc:mga07m45_33_c1 nmdc:mga07m45_33_c1_23403_24533 375
829 3300053104 Ga0500556_0000144 Ga0500556_0000144_27371_28510 375
830 3300053130 Ga0500642_0000001 Ga0500642_0000001_329059_330198 375
831 3300053730 Ga0500645_000780 Ga0500645_000780_16416_17555 375
832 iso_pu_bacteria 2512564014 2512643376 375
833 3300002459 JGI24751J29686_10000140 JGI24751J29686_100001404 376
834 3300005289 Ga0065704_10001493 Ga0065704_100014934 376
835 3300005327 Ga0070658_10000067 Ga0070658_1000006786 376
836 3300005329 Ga0070683_100172906 Ga0070683_1001729062 376
837 3300005347 Ga0070668_100003251 Ga0070668_1000032519 376
838 3300005353 Ga0070669_100000473 Ga0070669_10000047327 376
839 3300005353 Ga0070669_100002131 Ga0070669_10000213115 376
840 3300005355 Ga0070671_100000542 Ga0070671_10000054212 376
841 3300005367 Ga0070667_100000128 Ga0070667_10000012856 376
842 3300005367 Ga0070667_100004204 Ga0070667_1000042047 376
843 3300005367 Ga0070667_100049569 Ga0070667_1000495692 376
844 3300005440 Ga0070705_100099149 Ga0070705_1000991492 376
845 3300005548 Ga0070665_100001356 Ga0070665_1000013569 376
846 3300005548 Ga0070665_100010985 Ga0070665_1000109857 376
847 3300005563 Ga0068855_100015135 Ga0068855_1000151353 376
848 3300005578 Ga0068854_100003154 Ga0068854_1000031545 376
849 3300005614 Ga0068856_100004323 Ga0068856_1000043232 376
850 3300005616 Ga0068852_100000075 Ga0068852_10000007541 376
851 3300005841 Ga0068863_100010358 Ga0068863_1000103586 376
852 3300005843 Ga0068860_100017637 Ga0068860_1000176374 376
853 3300005844 Ga0068862_100010728 Ga0068862_1000107282 376
854 3300005844 Ga0068862_100040836 Ga0068862_1000408362 376
855 3300005844 Ga0068862_100089890 Ga0068862_1000898902 376
856 3300006048 Ga0075363_100003377 Ga0075363_1000033773 376
857 3300006051 Ga0075364_10016692 Ga0075364_100166923 376
858 3300006177 Ga0075362_10000234 Ga0075362_1000023415 376
859 3300006195 Ga0075366_10000168 Ga0075366_100001684 376
860 3300006195 Ga0075366_10021504 Ga0075366_100215044 376
861 3300006353 Ga0075370_10000032 Ga0075370_100000325 376
862 3300006946 Ga0079104_1008150 Ga0079104_10081503 376
863 3300009011 Ga0105251_10001861 Ga0105251_100018613 376
864 3300009011 Ga0105251_10061191 Ga0105251_100611912 376
865 3300009093 Ga0105240_10010488 Ga0105240_100104888 376
866 3300009101 Ga0105247_10037912 Ga0105247_100379121 376
867 3300009177 Ga0105248_10013528 Ga0105248_100135287 376
868 3300009177 Ga0105248_10024262 Ga0105248_100242628 376
869 3300009551 Ga0105238_10017115 Ga0105238_100171159 376
870 3300009553 Ga0105249_10348210 Ga0105249_103482102 376
871 3300013104 Ga0157370_10053190 Ga0157370_100531902 376
872 3300013306 Ga0163162_10044800 Ga0163162_100448003 376
873 3300025298 Ga0209050_1000441 Ga0209050_100044121 376
874 3300025315 Ga0207697_10015555 Ga0207697_100155552 376
875 3300025735 Ga0207713_1002460 Ga0207713_100246014 376
876 3300025735 Ga0207713_1016496 Ga0207713_10164965 376
877 3300025900 Ga0207710_10035134 Ga0207710_100351341 376
878 3300025909 Ga0207705_10000075 Ga0207705_1000007567 376
879 3300025913 Ga0207695_10006069 Ga0207695_100060698 376
880 3300025923 Ga0207681_10000503 Ga0207681_1000050313 376
881 3300025923 Ga0207681_10000663 Ga0207681_100006632 376
882 3300025924 Ga0207694_10009731 Ga0207694_100097312 376
883 3300025925 Ga0207650_10047790 Ga0207650_100477902 376
884 3300025931 Ga0207644_10001520 Ga0207644_1000152010 376
885 3300025931 Ga0207644_10020323 Ga0207644_100203232 376
886 3300025941 Ga0207711_10002363 Ga0207711_1000236311 376
887 3300025949 Ga0207667_10013795 Ga0207667_100137959 376
888 3300025949 Ga0207667_10301320 Ga0207667_103013202 376
889 3300025972 Ga0207668_10003433 Ga0207668_100034337 376
890 3300025972 Ga0207668_10003815 Ga0207668_100038157 376
891 3300025981 Ga0207640_10000570 Ga0207640_100005703 376
892 3300025986 Ga0207658_10002944 Ga0207658_100029447 376
893 3300025986 Ga0207658_10025127 Ga0207658_100251272 376
894 3300025986 Ga0207658_10031477 Ga0207658_100314774 376
895 3300025986 Ga0207658_10110014 Ga0207658_101100143 376
896 3300026078 Ga0207702_10037147 Ga0207702_100371474 376
897 3300026088 Ga0207641_10022838 Ga0207641_100228382 376
898 3300026142 Ga0207698_10000005 Ga0207698_10000005181 376
899 3300027111 Ga0209281_1010835 Ga0209281_10108352 376
900 3300028379 Ga0268266_10000534 Ga0268266_100005349 376
901 3300028379 Ga0268266_10008419 Ga0268266_100084197 376
902 3300028380 Ga0268265_10001459 Ga0268265_100014599 376
903 3300028380 Ga0268265_10013635 Ga0268265_100136353 376
904 3300028381 Ga0268264_10029925 Ga0268264_100299252 376
905 3300031251 Ga0265327_10034616 Ga0265327_100346162 376
906 3300031824 Ga0307413_10061015 Ga0307413_100610152 376
907 3300031824 Ga0307413_10246634 Ga0307413_102466342 376
908 3300032005 Ga0307411_10007009 Ga0307411_100070094 376
909 3300044712 Ga0453684_0260886 Ga0453684_0260886_809_1939 376
910 3300046453 Ga0495627_001469 Ga0495627_001469_12432_13565 376
911 3300046460 Ga0495638_0015526 Ga0495638_0015526_1806_2948 376
912 3300046460 Ga0495638_0043711 Ga0495638_0043711_63_1208 376
913 3300046471 Ga0495650_0001135 Ga0495650_0001135_12373_13506 376
914 3300046500 Ga0495596_0000054 Ga0495596_0000054_51110_52243 376
915 3300046500 Ga0495596_0001629 Ga0495596_0001629_1598_2728 376
916 3300046501 Ga0495607_0011251 Ga0495607_0011251_4728_5861 376
917 3300046506 Ga0495583_0032633 Ga0495583_0032633_702_1835 376
918 3300046512 Ga0495610_0000022 Ga0495610_0000022_202603_203736 376
919 3300046512 Ga0495610_0000081 Ga0495610_0000081_48172_49302 376
920 3300046512 Ga0495610_0002317 Ga0495610_0002317_12556_13686 376
921 3300046515 Ga0495620_0017938 Ga0495620_0017938_1539_2672 376
922 3300046515 Ga0495620_0076391 Ga0495620_0076391_31_1164 376
923 3300046519 Ga0495632_0000948 Ga0495632_0000948_9270_10403 376
924 3300046519 Ga0495632_0008112 Ga0495632_0008112_550_1683 376
925 3300046519 Ga0495632_0027220 Ga0495632_0027220_973_2121 376
926 3300046522 Ga0495643_0000077 Ga0495643_0000077_142008_143138 376
927 3300046522 Ga0495643_0006700 Ga0495643_0006700_5052_6185 376
928 3300046522 Ga0495643_0015150 Ga0495643_0015150_2456_3589 376
929 3300046522 Ga0495643_0122045 Ga0495643_0122045_39_1175 376
930 3300046530 Ga0495654_0041315 Ga0495654_0041315_990_2132 376
931 3300046538 Ga0495609_0015133 Ga0495609_0015133_1802_2935 376
932 3300047470 Ga0495681_0000010 Ga0495681_0000010_53238_54371 376
933 3300048090 Ga0495615_0000150 Ga0495615_0000150_14453_15583 376
934 3300048091 Ga0495626_0001895 Ga0495626_0001895_9771_10901 376
935 3300048904 Ga0496101_0041543 Ga0496101_0041543_295_1428 376
936 3300048905 Ga0496102_0000570 Ga0496102_0000570_24947_26080 376
937 3300048906 Ga0496103_0000201 Ga0496103_0000201_51265_52398 376
938 3300048906 Ga0496103_0018844 Ga0496103_0018844_1015_2145 376
939 3300048907 Ga0496104_0000078 Ga0496104_0000078_96601_97734 376
940 3300048908 Ga0496105_0000241 Ga0496105_0000241_1011_2144 376
941 3300048915 Ga0496112_0112199 Ga0496112_0112199_619_1752 376
942 3300048916 Ga0496113_0017588 Ga0496113_0017588_1716_2849 376
943 3300048919 Ga0496116_0000017 Ga0496116_0000017_364326_365456 376
944 3300048920 Ga0496117_0006507 Ga0496117_0006507_5233_6366 376
945 3300048920 Ga0496117_0021332 Ga0496117_0021332_2479_3609 376
946 3300048921 Ga0496118_0012741 Ga0496118_0012741_3366_4499 376
947 3300048922 Ga0496119_0000114 Ga0496119_0000114_96601_97734 376
948 3300048923 Ga0496120_0000266 Ga0496120_0000266_1759_2892 376
949 3300048924 Ga0496121_0000675 Ga0496121_0000675_47191_48321 376
950 3300048924 Ga0496121_0012385 Ga0496121_0012385_3741_4871 376
951 3300048925 Ga0496122_0013037 Ga0496122_0013037_3474_4604 376
952 3300048925 Ga0496122_0016897 Ga0496122_0016897_169_1311 376
953 3300048926 Ga0496123_0001706 Ga0496123_0001706_12633_13775 376
954 3300048926 Ga0496123_0001817 Ga0496123_0001817_23362_24492 376
955 3300048926 Ga0496123_0010209 Ga0496123_0010209_2474_3607 376
956 3300048926 Ga0496123_0016103 Ga0496123_0016103_2836_3966 376
957 3300048927 Ga0496124_0001890 Ga0496124_0001890_4382_5512 376
958 3300048927 Ga0496124_0002608 Ga0496124_0002608_18118_19251 376
959 3300048928 Ga0496125_0022628 Ga0496125_0022628_3345_4475 376
960 3300048928 Ga0496125_0037129 Ga0496125_0037129_1474_2604 376
961 3300048929 Ga0496126_0000173 Ga0496126_0000173_41667_42800 376
962 3300048929 Ga0496126_0001284 Ga0496126_0001284_3621_4751 376
963 3300048929 Ga0496126_0095437 Ga0496126_0095437_485_1618 376
964 3300049570 Ga0501033_0065135 Ga0501033_0065135_747_1883 376
965 3300049744 Ga0501083_0079449 Ga0501083_0079449_604_1734 376
966 3300049822 Ga0501035_0168692 Ga0501035_0168692_600_1760 376
967 3300049823 Ga0501044_0006548 Ga0501044_0006548_3585_4727 376
968 3300050489 nmdc:mga03683_463_c1 nmdc:mga03683_463_c1_2358_3491 376
969 3300050491 nmdc:mga00v17_39430_c1 nmdc:mga00v17_39430_c1_1450_2580 376
970 3300050493 nmdc:mga0k408_110078_c1 nmdc:mga0k408_110078_c1_282_1412 376
971 3300050493 nmdc:mga0k408_1430_c1 nmdc:mga0k408_1430_c1_2229_3362 376
972 3300050496 nmdc:mga07m45_30503_c1 nmdc:mga07m45_30503_c1_702_1844 376
973 3300050496 nmdc:mga07m45_8_c1 nmdc:mga07m45_8_c1_2178_3311 376
974 3300050516 nmdc:mga0sz30_15458_c1 nmdc:mga0sz30_15458_c1_446_1576 376
975 3300050516 nmdc:mga0sz30_585_c1 nmdc:mga0sz30_585_c1_2143_3276 376
976 3300053087 Ga0500643_000004 Ga0500643_000004_147221_148363 376
977 3300053116 Ga0500592_011306 Ga0500592_011306_88_1218 376
978 3300053121 Ga0500607_000098 Ga0500607_000098_1843_2985 376
979 3300053121 Ga0500607_000381 Ga0500607_000381_5168_6310 376
980 3300053122 Ga0500608_000054 Ga0500608_000054_33815_34948 376
981 3300053136 Ga0500559_0000607 Ga0500559_0000607_5122_6264 376
982 3300053136 Ga0500559_0012105 Ga0500559_0012105_1614_2765 376
983 3300053136 Ga0500559_0024336 Ga0500559_0024336_1120_2253 376
984 3300053140 Ga0500573_0119818 Ga0500573_0119818_160_1293 376
985 3300053153 Ga0500616_0001893 Ga0500616_0001893_16947_18080 376
986 3300053156 Ga0500622_0001014 Ga0500622_0001014_3496_4662 376
987 3300053178 Ga0500637_0057843 Ga0500637_0057843_942_2084 376
988 3300053723 Ga0500567_007512 Ga0500567_007512_2214_3347 376
989 3300053729 Ga0500625_000002 Ga0500625_000002_179224_180357 376
990 3300053730 Ga0500645_006477 Ga0500645_006477_2595_3737 376
991 2162886007 SwRhRL2b_contig_2235436 SwRhRL2b_0637.00008150 380
992 3300005289 Ga0065704_10070176 Ga0065704_1007017641 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01472

PUA

PUA domain

331

404

0.96

PF00696

AA_kinase

Amino acid kinase family

62

292

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2as0-assembly1.cif.gz_B crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase 0.9268 287 338
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.919 16 264
3zv0-assembly1.cif.gz_D structure of the shq1p-cbf5p complex 0.9132 286 346
3zv0-assembly1.cif.gz_C structure of the shq1p-cbf5p complex 0.9126 286 346
3uai-assembly1.cif.gz_A structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae 0.9107 286 345
ID Description Score Start End Superfamily
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9745 286 377 2.30.130.10
af_Q54LB6_223_322_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9563 284 377 2.30.130.10
af_A0A1D8PU95_3_196_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9459 17 201 3.40.1160.10
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9443 286 377 2.30.130.10
af_O13810_285_387_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9421 283 377 2.30.130.10
ID Description Score Start End GO Terms
AF-A0A355T3B8-F1-model_v4 Glutamate 5-kinase 0.9995 289 377 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A4Q3C6E4-F1-model_v4 Glutamate 5-kinase 0.9975 291 375 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A435K544-F1-model_v4 deleted 0.9939 295 377
AF-A0A259IKD3-F1-model_v4 deleted 0.9916 291 377
AF-A0A845Z6K0-F1-model_v4 Glutamate 5-kinase 0.9902 302 377 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561

Feature Viewer

pLDDT pTM Quality
88.84 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map