F487669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 992 | 373 | 953 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0010962|Ga0496105_0010962_522_1787 |
| Length | 421 |
| Sequence | LLPAALADPHNQPAPESPARPLISPVTSPRHLPNRAAFPYPPAMPAPAIQSLADLGDATRAPRIVIKVGSALLVDATGARRAWLAALVAELAQARARGQQVIVVSSGAIALGARKLGLEKGGRASLADAQAAAAVGQIALSGLWAELLEAHGLTAAQLLLTLDDLEDRRRYLNATATLTRLLDAGAVPVINENDSVATQEIRFGDNDRLAARIAQAARASAVVLLSDIDGLYDRHPSDPGAKRLPLVKAITPEIRAMASPVSGSGMGSGGMISKLQAAEIAQLAGIALAIGNGHVEAPLARIAAGEGTLFPARQRTAARKAWLGGRLRLKGELVVDQGAAVALANGSSLLARGITASSGQFHRGDAVAIRNQAGETLAHGLAEYDAAECALLIGRHSSEHADLLGYAPRPAIVHRDQLVLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 8 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 9 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 10 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 11 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 12 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 13 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 14 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 15 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 16 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 17 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 18 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 19 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 20 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 21 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 22 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 23 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 24 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 25 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 26 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 27 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 28 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 29 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 30 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 31 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 32 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 33 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 34 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 35 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 36 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 37 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 38 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 39 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 40 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 41 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 42 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 47 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 48 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 49 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 50 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 51 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 52 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 53 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 54 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 240 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 324 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 325 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 331 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 350 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 351 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 352 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 353 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 359 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 367 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 368 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 369 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 370 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 373 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.07 |
| Metatranscriptomes | 0 |
| Isolates | 3.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 11.49 |
| Nodule | 0.2 |
| Rhizoplane | 4.94 |
| Rhizosphere | 72.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2235436 | 2162886007 | Bacteria | 72815 |
| 2 | JGI24736J21556_1000256 | 3300001904 | Bacteria | 9743 |
| 3 | JGI24741J21665_1001032 | 3300001915 | Bacteria | 8381 |
| 4 | JGI24741J21665_1001215 | 3300001915 | Bacteria | 7580 |
| 5 | JGI24752J21851_1000062 | 3300001976 | Bacteria | 13721 |
| 6 | JGI24752J21851_1001369 | 3300001976 | Bacteria | 3295 |
| 7 | JGI24752J21851_1007004 | 3300001976 | Bacteria | 1473 |
| 8 | JGI24740J21852_10000540 | 3300001979 | Bacteria | 16192 |
| 9 | JGI24740J21852_10005886 | 3300001979 | Bacteria | 5139 |
| 10 | JGI24740J21852_10011274 | 3300001979 | Bacteria | 3408 |
| 11 | JGI24739J22299_10001027 | 3300001989 | Bacteria | 10334 |
| 12 | JGI24739J22299_10003942 | 3300001989 | Bacteria | 5678 |
| 13 | JGI24739J22299_10004578 | 3300001989 | Bacteria | 5287 |
| 14 | JGI24737J22298_10002455 | 3300001990 | Bacteria | 6602 |
| 15 | JGI24737J22298_10004191 | 3300001990 | Bacteria | 5041 |
| 16 | JGI24735J21928_10000861 | 3300002067 | Bacteria | 10803 |
| 17 | JGI24735J21928_10003084 | 3300002067 | Bacteria | 5704 |
| 18 | JGI24750J21931_1000036 | 3300002070 | Bacteria | 18006 |
| 19 | JGI24748J21848_1000103 | 3300002074 | Bacteria | 18872 |
| 20 | JGI24738J21930_10001565 | 3300002075 | Bacteria | 6314 |
| 21 | JGI24749J21850_1000087 | 3300002076 | Bacteria | 16750 |
| 22 | JGI24034J26672_10000057 | 3300002239 | Bacteria | 42515 |
| 23 | JGI24742J22300_10004425 | 3300002244 | Bacteria | 2300 |
| 24 | JGI24751J29686_10000054 | 3300002459 | Bacteria | 65209 |
| 25 | JGI24751J29686_10000140 | 3300002459 | Bacteria | 35958 |
| 26 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 27 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 28 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 29 | Ga0055542_1000355 | 3300003762 | Bacteria | 48043 |
| 30 | Ga0055529_1000045 | 3300003763 | Bacteria | 209617 |
| 31 | Ga0065165_1004400 | 3300005262 | Bacteria | 8781 |
| 32 | Ga0065704_10001493 | 3300005289 | Bacteria | 12929 |
| 33 | Ga0065704_10007473 | 3300005289 | Bacteria | 6245 |
| 34 | Ga0065704_10070176 | 3300005289 | Bacteria | 138803 |
| 35 | Ga0065704_10105609 | 3300005289 | Bacteria | 2101 |
| 36 | Ga0065707_10083253 | 3300005295 | Bacteria | 9789 |
| 37 | Ga0070658_10000067 | 3300005327 | Bacteria | 103026 |
| 38 | Ga0070658_10001571 | 3300005327 | Bacteria | 19350 |
| 39 | Ga0070658_10032881 | 3300005327 | Bacteria | 4171 |
| 40 | Ga0070658_10032902 | 3300005327 | Bacteria | 4169 |
| 41 | Ga0070658_10105365 | 3300005327 | Bacteria | 2333 |
| 42 | Ga0070683_100170222 | 3300005329 | Bacteria | 2068 |
| 43 | Ga0070683_100172906 | 3300005329 | Bacteria | 2051 |
| 44 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 45 | Ga0070690_100046244 | 3300005330 | Bacteria | 2767 |
| 46 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 47 | Ga0070670_100000210 | 3300005331 | Bacteria | 54177 |
| 48 | Ga0070670_100000965 | 3300005331 | Bacteria | 22582 |
| 49 | Ga0070670_100009509 | 3300005331 | Bacteria | 8297 |
| 50 | Ga0070670_100018785 | 3300005331 | Bacteria | 5926 |
| 51 | Ga0070670_100190597 | 3300005331 | Bacteria | 1781 |
| 52 | Ga0070670_100240614 | 3300005331 | Bacteria | 1576 |
| 53 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 54 | Ga0070666_10000089 | 3300005335 | Bacteria | 64147 |
| 55 | Ga0070666_10013840 | 3300005335 | Bacteria | 5127 |
| 56 | Ga0070666_10036618 | 3300005335 | Bacteria | 3259 |
| 57 | Ga0070666_10158615 | 3300005335 | Bacteria | 1581 |
| 58 | Ga0070666_10198050 | 3300005335 | Bacteria | 1413 |
| 59 | Ga0070680_100011845 | 3300005336 | Bacteria | 6763 |
| 60 | Ga0070660_100075680 | 3300005339 | Bacteria | 2636 |
| 61 | Ga0070660_100148168 | 3300005339 | Bacteria | 1886 |
| 62 | Ga0070689_100002742 | 3300005340 | Bacteria | 11551 |
| 63 | Ga0070661_100011173 | 3300005344 | Bacteria | 6255 |
| 64 | Ga0070668_100000003 | 3300005347 | Bacteria | 195738 |
| 65 | Ga0070668_100000014 | 3300005347 | Bacteria | 112374 |
| 66 | Ga0070668_100003251 | 3300005347 | Bacteria | 11982 |
| 67 | Ga0070668_100007280 | 3300005347 | Bacteria | 8209 |
| 68 | Ga0070668_100042436 | 3300005347 | Bacteria | 3487 |
| 69 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 70 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 71 | Ga0070669_100000334 | 3300005353 | Bacteria | 36683 |
| 72 | Ga0070669_100000473 | 3300005353 | Bacteria | 30554 |
| 73 | Ga0070669_100000712 | 3300005353 | Bacteria | 24397 |
| 74 | Ga0070669_100002131 | 3300005353 | Bacteria | 14306 |
| 75 | Ga0070669_100003995 | 3300005353 | Bacteria | 10660 |
| 76 | Ga0070669_100024149 | 3300005353 | Bacteria | 4357 |
| 77 | Ga0070669_100034312 | 3300005353 | Bacteria | 3673 |
| 78 | Ga0070669_100050393 | 3300005353 | Bacteria | 3041 |
| 79 | Ga0070669_100157764 | 3300005353 | Bacteria | 1761 |
| 80 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 81 | Ga0070671_100000138 | 3300005355 | Bacteria | 46941 |
| 82 | Ga0070671_100000435 | 3300005355 | Bacteria | 28993 |
| 83 | Ga0070671_100000542 | 3300005355 | Bacteria | 26647 |
| 84 | Ga0070671_100002625 | 3300005355 | Bacteria | 13916 |
| 85 | Ga0070671_100039115 | 3300005355 | Bacteria | 3937 |
| 86 | Ga0070671_100210640 | 3300005355 | Bacteria | 1648 |
| 87 | Ga0070674_100011307 | 3300005356 | Bacteria | 5430 |
| 88 | Ga0070688_100001328 | 3300005365 | Bacteria | 12256 |
| 89 | Ga0070659_100008121 | 3300005366 | Bacteria | 7656 |
| 90 | Ga0070659_100070457 | 3300005366 | Bacteria | 2777 |
| 91 | Ga0070659_100216272 | 3300005366 | Bacteria | 1581 |
| 92 | Ga0070667_100000051 | 3300005367 | Bacteria | 155117 |
| 93 | Ga0070667_100000128 | 3300005367 | Bacteria | 95780 |
| 94 | Ga0070667_100000298 | 3300005367 | Bacteria | 55786 |
| 95 | Ga0070667_100000851 | 3300005367 | Bacteria | 28385 |
| 96 | Ga0070667_100001003 | 3300005367 | Bacteria | 25848 |
| 97 | Ga0070667_100002068 | 3300005367 | Bacteria | 17765 |
| 98 | Ga0070667_100004204 | 3300005367 | Bacteria | 12158 |
| 99 | Ga0070667_100011284 | 3300005367 | Bacteria | 7391 |
| 100 | Ga0070667_100014546 | 3300005367 | Bacteria | 6503 |
| 101 | Ga0070667_100040604 | 3300005367 | Bacteria | 3902 |
| 102 | Ga0070667_100049569 | 3300005367 | Bacteria | 3537 |
| 103 | Ga0070667_100104253 | 3300005367 | Bacteria | 2453 |
| 104 | Ga0070705_100004759 | 3300005440 | Bacteria | 6608 |
| 105 | Ga0070705_100099149 | 3300005440 | Bacteria | 1835 |
| 106 | Ga0070708_100094332 | 3300005445 | Bacteria | 2730 |
| 107 | Ga0070663_100017417 | 3300005455 | Bacteria | 4689 |
| 108 | Ga0070663_100100915 | 3300005455 | Bacteria | 2153 |
| 109 | Ga0070663_100129135 | 3300005455 | Bacteria | 1917 |
| 110 | Ga0070678_100012555 | 3300005456 | Bacteria | 5274 |
| 111 | Ga0070662_100012698 | 3300005457 | Bacteria | 5590 |
| 112 | Ga0070681_10005668 | 3300005458 | Bacteria | 12071 |
| 113 | Ga0068867_100007513 | 3300005459 | Bacteria | 7706 |
| 114 | Ga0068867_100235491 | 3300005459 | Bacteria | 1482 |
| 115 | Ga0070685_10000168 | 3300005466 | Bacteria | 43369 |
| 116 | Ga0070679_100008282 | 3300005530 | Bacteria | 9782 |
| 117 | Ga0068853_100004036 | 3300005539 | Bacteria | 11295 |
| 118 | Ga0068853_100009085 | 3300005539 | Bacteria | 8003 |
| 119 | Ga0068853_100019326 | 3300005539 | Bacteria | 5648 |
| 120 | Ga0068853_100025577 | 3300005539 | Bacteria | 4954 |
| 121 | Ga0068853_100174305 | 3300005539 | Bacteria | 1947 |
| 122 | Ga0070672_100315773 | 3300005543 | Bacteria | 1327 |
| 123 | Ga0070686_100001324 | 3300005544 | Bacteria | 14003 |
| 124 | Ga0070686_100017427 | 3300005544 | Bacteria | 4197 |
| 125 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 126 | Ga0070665_100000206 | 3300005548 | Bacteria | 102989 |
| 127 | Ga0070665_100001356 | 3300005548 | Bacteria | 28943 |
| 128 | Ga0070665_100010985 | 3300005548 | Bacteria | 9156 |
| 129 | Ga0070665_100012580 | 3300005548 | Bacteria | 8522 |
| 130 | Ga0070665_100088252 | 3300005548 | Bacteria | 3107 |
| 131 | Ga0070665_100137757 | 3300005548 | Bacteria | 2444 |
| 132 | Ga0070665_100287580 | 3300005548 | Bacteria | 1646 |
| 133 | Ga0068855_100000962 | 3300005563 | Bacteria | 35800 |
| 134 | Ga0068855_100014816 | 3300005563 | Bacteria | 9389 |
| 135 | Ga0068855_100015135 | 3300005563 | Bacteria | 9288 |
| 136 | Ga0068855_100040224 | 3300005563 | Bacteria | 5549 |
| 137 | Ga0068855_100060879 | 3300005563 | Bacteria | 4412 |
| 138 | Ga0070664_100013946 | 3300005564 | Bacteria | 6552 |
| 139 | Ga0070664_100020427 | 3300005564 | Bacteria | 5453 |
| 140 | Ga0070664_100102464 | 3300005564 | Bacteria | 2490 |
| 141 | Ga0068857_100009607 | 3300005577 | Bacteria | 8404 |
| 142 | Ga0068857_100018029 | 3300005577 | Bacteria | 6193 |
| 143 | Ga0068857_100065228 | 3300005577 | Bacteria | 3237 |
| 144 | Ga0068857_100069212 | 3300005577 | Bacteria | 3143 |
| 145 | Ga0068857_100084922 | 3300005577 | Bacteria | 2829 |
| 146 | Ga0068857_100194718 | 3300005577 | Bacteria | 1847 |
| 147 | Ga0068857_100245112 | 3300005577 | Bacteria | 1641 |
| 148 | Ga0068854_100003154 | 3300005578 | Bacteria | 10274 |
| 149 | Ga0068854_100010741 | 3300005578 | Bacteria | 5941 |
| 150 | Ga0068854_100012195 | 3300005578 | Bacteria | 5624 |
| 151 | Ga0068854_100019472 | 3300005578 | Bacteria | 4574 |
| 152 | Ga0068854_100305493 | 3300005578 | Bacteria | 1288 |
| 153 | Ga0068856_100004323 | 3300005614 | Bacteria | 14177 |
| 154 | Ga0068856_100011400 | 3300005614 | Bacteria | 8622 |
| 155 | Ga0068856_100142927 | 3300005614 | Bacteria | 2400 |
| 156 | Ga0068856_100332962 | 3300005614 | Bacteria | 1536 |
| 157 | Ga0068856_100494178 | 3300005614 | Bacteria | 1244 |
| 158 | Ga0070702_100028407 | 3300005615 | Bacteria | 3031 |
| 159 | Ga0068852_100000075 | 3300005616 | Bacteria | 69379 |
| 160 | Ga0068852_100108194 | 3300005616 | Bacteria | 2523 |
| 161 | Ga0068852_100183379 | 3300005616 | Bacteria | 1970 |
| 162 | Ga0068859_100000256 | 3300005617 | Bacteria | 52870 |
| 163 | Ga0068859_100001299 | 3300005617 | Bacteria | 25520 |
| 164 | Ga0068859_100006610 | 3300005617 | Bacteria | 11774 |
| 165 | Ga0068859_100025168 | 3300005617 | Bacteria | 5973 |
| 166 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 167 | Ga0068864_100000332 | 3300005618 | Bacteria | 41671 |
| 168 | Ga0068864_100000642 | 3300005618 | Bacteria | 29378 |
| 169 | Ga0068864_100001753 | 3300005618 | Bacteria | 17839 |
| 170 | Ga0068864_100025454 | 3300005618 | Bacteria | 4983 |
| 171 | Ga0068864_100053335 | 3300005618 | Bacteria | 3488 |
| 172 | Ga0068864_100118219 | 3300005618 | Bacteria | 2367 |
| 173 | Ga0068861_100001329 | 3300005719 | Bacteria | 15509 |
| 174 | Ga0068861_100015879 | 3300005719 | Bacteria | 5317 |
| 175 | Ga0068861_100088296 | 3300005719 | Bacteria | 2441 |
| 176 | Ga0068851_10011445 | 3300005834 | Bacteria | 4161 |
| 177 | Ga0068851_10042184 | 3300005834 | Bacteria | 2296 |
| 178 | Ga0068863_100000016 | 3300005841 | Bacteria | 213575 |
| 179 | Ga0068863_100000028 | 3300005841 | Bacteria | 181662 |
| 180 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 181 | Ga0068863_100000456 | 3300005841 | Bacteria | 41671 |
| 182 | Ga0068863_100000719 | 3300005841 | Bacteria | 33262 |
| 183 | Ga0068863_100005237 | 3300005841 | Bacteria | 12796 |
| 184 | Ga0068863_100010358 | 3300005841 | Bacteria | 9058 |
| 185 | Ga0068863_100017269 | 3300005841 | Bacteria | 6922 |
| 186 | Ga0068863_100028865 | 3300005841 | Bacteria | 5298 |
| 187 | Ga0068863_100415980 | 3300005841 | Bacteria | 1316 |
| 188 | Ga0068858_100000304 | 3300005842 | Bacteria | 52470 |
| 189 | Ga0068858_100000472 | 3300005842 | Bacteria | 41922 |
| 190 | Ga0068858_100002895 | 3300005842 | Bacteria | 17259 |
| 191 | Ga0068858_100004091 | 3300005842 | Bacteria | 14368 |
| 192 | Ga0068858_100016712 | 3300005842 | Bacteria | 6891 |
| 193 | Ga0068858_100022636 | 3300005842 | Bacteria | 5860 |
| 194 | Ga0068858_100104346 | 3300005842 | Bacteria | 2644 |
| 195 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 196 | Ga0068860_100000143 | 3300005843 | Bacteria | 116787 |
| 197 | Ga0068860_100000168 | 3300005843 | Bacteria | 107408 |
| 198 | Ga0068860_100000412 | 3300005843 | Bacteria | 55786 |
| 199 | Ga0068860_100001698 | 3300005843 | Bacteria | 23527 |
| 200 | Ga0068860_100006149 | 3300005843 | Bacteria | 12074 |
| 201 | Ga0068860_100007410 | 3300005843 | Bacteria | 10976 |
| 202 | Ga0068860_100017637 | 3300005843 | Bacteria | 6956 |
| 203 | Ga0068860_100174989 | 3300005843 | Bacteria | 2074 |
| 204 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 205 | Ga0068862_100000085 | 3300005844 | Bacteria | 110879 |
| 206 | Ga0068862_100000168 | 3300005844 | Bacteria | 72749 |
| 207 | Ga0068862_100000310 | 3300005844 | Bacteria | 53315 |
| 208 | Ga0068862_100000506 | 3300005844 | Bacteria | 41538 |
| 209 | Ga0068862_100001574 | 3300005844 | Bacteria | 20794 |
| 210 | Ga0068862_100010705 | 3300005844 | Bacteria | 7573 |
| 211 | Ga0068862_100010728 | 3300005844 | Bacteria | 7566 |
| 212 | Ga0068862_100040836 | 3300005844 | Bacteria | 3945 |
| 213 | Ga0068862_100089890 | 3300005844 | Bacteria | 2673 |
| 214 | Ga0081455_10000131 | 3300005937 | Bacteria | 87553 |
| 215 | Ga0075368_10001483 | 3300006042 | Bacteria | 7519 |
| 216 | Ga0075368_10041808 | 3300006042 | Bacteria | 1801 |
| 217 | Ga0075363_100003377 | 3300006048 | Bacteria | 6781 |
| 218 | Ga0075363_100003814 | 3300006048 | Bacteria | 6495 |
| 219 | Ga0075364_10016692 | 3300006051 | Bacteria | 4572 |
| 220 | Ga0075432_10004187 | 3300006058 | Bacteria | 4911 |
| 221 | Ga0075362_10000234 | 3300006177 | Bacteria | 15472 |
| 222 | Ga0075362_10000526 | 3300006177 | Bacteria | 11123 |
| 223 | Ga0075367_10000092 | 3300006178 | Bacteria | 24598 |
| 224 | Ga0075366_10000168 | 3300006195 | Bacteria | 28069 |
| 225 | Ga0075366_10006887 | 3300006195 | Bacteria | 6254 |
| 226 | Ga0075366_10021504 | 3300006195 | Bacteria | 3750 |
| 227 | Ga0097621_100136045 | 3300006237 | Bacteria | 2096 |
| 228 | Ga0075370_10000032 | 3300006353 | Bacteria | 44839 |
| 229 | Ga0075370_10045379 | 3300006353 | Bacteria | 2486 |
| 230 | Ga0075429_100039568 | 3300006880 | Bacteria | 4103 |
| 231 | Ga0075429_100102528 | 3300006880 | Bacteria | 2498 |
| 232 | Ga0097620_100000256 | 3300006931 | Bacteria | 52870 |
| 233 | Ga0097620_100001299 | 3300006931 | Bacteria | 25520 |
| 234 | Ga0097620_100006610 | 3300006931 | Bacteria | 11774 |
| 235 | Ga0097620_100025168 | 3300006931 | Bacteria | 5973 |
| 236 | Ga0079104_1008150 | 3300006946 | Bacteria | 3705 |
| 237 | Ga0105251_10001625 | 3300009011 | Bacteria | 19048 |
| 238 | Ga0105251_10001861 | 3300009011 | Bacteria | 17335 |
| 239 | Ga0105251_10010467 | 3300009011 | Bacteria | 5379 |
| 240 | Ga0105251_10061191 | 3300009011 | Bacteria | 1771 |
| 241 | Ga0105251_10069374 | 3300009011 | Bacteria | 1643 |
| 242 | Ga0105240_10001848 | 3300009093 | Bacteria | 35437 |
| 243 | Ga0105240_10010488 | 3300009093 | Bacteria | 13024 |
| 244 | Ga0105240_10035481 | 3300009093 | Bacteria | 6426 |
| 245 | Ga0105240_10070426 | 3300009093 | Bacteria | 4326 |
| 246 | Ga0105240_10078303 | 3300009093 | Bacteria | 4071 |
| 247 | Ga0105245_10001108 | 3300009098 | Bacteria | 24360 |
| 248 | Ga0105247_10000644 | 3300009101 | Bacteria | 27956 |
| 249 | Ga0105247_10037912 | 3300009101 | Bacteria | 2941 |
| 250 | Ga0114129_10021496 | 3300009147 | Bacteria | 9159 |
| 251 | Ga0105243_10000423 | 3300009148 | Bacteria | 44393 |
| 252 | Ga0105243_10075604 | 3300009148 | Bacteria | 2734 |
| 253 | Ga0105243_10261150 | 3300009148 | Bacteria | 1550 |
| 254 | Ga0105241_10000997 | 3300009174 | Bacteria | 21452 |
| 255 | Ga0105241_10166400 | 3300009174 | Bacteria | 1817 |
| 256 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 257 | Ga0105248_10000086 | 3300009177 | Bacteria | 106349 |
| 258 | Ga0105248_10013528 | 3300009177 | Bacteria | 8982 |
| 259 | Ga0105248_10024262 | 3300009177 | Bacteria | 6743 |
| 260 | Ga0105248_10031271 | 3300009177 | Bacteria | 5949 |
| 261 | Ga0105248_10120069 | 3300009177 | Bacteria | 2965 |
| 262 | Ga0105248_10175942 | 3300009177 | Bacteria | 2412 |
| 263 | Ga0105237_10002073 | 3300009545 | Bacteria | 25405 |
| 264 | Ga0105237_10007129 | 3300009545 | Bacteria | 12280 |
| 265 | Ga0105237_10009460 | 3300009545 | Bacteria | 10438 |
| 266 | Ga0105237_10140837 | 3300009545 | Bacteria | 2406 |
| 267 | Ga0105238_10017115 | 3300009551 | Bacteria | 7359 |
| 268 | Ga0105238_10182143 | 3300009551 | Bacteria | 2077 |
| 269 | Ga0105238_10203403 | 3300009551 | Bacteria | 1956 |
| 270 | Ga0105238_10254974 | 3300009551 | Bacteria | 1733 |
| 271 | Ga0105249_10000024 | 3300009553 | Bacteria | 232947 |
| 272 | Ga0105249_10000038 | 3300009553 | Bacteria | 196425 |
| 273 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 274 | Ga0105249_10002324 | 3300009553 | Bacteria | 16499 |
| 275 | Ga0105249_10348210 | 3300009553 | Bacteria | 1500 |
| 276 | Ga0105148_100059 | 3300009978 | Bacteria | 17255 |
| 277 | Ga0105239_10027686 | 3300010375 | Bacteria | 6236 |
| 278 | Ga0105239_10067612 | 3300010375 | Bacteria | 3925 |
| 279 | Ga0105239_10618628 | 3300010375 | Bacteria | 1236 |
| 280 | Ga0157326_1000001 | 3300012513 | Bacteria | 19397 |
| 281 | Ga0157373_10003358 | 3300013100 | Bacteria | 12096 |
| 282 | Ga0157371_10000032 | 3300013102 | Bacteria | 230252 |
| 283 | Ga0157371_10003665 | 3300013102 | Bacteria | 13817 |
| 284 | Ga0157371_10140860 | 3300013102 | Bacteria | 1718 |
| 285 | Ga0157370_10013758 | 3300013104 | Bacteria | 8315 |
| 286 | Ga0157370_10051407 | 3300013104 | Bacteria | 3937 |
| 287 | Ga0157370_10053190 | 3300013104 | Bacteria | 3862 |
| 288 | Ga0157370_10330811 | 3300013104 | Bacteria | 1405 |
| 289 | Ga0157369_10115578 | 3300013105 | Bacteria | 2849 |
| 290 | Ga0157369_10289035 | 3300013105 | Bacteria | 1707 |
| 291 | Ga0157378_10187768 | 3300013297 | Bacteria | 1947 |
| 292 | Ga0163162_10003527 | 3300013306 | Bacteria | 14967 |
| 293 | Ga0163162_10012124 | 3300013306 | Bacteria | 8412 |
| 294 | Ga0163162_10015484 | 3300013306 | Bacteria | 7452 |
| 295 | Ga0163162_10044800 | 3300013306 | Bacteria | 4432 |
| 296 | Ga0157372_10035441 | 3300013307 | Bacteria | 5494 |
| 297 | Ga0157372_10242033 | 3300013307 | Bacteria | 2093 |
| 298 | Ga0157372_10328848 | 3300013307 | Bacteria | 1780 |
| 299 | Ga0163163_10008504 | 3300014325 | Bacteria | 9122 |
| 300 | Ga0163163_10172430 | 3300014325 | Bacteria | 2210 |
| 301 | Ga0157380_10000060 | 3300014326 | Bacteria | 62248 |
| 302 | Ga0157380_10000542 | 3300014326 | Bacteria | 23239 |
| 303 | Ga0157380_10148878 | 3300014326 | Bacteria | 2021 |
| 304 | Ga0157379_10004525 | 3300014968 | Bacteria | 11922 |
| 305 | Ga0157379_10042529 | 3300014968 | Bacteria | 4057 |
| 306 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 307 | Ga0163161_10000716 | 3300017792 | Bacteria | 26178 |
| 308 | Ga0163161_10082721 | 3300017792 | Bacteria | 2366 |
| 309 | Ga0213875_10000264 | 3300021388 | Bacteria | 52435 |
| 310 | Ga0209147_104064 | 3300025229 | Bacteria | 2558 |
| 311 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 312 | Ga0209677_104116 | 3300025253 | Bacteria | 4355 |
| 313 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 314 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 315 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 316 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 317 | Ga0209050_1000441 | 3300025298 | Bacteria | 75474 |
| 318 | Ga0207697_10000419 | 3300025315 | Bacteria | 24002 |
| 319 | Ga0207697_10012242 | 3300025315 | Bacteria | 3602 |
| 320 | Ga0207697_10015555 | 3300025315 | Bacteria | 3142 |
| 321 | Ga0207656_10000378 | 3300025321 | Bacteria | 14923 |
| 322 | Ga0207656_10005981 | 3300025321 | Bacteria | 4347 |
| 323 | Ga0207713_1002460 | 3300025735 | Bacteria | 13462 |
| 324 | Ga0207713_1016496 | 3300025735 | Bacteria | 3746 |
| 325 | Ga0207710_10006923 | 3300025900 | Bacteria | 4823 |
| 326 | Ga0207710_10035134 | 3300025900 | Bacteria | 2205 |
| 327 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 328 | Ga0207680_10000517 | 3300025903 | Bacteria | 18430 |
| 329 | Ga0207680_10003829 | 3300025903 | Bacteria | 7085 |
| 330 | Ga0207680_10125961 | 3300025903 | Bacteria | 1682 |
| 331 | Ga0207680_10140440 | 3300025903 | Bacteria | 1601 |
| 332 | Ga0207680_10155143 | 3300025903 | Bacteria | 1530 |
| 333 | Ga0207647_10008366 | 3300025904 | Bacteria | 7421 |
| 334 | Ga0207647_10026599 | 3300025904 | Bacteria | 3783 |
| 335 | Ga0207647_10064805 | 3300025904 | Bacteria | 2219 |
| 336 | Ga0207645_10165005 | 3300025907 | Bacteria | 1450 |
| 337 | Ga0207705_10000075 | 3300025909 | Bacteria | 123551 |
| 338 | Ga0207705_10000122 | 3300025909 | Bacteria | 86442 |
| 339 | Ga0207705_10090342 | 3300025909 | Bacteria | 2242 |
| 340 | Ga0207705_10123396 | 3300025909 | Bacteria | 1924 |
| 341 | Ga0207654_10002907 | 3300025911 | Bacteria | 8680 |
| 342 | Ga0207707_10069377 | 3300025912 | Bacteria | 3072 |
| 343 | Ga0207707_10141338 | 3300025912 | Bacteria | 2105 |
| 344 | Ga0207695_10000288 | 3300025913 | Bacteria | 125085 |
| 345 | Ga0207695_10006069 | 3300025913 | Bacteria | 15766 |
| 346 | Ga0207695_10015610 | 3300025913 | Bacteria | 8933 |
| 347 | Ga0207695_10036202 | 3300025913 | Bacteria | 5338 |
| 348 | Ga0207695_10055082 | 3300025913 | Bacteria | 4147 |
| 349 | Ga0207695_10075297 | 3300025913 | Bacteria | 3435 |
| 350 | Ga0207695_10095696 | 3300025913 | Bacteria | 2973 |
| 351 | Ga0207695_10150591 | 3300025913 | Bacteria | 2266 |
| 352 | Ga0207671_10001439 | 3300025914 | Bacteria | 27570 |
| 353 | Ga0207671_10006770 | 3300025914 | Bacteria | 10131 |
| 354 | Ga0207671_10018947 | 3300025914 | Bacteria | 5272 |
| 355 | Ga0207657_10000408 | 3300025919 | Bacteria | 45400 |
| 356 | Ga0207657_10002471 | 3300025919 | Bacteria | 19998 |
| 357 | Ga0207657_10007801 | 3300025919 | Bacteria | 10926 |
| 358 | Ga0207657_10011633 | 3300025919 | Bacteria | 8727 |
| 359 | Ga0207657_10085021 | 3300025919 | Bacteria | 2651 |
| 360 | Ga0207657_10186792 | 3300025919 | Bacteria | 1673 |
| 361 | Ga0207649_10000482 | 3300025920 | Bacteria | 28301 |
| 362 | Ga0207649_10159200 | 3300025920 | Bacteria | 1563 |
| 363 | Ga0207652_10008597 | 3300025921 | Bacteria | 8216 |
| 364 | Ga0207652_10114171 | 3300025921 | Bacteria | 2398 |
| 365 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 366 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 367 | Ga0207681_10000089 | 3300025923 | Bacteria | 79526 |
| 368 | Ga0207681_10000503 | 3300025923 | Bacteria | 27243 |
| 369 | Ga0207681_10000663 | 3300025923 | Bacteria | 22786 |
| 370 | Ga0207681_10001365 | 3300025923 | Bacteria | 15750 |
| 371 | Ga0207681_10004407 | 3300025923 | Bacteria | 8674 |
| 372 | Ga0207681_10018758 | 3300025923 | Bacteria | 4363 |
| 373 | Ga0207681_10041605 | 3300025923 | Bacteria | 3065 |
| 374 | Ga0207681_10140268 | 3300025923 | Bacteria | 1799 |
| 375 | Ga0207694_10005621 | 3300025924 | Bacteria | 9610 |
| 376 | Ga0207694_10009731 | 3300025924 | Bacteria | 7251 |
| 377 | Ga0207694_10018966 | 3300025924 | Bacteria | 5200 |
| 378 | Ga0207694_10061619 | 3300025924 | Bacteria | 2920 |
| 379 | Ga0207694_10175781 | 3300025924 | Bacteria | 1735 |
| 380 | Ga0207694_10182713 | 3300025924 | Bacteria | 1701 |
| 381 | Ga0207694_10237460 | 3300025924 | Bacteria | 1489 |
| 382 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 383 | Ga0207650_10000545 | 3300025925 | Bacteria | 30685 |
| 384 | Ga0207650_10010295 | 3300025925 | Bacteria | 6409 |
| 385 | Ga0207650_10015807 | 3300025925 | Bacteria | 5262 |
| 386 | Ga0207650_10047790 | 3300025925 | Bacteria | 3154 |
| 387 | Ga0207650_10083091 | 3300025925 | Bacteria | 2432 |
| 388 | Ga0207687_10000853 | 3300025927 | Bacteria | 20620 |
| 389 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 390 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 391 | Ga0207644_10000447 | 3300025931 | Bacteria | 26636 |
| 392 | Ga0207644_10001520 | 3300025931 | Bacteria | 14966 |
| 393 | Ga0207644_10003216 | 3300025931 | Bacteria | 10526 |
| 394 | Ga0207644_10020323 | 3300025931 | Bacteria | 4515 |
| 395 | Ga0207644_10021357 | 3300025931 | Bacteria | 4409 |
| 396 | Ga0207644_10070832 | 3300025931 | Bacteria | 2549 |
| 397 | Ga0207690_10000696 | 3300025932 | Bacteria | 21652 |
| 398 | Ga0207690_10023275 | 3300025932 | Bacteria | 3865 |
| 399 | Ga0207690_10031743 | 3300025932 | Bacteria | 3383 |
| 400 | Ga0207690_10225677 | 3300025932 | Bacteria | 1436 |
| 401 | Ga0207706_10002919 | 3300025933 | Bacteria | 16521 |
| 402 | Ga0207706_10004237 | 3300025933 | Bacteria | 13507 |
| 403 | Ga0207706_10012315 | 3300025933 | Bacteria | 7791 |
| 404 | Ga0207706_10075750 | 3300025933 | Bacteria | 2959 |
| 405 | Ga0207709_10000574 | 3300025935 | Bacteria | 30979 |
| 406 | Ga0207709_10193909 | 3300025935 | Bacteria | 1445 |
| 407 | Ga0207670_10013004 | 3300025936 | Bacteria | 4894 |
| 408 | Ga0207669_10006239 | 3300025937 | Bacteria | 5431 |
| 409 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 410 | Ga0207711_10000310 | 3300025941 | Bacteria | 52175 |
| 411 | Ga0207711_10002363 | 3300025941 | Bacteria | 16902 |
| 412 | Ga0207711_10019413 | 3300025941 | Bacteria | 5661 |
| 413 | Ga0207711_10024128 | 3300025941 | Bacteria | 5090 |
| 414 | Ga0207711_10048966 | 3300025941 | Bacteria | 3617 |
| 415 | Ga0207661_10256435 | 3300025944 | Bacteria | 1556 |
| 416 | Ga0207679_10100238 | 3300025945 | Bacteria | 2263 |
| 417 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 418 | Ga0207667_10004952 | 3300025949 | Bacteria | 16269 |
| 419 | Ga0207667_10008229 | 3300025949 | Bacteria | 12408 |
| 420 | Ga0207667_10013795 | 3300025949 | Bacteria | 9232 |
| 421 | Ga0207667_10118401 | 3300025949 | Bacteria | 2729 |
| 422 | Ga0207667_10301320 | 3300025949 | Bacteria | 1638 |
| 423 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 424 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 425 | Ga0207712_10000034 | 3300025961 | Bacteria | 202320 |
| 426 | Ga0207668_10000006 | 3300025972 | Bacteria | 191468 |
| 427 | Ga0207668_10000047 | 3300025972 | Bacteria | 101453 |
| 428 | Ga0207668_10003433 | 3300025972 | Bacteria | 9293 |
| 429 | Ga0207668_10003815 | 3300025972 | Bacteria | 8882 |
| 430 | Ga0207668_10004706 | 3300025972 | Bacteria | 8024 |
| 431 | Ga0207668_10009940 | 3300025972 | Bacteria | 5722 |
| 432 | Ga0207668_10316619 | 3300025972 | Bacteria | 1293 |
| 433 | Ga0207640_10000570 | 3300025981 | Bacteria | 21973 |
| 434 | Ga0207640_10000586 | 3300025981 | Bacteria | 21662 |
| 435 | Ga0207640_10002545 | 3300025981 | Bacteria | 9776 |
| 436 | Ga0207640_10018948 | 3300025981 | Bacteria | 4054 |
| 437 | Ga0207640_10070046 | 3300025981 | Bacteria | 2357 |
| 438 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 439 | Ga0207658_10000057 | 3300025986 | Bacteria | 124003 |
| 440 | Ga0207658_10000254 | 3300025986 | Bacteria | 55800 |
| 441 | Ga0207658_10000434 | 3300025986 | Bacteria | 39528 |
| 442 | Ga0207658_10001330 | 3300025986 | Bacteria | 19356 |
| 443 | Ga0207658_10002894 | 3300025986 | Bacteria | 12306 |
| 444 | Ga0207658_10002944 | 3300025986 | Bacteria | 12197 |
| 445 | Ga0207658_10003250 | 3300025986 | Bacteria | 11554 |
| 446 | Ga0207658_10007629 | 3300025986 | Bacteria | 7368 |
| 447 | Ga0207658_10025127 | 3300025986 | Bacteria | 4169 |
| 448 | Ga0207658_10031477 | 3300025986 | Bacteria | 3767 |
| 449 | Ga0207658_10110014 | 3300025986 | Bacteria | 2176 |
| 450 | Ga0207703_10000435 | 3300026035 | Bacteria | 43900 |
| 451 | Ga0207703_10000568 | 3300026035 | Bacteria | 37997 |
| 452 | Ga0207703_10001463 | 3300026035 | Bacteria | 21547 |
| 453 | Ga0207703_10001946 | 3300026035 | Bacteria | 18263 |
| 454 | Ga0207703_10001956 | 3300026035 | Bacteria | 18195 |
| 455 | Ga0207703_10012521 | 3300026035 | Bacteria | 6612 |
| 456 | Ga0207703_10070059 | 3300026035 | Bacteria | 2894 |
| 457 | Ga0207703_10109986 | 3300026035 | Bacteria | 2350 |
| 458 | Ga0207703_10126510 | 3300026035 | Bacteria | 2201 |
| 459 | Ga0207639_10000777 | 3300026041 | Bacteria | 21710 |
| 460 | Ga0207639_10003342 | 3300026041 | Bacteria | 10792 |
| 461 | Ga0207639_10018070 | 3300026041 | Bacteria | 5005 |
| 462 | Ga0207639_10020172 | 3300026041 | Bacteria | 4768 |
| 463 | Ga0207639_10045628 | 3300026041 | Bacteria | 3302 |
| 464 | Ga0207639_10074344 | 3300026041 | Bacteria | 2668 |
| 465 | Ga0207639_10224291 | 3300026041 | Bacteria | 1625 |
| 466 | Ga0207678_10000324 | 3300026067 | Bacteria | 42936 |
| 467 | Ga0207678_10005545 | 3300026067 | Bacteria | 11277 |
| 468 | Ga0207678_10013334 | 3300026067 | Bacteria | 7212 |
| 469 | Ga0207678_10041873 | 3300026067 | Bacteria | 3970 |
| 470 | Ga0207702_10005910 | 3300026078 | Bacteria | 10640 |
| 471 | Ga0207702_10006661 | 3300026078 | Bacteria | 9934 |
| 472 | Ga0207702_10037147 | 3300026078 | Bacteria | 4076 |
| 473 | Ga0207702_10113339 | 3300026078 | Bacteria | 2414 |
| 474 | Ga0207702_10113370 | 3300026078 | Bacteria | 2414 |
| 475 | Ga0207702_10255571 | 3300026078 | Bacteria | 1647 |
| 476 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 477 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 478 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 479 | Ga0207641_10000315 | 3300026088 | Bacteria | 60017 |
| 480 | Ga0207641_10000346 | 3300026088 | Bacteria | 55535 |
| 481 | Ga0207641_10002472 | 3300026088 | Bacteria | 17065 |
| 482 | Ga0207641_10002944 | 3300026088 | Bacteria | 15396 |
| 483 | Ga0207641_10017728 | 3300026088 | Bacteria | 5832 |
| 484 | Ga0207641_10022838 | 3300026088 | Bacteria | 5151 |
| 485 | Ga0207641_10025121 | 3300026088 | Bacteria | 4911 |
| 486 | Ga0207641_10025885 | 3300026088 | Bacteria | 4839 |
| 487 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 488 | Ga0207676_10000036 | 3300026095 | Bacteria | 198447 |
| 489 | Ga0207676_10000603 | 3300026095 | Bacteria | 29490 |
| 490 | Ga0207676_10002760 | 3300026095 | Bacteria | 12487 |
| 491 | Ga0207676_10003853 | 3300026095 | Bacteria | 10592 |
| 492 | Ga0207676_10004588 | 3300026095 | Bacteria | 9784 |
| 493 | Ga0207676_10011106 | 3300026095 | Bacteria | 6428 |
| 494 | Ga0207676_10028724 | 3300026095 | Bacteria | 4158 |
| 495 | Ga0207674_10003143 | 3300026116 | Bacteria | 20360 |
| 496 | Ga0207674_10004472 | 3300026116 | Bacteria | 16807 |
| 497 | Ga0207674_10009082 | 3300026116 | Bacteria | 11411 |
| 498 | Ga0207674_10012390 | 3300026116 | Bacteria | 9533 |
| 499 | Ga0207674_10014452 | 3300026116 | Bacteria | 8719 |
| 500 | Ga0207674_10085003 | 3300026116 | Bacteria | 3161 |
| 501 | Ga0207674_10100585 | 3300026116 | Bacteria | 2873 |
| 502 | Ga0207674_10161876 | 3300026116 | Bacteria | 2192 |
| 503 | Ga0207674_10330920 | 3300026116 | Bacteria | 1473 |
| 504 | Ga0207675_100000740 | 3300026118 | Bacteria | 32427 |
| 505 | Ga0207675_100003757 | 3300026118 | Bacteria | 14793 |
| 506 | Ga0207675_100020136 | 3300026118 | Bacteria | 6222 |
| 507 | Ga0207683_10022042 | 3300026121 | Bacteria | 5465 |
| 508 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 509 | Ga0207698_10027376 | 3300026142 | Bacteria | 4046 |
| 510 | Ga0209281_1010835 | 3300027111 | Bacteria | 2063 |
| 511 | Ga0209983_1009114 | 3300027665 | Bacteria | 2028 |
| 512 | Ga0209813_10000114 | 3300027866 | Bacteria | 29415 |
| 513 | Ga0209813_10000530 | 3300027866 | Bacteria | 9004 |
| 514 | Ga0207428_10036711 | 3300027907 | Bacteria | 3994 |
| 515 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 516 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 517 | Ga0268266_10000534 | 3300028379 | Bacteria | 53027 |
| 518 | Ga0268266_10008419 | 3300028379 | Bacteria | 9172 |
| 519 | Ga0268266_10015509 | 3300028379 | Bacteria | 6536 |
| 520 | Ga0268266_10029365 | 3300028379 | Bacteria | 4675 |
| 521 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 522 | Ga0268265_10000059 | 3300028380 | Bacteria | 152531 |
| 523 | Ga0268265_10000104 | 3300028380 | Bacteria | 105776 |
| 524 | Ga0268265_10000986 | 3300028380 | Bacteria | 25848 |
| 525 | Ga0268265_10001459 | 3300028380 | Bacteria | 19860 |
| 526 | Ga0268265_10002264 | 3300028380 | Bacteria | 14694 |
| 527 | Ga0268265_10002795 | 3300028380 | Bacteria | 12867 |
| 528 | Ga0268265_10013635 | 3300028380 | Bacteria | 5527 |
| 529 | Ga0268265_10070580 | 3300028380 | Bacteria | 2717 |
| 530 | Ga0268265_10107211 | 3300028380 | Bacteria | 2271 |
| 531 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 532 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 533 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 534 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 535 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 536 | Ga0268264_10004451 | 3300028381 | Bacteria | 11955 |
| 537 | Ga0268264_10012761 | 3300028381 | Bacteria | 6914 |
| 538 | Ga0268264_10029925 | 3300028381 | Bacteria | 4464 |
| 539 | Ga0268264_10146421 | 3300028381 | Bacteria | 2112 |
| 540 | Ga0265323_10023219 | 3300028653 | Bacteria | 2366 |
| 541 | Ga0307517_10076293 | 3300028786 | Bacteria | 2929 |
| 542 | Ga0265330_10009538 | 3300031235 | Unclassified | 4608 |
| 543 | Ga0265331_10064820 | 3300031250 | Bacteria | 1719 |
| 544 | Ga0265327_10034616 | 3300031251 | Bacteria | 2801 |
| 545 | Ga0265316_10002067 | 3300031344 | Bacteria | 21137 |
| 546 | Ga0307513_10006540 | 3300031456 | Bacteria | 15221 |
| 547 | Ga0307513_10040993 | 3300031456 | Bacteria | 5114 |
| 548 | Ga0307408_100024261 | 3300031548 | Bacteria | 4139 |
| 549 | Ga0307408_100062683 | 3300031548 | Bacteria | 2717 |
| 550 | Ga0307408_100069487 | 3300031548 | Bacteria | 2597 |
| 551 | Ga0307508_10001821 | 3300031616 | Bacteria | 23580 |
| 552 | Ga0265342_10103895 | 3300031712 | Bacteria | 1615 |
| 553 | Ga0307405_10003814 | 3300031731 | Bacteria | 7008 |
| 554 | Ga0307413_10061015 | 3300031824 | Bacteria | 2324 |
| 555 | Ga0307413_10246634 | 3300031824 | Bacteria | 1322 |
| 556 | Ga0307410_10032147 | 3300031852 | Bacteria | 3374 |
| 557 | Ga0307410_10131432 | 3300031852 | Bacteria | 1839 |
| 558 | Ga0307406_10043622 | 3300031901 | Bacteria | 2806 |
| 559 | Ga0307412_10000457 | 3300031911 | Bacteria | 24624 |
| 560 | Ga0307412_10002757 | 3300031911 | Bacteria | 9760 |
| 561 | Ga0307412_10004671 | 3300031911 | Bacteria | 7639 |
| 562 | Ga0307412_10025366 | 3300031911 | Bacteria | 3671 |
| 563 | Ga0307412_10025379 | 3300031911 | Bacteria | 3671 |
| 564 | Ga0307412_10043331 | 3300031911 | Bacteria | 2929 |
| 565 | Ga0307412_10066770 | 3300031911 | Bacteria | 2439 |
| 566 | Ga0307412_10086777 | 3300031911 | Bacteria | 2179 |
| 567 | Ga0307409_100108884 | 3300031995 | Bacteria | 2318 |
| 568 | Ga0307416_100046276 | 3300032002 | Bacteria | 3432 |
| 569 | Ga0307416_100080150 | 3300032002 | Bacteria | 2754 |
| 570 | Ga0307416_100111520 | 3300032002 | Bacteria | 2412 |
| 571 | Ga0307414_10000070 | 3300032004 | Bacteria | 96231 |
| 572 | Ga0307414_10000288 | 3300032004 | Bacteria | 29634 |
| 573 | Ga0307414_10000359 | 3300032004 | Bacteria | 25279 |
| 574 | Ga0307411_10007009 | 3300032005 | Bacteria | 5696 |
| 575 | Ga0307411_10230582 | 3300032005 | Bacteria | 1443 |
| 576 | Ga0307415_100206526 | 3300032126 | Bacteria | 1563 |
| 577 | Ga0316583_10008936 | 3300032133 | Bacteria | 3612 |
| 578 | Ga0307510_10008642 | 3300033180 | Bacteria | 12135 |
| 579 | Ga0373937_0071330 | 3300036401 | Bacteria | 3204 |
| 580 | Ga0316582_0014476 | 3300036647 | Bacteria | 4477 |
| 581 | Ga0316584_0074383 | 3300036712 | Bacteria | 2547 |
| 582 | Ga0316584_0087070 | 3300036712 | Bacteria | 2338 |
| 583 | Ga0395900_0044548 | 3300037418 | Bacteria | 4571 |
| 584 | Ga0395898_0018073 | 3300037466 | Bacteria | 7193 |
| 585 | Ga0436364_1200653 | 3300037853 | Bacteria | 55826 |
| 586 | Ga0395901_0018063 | 3300038443 | Bacteria | 7199 |
| 587 | Ga0439436_0009476 | 3300041404 | Bacteria | 2986 |
| 588 | Ga0439436_0018522 | 3300041404 | Bacteria | 2082 |
| 589 | Ga0439461_0000086 | 3300041410 | Bacteria | 12130 |
| 590 | Ga0439465_0001125 | 3300041413 | Bacteria | 8568 |
| 591 | Ga0439465_0016622 | 3300041413 | Bacteria | 2295 |
| 592 | Ga0451802_1561412 | 3300041460 | Bacteria | 1770 |
| 593 | Ga0439431_0000491 | 3300041997 | Bacteria | 8366 |
| 594 | Ga0439431_0020680 | 3300041997 | Bacteria | 1574 |
| 595 | Ga0439445_0011274 | 3300042004 | Bacteria | 2129 |
| 596 | Ga0439432_005779 | 3300042006 | Bacteria | 4444 |
| 597 | Ga0439452_025280 | 3300042010 | Bacteria | 1509 |
| 598 | Ga0439462_0002734 | 3300042015 | Bacteria | 4143 |
| 599 | Ga0453684_0260886 | 3300044712 | Bacteria | 1985 |
| 600 | Ga0451576_0000588 | 3300045051 | Bacteria | 77026 |
| 601 | Ga0451576_0215241 | 3300045051 | Bacteria | 2006 |
| 602 | Ga0466967_0082472 | 3300045976 | Bacteria | 2906 |
| 603 | Ga0495617_025936 | 3300046452 | Bacteria | 1974 |
| 604 | Ga0495627_000094 | 3300046453 | Bacteria | 108256 |
| 605 | Ga0495627_000391 | 3300046453 | Bacteria | 39764 |
| 606 | Ga0495627_001469 | 3300046453 | Bacteria | 13724 |
| 607 | Ga0495629_0046040 | 3300046459 | Bacteria | 3060 |
| 608 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 609 | Ga0495638_0001145 | 3300046460 | Bacteria | 25617 |
| 610 | Ga0495638_0006816 | 3300046460 | Bacteria | 8247 |
| 611 | Ga0495638_0015526 | 3300046460 | Bacteria | 5113 |
| 612 | Ga0495638_0017047 | 3300046460 | Bacteria | 4853 |
| 613 | Ga0495638_0043711 | 3300046460 | Bacteria | 2825 |
| 614 | Ga0495638_0111145 | 3300046460 | Bacteria | 1628 |
| 615 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 616 | Ga0495650_0001135 | 3300046471 | Bacteria | 28922 |
| 617 | Ga0495650_0021897 | 3300046471 | Bacteria | 3074 |
| 618 | Ga0495585_0007224 | 3300046492 | Bacteria | 6825 |
| 619 | Ga0495585_0070263 | 3300046492 | Bacteria | 1910 |
| 620 | Ga0495585_0107265 | 3300046492 | Bacteria | 1488 |
| 621 | Ga0495596_0000054 | 3300046500 | Bacteria | 83068 |
| 622 | Ga0495596_0001629 | 3300046500 | Bacteria | 12750 |
| 623 | Ga0495607_0011251 | 3300046501 | Bacteria | 5969 |
| 624 | Ga0495583_0000139 | 3300046506 | Bacteria | 123464 |
| 625 | Ga0495583_0000187 | 3300046506 | Bacteria | 104971 |
| 626 | Ga0495583_0000631 | 3300046506 | Bacteria | 46958 |
| 627 | Ga0495583_0010716 | 3300046506 | Bacteria | 5321 |
| 628 | Ga0495583_0032633 | 3300046506 | Bacteria | 2512 |
| 629 | Ga0495606_0000672 | 3300046507 | Bacteria | 53500 |
| 630 | Ga0495606_0000685 | 3300046507 | Bacteria | 52815 |
| 631 | Ga0495606_0033566 | 3300046507 | Bacteria | 3538 |
| 632 | Ga0495610_0000022 | 3300046512 | Bacteria | 317107 |
| 633 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 634 | Ga0495610_0000886 | 3300046512 | Bacteria | 27808 |
| 635 | Ga0495610_0002317 | 3300046512 | Bacteria | 16092 |
| 636 | Ga0495610_0020645 | 3300046512 | Bacteria | 3652 |
| 637 | Ga0495616_0000024 | 3300046513 | Bacteria | 145530 |
| 638 | Ga0495620_0017938 | 3300046515 | Bacteria | 3516 |
| 639 | Ga0495620_0076391 | 3300046515 | Bacteria | 1361 |
| 640 | Ga0495631_0023064 | 3300046518 | Bacteria | 2889 |
| 641 | Ga0495632_0000383 | 3300046519 | Bacteria | 42267 |
| 642 | Ga0495632_0000948 | 3300046519 | Bacteria | 25335 |
| 643 | Ga0495632_0008112 | 3300046519 | Bacteria | 6498 |
| 644 | Ga0495632_0027220 | 3300046519 | Bacteria | 2997 |
| 645 | Ga0495632_0052730 | 3300046519 | Bacteria | 1999 |
| 646 | Ga0495637_0008273 | 3300046520 | Bacteria | 5115 |
| 647 | Ga0495637_0040095 | 3300046520 | Bacteria | 2018 |
| 648 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 649 | Ga0495643_0000077 | 3300046522 | Bacteria | 163843 |
| 650 | Ga0495643_0006700 | 3300046522 | Bacteria | 7542 |
| 651 | Ga0495643_0008719 | 3300046522 | Bacteria | 6395 |
| 652 | Ga0495643_0012069 | 3300046522 | Bacteria | 5226 |
| 653 | Ga0495643_0015150 | 3300046522 | Bacteria | 4566 |
| 654 | Ga0495643_0122045 | 3300046522 | Bacteria | 1315 |
| 655 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 656 | Ga0495648_0000143 | 3300046524 | Bacteria | 85539 |
| 657 | Ga0495648_0039704 | 3300046524 | Bacteria | 2992 |
| 658 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 659 | Ga0495663_0007556 | 3300046525 | Bacteria | 3008 |
| 660 | Ga0495654_0005346 | 3300046530 | Bacteria | 7482 |
| 661 | Ga0495654_0041315 | 3300046530 | Bacteria | 2294 |
| 662 | Ga0495587_0019617 | 3300046536 | Bacteria | 4183 |
| 663 | Ga0495598_0015882 | 3300046537 | Bacteria | 1910 |
| 664 | Ga0495609_0015133 | 3300046538 | Bacteria | 3614 |
| 665 | Ga0495621_0016225 | 3300046539 | Bacteria | 2387 |
| 666 | Ga0495633_0000184 | 3300046558 | Bacteria | 81757 |
| 667 | Ga0495633_0000892 | 3300046558 | Bacteria | 25551 |
| 668 | Ga0495633_0011496 | 3300046558 | Bacteria | 4768 |
| 669 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 670 | Ga0495668_0010303 | 3300046616 | Bacteria | 5666 |
| 671 | Ga0495668_0011827 | 3300046616 | Bacteria | 5202 |
| 672 | Ga0495668_0041896 | 3300046616 | Bacteria | 2549 |
| 673 | Ga0495668_0082368 | 3300046616 | Bacteria | 1765 |
| 674 | Ga0495625_0000150 | 3300046660 | Bacteria | 106314 |
| 675 | Ga0495625_0000153 | 3300046660 | Bacteria | 105123 |
| 676 | Ga0495625_0003185 | 3300046660 | Bacteria | 16701 |
| 677 | Ga0495625_0008151 | 3300046660 | Bacteria | 8975 |
| 678 | Ga0495625_0025768 | 3300046660 | Bacteria | 4453 |
| 679 | Ga0495625_0093400 | 3300046660 | Bacteria | 2077 |
| 680 | Ga0495661_0038909 | 3300046665 | Bacteria | 2958 |
| 681 | Ga0495661_0068431 | 3300046665 | Bacteria | 2083 |
| 682 | Ga0495669_0000050 | 3300046684 | Bacteria | 80688 |
| 683 | Ga0495670_0059556 | 3300046691 | Bacteria | 1917 |
| 684 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 685 | Ga0495671_0000072 | 3300046692 | Bacteria | 97315 |
| 686 | Ga0495671_0005155 | 3300046692 | Bacteria | 7687 |
| 687 | Ga0495600_0000690 | 3300046809 | Bacteria | 17650 |
| 688 | Ga0495683_0000963 | 3300047323 | Bacteria | 20180 |
| 689 | Ga0495687_001845 | 3300047443 | Bacteria | 18538 |
| 690 | Ga0495687_002183 | 3300047443 | Bacteria | 16292 |
| 691 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 692 | Ga0495673_0014606 | 3300047469 | Bacteria | 4079 |
| 693 | Ga0495673_0018818 | 3300047469 | Bacteria | 3474 |
| 694 | Ga0495681_0000010 | 3300047470 | Bacteria | 203548 |
| 695 | Ga0495681_0000342 | 3300047470 | Bacteria | 36568 |
| 696 | Ga0495681_0011835 | 3300047470 | Bacteria | 5164 |
| 697 | Ga0495686_0000182 | 3300047472 | Bacteria | 119682 |
| 698 | Ga0495686_0000363 | 3300047472 | Bacteria | 73366 |
| 699 | Ga0495686_0005716 | 3300047472 | Bacteria | 9717 |
| 700 | Ga0495686_0010474 | 3300047472 | Bacteria | 6591 |
| 701 | Ga0495686_0023442 | 3300047472 | Bacteria | 4070 |
| 702 | Ga0495686_0039832 | 3300047472 | Bacteria | 2999 |
| 703 | Ga0495686_0043044 | 3300047472 | Bacteria | 2866 |
| 704 | Ga0495686_0099114 | 3300047472 | Bacteria | 1759 |
| 705 | Ga0495615_0000150 | 3300048090 | Bacteria | 17571 |
| 706 | Ga0495626_0001895 | 3300048091 | Bacteria | 15617 |
| 707 | Ga0496100_0147390 | 3300048903 | Bacteria | 1675 |
| 708 | Ga0496101_0029318 | 3300048904 | Bacteria | 3849 |
| 709 | Ga0496101_0041543 | 3300048904 | Bacteria | 3279 |
| 710 | Ga0496101_0047847 | 3300048904 | Bacteria | 3071 |
| 711 | Ga0496102_0000199 | 3300048905 | Bacteria | 81435 |
| 712 | Ga0496102_0000243 | 3300048905 | Bacteria | 71427 |
| 713 | Ga0496102_0000570 | 3300048905 | Bacteria | 39156 |
| 714 | Ga0496102_0043153 | 3300048905 | Bacteria | 4088 |
| 715 | Ga0496102_0369014 | 3300048905 | Bacteria | 1351 |
| 716 | Ga0496103_0000201 | 3300048906 | Bacteria | 59837 |
| 717 | Ga0496103_0000479 | 3300048906 | Bacteria | 33569 |
| 718 | Ga0496103_0000633 | 3300048906 | Bacteria | 26944 |
| 719 | Ga0496103_0001160 | 3300048906 | Bacteria | 18172 |
| 720 | Ga0496103_0010198 | 3300048906 | Bacteria | 5556 |
| 721 | Ga0496103_0018844 | 3300048906 | Bacteria | 4143 |
| 722 | Ga0496103_0050435 | 3300048906 | Bacteria | 2575 |
| 723 | Ga0496104_0000078 | 3300048907 | Bacteria | 100203 |
| 724 | Ga0496104_0014211 | 3300048907 | Bacteria | 7185 |
| 725 | Ga0496104_0038825 | 3300048907 | Bacteria | 4457 |
| 726 | Ga0496104_0090818 | 3300048907 | Bacteria | 2919 |
| 727 | Ga0496104_0103178 | 3300048907 | Bacteria | 2732 |
| 728 | Ga0496105_0000241 | 3300048908 | Bacteria | 36833 |
| 729 | Ga0496105_0000690 | 3300048908 | Bacteria | 22731 |
| 730 | Ga0496105_0010962 | 3300048908 | Bacteria | 7142 |
| 731 | Ga0496105_0026430 | 3300048908 | Bacteria | 4733 |
| 732 | Ga0496105_0115218 | 3300048908 | Bacteria | 2217 |
| 733 | Ga0496105_0131538 | 3300048908 | Bacteria | 2063 |
| 734 | Ga0496105_0275811 | 3300048908 | Bacteria | 1357 |
| 735 | Ga0496106_0017827 | 3300048909 | Bacteria | 5251 |
| 736 | Ga0496107_0000794 | 3300048910 | Bacteria | 18300 |
| 737 | Ga0496107_0026839 | 3300048910 | Bacteria | 4087 |
| 738 | Ga0496108_0036958 | 3300048911 | Bacteria | 4065 |
| 739 | Ga0496109_0069384 | 3300048912 | Bacteria | 3232 |
| 740 | Ga0496109_0076132 | 3300048912 | Bacteria | 3086 |
| 741 | Ga0496109_0122522 | 3300048912 | Bacteria | 2423 |
| 742 | Ga0496110_0017737 | 3300048913 | Bacteria | 5956 |
| 743 | Ga0496110_0063880 | 3300048913 | Bacteria | 3253 |
| 744 | Ga0496111_0061819 | 3300048914 | Bacteria | 2715 |
| 745 | Ga0496112_0112199 | 3300048915 | Bacteria | 2696 |
| 746 | Ga0496112_0629436 | 3300048915 | Bacteria | 1003 |
| 747 | Ga0496113_0003620 | 3300048916 | Bacteria | 9287 |
| 748 | Ga0496113_0004827 | 3300048916 | Bacteria | 8339 |
| 749 | Ga0496113_0017588 | 3300048916 | Bacteria | 4966 |
| 750 | Ga0496113_0141577 | 3300048916 | Bacteria | 1893 |
| 751 | Ga0496114_0019776 | 3300048917 | Bacteria | 5459 |
| 752 | Ga0496114_0074792 | 3300048917 | Bacteria | 2852 |
| 753 | Ga0496115_0000131 | 3300048918 | Bacteria | 68111 |
| 754 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 755 | Ga0496116_0002567 | 3300048919 | Bacteria | 18955 |
| 756 | Ga0496116_0034167 | 3300048919 | Bacteria | 3593 |
| 757 | Ga0496117_0000179 | 3300048920 | Bacteria | 130966 |
| 758 | Ga0496117_0000352 | 3300048920 | Bacteria | 81089 |
| 759 | Ga0496117_0003444 | 3300048920 | Bacteria | 18406 |
| 760 | Ga0496117_0006507 | 3300048920 | Bacteria | 11782 |
| 761 | Ga0496117_0006558 | 3300048920 | Bacteria | 11712 |
| 762 | Ga0496117_0012763 | 3300048920 | Bacteria | 7371 |
| 763 | Ga0496117_0013579 | 3300048920 | Bacteria | 7095 |
| 764 | Ga0496117_0013905 | 3300048920 | Bacteria | 6976 |
| 765 | Ga0496117_0021332 | 3300048920 | Bacteria | 5244 |
| 766 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 767 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 768 | Ga0496118_0004591 | 3300048921 | Bacteria | 16240 |
| 769 | Ga0496118_0007285 | 3300048921 | Bacteria | 11778 |
| 770 | Ga0496118_0007538 | 3300048921 | Bacteria | 11492 |
| 771 | Ga0496118_0012741 | 3300048921 | Bacteria | 8034 |
| 772 | Ga0496118_0031432 | 3300048921 | Bacteria | 4401 |
| 773 | Ga0496118_0094030 | 3300048921 | Bacteria | 2051 |
| 774 | Ga0496118_0179622 | 3300048921 | Bacteria | 1280 |
| 775 | Ga0496119_0000114 | 3300048922 | Bacteria | 114495 |
| 776 | Ga0496119_0004697 | 3300048922 | Bacteria | 13438 |
| 777 | Ga0496119_0023936 | 3300048922 | Bacteria | 4313 |
| 778 | Ga0496119_0090783 | 3300048922 | Bacteria | 1736 |
| 779 | Ga0496120_0000266 | 3300048923 | Bacteria | 87412 |
| 780 | Ga0496120_0047341 | 3300048923 | Bacteria | 2480 |
| 781 | Ga0496120_0051004 | 3300048923 | Bacteria | 2366 |
| 782 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 783 | Ga0496121_0000228 | 3300048924 | Bacteria | 120653 |
| 784 | Ga0496121_0000526 | 3300048924 | Bacteria | 72764 |
| 785 | Ga0496121_0000675 | 3300048924 | Bacteria | 63670 |
| 786 | Ga0496121_0001839 | 3300048924 | Bacteria | 34202 |
| 787 | Ga0496121_0001919 | 3300048924 | Bacteria | 33213 |
| 788 | Ga0496121_0003164 | 3300048924 | Bacteria | 23728 |
| 789 | Ga0496121_0009156 | 3300048924 | Bacteria | 11446 |
| 790 | Ga0496121_0012385 | 3300048924 | Bacteria | 9312 |
| 791 | Ga0496121_0023268 | 3300048924 | Bacteria | 5973 |
| 792 | Ga0496121_0045089 | 3300048924 | Bacteria | 3793 |
| 793 | Ga0496121_0081421 | 3300048924 | Bacteria | 2563 |
| 794 | Ga0496121_0086801 | 3300048924 | Bacteria | 2458 |
| 795 | Ga0496122_0000176 | 3300048925 | Bacteria | 152190 |
| 796 | Ga0496122_0013037 | 3300048925 | Bacteria | 8187 |
| 797 | Ga0496122_0016897 | 3300048925 | Bacteria | 6861 |
| 798 | Ga0496122_0041018 | 3300048925 | Bacteria | 3669 |
| 799 | Ga0496122_0082928 | 3300048925 | Bacteria | 2225 |
| 800 | Ga0496122_0096877 | 3300048925 | Bacteria | 1987 |
| 801 | Ga0496123_0000291 | 3300048926 | Bacteria | 97989 |
| 802 | Ga0496123_0001706 | 3300048926 | Bacteria | 29346 |
| 803 | Ga0496123_0001817 | 3300048926 | Bacteria | 28073 |
| 804 | Ga0496123_0010209 | 3300048926 | Bacteria | 8332 |
| 805 | Ga0496123_0011704 | 3300048926 | Bacteria | 7568 |
| 806 | Ga0496123_0016103 | 3300048926 | Bacteria | 6092 |
| 807 | Ga0496123_0023217 | 3300048926 | Bacteria | 4752 |
| 808 | Ga0496123_0040904 | 3300048926 | Bacteria | 3221 |
| 809 | Ga0496123_0050151 | 3300048926 | Bacteria | 2791 |
| 810 | Ga0496123_0079366 | 3300048926 | Bacteria | 2006 |
| 811 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 812 | Ga0496124_0000264 | 3300048927 | Bacteria | 101377 |
| 813 | Ga0496124_0000684 | 3300048927 | Bacteria | 55763 |
| 814 | Ga0496124_0001890 | 3300048927 | Bacteria | 28794 |
| 815 | Ga0496124_0002608 | 3300048927 | Bacteria | 23273 |
| 816 | Ga0496124_0003283 | 3300048927 | Bacteria | 19954 |
| 817 | Ga0496124_0035004 | 3300048927 | Bacteria | 4398 |
| 818 | Ga0496124_0066690 | 3300048927 | Bacteria | 2996 |
| 819 | Ga0496124_0138686 | 3300048927 | Bacteria | 1922 |
| 820 | Ga0496124_0149687 | 3300048927 | Bacteria | 1833 |
| 821 | Ga0496125_0000980 | 3300048928 | Bacteria | 44624 |
| 822 | Ga0496125_0009124 | 3300048928 | Bacteria | 10260 |
| 823 | Ga0496125_0022628 | 3300048928 | Bacteria | 5830 |
| 824 | Ga0496125_0037129 | 3300048928 | Bacteria | 4239 |
| 825 | Ga0496125_0053383 | 3300048928 | Bacteria | 3313 |
| 826 | Ga0496125_0088882 | 3300048928 | Bacteria | 2326 |
| 827 | Ga0496125_0095291 | 3300048928 | Bacteria | 2214 |
| 828 | Ga0496125_0129831 | 3300048928 | Bacteria | 1776 |
| 829 | Ga0496126_0000173 | 3300048929 | Bacteria | 146490 |
| 830 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 831 | Ga0496126_0001284 | 3300048929 | Bacteria | 40249 |
| 832 | Ga0496126_0095437 | 3300048929 | Bacteria | 2609 |
| 833 | Ga0496126_0140487 | 3300048929 | Bacteria | 2079 |
| 834 | Ga0496126_0142783 | 3300048929 | Bacteria | 2059 |
| 835 | Ga0496126_0148654 | 3300048929 | Bacteria | 2010 |
| 836 | Ga0496126_0166748 | 3300048929 | Bacteria | 1879 |
| 837 | Ga0496126_0274736 | 3300048929 | Bacteria | 1397 |
| 838 | Ga0501292_000247 | 3300049515 | Bacteria | 8012 |
| 839 | Ga0501032_0060590 | 3300049569 | Bacteria | 2538 |
| 840 | Ga0501033_0065135 | 3300049570 | Bacteria | 2681 |
| 841 | Ga0501038_0047716 | 3300049574 | Bacteria | 3709 |
| 842 | Ga0501043_0051084 | 3300049579 | Bacteria | 3249 |
| 843 | Ga0501047_0000447 | 3300049581 | Bacteria | 45607 |
| 844 | Ga0501070_0159647 | 3300049586 | Bacteria | 1859 |
| 845 | Ga0501211_000821 | 3300049658 | Bacteria | 3224 |
| 846 | Ga0501223_000010 | 3300049663 | Bacteria | 106901 |
| 847 | Ga0501223_000112 | 3300049663 | Bacteria | 23415 |
| 848 | Ga0501223_002105 | 3300049663 | Bacteria | 4464 |
| 849 | Ga0501224_000020 | 3300049664 | Bacteria | 74346 |
| 850 | Ga0501224_009536 | 3300049664 | Bacteria | 1421 |
| 851 | Ga0501233_001867 | 3300049668 | Bacteria | 3656 |
| 852 | Ga0501235_001604 | 3300049669 | Bacteria | 4846 |
| 853 | Ga0501235_002575 | 3300049669 | Bacteria | 3902 |
| 854 | Ga0501246_000669 | 3300049676 | Bacteria | 2516 |
| 855 | Ga0501257_000029 | 3300049686 | Bacteria | 42945 |
| 856 | Ga0501261_000214 | 3300049690 | Bacteria | 7972 |
| 857 | Ga0501225_0000008 | 3300049705 | Bacteria | 95521 |
| 858 | Ga0501225_0000135 | 3300049705 | Bacteria | 22383 |
| 859 | Ga0501225_0003339 | 3300049705 | Bacteria | 4887 |
| 860 | Ga0501245_000464 | 3300049708 | Bacteria | 4912 |
| 861 | Ga0501083_0079449 | 3300049744 | Bacteria | 2175 |
| 862 | Ga0501279_000220 | 3300049775 | Bacteria | 7984 |
| 863 | Ga0501280_000649 | 3300049776 | Bacteria | 7803 |
| 864 | Ga0501282_000493 | 3300049778 | Bacteria | 4700 |
| 865 | Ga0501035_0168692 | 3300049822 | Bacteria | 1892 |
| 866 | Ga0501044_0006548 | 3300049823 | Bacteria | 12857 |
| 867 | Ga0501044_0010061 | 3300049823 | Bacteria | 10279 |
| 868 | Ga0501226_000044 | 3300049853 | Bacteria | 56354 |
| 869 | nmdc:mga03683_229_c1 | 3300050489 | Bacteria | 17517 |
| 870 | nmdc:mga03683_463_c1 | 3300050489 | Bacteria | 11717 |
| 871 | nmdc:mga03n38_5700_c1 | 3300050490 | Bacteria | 4265 |
| 872 | nmdc:mga00v17_3081_c2 | 3300050491 | Bacteria | 3920 |
| 873 | nmdc:mga00v17_39430_c1 | 3300050491 | Bacteria | 2829 |
| 874 | nmdc:mga0k408_110078_c1 | 3300050493 | Bacteria | 1628 |
| 875 | nmdc:mga0k408_1430_c1 | 3300050493 | Bacteria | 12925 |
| 876 | nmdc:mga0k408_51841_c1 | 3300050493 | Bacteria | 2377 |
| 877 | nmdc:mga06z11_3692_c1 | 3300050494 | Bacteria | 5945 |
| 878 | nmdc:mga06z11_519_c1 | 3300050494 | Bacteria | 14218 |
| 879 | nmdc:mga04h51_69_c1 | 3300050495 | Bacteria | 33095 |
| 880 | nmdc:mga04h51_7426_c1 | 3300050495 | Bacteria | 2892 |
| 881 | nmdc:mga07m45_30503_c1 | 3300050496 | Bacteria | 2986 |
| 882 | nmdc:mga07m45_33_c1 | 3300050496 | Bacteria | 75596 |
| 883 | nmdc:mga07m45_50847_c1 | 3300050496 | Bacteria | 2336 |
| 884 | nmdc:mga07m45_73112_c1 | 3300050496 | Bacteria | 1952 |
| 885 | nmdc:mga07m45_8_c1 | 3300050496 | Bacteria | 214050 |
| 886 | nmdc:mga0sz30_15458_c1 | 3300050516 | Bacteria | 3016 |
| 887 | nmdc:mga0sz30_585_c1 | 3300050516 | Bacteria | 13728 |
| 888 | Ga0500610_0013948 | 3300053079 | Bacteria | 3756 |
| 889 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 890 | Ga0500643_000283 | 3300053087 | Bacteria | 43805 |
| 891 | Ga0500643_000330 | 3300053087 | Bacteria | 37938 |
| 892 | Ga0500643_000513 | 3300053087 | Bacteria | 27509 |
| 893 | Ga0500643_000620 | 3300053087 | Bacteria | 24035 |
| 894 | Ga0500643_001124 | 3300053087 | Bacteria | 15971 |
| 895 | Ga0500643_001505 | 3300053087 | Bacteria | 13338 |
| 896 | Ga0500643_006824 | 3300053087 | Bacteria | 4704 |
| 897 | Ga0500643_009073 | 3300053087 | Bacteria | 3835 |
| 898 | Ga0500651_0021296 | 3300053093 | Bacteria | 4041 |
| 899 | Ga0500555_003466 | 3300053103 | Bacteria | 4493 |
| 900 | Ga0500556_0000144 | 3300053104 | Bacteria | 59354 |
| 901 | Ga0500562_000252 | 3300053108 | Bacteria | 13785 |
| 902 | Ga0500592_000568 | 3300053116 | Bacteria | 6104 |
| 903 | Ga0500592_001514 | 3300053116 | Bacteria | 3762 |
| 904 | Ga0500592_003121 | 3300053116 | Bacteria | 2648 |
| 905 | Ga0500592_011306 | 3300053116 | Bacteria | 1427 |
| 906 | Ga0500607_000098 | 3300053121 | Bacteria | 65919 |
| 907 | Ga0500607_000381 | 3300053121 | Bacteria | 42415 |
| 908 | Ga0500608_000054 | 3300053122 | Bacteria | 51067 |
| 909 | Ga0500614_022454 | 3300053123 | Bacteria | 1473 |
| 910 | Ga0500618_000803 | 3300053125 | Bacteria | 17291 |
| 911 | Ga0500618_017176 | 3300053125 | Bacteria | 1803 |
| 912 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 913 | Ga0500642_0017110 | 3300053130 | Bacteria | 2771 |
| 914 | Ga0500655_000561 | 3300053133 | Bacteria | 7469 |
| 915 | Ga0500658_0001466 | 3300053134 | Bacteria | 9439 |
| 916 | Ga0500658_0001655 | 3300053134 | Bacteria | 8866 |
| 917 | Ga0500559_0000607 | 3300053136 | Bacteria | 24382 |
| 918 | Ga0500559_0001427 | 3300053136 | Bacteria | 13559 |
| 919 | Ga0500559_0011941 | 3300053136 | Bacteria | 3702 |
| 920 | Ga0500559_0012105 | 3300053136 | Bacteria | 3674 |
| 921 | Ga0500559_0024336 | 3300053136 | Bacteria | 2576 |
| 922 | Ga0500559_0054494 | 3300053136 | Bacteria | 1771 |
| 923 | Ga0500559_0054945 | 3300053136 | Bacteria | 1765 |
| 924 | Ga0500573_0000278 | 3300053140 | Bacteria | 21754 |
| 925 | Ga0500573_0119818 | 3300053140 | Bacteria | 1466 |
| 926 | Ga0500590_000301 | 3300053148 | Bacteria | 15719 |
| 927 | Ga0500590_017734 | 3300053148 | Bacteria | 3680 |
| 928 | Ga0500604_0002278 | 3300053151 | Bacteria | 5253 |
| 929 | Ga0500616_0001893 | 3300053153 | Bacteria | 18825 |
| 930 | Ga0500622_0001014 | 3300053156 | Bacteria | 23572 |
| 931 | Ga0500622_0057718 | 3300053156 | Bacteria | 1985 |
| 932 | Ga0500624_000015 | 3300053157 | Bacteria | 161928 |
| 933 | Ga0500624_000023 | 3300053157 | Bacteria | 114997 |
| 934 | Ga0500624_000289 | 3300053157 | Bacteria | 17376 |
| 935 | Ga0500627_0000104 | 3300053158 | Bacteria | 28060 |
| 936 | Ga0500627_0000488 | 3300053158 | Bacteria | 10673 |
| 937 | Ga0500627_0000778 | 3300053158 | Bacteria | 8492 |
| 938 | Ga0500636_0003237 | 3300053177 | Bacteria | 9121 |
| 939 | Ga0500636_0011030 | 3300053177 | Bacteria | 5286 |
| 940 | Ga0500636_0026651 | 3300053177 | Bacteria | 3414 |
| 941 | Ga0500637_0000013 | 3300053178 | Bacteria | 73168 |
| 942 | Ga0500637_0057843 | 3300053178 | Bacteria | 2217 |
| 943 | Ga0500567_007512 | 3300053723 | Bacteria | 5134 |
| 944 | Ga0500570_006332 | 3300053724 | Bacteria | 6424 |
| 945 | Ga0500611_002591 | 3300053727 | Bacteria | 2194 |
| 946 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 947 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 948 | Ga0500645_000780 | 3300053730 | Bacteria | 19276 |
| 949 | Ga0500645_006477 | 3300053730 | Bacteria | 4171 |
| 950 | Ga0500645_013828 | 3300053730 | Bacteria | 2583 |
| 951 | Ga0500645_018269 | 3300053730 | Bacteria | 2191 |
| 952 | Ga0500645_021520 | 3300053730 | Bacteria | 1990 |
| 953 | Ga0500596_002731 | 3300053735 | Bacteria | 3458 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042010 | Ga0439452_025280 | Ga0439452_025280_507_1421 | 280 |
| 2 | 3300048915 | Ga0496112_0629436 | Ga0496112_0629436_16_984 | 315 |
| 3 | 3300013306 | Ga0163162_10015484 | Ga0163162_100154842 | 335 |
| 4 | 3300010375 | Ga0105239_10618628 | Ga0105239_106186282 | 336 |
| 5 | 3300015690 | Ga0183363_1004 | Ga0183363_1004199 | 337 |
| 6 | 3300053134 | Ga0500658_0001655 | Ga0500658_0001655_1452_2558 | 337 |
| 7 | 3300005618 | Ga0068864_100000642 | Ga0068864_10000064230 | 338 |
| 8 | 3300005842 | Ga0068858_100000304 | Ga0068858_1000003048 | 338 |
| 9 | 3300026035 | Ga0207703_10000435 | Ga0207703_100004352 | 338 |
| 10 | 3300026095 | Ga0207676_10000603 | Ga0207676_100006032 | 338 |
| 11 | 3300025972 | Ga0207668_10316619 | Ga0207668_103166191 | 339 |
| 12 | 3300041404 | Ga0439436_0018522 | Ga0439436_0018522_845_1951 | 341 |
| 13 | 3300041413 | Ga0439465_0016622 | Ga0439465_0016622_353_1465 | 342 |
| 14 | 3300042004 | Ga0439445_0011274 | Ga0439445_0011274_977_2089 | 342 |
| 15 | 3300046519 | Ga0495632_0052730 | Ga0495632_0052730_15_1043 | 342 |
| 16 | 3300025924 | Ga0207694_10175781 | Ga0207694_101757812 | 343 |
| 17 | 3300053730 | Ga0500645_018269 | Ga0500645_018269_124_1230 | 343 |
| 18 | 3300041404 | Ga0439436_0009476 | Ga0439436_0009476_722_1834 | 344 |
| 19 | 3300041410 | Ga0439461_0000086 | Ga0439461_0000086_4710_5822 | 344 |
| 20 | 3300041413 | Ga0439465_0001125 | Ga0439465_0001125_6314_7426 | 344 |
| 21 | 3300041997 | Ga0439431_0000491 | Ga0439431_0000491_897_2009 | 344 |
| 22 | 3300042006 | Ga0439432_005779 | Ga0439432_005779_2006_3118 | 344 |
| 23 | 3300048920 | Ga0496117_0012763 | Ga0496117_0012763_2782_3906 | 345 |
| 24 | 3300048921 | Ga0496118_0007285 | Ga0496118_0007285_6370_7494 | 345 |
| 25 | 3300005539 | Ga0068853_100019326 | Ga0068853_1000193264 | 348 |
| 26 | 3300049658 | Ga0501211_000821 | Ga0501211_000821_168_1253 | 349 |
| 27 | 3300049669 | Ga0501235_002575 | Ga0501235_002575_860_1945 | 349 |
| 28 | 3300049686 | Ga0501257_000029 | Ga0501257_000029_34340_35464 | 349 |
| 29 | 3300048903 | Ga0496100_0147390 | Ga0496100_0147390_414_1502 | 351 |
| 30 | 3300049663 | Ga0501223_000010 | Ga0501223_000010_19444_20505 | 351 |
| 31 | 3300049676 | Ga0501246_000669 | Ga0501246_000669_63_1124 | 351 |
| 32 | 3300049705 | Ga0501225_0000008 | Ga0501225_0000008_7813_8874 | 351 |
| 33 | 3300027665 | Ga0209983_1009114 | Ga0209983_10091142 | 352 |
| 34 | 3300045051 | Ga0451576_0000588 | Ga0451576_0000588_30101_31216 | 352 |
| 35 | 3300005530 | Ga0070679_100008282 | Ga0070679_1000082827 | 353 |
| 36 | 3300025921 | Ga0207652_10008597 | Ga0207652_100085978 | 353 |
| 37 | 3300031548 | Ga0307408_100024261 | Ga0307408_1000242614 | 353 |
| 38 | 3300031911 | Ga0307412_10043331 | Ga0307412_100433312 | 353 |
| 39 | 3300032002 | Ga0307416_100046276 | Ga0307416_1000462762 | 353 |
| 40 | 3300053136 | Ga0500559_0054494 | Ga0500559_0054494_144_1256 | 353 |
| 41 | 3300026088 | Ga0207641_10025885 | Ga0207641_100258853 | 354 |
| 42 | 3300005618 | Ga0068864_100001753 | Ga0068864_10000175314 | 355 |
| 43 | 3300005841 | Ga0068863_100017269 | Ga0068863_1000172698 | 355 |
| 44 | 3300026088 | Ga0207641_10000346 | Ga0207641_1000034659 | 355 |
| 45 | 3300026095 | Ga0207676_10003853 | Ga0207676_1000385310 | 355 |
| 46 | 3300045051 | Ga0451576_0215241 | Ga0451576_0215241_239_1384 | 355 |
| 47 | 3300046492 | Ga0495585_0070263 | Ga0495585_0070263_289_1401 | 355 |
| 48 | 3300053140 | Ga0500573_0000278 | Ga0500573_0000278_2329_3441 | 355 |
| 49 | 3300005331 | Ga0070670_100240614 | Ga0070670_1002406141 | 356 |
| 50 | 3300005355 | Ga0070671_100039115 | Ga0070671_1000391153 | 356 |
| 51 | 3300005367 | Ga0070667_100104253 | Ga0070667_1001042531 | 356 |
| 52 | 3300005842 | Ga0068858_100016712 | Ga0068858_1000167124 | 356 |
| 53 | 3300009177 | Ga0105248_10175942 | Ga0105248_101759422 | 356 |
| 54 | 3300025931 | Ga0207644_10021357 | Ga0207644_100213573 | 356 |
| 55 | 3300025941 | Ga0207711_10048966 | Ga0207711_100489662 | 356 |
| 56 | 3300026035 | Ga0207703_10001956 | Ga0207703_100019564 | 356 |
| 57 | 3300041997 | Ga0439431_0020680 | Ga0439431_0020680_27_1133 | 356 |
| 58 | 3300048912 | Ga0496109_0076132 | Ga0496109_0076132_1227_2372 | 356 |
| 59 | 3300048917 | Ga0496114_0074792 | Ga0496114_0074792_1348_2493 | 356 |
| 60 | 3300048927 | Ga0496124_0149687 | Ga0496124_0149687_504_1649 | 356 |
| 61 | 3300048929 | Ga0496126_0140487 | Ga0496126_0140487_139_1284 | 356 |
| 62 | 3300050493 | nmdc:mga0k408_51841_c1 | nmdc:mga0k408_51841_c1_1273_2349 | 357 |
| 63 | 3300053087 | Ga0500643_009073 | Ga0500643_009073_1829_2935 | 357 |
| 64 | 3300002076 | JGI24749J21850_1000087 | JGI24749J21850_100008718 | 359 |
| 65 | 3300002459 | JGI24751J29686_10000054 | JGI24751J29686_1000005475 | 359 |
| 66 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003392 | 359 |
| 67 | 3300005335 | Ga0070666_10198050 | Ga0070666_101980501 | 359 |
| 68 | 3300005353 | Ga0070669_100000020 | Ga0070669_100000020141 | 359 |
| 69 | 3300005367 | Ga0070667_100000851 | Ga0070667_10000085123 | 359 |
| 70 | 3300005617 | Ga0068859_100001299 | Ga0068859_10000129927 | 359 |
| 71 | 3300005618 | Ga0068864_100000005 | Ga0068864_100000005260 | 359 |
| 72 | 3300005719 | Ga0068861_100088296 | Ga0068861_1000882963 | 359 |
| 73 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001181 | 359 |
| 74 | 3300006880 | Ga0075429_100039568 | Ga0075429_1000395683 | 359 |
| 75 | 3300006880 | Ga0075429_100102528 | Ga0075429_1001025282 | 359 |
| 76 | 3300006931 | Ga0097620_100001299 | Ga0097620_10000129927 | 359 |
| 77 | 3300009177 | Ga0105248_10000086 | Ga0105248_10000086121 | 359 |
| 78 | 3300014326 | Ga0157380_10000060 | Ga0157380_1000006018 | 359 |
| 79 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005332 | 359 |
| 80 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004390 | 359 |
| 81 | 3300025941 | Ga0207711_10000310 | Ga0207711_1000031041 | 359 |
| 82 | 3300025986 | Ga0207658_10001330 | Ga0207658_100013306 | 359 |
| 83 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006322 | 359 |
| 84 | 3300026118 | Ga0207675_100020136 | Ga0207675_1000201362 | 359 |
| 85 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001850 | 359 |
| 86 | 3300031616 | Ga0307508_10001821 | Ga0307508_100018212 | 359 |
| 87 | 3300046460 | Ga0495638_0000018 | Ga0495638_0000018_120498_121646 | 359 |
| 88 | 3300046460 | Ga0495638_0001145 | Ga0495638_0001145_9288_10400 | 359 |
| 89 | 3300046506 | Ga0495583_0000187 | Ga0495583_0000187_8221_9369 | 359 |
| 90 | 3300046524 | Ga0495648_0000018 | Ga0495648_0000018_160845_161993 | 359 |
| 91 | 3300046616 | Ga0495668_0041896 | Ga0495668_0041896_816_1964 | 359 |
| 92 | 3300046660 | Ga0495625_0000153 | Ga0495625_0000153_49737_50855 | 359 |
| 93 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_184548_185696 | 359 |
| 94 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_452612_453760 | 359 |
| 95 | 3300048928 | Ga0496125_0088882 | Ga0496125_0088882_1084_2169 | 359 |
| 96 | 3300053116 | Ga0500592_003121 | Ga0500592_003121_984_2132 | 359 |
| 97 | 3300053134 | Ga0500658_0001466 | Ga0500658_0001466_791_1903 | 359 |
| 98 | 3300001976 | JGI24752J21851_1001369 | JGI24752J21851_10013693 | 360 |
| 99 | 3300003214 | JGI25165J46597_1000012 | JGI25165J46597_1000012106 | 360 |
| 100 | 3300005331 | Ga0070670_100000965 | Ga0070670_1000009659 | 360 |
| 101 | 3300005367 | Ga0070667_100002068 | Ga0070667_1000020688 | 360 |
| 102 | 3300005618 | Ga0068864_100000332 | Ga0068864_10000033240 | 360 |
| 103 | 3300005841 | Ga0068863_100000456 | Ga0068863_1000004569 | 360 |
| 104 | 3300005844 | Ga0068862_100000506 | Ga0068862_10000050640 | 360 |
| 105 | 3300009011 | Ga0105251_10001625 | Ga0105251_1000162510 | 360 |
| 106 | 3300009177 | Ga0105248_10000029 | Ga0105248_1000002940 | 360 |
| 107 | 3300009551 | Ga0105238_10254974 | Ga0105238_102549741 | 360 |
| 108 | 3300009553 | Ga0105249_10000024 | Ga0105249_1000002423 | 360 |
| 109 | 3300025261 | Ga0209233_1000058 | Ga0209233_1000058313 | 360 |
| 110 | 3300025919 | Ga0207657_10186792 | Ga0207657_101867921 | 360 |
| 111 | 3300025925 | Ga0207650_10000545 | Ga0207650_1000054516 | 360 |
| 112 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004467 | 360 |
| 113 | 3300025961 | Ga0207712_10000034 | Ga0207712_1000003424 | 360 |
| 114 | 3300025986 | Ga0207658_10000434 | Ga0207658_1000043425 | 360 |
| 115 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010118 | 360 |
| 116 | 3300026095 | Ga0207676_10000036 | Ga0207676_10000036160 | 360 |
| 117 | 3300028380 | Ga0268265_10000059 | Ga0268265_10000059113 | 360 |
| 118 | 3300046513 | Ga0495616_0000024 | Ga0495616_0000024_75619_76767 | 360 |
| 119 | 3300046616 | Ga0495668_0010303 | Ga0495668_0010303_3926_5074 | 360 |
| 120 | 3300048904 | Ga0496101_0029318 | Ga0496101_0029318_514_1656 | 360 |
| 121 | 3300048906 | Ga0496103_0010198 | Ga0496103_0010198_3956_5098 | 360 |
| 122 | 3300048920 | Ga0496117_0006558 | Ga0496117_0006558_7406_8548 | 360 |
| 123 | 3300048920 | Ga0496117_0013579 | Ga0496117_0013579_3131_4252 | 360 |
| 124 | 3300048921 | Ga0496118_0004591 | Ga0496118_0004591_7428_8570 | 360 |
| 125 | 3300053136 | Ga0500559_0054945 | Ga0500559_0054945_340_1452 | 360 |
| 126 | 3300053151 | Ga0500604_0002278 | Ga0500604_0002278_2752_3900 | 360 |
| 127 | 3300053158 | Ga0500627_0000488 | Ga0500627_0000488_9079_10227 | 360 |
| 128 | iso_pu_bacteria | 2830075706 | 2830078125 | 361 |
| 129 | 3300026035 | Ga0207703_10109986 | Ga0207703_101099862 | 362 |
| 130 | 3300032004 | Ga0307414_10000070 | Ga0307414_1000007050 | 362 |
| 131 | 3300042015 | Ga0439462_0002734 | Ga0439462_0002734_675_1808 | 362 |
| 132 | 3300049569 | Ga0501032_0060590 | Ga0501032_0060590_845_1987 | 362 |
| 133 | 3300049579 | Ga0501043_0051084 | Ga0501043_0051084_574_1716 | 362 |
| 134 | 3300049581 | Ga0501047_0000447 | Ga0501047_0000447_466_1608 | 362 |
| 135 | 3300001915 | JGI24741J21665_1001215 | JGI24741J21665_10012157 | 363 |
| 136 | 3300001979 | JGI24740J21852_10000540 | JGI24740J21852_1000054017 | 363 |
| 137 | 3300001989 | JGI24739J22299_10003942 | JGI24739J22299_100039426 | 363 |
| 138 | 3300001990 | JGI24737J22298_10004191 | JGI24737J22298_100041911 | 363 |
| 139 | 3300002067 | JGI24735J21928_10000861 | JGI24735J21928_100008618 | 363 |
| 140 | 3300005289 | Ga0065704_10105609 | Ga0065704_101056092 | 363 |
| 141 | 3300005327 | Ga0070658_10032881 | Ga0070658_100328812 | 363 |
| 142 | 3300005327 | Ga0070658_10032902 | Ga0070658_100329024 | 363 |
| 143 | 3300005336 | Ga0070680_100011845 | Ga0070680_1000118454 | 363 |
| 144 | 3300005347 | Ga0070668_100042436 | Ga0070668_1000424363 | 363 |
| 145 | 3300005353 | Ga0070669_100050393 | Ga0070669_1000503932 | 363 |
| 146 | 3300005355 | Ga0070671_100002625 | Ga0070671_1000026256 | 363 |
| 147 | 3300005366 | Ga0070659_100008121 | Ga0070659_1000081218 | 363 |
| 148 | 3300005455 | Ga0070663_100129135 | Ga0070663_1001291352 | 363 |
| 149 | 3300005458 | Ga0070681_10005668 | Ga0070681_1000566812 | 363 |
| 150 | 3300005459 | Ga0068867_100235491 | Ga0068867_1002354912 | 363 |
| 151 | 3300005548 | Ga0070665_100137757 | Ga0070665_1001377572 | 363 |
| 152 | 3300005563 | Ga0068855_100014816 | Ga0068855_1000148162 | 363 |
| 153 | 3300005564 | Ga0070664_100020427 | Ga0070664_1000204275 | 363 |
| 154 | 3300005564 | Ga0070664_100102464 | Ga0070664_1001024641 | 363 |
| 155 | 3300005577 | Ga0068857_100009607 | Ga0068857_1000096072 | 363 |
| 156 | 3300005577 | Ga0068857_100069212 | Ga0068857_1000692122 | 363 |
| 157 | 3300005614 | Ga0068856_100011400 | Ga0068856_1000114003 | 363 |
| 158 | 3300005834 | Ga0068851_10042184 | Ga0068851_100421842 | 363 |
| 159 | 3300005842 | Ga0068858_100000472 | Ga0068858_1000004726 | 363 |
| 160 | 3300009093 | Ga0105240_10070426 | Ga0105240_100704264 | 363 |
| 161 | 3300009098 | Ga0105245_10001108 | Ga0105245_1000110817 | 363 |
| 162 | 3300009147 | Ga0114129_10021496 | Ga0114129_100214968 | 363 |
| 163 | 3300009174 | Ga0105241_10000997 | Ga0105241_1000099714 | 363 |
| 164 | 3300009174 | Ga0105241_10166400 | Ga0105241_101664002 | 363 |
| 165 | 3300009545 | Ga0105237_10007129 | Ga0105237_100071294 | 363 |
| 166 | 3300010375 | Ga0105239_10067612 | Ga0105239_100676124 | 363 |
| 167 | 3300013100 | Ga0157373_10003358 | Ga0157373_100033585 | 363 |
| 168 | 3300013102 | Ga0157371_10003665 | Ga0157371_100036659 | 363 |
| 169 | 3300013102 | Ga0157371_10140860 | Ga0157371_101408602 | 363 |
| 170 | 3300013104 | Ga0157370_10013758 | Ga0157370_100137585 | 363 |
| 171 | 3300013104 | Ga0157370_10330811 | Ga0157370_103308111 | 363 |
| 172 | 3300013105 | Ga0157369_10115578 | Ga0157369_101155782 | 363 |
| 173 | 3300013307 | Ga0157372_10242033 | Ga0157372_102420331 | 363 |
| 174 | 3300013307 | Ga0157372_10328848 | Ga0157372_103288482 | 363 |
| 175 | 3300014326 | Ga0157380_10148878 | Ga0157380_101488782 | 363 |
| 176 | 3300025904 | Ga0207647_10008366 | Ga0207647_100083662 | 363 |
| 177 | 3300025912 | Ga0207707_10069377 | Ga0207707_100693772 | 363 |
| 178 | 3300025913 | Ga0207695_10095696 | Ga0207695_100956962 | 363 |
| 179 | 3300025919 | Ga0207657_10000408 | Ga0207657_1000040848 | 363 |
| 180 | 3300025919 | Ga0207657_10002471 | Ga0207657_100024718 | 363 |
| 181 | 3300025920 | Ga0207649_10159200 | Ga0207649_101592001 | 363 |
| 182 | 3300025924 | Ga0207694_10182713 | Ga0207694_101827132 | 363 |
| 183 | 3300025927 | Ga0207687_10000853 | Ga0207687_1000085314 | 363 |
| 184 | 3300025931 | Ga0207644_10070832 | Ga0207644_100708322 | 363 |
| 185 | 3300025932 | Ga0207690_10023275 | Ga0207690_100232753 | 363 |
| 186 | 3300025932 | Ga0207690_10031743 | Ga0207690_100317434 | 363 |
| 187 | 3300025933 | Ga0207706_10002919 | Ga0207706_100029198 | 363 |
| 188 | 3300025933 | Ga0207706_10004237 | Ga0207706_100042378 | 363 |
| 189 | 3300025944 | Ga0207661_10256435 | Ga0207661_102564351 | 363 |
| 190 | 3300025945 | Ga0207679_10100238 | Ga0207679_101002382 | 363 |
| 191 | 3300025949 | Ga0207667_10118401 | Ga0207667_101184012 | 363 |
| 192 | 3300025981 | Ga0207640_10018948 | Ga0207640_100189483 | 363 |
| 193 | 3300026035 | Ga0207703_10000568 | Ga0207703_1000056835 | 363 |
| 194 | 3300026041 | Ga0207639_10045628 | Ga0207639_100456282 | 363 |
| 195 | 3300026041 | Ga0207639_10074344 | Ga0207639_100743443 | 363 |
| 196 | 3300026041 | Ga0207639_10224291 | Ga0207639_102242912 | 363 |
| 197 | 3300026067 | Ga0207678_10000324 | Ga0207678_1000032425 | 363 |
| 198 | 3300026078 | Ga0207702_10005910 | Ga0207702_100059103 | 363 |
| 199 | 3300026116 | Ga0207674_10003143 | Ga0207674_100031439 | 363 |
| 200 | 3300026116 | Ga0207674_10009082 | Ga0207674_1000908211 | 363 |
| 201 | 3300026116 | Ga0207674_10085003 | Ga0207674_100850032 | 363 |
| 202 | 3300031548 | Ga0307408_100062683 | Ga0307408_1000626832 | 363 |
| 203 | 3300031911 | Ga0307412_10025366 | Ga0307412_100253662 | 363 |
| 204 | 3300032002 | Ga0307416_100080150 | Ga0307416_1000801502 | 363 |
| 205 | 3300037418 | Ga0395900_0044548 | Ga0395900_0044548_991_2103 | 363 |
| 206 | 3300037466 | Ga0395898_0018073 | Ga0395898_0018073_1584_2696 | 363 |
| 207 | 3300038443 | Ga0395901_0018063 | Ga0395901_0018063_5503_6615 | 363 |
| 208 | 3300045976 | Ga0466967_0082472 | Ga0466967_0082472_1273_2385 | 363 |
| 209 | 3300046530 | Ga0495654_0005346 | Ga0495654_0005346_5259_6407 | 363 |
| 210 | 3300046616 | Ga0495668_0000016 | Ga0495668_0000016_292480_293598 | 363 |
| 211 | 3300046616 | Ga0495668_0011827 | Ga0495668_0011827_1706_2854 | 363 |
| 212 | 3300047472 | Ga0495686_0039832 | Ga0495686_0039832_163_1293 | 363 |
| 213 | 3300048905 | Ga0496102_0369014 | Ga0496102_0369014_109_1260 | 363 |
| 214 | 3300048912 | Ga0496109_0069384 | Ga0496109_0069384_562_1713 | 363 |
| 215 | 3300048913 | Ga0496110_0017737 | Ga0496110_0017737_4422_5573 | 363 |
| 216 | 3300048916 | Ga0496113_0004827 | Ga0496113_0004827_6535_7686 | 363 |
| 217 | 3300048919 | Ga0496116_0034167 | Ga0496116_0034167_516_1643 | 363 |
| 218 | 3300048924 | Ga0496121_0003164 | Ga0496121_0003164_6272_7399 | 363 |
| 219 | 3300048924 | Ga0496121_0009156 | Ga0496121_0009156_8806_9936 | 363 |
| 220 | 3300048928 | Ga0496125_0095291 | Ga0496125_0095291_216_1367 | 363 |
| 221 | 3300048928 | Ga0496125_0129831 | Ga0496125_0129831_351_1478 | 363 |
| 222 | 3300049515 | Ga0501292_000247 | Ga0501292_000247_3984_5123 | 363 |
| 223 | 3300049663 | Ga0501223_002105 | Ga0501223_002105_1387_2526 | 363 |
| 224 | 3300049664 | Ga0501224_009536 | Ga0501224_009536_272_1411 | 363 |
| 225 | 3300049690 | Ga0501261_000214 | Ga0501261_000214_4138_5277 | 363 |
| 226 | 3300049708 | Ga0501245_000464 | Ga0501245_000464_2443_3582 | 363 |
| 227 | 3300049775 | Ga0501279_000220 | Ga0501279_000220_4152_5291 | 363 |
| 228 | 3300049776 | Ga0501280_000649 | Ga0501280_000649_2624_3763 | 363 |
| 229 | 3300049778 | Ga0501282_000493 | Ga0501282_000493_1820_2959 | 363 |
| 230 | 3300053093 | Ga0500651_0021296 | Ga0500651_0021296_1594_2718 | 363 |
| 231 | 3300053123 | Ga0500614_022454 | Ga0500614_022454_202_1326 | 363 |
| 232 | 3300053156 | Ga0500622_0057718 | Ga0500622_0057718_768_1892 | 363 |
| 233 | 3300053158 | Ga0500627_0000778 | Ga0500627_0000778_5236_6384 | 363 |
| 234 | iso_pu_bacteria | 2990265787 | 2990266443 | 363 |
| 235 | iso_pu_bacteria | 2993693658 | 2993695764 | 363 |
| 236 | 3300001904 | JGI24736J21556_1000256 | JGI24736J21556_10002562 | 365 |
| 237 | 3300001976 | JGI24752J21851_1000062 | JGI24752J21851_100006212 | 365 |
| 238 | 3300001979 | JGI24740J21852_10005886 | JGI24740J21852_100058864 | 365 |
| 239 | 3300001989 | JGI24739J22299_10004578 | JGI24739J22299_100045782 | 365 |
| 240 | 3300002067 | JGI24735J21928_10003084 | JGI24735J21928_100030843 | 365 |
| 241 | 3300002070 | JGI24750J21931_1000036 | JGI24750J21931_10000368 | 365 |
| 242 | 3300002074 | JGI24748J21848_1000103 | JGI24748J21848_10001038 | 365 |
| 243 | 3300002075 | JGI24738J21930_10001565 | JGI24738J21930_100015653 | 365 |
| 244 | 3300002239 | JGI24034J26672_10000057 | JGI24034J26672_1000005740 | 365 |
| 245 | 3300002244 | JGI24742J22300_10004425 | JGI24742J22300_100044252 | 365 |
| 246 | 3300005329 | Ga0070683_100170222 | Ga0070683_1001702222 | 365 |
| 247 | 3300005330 | Ga0070690_100000011 | Ga0070690_10000001195 | 365 |
| 248 | 3300005331 | Ga0070670_100018785 | Ga0070670_1000187856 | 365 |
| 249 | 3300005335 | Ga0070666_10000035 | Ga0070666_10000035119 | 365 |
| 250 | 3300005340 | Ga0070689_100002742 | Ga0070689_1000027424 | 365 |
| 251 | 3300005353 | Ga0070669_100000712 | Ga0070669_1000007128 | 365 |
| 252 | 3300005365 | Ga0070688_100001328 | Ga0070688_1000013288 | 365 |
| 253 | 3300005366 | Ga0070659_100070457 | Ga0070659_1000704572 | 365 |
| 254 | 3300005455 | Ga0070663_100017417 | Ga0070663_1000174175 | 365 |
| 255 | 3300005466 | Ga0070685_10000168 | Ga0070685_100001688 | 365 |
| 256 | 3300005544 | Ga0070686_100001324 | Ga0070686_1000013246 | 365 |
| 257 | 3300005548 | Ga0070665_100000161 | Ga0070665_1000001618 | 365 |
| 258 | 3300005577 | Ga0068857_100245112 | Ga0068857_1002451121 | 365 |
| 259 | 3300005578 | Ga0068854_100305493 | Ga0068854_1003054931 | 365 |
| 260 | 3300005614 | Ga0068856_100494178 | Ga0068856_1004941781 | 365 |
| 261 | 3300005616 | Ga0068852_100108194 | Ga0068852_1001081943 | 365 |
| 262 | 3300005617 | Ga0068859_100006610 | Ga0068859_10000661012 | 365 |
| 263 | 3300005618 | Ga0068864_100025454 | Ga0068864_1000254544 | 365 |
| 264 | 3300005719 | Ga0068861_100015879 | Ga0068861_1000158792 | 365 |
| 265 | 3300005841 | Ga0068863_100000060 | Ga0068863_1000000608 | 365 |
| 266 | 3300005842 | Ga0068858_100022636 | Ga0068858_1000226361 | 365 |
| 267 | 3300005843 | Ga0068860_100000126 | Ga0068860_1000001268 | 365 |
| 268 | 3300005844 | Ga0068862_100001574 | Ga0068862_1000015744 | 365 |
| 269 | 3300006931 | Ga0097620_100006610 | Ga0097620_10000661012 | 365 |
| 270 | 3300009553 | Ga0105249_10000094 | Ga0105249_10000094121 | 365 |
| 271 | 3300013104 | Ga0157370_10051407 | Ga0157370_100514074 | 365 |
| 272 | 3300013307 | Ga0157372_10035441 | Ga0157372_100354413 | 365 |
| 273 | 3300014325 | Ga0163163_10008504 | Ga0163163_100085046 | 365 |
| 274 | 3300014326 | Ga0157380_10000542 | Ga0157380_100005422 | 365 |
| 275 | 3300014968 | Ga0157379_10004525 | Ga0157379_100045258 | 365 |
| 276 | 3300017792 | Ga0163161_10000716 | Ga0163161_100007166 | 365 |
| 277 | 3300025321 | Ga0207656_10005981 | Ga0207656_100059814 | 365 |
| 278 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007397 | 365 |
| 279 | 3300025911 | Ga0207654_10002907 | Ga0207654_100029073 | 365 |
| 280 | 3300025913 | Ga0207695_10075297 | Ga0207695_100752974 | 365 |
| 281 | 3300025914 | Ga0207671_10018947 | Ga0207671_100189474 | 365 |
| 282 | 3300025919 | Ga0207657_10011633 | Ga0207657_100116332 | 365 |
| 283 | 3300025923 | Ga0207681_10000089 | Ga0207681_100000894 | 365 |
| 284 | 3300025924 | Ga0207694_10005621 | Ga0207694_100056216 | 365 |
| 285 | 3300025931 | Ga0207644_10003216 | Ga0207644_100032168 | 365 |
| 286 | 3300025936 | Ga0207670_10013004 | Ga0207670_100130044 | 365 |
| 287 | 3300025941 | Ga0207711_10024128 | Ga0207711_100241282 | 365 |
| 288 | 3300025949 | Ga0207667_10008229 | Ga0207667_100082294 | 365 |
| 289 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004385 | 365 |
| 290 | 3300025986 | Ga0207658_10002894 | Ga0207658_100028948 | 365 |
| 291 | 3300026035 | Ga0207703_10012521 | Ga0207703_100125216 | 365 |
| 292 | 3300026067 | Ga0207678_10041873 | Ga0207678_100418733 | 365 |
| 293 | 3300026078 | Ga0207702_10113370 | Ga0207702_101133702 | 365 |
| 294 | 3300026088 | Ga0207641_10000100 | Ga0207641_10000100124 | 365 |
| 295 | 3300026095 | Ga0207676_10002760 | Ga0207676_100027604 | 365 |
| 296 | 3300026118 | Ga0207675_100003757 | Ga0207675_1000037578 | 365 |
| 297 | 3300026142 | Ga0207698_10027376 | Ga0207698_100273762 | 365 |
| 298 | 3300028379 | Ga0268266_10000040 | Ga0268266_10000040309 | 365 |
| 299 | 3300028380 | Ga0268265_10002795 | Ga0268265_1000279510 | 365 |
| 300 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003399 | 365 |
| 301 | 3300048906 | Ga0496103_0001160 | Ga0496103_0001160_7186_8334 | 365 |
| 302 | 3300048907 | Ga0496104_0103178 | Ga0496104_0103178_551_1699 | 365 |
| 303 | 3300048908 | Ga0496105_0115218 | Ga0496105_0115218_776_1924 | 365 |
| 304 | 3300048909 | Ga0496106_0017827 | Ga0496106_0017827_3294_4442 | 365 |
| 305 | 3300048910 | Ga0496107_0026839 | Ga0496107_0026839_2846_3994 | 365 |
| 306 | 3300048920 | Ga0496117_0003444 | Ga0496117_0003444_447_1595 | 365 |
| 307 | 3300048922 | Ga0496119_0090783 | Ga0496119_0090783_295_1443 | 365 |
| 308 | 3300048927 | Ga0496124_0138686 | Ga0496124_0138686_729_1877 | 365 |
| 309 | 3300005327 | Ga0070658_10105365 | Ga0070658_101053652 | 366 |
| 310 | 3300005331 | Ga0070670_100000210 | Ga0070670_10000021010 | 366 |
| 311 | 3300005335 | Ga0070666_10013840 | Ga0070666_100138406 | 366 |
| 312 | 3300005347 | Ga0070668_100000014 | Ga0070668_10000001460 | 366 |
| 313 | 3300005353 | Ga0070669_100003995 | Ga0070669_10000399512 | 366 |
| 314 | 3300005366 | Ga0070659_100216272 | Ga0070659_1002162722 | 366 |
| 315 | 3300005367 | Ga0070667_100000051 | Ga0070667_100000051110 | 366 |
| 316 | 3300005367 | Ga0070667_100011284 | Ga0070667_1000112849 | 366 |
| 317 | 3300005440 | Ga0070705_100004759 | Ga0070705_1000047592 | 366 |
| 318 | 3300005445 | Ga0070708_100094332 | Ga0070708_1000943322 | 366 |
| 319 | 3300005564 | Ga0070664_100013946 | Ga0070664_1000139464 | 366 |
| 320 | 3300005577 | Ga0068857_100084922 | Ga0068857_1000849222 | 366 |
| 321 | 3300005578 | Ga0068854_100010741 | Ga0068854_1000107416 | 366 |
| 322 | 3300005617 | Ga0068859_100000256 | Ga0068859_10000025644 | 366 |
| 323 | 3300005841 | Ga0068863_100000028 | Ga0068863_100000028140 | 366 |
| 324 | 3300005843 | Ga0068860_100007410 | Ga0068860_10000741013 | 366 |
| 325 | 3300006931 | Ga0097620_100000256 | Ga0097620_10000025644 | 366 |
| 326 | 3300009101 | Ga0105247_10000644 | Ga0105247_1000064412 | 366 |
| 327 | 3300009148 | Ga0105243_10261150 | Ga0105243_102611502 | 366 |
| 328 | 3300009553 | Ga0105249_10002324 | Ga0105249_100023247 | 366 |
| 329 | 3300014968 | Ga0157379_10042529 | Ga0157379_100425292 | 366 |
| 330 | 3300025900 | Ga0207710_10006923 | Ga0207710_100069236 | 366 |
| 331 | 3300025903 | Ga0207680_10003829 | Ga0207680_100038299 | 366 |
| 332 | 3300025909 | Ga0207705_10090342 | Ga0207705_100903422 | 366 |
| 333 | 3300025923 | Ga0207681_10041605 | Ga0207681_100416052 | 366 |
| 334 | 3300025925 | Ga0207650_10010295 | Ga0207650_100102958 | 366 |
| 335 | 3300025932 | Ga0207690_10225677 | Ga0207690_102256771 | 366 |
| 336 | 3300025935 | Ga0207709_10193909 | Ga0207709_101939092 | 366 |
| 337 | 3300025941 | Ga0207711_10019413 | Ga0207711_100194132 | 366 |
| 338 | 3300025972 | Ga0207668_10000047 | Ga0207668_1000004758 | 366 |
| 339 | 3300025981 | Ga0207640_10002545 | Ga0207640_100025456 | 366 |
| 340 | 3300025986 | Ga0207658_10000057 | Ga0207658_10000057111 | 366 |
| 341 | 3300026067 | Ga0207678_10013334 | Ga0207678_100133342 | 366 |
| 342 | 3300026088 | Ga0207641_10000014 | Ga0207641_10000014286 | 366 |
| 343 | 3300026116 | Ga0207674_10100585 | Ga0207674_101005852 | 366 |
| 344 | 3300028380 | Ga0268265_10070580 | Ga0268265_100705803 | 366 |
| 345 | 3300028381 | Ga0268264_10004451 | Ga0268264_100044514 | 366 |
| 346 | 3300046471 | Ga0495650_0021897 | Ga0495650_0021897_1349_2491 | 366 |
| 347 | 3300049574 | Ga0501038_0047716 | Ga0501038_0047716_1185_2315 | 366 |
| 348 | 3300005339 | Ga0070660_100075680 | Ga0070660_1000756803 | 367 |
| 349 | 3300005539 | Ga0068853_100009085 | Ga0068853_1000090856 | 367 |
| 350 | 3300005563 | Ga0068855_100000962 | Ga0068855_10000096211 | 367 |
| 351 | 3300005614 | Ga0068856_100332962 | Ga0068856_1003329621 | 367 |
| 352 | 3300009093 | Ga0105240_10078303 | Ga0105240_100783034 | 367 |
| 353 | 3300009551 | Ga0105238_10203403 | Ga0105238_102034032 | 367 |
| 354 | 3300013297 | Ga0157378_10187768 | Ga0157378_101877682 | 367 |
| 355 | 3300013306 | Ga0163162_10012124 | Ga0163162_100121243 | 367 |
| 356 | 3300025912 | Ga0207707_10141338 | Ga0207707_101413382 | 367 |
| 357 | 3300025913 | Ga0207695_10055082 | Ga0207695_100550822 | 367 |
| 358 | 3300025919 | Ga0207657_10085021 | Ga0207657_100850214 | 367 |
| 359 | 3300025921 | Ga0207652_10114171 | Ga0207652_101141712 | 367 |
| 360 | 3300025924 | Ga0207694_10061619 | Ga0207694_100616194 | 367 |
| 361 | 3300025949 | Ga0207667_10004952 | Ga0207667_100049528 | 367 |
| 362 | 3300026041 | Ga0207639_10018070 | Ga0207639_100180704 | 367 |
| 363 | 3300026078 | Ga0207702_10255571 | Ga0207702_102555712 | 367 |
| 364 | 3300028653 | Ga0265323_10023219 | Ga0265323_100232192 | 367 |
| 365 | 3300031344 | Ga0265316_10002067 | Ga0265316_100020678 | 367 |
| 366 | 3300031712 | Ga0265342_10103895 | Ga0265342_101038951 | 367 |
| 367 | 3300031852 | Ga0307410_10131432 | Ga0307410_101314322 | 367 |
| 368 | 3300031901 | Ga0307406_10043622 | Ga0307406_100436222 | 367 |
| 369 | 3300046524 | Ga0495648_0039704 | Ga0495648_0039704_1330_2442 | 367 |
| 370 | 3300046537 | Ga0495598_0015882 | Ga0495598_0015882_531_1664 | 367 |
| 371 | 3300046539 | Ga0495621_0016225 | Ga0495621_0016225_1224_2357 | 367 |
| 372 | 3300048917 | Ga0496114_0019776 | Ga0496114_0019776_2249_3385 | 367 |
| 373 | 3300053148 | Ga0500590_017734 | Ga0500590_017734_1819_2961 | 367 |
| 374 | 3300001976 | JGI24752J21851_1007004 | JGI24752J21851_10070042 | 368 |
| 375 | 3300005335 | Ga0070666_10000089 | Ga0070666_1000008926 | 368 |
| 376 | 3300005353 | Ga0070669_100000024 | Ga0070669_100000024154 | 368 |
| 377 | 3300005355 | Ga0070671_100000006 | Ga0070671_10000000698 | 368 |
| 378 | 3300005543 | Ga0070672_100315773 | Ga0070672_1003157732 | 368 |
| 379 | 3300005548 | Ga0070665_100012580 | Ga0070665_1000125804 | 368 |
| 380 | 3300005615 | Ga0070702_100028407 | Ga0070702_1000284073 | 368 |
| 381 | 3300005618 | Ga0068864_100053335 | Ga0068864_1000533353 | 368 |
| 382 | 3300005719 | Ga0068861_100001329 | Ga0068861_1000013295 | 368 |
| 383 | 3300005841 | Ga0068863_100000719 | Ga0068863_10000071913 | 368 |
| 384 | 3300005842 | Ga0068858_100002895 | Ga0068858_10000289515 | 368 |
| 385 | 3300005843 | Ga0068860_100001698 | Ga0068860_1000016985 | 368 |
| 386 | 3300005844 | Ga0068862_100000310 | Ga0068862_10000031039 | 368 |
| 387 | 3300009011 | Ga0105251_10069374 | Ga0105251_100693742 | 368 |
| 388 | 3300013306 | Ga0163162_10003527 | Ga0163162_100035275 | 368 |
| 389 | 3300025315 | Ga0207697_10000419 | Ga0207697_1000041923 | 368 |
| 390 | 3300025903 | Ga0207680_10000517 | Ga0207680_1000051715 | 368 |
| 391 | 3300025923 | Ga0207681_10000004 | Ga0207681_10000004328 | 368 |
| 392 | 3300025931 | Ga0207644_10000009 | Ga0207644_10000009152 | 368 |
| 393 | 3300025972 | Ga0207668_10009940 | Ga0207668_100099403 | 368 |
| 394 | 3300025986 | Ga0207658_10003250 | Ga0207658_100032507 | 368 |
| 395 | 3300026035 | Ga0207703_10001946 | Ga0207703_100019467 | 368 |
| 396 | 3300026088 | Ga0207641_10002944 | Ga0207641_1000294410 | 368 |
| 397 | 3300026095 | Ga0207676_10004588 | Ga0207676_1000458812 | 368 |
| 398 | 3300026118 | Ga0207675_100000740 | Ga0207675_10000074027 | 368 |
| 399 | 3300028379 | Ga0268266_10029365 | Ga0268266_100293656 | 368 |
| 400 | 3300028380 | Ga0268265_10002264 | Ga0268265_1000226415 | 368 |
| 401 | 3300028381 | Ga0268264_10000069 | Ga0268264_1000006994 | 368 |
| 402 | 3300028786 | Ga0307517_10076293 | Ga0307517_100762932 | 368 |
| 403 | 3300031235 | Ga0265330_10009538 | Ga0265330_100095382 | 368 |
| 404 | 3300033180 | Ga0307510_10008642 | Ga0307510_1000864210 | 368 |
| 405 | 3300036712 | Ga0316584_0087070 | Ga0316584_0087070_975_2111 | 368 |
| 406 | 3300046492 | Ga0495585_0107265 | Ga0495585_0107265_254_1363 | 368 |
| 407 | 3300046660 | Ga0495625_0003185 | Ga0495625_0003185_14843_15955 | 368 |
| 408 | 3300048905 | Ga0496102_0000199 | Ga0496102_0000199_10651_11760 | 368 |
| 409 | 3300048906 | Ga0496103_0000633 | Ga0496103_0000633_15314_16423 | 368 |
| 410 | 3300048907 | Ga0496104_0038825 | Ga0496104_0038825_2453_3562 | 368 |
| 411 | 3300048908 | Ga0496105_0000690 | Ga0496105_0000690_10770_11879 | 368 |
| 412 | 3300048913 | Ga0496110_0063880 | Ga0496110_0063880_635_1744 | 368 |
| 413 | 3300048914 | Ga0496111_0061819 | Ga0496111_0061819_501_1610 | 368 |
| 414 | 3300048916 | Ga0496113_0141577 | Ga0496113_0141577_17_1126 | 368 |
| 415 | 3300048918 | Ga0496115_0000131 | Ga0496115_0000131_48867_49976 | 368 |
| 416 | 3300048920 | Ga0496117_0000352 | Ga0496117_0000352_69604_70713 | 368 |
| 417 | 3300048921 | Ga0496118_0000092 | Ga0496118_0000092_157437_158546 | 368 |
| 418 | 3300048922 | Ga0496119_0004697 | Ga0496119_0004697_8772_9881 | 368 |
| 419 | 3300048924 | Ga0496121_0000228 | Ga0496121_0000228_48904_50013 | 368 |
| 420 | 3300048926 | Ga0496123_0040904 | Ga0496123_0040904_15_1124 | 368 |
| 421 | 3300048927 | Ga0496124_0000081 | Ga0496124_0000081_49796_50905 | 368 |
| 422 | 3300048928 | Ga0496125_0000980 | Ga0496125_0000980_11506_12615 | 368 |
| 423 | 3300048929 | Ga0496126_0000283 | Ga0496126_0000283_10569_11678 | 368 |
| 424 | 3300053087 | Ga0500643_000620 | Ga0500643_000620_14039_15151 | 368 |
| 425 | 3300053730 | Ga0500645_021520 | Ga0500645_021520_208_1320 | 368 |
| 426 | iso_pu_bacteria | 2643221605 | 2644038908 | 368 |
| 427 | 3300005330 | Ga0070690_100046244 | Ga0070690_1000462442 | 369 |
| 428 | 3300005331 | Ga0070670_100190597 | Ga0070670_1001905972 | 369 |
| 429 | 3300005353 | Ga0070669_100000334 | Ga0070669_10000033415 | 369 |
| 430 | 3300005355 | Ga0070671_100000138 | Ga0070671_10000013837 | 369 |
| 431 | 3300005367 | Ga0070667_100040604 | Ga0070667_1000406044 | 369 |
| 432 | 3300005544 | Ga0070686_100017427 | Ga0070686_1000174272 | 369 |
| 433 | 3300005563 | Ga0068855_100040224 | Ga0068855_1000402244 | 369 |
| 434 | 3300005617 | Ga0068859_100025168 | Ga0068859_1000251682 | 369 |
| 435 | 3300005618 | Ga0068864_100118219 | Ga0068864_1001182192 | 369 |
| 436 | 3300005842 | Ga0068858_100104346 | Ga0068858_1001043463 | 369 |
| 437 | 3300005843 | Ga0068860_100006149 | Ga0068860_10000614912 | 369 |
| 438 | 3300005843 | Ga0068860_100174989 | Ga0068860_1001749892 | 369 |
| 439 | 3300005844 | Ga0068862_100000085 | Ga0068862_10000008591 | 369 |
| 440 | 3300006931 | Ga0097620_100025168 | Ga0097620_1000251688 | 369 |
| 441 | 3300009177 | Ga0105248_10120069 | Ga0105248_101200692 | 369 |
| 442 | 3300009553 | Ga0105249_10000038 | Ga0105249_10000038167 | 369 |
| 443 | 3300014325 | Ga0163163_10172430 | Ga0163163_101724302 | 369 |
| 444 | 3300025315 | Ga0207697_10012242 | Ga0207697_100122422 | 369 |
| 445 | 3300025923 | Ga0207681_10001365 | Ga0207681_100013659 | 369 |
| 446 | 3300025925 | Ga0207650_10083091 | Ga0207650_100830912 | 369 |
| 447 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005182 | 369 |
| 448 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002167 | 369 |
| 449 | 3300026035 | Ga0207703_10126510 | Ga0207703_101265101 | 369 |
| 450 | 3300026095 | Ga0207676_10028724 | Ga0207676_100287243 | 369 |
| 451 | 3300026116 | Ga0207674_10161876 | Ga0207674_101618761 | 369 |
| 452 | 3300028380 | Ga0268265_10000104 | Ga0268265_1000010477 | 369 |
| 453 | 3300028381 | Ga0268264_10012761 | Ga0268264_100127616 | 369 |
| 454 | 3300028381 | Ga0268264_10146421 | Ga0268264_101464212 | 369 |
| 455 | 3300031456 | Ga0307513_10040993 | Ga0307513_100409932 | 369 |
| 456 | 3300048904 | Ga0496101_0047847 | Ga0496101_0047847_1872_3017 | 369 |
| 457 | 3300048905 | Ga0496102_0043153 | Ga0496102_0043153_1960_3105 | 369 |
| 458 | 3300048906 | Ga0496103_0050435 | Ga0496103_0050435_300_1445 | 369 |
| 459 | 3300048908 | Ga0496105_0026430 | Ga0496105_0026430_201_1346 | 369 |
| 460 | 3300048908 | Ga0496105_0275811 | Ga0496105_0275811_66_1211 | 369 |
| 461 | 3300048910 | Ga0496107_0000794 | Ga0496107_0000794_4708_5853 | 369 |
| 462 | 3300048911 | Ga0496108_0036958 | Ga0496108_0036958_225_1370 | 369 |
| 463 | 3300048916 | Ga0496113_0003620 | Ga0496113_0003620_6432_7577 | 369 |
| 464 | 3300048924 | Ga0496121_0086801 | Ga0496121_0086801_455_1600 | 369 |
| 465 | iso_pu_bacteria | 2880518877 | 2880522326 | 369 |
| 466 | 3300001915 | JGI24741J21665_1001032 | JGI24741J21665_10010323 | 370 |
| 467 | 3300001979 | JGI24740J21852_10011274 | JGI24740J21852_100112742 | 370 |
| 468 | 3300001990 | JGI24737J22298_10002455 | JGI24737J22298_100024554 | 370 |
| 469 | 3300003215 | JGI25153J46596_10000005 | JGI25153J46596_10000005278 | 370 |
| 470 | 3300003759 | Ga0055525_1000012 | Ga0055525_1000012320 | 370 |
| 471 | 3300003762 | Ga0055542_1000355 | Ga0055542_100035539 | 370 |
| 472 | 3300003763 | Ga0055529_1000045 | Ga0055529_1000045169 | 370 |
| 473 | 3300005327 | Ga0070658_10001571 | Ga0070658_1000157118 | 370 |
| 474 | 3300005339 | Ga0070660_100148168 | Ga0070660_1001481682 | 370 |
| 475 | 3300005344 | Ga0070661_100011173 | Ga0070661_1000111734 | 370 |
| 476 | 3300005356 | Ga0070674_100011307 | Ga0070674_1000113075 | 370 |
| 477 | 3300005455 | Ga0070663_100100915 | Ga0070663_1001009152 | 370 |
| 478 | 3300005456 | Ga0070678_100012555 | Ga0070678_1000125552 | 370 |
| 479 | 3300005459 | Ga0068867_100007513 | Ga0068867_1000075138 | 370 |
| 480 | 3300005539 | Ga0068853_100174305 | Ga0068853_1001743052 | 370 |
| 481 | 3300005548 | Ga0070665_100000206 | Ga0070665_10000020633 | 370 |
| 482 | 3300005563 | Ga0068855_100060879 | Ga0068855_1000608793 | 370 |
| 483 | 3300005834 | Ga0068851_10011445 | Ga0068851_100114454 | 370 |
| 484 | 3300006237 | Ga0097621_100136045 | Ga0097621_1001360452 | 370 |
| 485 | 3300009148 | Ga0105243_10000423 | Ga0105243_1000042316 | 370 |
| 486 | 3300013102 | Ga0157371_10000032 | Ga0157371_1000003277 | 370 |
| 487 | 3300025230 | Ga0209563_100030 | Ga0209563_100030130 | 370 |
| 488 | 3300025253 | Ga0209677_104116 | Ga0209677_1041165 | 370 |
| 489 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011596 | 370 |
| 490 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006598 | 370 |
| 491 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001281 | 370 |
| 492 | 3300025321 | Ga0207656_10000378 | Ga0207656_100003783 | 370 |
| 493 | 3300025904 | Ga0207647_10026599 | Ga0207647_100265993 | 370 |
| 494 | 3300025904 | Ga0207647_10064805 | Ga0207647_100648052 | 370 |
| 495 | 3300025907 | Ga0207645_10165005 | Ga0207645_101650051 | 370 |
| 496 | 3300025909 | Ga0207705_10000122 | Ga0207705_100001225 | 370 |
| 497 | 3300025913 | Ga0207695_10015610 | Ga0207695_100156107 | 370 |
| 498 | 3300025919 | Ga0207657_10007801 | Ga0207657_100078014 | 370 |
| 499 | 3300025920 | Ga0207649_10000482 | Ga0207649_100004827 | 370 |
| 500 | 3300025924 | Ga0207694_10018966 | Ga0207694_100189665 | 370 |
| 501 | 3300025932 | Ga0207690_10000696 | Ga0207690_1000069621 | 370 |
| 502 | 3300025935 | Ga0207709_10000574 | Ga0207709_1000057429 | 370 |
| 503 | 3300025937 | Ga0207669_10006239 | Ga0207669_100062395 | 370 |
| 504 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002327 | 370 |
| 505 | 3300025981 | Ga0207640_10000586 | Ga0207640_1000058619 | 370 |
| 506 | 3300026041 | Ga0207639_10000777 | Ga0207639_100007775 | 370 |
| 507 | 3300026067 | Ga0207678_10005545 | Ga0207678_1000554511 | 370 |
| 508 | 3300026078 | Ga0207702_10006661 | Ga0207702_100066619 | 370 |
| 509 | 3300026116 | Ga0207674_10012390 | Ga0207674_100123908 | 370 |
| 510 | 3300026121 | Ga0207683_10022042 | Ga0207683_100220426 | 370 |
| 511 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021698 | 370 |
| 512 | 3300031456 | Ga0307513_10006540 | Ga0307513_100065403 | 370 |
| 513 | 3300031852 | Ga0307410_10032147 | Ga0307410_100321472 | 370 |
| 514 | 3300031995 | Ga0307409_100108884 | Ga0307409_1001088842 | 370 |
| 515 | 3300032004 | Ga0307414_10000359 | Ga0307414_1000035912 | 370 |
| 516 | 3300032005 | Ga0307411_10230582 | Ga0307411_102305822 | 370 |
| 517 | 3300032126 | Ga0307415_100206526 | Ga0307415_1002065262 | 370 |
| 518 | 3300046459 | Ga0495629_0046040 | Ga0495629_0046040_714_1832 | 370 |
| 519 | 3300046460 | Ga0495638_0111145 | Ga0495638_0111145_497_1615 | 370 |
| 520 | 3300046471 | Ga0495650_0000158 | Ga0495650_0000158_49935_51053 | 370 |
| 521 | 3300046492 | Ga0495585_0007224 | Ga0495585_0007224_2456_3574 | 370 |
| 522 | 3300046506 | Ga0495583_0000631 | Ga0495583_0000631_4124_5242 | 370 |
| 523 | 3300046506 | Ga0495583_0010716 | Ga0495583_0010716_2011_3129 | 370 |
| 524 | 3300046507 | Ga0495606_0000672 | Ga0495606_0000672_27160_28278 | 370 |
| 525 | 3300046518 | Ga0495631_0023064 | Ga0495631_0023064_1113_2231 | 370 |
| 526 | 3300046520 | Ga0495637_0040095 | Ga0495637_0040095_708_1826 | 370 |
| 527 | 3300046522 | Ga0495643_0008719 | Ga0495643_0008719_2672_3790 | 370 |
| 528 | 3300046522 | Ga0495643_0012069 | Ga0495643_0012069_1274_2392 | 370 |
| 529 | 3300046524 | Ga0495648_0000143 | Ga0495648_0000143_37081_38199 | 370 |
| 530 | 3300046525 | Ga0495663_0007556 | Ga0495663_0007556_1774_2892 | 370 |
| 531 | 3300046536 | Ga0495587_0019617 | Ga0495587_0019617_617_1735 | 370 |
| 532 | 3300046558 | Ga0495633_0011496 | Ga0495633_0011496_2652_3770 | 370 |
| 533 | 3300046660 | Ga0495625_0000150 | Ga0495625_0000150_49079_50197 | 370 |
| 534 | 3300046660 | Ga0495625_0025768 | Ga0495625_0025768_994_2112 | 370 |
| 535 | 3300046665 | Ga0495661_0068431 | Ga0495661_0068431_382_1500 | 370 |
| 536 | 3300046684 | Ga0495669_0000050 | Ga0495669_0000050_7162_8280 | 370 |
| 537 | 3300046809 | Ga0495600_0000690 | Ga0495600_0000690_2441_3559 | 370 |
| 538 | 3300047323 | Ga0495683_0000963 | Ga0495683_0000963_3418_4536 | 370 |
| 539 | 3300047443 | Ga0495687_001845 | Ga0495687_001845_3850_4968 | 370 |
| 540 | 3300047443 | Ga0495687_002183 | Ga0495687_002183_2728_3846 | 370 |
| 541 | 3300047470 | Ga0495681_0011835 | Ga0495681_0011835_1024_2142 | 370 |
| 542 | 3300048912 | Ga0496109_0122522 | Ga0496109_0122522_93_1211 | 370 |
| 543 | 3300053079 | Ga0500610_0013948 | Ga0500610_0013948_757_1875 | 370 |
| 544 | 3300053087 | Ga0500643_001505 | Ga0500643_001505_10025_11146 | 370 |
| 545 | 3300053130 | Ga0500642_0017110 | Ga0500642_0017110_631_1749 | 370 |
| 546 | 3300053177 | Ga0500636_0011030 | Ga0500636_0011030_1699_2817 | 370 |
| 547 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_26318_27436 | 370 |
| 548 | 3300053735 | Ga0500596_002731 | Ga0500596_002731_392_1510 | 370 |
| 549 | iso_pu_bacteria | 2582581305 | 2585261175 | 370 |
| 550 | iso_pu_bacteria | 2775507255 | 2778125010 | 370 |
| 551 | iso_pu_bacteria | 2919709256 | 2919709701 | 370 |
| 552 | 3300005331 | Ga0070670_100009509 | Ga0070670_1000095093 | 371 |
| 553 | 3300005335 | Ga0070666_10036618 | Ga0070666_100366182 | 371 |
| 554 | 3300005335 | Ga0070666_10158615 | Ga0070666_101586151 | 371 |
| 555 | 3300005347 | Ga0070668_100000003 | Ga0070668_100000003184 | 371 |
| 556 | 3300005347 | Ga0070668_100007280 | Ga0070668_1000072807 | 371 |
| 557 | 3300005353 | Ga0070669_100034312 | Ga0070669_1000343123 | 371 |
| 558 | 3300005353 | Ga0070669_100157764 | Ga0070669_1001577642 | 371 |
| 559 | 3300005355 | Ga0070671_100000435 | Ga0070671_10000043521 | 371 |
| 560 | 3300005355 | Ga0070671_100210640 | Ga0070671_1002106402 | 371 |
| 561 | 3300005367 | Ga0070667_100000298 | Ga0070667_10000029844 | 371 |
| 562 | 3300005367 | Ga0070667_100001003 | Ga0070667_1000010035 | 371 |
| 563 | 3300005548 | Ga0070665_100287580 | Ga0070665_1002875802 | 371 |
| 564 | 3300005577 | Ga0068857_100018029 | Ga0068857_1000180293 | 371 |
| 565 | 3300005577 | Ga0068857_100194718 | Ga0068857_1001947182 | 371 |
| 566 | 3300005578 | Ga0068854_100012195 | Ga0068854_1000121954 | 371 |
| 567 | 3300005578 | Ga0068854_100019472 | Ga0068854_1000194724 | 371 |
| 568 | 3300005841 | Ga0068863_100005237 | Ga0068863_1000052378 | 371 |
| 569 | 3300005841 | Ga0068863_100415980 | Ga0068863_1004159801 | 371 |
| 570 | 3300005842 | Ga0068858_100004091 | Ga0068858_1000040918 | 371 |
| 571 | 3300005843 | Ga0068860_100000143 | Ga0068860_10000014362 | 371 |
| 572 | 3300005843 | Ga0068860_100000412 | Ga0068860_10000041245 | 371 |
| 573 | 3300005844 | Ga0068862_100000168 | Ga0068862_1000001682 | 371 |
| 574 | 3300005844 | Ga0068862_100010705 | Ga0068862_1000107058 | 371 |
| 575 | 3300009093 | Ga0105240_10001848 | Ga0105240_100018484 | 371 |
| 576 | 3300009093 | Ga0105240_10035481 | Ga0105240_100354815 | 371 |
| 577 | 3300009177 | Ga0105248_10031271 | Ga0105248_100312714 | 371 |
| 578 | 3300009545 | Ga0105237_10002073 | Ga0105237_100020735 | 371 |
| 579 | 3300010375 | Ga0105239_10027686 | Ga0105239_100276863 | 371 |
| 580 | 3300012513 | Ga0157326_1000001 | Ga0157326_10000015 | 371 |
| 581 | 3300025903 | Ga0207680_10125961 | Ga0207680_101259612 | 371 |
| 582 | 3300025903 | Ga0207680_10140440 | Ga0207680_101404401 | 371 |
| 583 | 3300025903 | Ga0207680_10155143 | Ga0207680_101551432 | 371 |
| 584 | 3300025913 | Ga0207695_10000288 | Ga0207695_1000028819 | 371 |
| 585 | 3300025913 | Ga0207695_10036202 | Ga0207695_100362021 | 371 |
| 586 | 3300025914 | Ga0207671_10001439 | Ga0207671_1000143928 | 371 |
| 587 | 3300025923 | Ga0207681_10004407 | Ga0207681_100044079 | 371 |
| 588 | 3300025923 | Ga0207681_10140268 | Ga0207681_101402682 | 371 |
| 589 | 3300025925 | Ga0207650_10015807 | Ga0207650_100158075 | 371 |
| 590 | 3300025931 | Ga0207644_10000447 | Ga0207644_1000044716 | 371 |
| 591 | 3300025933 | Ga0207706_10075750 | Ga0207706_100757503 | 371 |
| 592 | 3300025972 | Ga0207668_10000006 | Ga0207668_10000006180 | 371 |
| 593 | 3300025972 | Ga0207668_10004706 | Ga0207668_100047065 | 371 |
| 594 | 3300025986 | Ga0207658_10000026 | Ga0207658_10000026125 | 371 |
| 595 | 3300025986 | Ga0207658_10000254 | Ga0207658_1000025443 | 371 |
| 596 | 3300026035 | Ga0207703_10001463 | Ga0207703_100014638 | 371 |
| 597 | 3300026088 | Ga0207641_10002472 | Ga0207641_1000247215 | 371 |
| 598 | 3300026088 | Ga0207641_10017728 | Ga0207641_100177287 | 371 |
| 599 | 3300026116 | Ga0207674_10330920 | Ga0207674_103309202 | 371 |
| 600 | 3300028380 | Ga0268265_10000986 | Ga0268265_1000098619 | 371 |
| 601 | 3300028380 | Ga0268265_10107211 | Ga0268265_101072112 | 371 |
| 602 | 3300028381 | Ga0268264_10000076 | Ga0268264_1000007662 | 371 |
| 603 | 3300028381 | Ga0268264_10000083 | Ga0268264_1000008343 | 371 |
| 604 | 3300031911 | Ga0307412_10000457 | Ga0307412_100004573 | 371 |
| 605 | 3300031911 | Ga0307412_10002757 | Ga0307412_100027574 | 371 |
| 606 | 3300031911 | Ga0307412_10025379 | Ga0307412_100253792 | 371 |
| 607 | 3300031911 | Ga0307412_10086777 | Ga0307412_100867772 | 371 |
| 608 | 3300032002 | Ga0307416_100111520 | Ga0307416_1001115202 | 371 |
| 609 | 3300048905 | Ga0496102_0000243 | Ga0496102_0000243_10117_11238 | 371 |
| 610 | 3300048906 | Ga0496103_0000479 | Ga0496103_0000479_30582_31703 | 371 |
| 611 | 3300048907 | Ga0496104_0090818 | Ga0496104_0090818_236_1357 | 371 |
| 612 | 3300048908 | Ga0496105_0131538 | Ga0496105_0131538_825_1946 | 371 |
| 613 | 3300048919 | Ga0496116_0002567 | Ga0496116_0002567_16032_17153 | 371 |
| 614 | 3300048920 | Ga0496117_0000179 | Ga0496117_0000179_40087_41208 | 371 |
| 615 | 3300048920 | Ga0496117_0013905 | Ga0496117_0013905_4154_5275 | 371 |
| 616 | 3300048921 | Ga0496118_0000030 | Ga0496118_0000030_298739_299860 | 371 |
| 617 | 3300048921 | Ga0496118_0007538 | Ga0496118_0007538_10029_11171 | 371 |
| 618 | 3300048921 | Ga0496118_0179622 | Ga0496118_0179622_56_1177 | 371 |
| 619 | 3300048924 | Ga0496121_0001839 | Ga0496121_0001839_1278_2402 | 371 |
| 620 | 3300048924 | Ga0496121_0001919 | Ga0496121_0001919_31464_32588 | 371 |
| 621 | 3300048924 | Ga0496121_0023268 | Ga0496121_0023268_1642_2763 | 371 |
| 622 | 3300048925 | Ga0496122_0096877 | Ga0496122_0096877_217_1338 | 371 |
| 623 | 3300048926 | Ga0496123_0023217 | Ga0496123_0023217_2818_3939 | 371 |
| 624 | 3300048926 | Ga0496123_0079366 | Ga0496123_0079366_640_1782 | 371 |
| 625 | 3300048927 | Ga0496124_0000264 | Ga0496124_0000264_40087_41208 | 371 |
| 626 | 3300048929 | Ga0496126_0142783 | Ga0496126_0142783_495_1619 | 371 |
| 627 | 3300053087 | Ga0500643_000283 | Ga0500643_000283_34580_35704 | 371 |
| 628 | 3300053116 | Ga0500592_000568 | Ga0500592_000568_777_1901 | 371 |
| 629 | 3300053125 | Ga0500618_000803 | Ga0500618_000803_11842_12969 | 371 |
| 630 | 3300053133 | Ga0500655_000561 | Ga0500655_000561_1370_2494 | 371 |
| 631 | 3300053148 | Ga0500590_000301 | Ga0500590_000301_8777_9901 | 371 |
| 632 | 3300053157 | Ga0500624_000023 | Ga0500624_000023_47707_48828 | 371 |
| 633 | 3300053158 | Ga0500627_0000104 | Ga0500627_0000104_2206_3330 | 371 |
| 634 | 3300053178 | Ga0500637_0000013 | Ga0500637_0000013_39593_40714 | 371 |
| 635 | 3300053724 | Ga0500570_006332 | Ga0500570_006332_872_1996 | 371 |
| 636 | iso_pu_bacteria | 2599185359 | 2600227764 | 371 |
| 637 | iso_pu_bacteria | 2643221541 | 2643728122 | 371 |
| 638 | iso_pu_bacteria | 2643221588 | 2643950313 | 371 |
| 639 | iso_pu_bacteria | 2643221606 | 2644042929 | 371 |
| 640 | iso_pu_bacteria | 2643221671 | 2644395640 | 371 |
| 641 | iso_pu_bacteria | 2808606401 | 2809062414 | 371 |
| 642 | iso_pu_bacteria | 2808606404 | 2809078246 | 371 |
| 643 | iso_pu_bacteria | 2808606405 | 2809082803 | 371 |
| 644 | iso_pu_bacteria | 2818991466 | 2819714197 | 371 |
| 645 | iso_pu_bacteria | 2879163058 | 2879166507 | 371 |
| 646 | iso_pu_bacteria | 2882806704 | 2882808499 | 371 |
| 647 | iso_pu_bacteria | 2928526807 | 2928530411 | 371 |
| 648 | iso_pu_bacteria | 2928968154 | 2928968207 | 371 |
| 649 | 3300005262 | Ga0065165_1004400 | Ga0065165_100440010 | 372 |
| 650 | 3300009148 | Ga0105243_10075604 | Ga0105243_100756042 | 372 |
| 651 | 3300009545 | Ga0105237_10009460 | Ga0105237_100094604 | 372 |
| 652 | 3300017792 | Ga0163161_10082721 | Ga0163161_100827212 | 372 |
| 653 | 3300025914 | Ga0207671_10006770 | Ga0207671_100067709 | 372 |
| 654 | 3300047469 | Ga0495673_0018818 | Ga0495673_0018818_1242_2369 | 372 |
| 655 | 3300047472 | Ga0495686_0000363 | Ga0495686_0000363_56041_57168 | 372 |
| 656 | 3300047472 | Ga0495686_0043044 | Ga0495686_0043044_1278_2405 | 372 |
| 657 | 3300048923 | Ga0496120_0051004 | Ga0496120_0051004_185_1312 | 372 |
| 658 | 3300048925 | Ga0496122_0041018 | Ga0496122_0041018_753_1928 | 372 |
| 659 | 3300048926 | Ga0496123_0011704 | Ga0496123_0011704_6036_7211 | 372 |
| 660 | 3300048926 | Ga0496123_0050151 | Ga0496123_0050151_225_1400 | 372 |
| 661 | 3300048927 | Ga0496124_0000684 | Ga0496124_0000684_28474_29646 | 372 |
| 662 | 3300048927 | Ga0496124_0003283 | Ga0496124_0003283_3405_4580 | 372 |
| 663 | 3300048927 | Ga0496124_0035004 | Ga0496124_0035004_1890_3065 | 372 |
| 664 | 3300049823 | Ga0501044_0010061 | Ga0501044_0010061_4224_5351 | 372 |
| 665 | 3300053087 | Ga0500643_000513 | Ga0500643_000513_24971_26101 | 372 |
| 666 | iso_pu_bacteria | 2510917021 | 2511127888 | 372 |
| 667 | iso_pu_bacteria | 2738541275 | 2738709712 | 372 |
| 668 | iso_pu_bacteria | 2738541301 | 2738848137 | 372 |
| 669 | iso_pu_bacteria | 2738541304 | 2738863866 | 372 |
| 670 | iso_pu_bacteria | 2738543022 | 2739296384 | 372 |
| 671 | iso_pu_bacteria | 2738543033 | 2739358062 | 372 |
| 672 | iso_pu_bacteria | 2739367664 | 2739651933 | 372 |
| 673 | iso_pu_bacteria | 2739367865 | 2740030407 | 372 |
| 674 | iso_pu_bacteria | 2818991438 | 2819552456 | 372 |
| 675 | iso_pu_bacteria | 2848297114 | 2848297489 | 372 |
| 676 | iso_pu_bacteria | 2895880812 | 2895884209 | 372 |
| 677 | iso_pu_bacteria | 2896184354 | 2896186822 | 372 |
| 678 | iso_pu_bacteria | 2919138771 | 2919142784 | 372 |
| 679 | iso_pu_bacteria | 2928100450 | 2928101268 | 372 |
| 680 | iso_pu_bacteria | 2928959182 | 2928960321 | 372 |
| 681 | iso_pu_bacteria | 3000865235 | 3000866560 | 372 |
| 682 | iso_pu_bacteria | 8054302542 | 8054304953 | 372 |
| 683 | 3300001989 | JGI24739J22299_10001027 | JGI24739J22299_100010279 | 373 |
| 684 | 3300005289 | Ga0065704_10007473 | Ga0065704_100074732 | 373 |
| 685 | 3300005295 | Ga0065707_10083253 | Ga0065707_100832536 | 373 |
| 686 | 3300005353 | Ga0070669_100024149 | Ga0070669_1000241492 | 373 |
| 687 | 3300005457 | Ga0070662_100012698 | Ga0070662_1000126984 | 373 |
| 688 | 3300005539 | Ga0068853_100004036 | Ga0068853_1000040366 | 373 |
| 689 | 3300005539 | Ga0068853_100025577 | Ga0068853_1000255774 | 373 |
| 690 | 3300005577 | Ga0068857_100065228 | Ga0068857_1000652282 | 373 |
| 691 | 3300005614 | Ga0068856_100142927 | Ga0068856_1001429272 | 373 |
| 692 | 3300005616 | Ga0068852_100183379 | Ga0068852_1001833792 | 373 |
| 693 | 3300005937 | Ga0081455_10000131 | Ga0081455_1000013127 | 373 |
| 694 | 3300006042 | Ga0075368_10041808 | Ga0075368_100418082 | 373 |
| 695 | 3300006048 | Ga0075363_100003814 | Ga0075363_1000038143 | 373 |
| 696 | 3300006178 | Ga0075367_10000092 | Ga0075367_1000009223 | 373 |
| 697 | 3300006353 | Ga0075370_10045379 | Ga0075370_100453792 | 373 |
| 698 | 3300009011 | Ga0105251_10010467 | Ga0105251_100104673 | 373 |
| 699 | 3300009545 | Ga0105237_10140837 | Ga0105237_101408372 | 373 |
| 700 | 3300009551 | Ga0105238_10182143 | Ga0105238_101821432 | 373 |
| 701 | 3300009978 | Ga0105148_100059 | Ga0105148_1000596 | 373 |
| 702 | 3300013105 | Ga0157369_10289035 | Ga0157369_102890352 | 373 |
| 703 | 3300021388 | Ga0213875_10000264 | Ga0213875_1000026421 | 373 |
| 704 | 3300025229 | Ga0209147_104064 | Ga0209147_1040642 | 373 |
| 705 | 3300025913 | Ga0207695_10150591 | Ga0207695_101505911 | 373 |
| 706 | 3300025923 | Ga0207681_10018758 | Ga0207681_100187585 | 373 |
| 707 | 3300025924 | Ga0207694_10237460 | Ga0207694_102374602 | 373 |
| 708 | 3300025933 | Ga0207706_10012315 | Ga0207706_100123155 | 373 |
| 709 | 3300025981 | Ga0207640_10070046 | Ga0207640_100700462 | 373 |
| 710 | 3300026041 | Ga0207639_10003342 | Ga0207639_1000334210 | 373 |
| 711 | 3300026041 | Ga0207639_10020172 | Ga0207639_100201723 | 373 |
| 712 | 3300026078 | Ga0207702_10113339 | Ga0207702_101133392 | 373 |
| 713 | 3300026116 | Ga0207674_10004472 | Ga0207674_100044726 | 373 |
| 714 | 3300026116 | Ga0207674_10014452 | Ga0207674_100144526 | 373 |
| 715 | 3300027866 | Ga0209813_10000114 | Ga0209813_100001145 | 373 |
| 716 | 3300031548 | Ga0307408_100069487 | Ga0307408_1000694873 | 373 |
| 717 | 3300031911 | Ga0307412_10004671 | Ga0307412_100046714 | 373 |
| 718 | 3300031911 | Ga0307412_10066770 | Ga0307412_100667702 | 373 |
| 719 | 3300032004 | Ga0307414_10000288 | Ga0307414_100002887 | 373 |
| 720 | 3300037853 | Ga0436364_1200653 | Ga0436364_1200653_9234_10373 | 373 |
| 721 | 3300041460 | Ga0451802_1561412 | Ga0451802_1561412_370_1506 | 373 |
| 722 | 3300046452 | Ga0495617_025936 | Ga0495617_025936_14_1144 | 373 |
| 723 | 3300046453 | Ga0495627_000094 | Ga0495627_000094_71464_72594 | 373 |
| 724 | 3300046453 | Ga0495627_000391 | Ga0495627_000391_23640_24770 | 373 |
| 725 | 3300046460 | Ga0495638_0006816 | Ga0495638_0006816_4574_5713 | 373 |
| 726 | 3300046460 | Ga0495638_0017047 | Ga0495638_0017047_838_1968 | 373 |
| 727 | 3300046506 | Ga0495583_0000139 | Ga0495583_0000139_59108_60247 | 373 |
| 728 | 3300046507 | Ga0495606_0000685 | Ga0495606_0000685_12341_13480 | 373 |
| 729 | 3300046507 | Ga0495606_0033566 | Ga0495606_0033566_2173_3312 | 373 |
| 730 | 3300046512 | Ga0495610_0000886 | Ga0495610_0000886_11737_12867 | 373 |
| 731 | 3300046512 | Ga0495610_0020645 | Ga0495610_0020645_788_1918 | 373 |
| 732 | 3300046519 | Ga0495632_0000383 | Ga0495632_0000383_21286_22416 | 373 |
| 733 | 3300046520 | Ga0495637_0008273 | Ga0495637_0008273_775_1905 | 373 |
| 734 | 3300046522 | Ga0495643_0000030 | Ga0495643_0000030_166276_167406 | 373 |
| 735 | 3300046525 | Ga0495663_0000003 | Ga0495663_0000003_340279_341409 | 373 |
| 736 | 3300046558 | Ga0495633_0000184 | Ga0495633_0000184_16724_17854 | 373 |
| 737 | 3300046558 | Ga0495633_0000892 | Ga0495633_0000892_7889_9019 | 373 |
| 738 | 3300046660 | Ga0495625_0093400 | Ga0495625_0093400_16_1146 | 373 |
| 739 | 3300046665 | Ga0495661_0038909 | Ga0495661_0038909_466_1605 | 373 |
| 740 | 3300046691 | Ga0495670_0059556 | Ga0495670_0059556_361_1500 | 373 |
| 741 | 3300046692 | Ga0495671_0000072 | Ga0495671_0000072_3362_4492 | 373 |
| 742 | 3300047469 | Ga0495673_0014606 | Ga0495673_0014606_2255_3394 | 373 |
| 743 | 3300047470 | Ga0495681_0000342 | Ga0495681_0000342_22726_23856 | 373 |
| 744 | 3300047472 | Ga0495686_0000182 | Ga0495686_0000182_21472_22614 | 373 |
| 745 | 3300047472 | Ga0495686_0005716 | Ga0495686_0005716_7961_9100 | 373 |
| 746 | 3300047472 | Ga0495686_0010474 | Ga0495686_0010474_1698_2828 | 373 |
| 747 | 3300047472 | Ga0495686_0023442 | Ga0495686_0023442_1611_2747 | 373 |
| 748 | 3300047472 | Ga0495686_0099114 | Ga0495686_0099114_174_1310 | 373 |
| 749 | 3300048921 | Ga0496118_0094030 | Ga0496118_0094030_453_1589 | 373 |
| 750 | 3300048922 | Ga0496119_0023936 | Ga0496119_0023936_1439_2575 | 373 |
| 751 | 3300048924 | Ga0496121_0045089 | Ga0496121_0045089_403_1533 | 373 |
| 752 | 3300048924 | Ga0496121_0081421 | Ga0496121_0081421_922_2058 | 373 |
| 753 | 3300048925 | Ga0496122_0082928 | Ga0496122_0082928_928_2058 | 373 |
| 754 | 3300048927 | Ga0496124_0066690 | Ga0496124_0066690_1832_2962 | 373 |
| 755 | 3300048928 | Ga0496125_0009124 | Ga0496125_0009124_8988_10124 | 373 |
| 756 | 3300048928 | Ga0496125_0053383 | Ga0496125_0053383_1754_2884 | 373 |
| 757 | 3300048929 | Ga0496126_0148654 | Ga0496126_0148654_461_1597 | 373 |
| 758 | 3300048929 | Ga0496126_0166748 | Ga0496126_0166748_434_1564 | 373 |
| 759 | 3300049663 | Ga0501223_000112 | Ga0501223_000112_9442_10572 | 373 |
| 760 | 3300049664 | Ga0501224_000020 | Ga0501224_000020_60349_61479 | 373 |
| 761 | 3300049668 | Ga0501233_001867 | Ga0501233_001867_1089_2219 | 373 |
| 762 | 3300049669 | Ga0501235_001604 | Ga0501235_001604_2034_3164 | 373 |
| 763 | 3300049705 | Ga0501225_0000135 | Ga0501225_0000135_9604_10734 | 373 |
| 764 | 3300049705 | Ga0501225_0003339 | Ga0501225_0003339_1167_2318 | 373 |
| 765 | 3300049853 | Ga0501226_000044 | Ga0501226_000044_12865_13995 | 373 |
| 766 | 3300050490 | nmdc:mga03n38_5700_c1 | nmdc:mga03n38_5700_c1_987_2117 | 373 |
| 767 | 3300050494 | nmdc:mga06z11_3692_c1 | nmdc:mga06z11_3692_c1_4662_5792 | 373 |
| 768 | 3300050495 | nmdc:mga04h51_69_c1 | nmdc:mga04h51_69_c1_22412_23542 | 373 |
| 769 | 3300050496 | nmdc:mga07m45_73112_c1 | nmdc:mga07m45_73112_c1_281_1411 | 373 |
| 770 | 3300053087 | Ga0500643_000330 | Ga0500643_000330_18611_19741 | 373 |
| 771 | 3300053087 | Ga0500643_001124 | Ga0500643_001124_8932_10080 | 373 |
| 772 | 3300053087 | Ga0500643_006824 | Ga0500643_006824_2502_3632 | 373 |
| 773 | 3300053103 | Ga0500555_003466 | Ga0500555_003466_1056_2195 | 373 |
| 774 | 3300053116 | Ga0500592_001514 | Ga0500592_001514_1752_2900 | 373 |
| 775 | 3300053125 | Ga0500618_017176 | Ga0500618_017176_91_1230 | 373 |
| 776 | 3300053136 | Ga0500559_0001427 | Ga0500559_0001427_1492_2622 | 373 |
| 777 | 3300053136 | Ga0500559_0011941 | Ga0500559_0011941_657_1793 | 373 |
| 778 | 3300053157 | Ga0500624_000015 | Ga0500624_000015_105788_106918 | 373 |
| 779 | 3300053157 | Ga0500624_000289 | Ga0500624_000289_832_1962 | 373 |
| 780 | 3300053177 | Ga0500636_0003237 | Ga0500636_0003237_7831_8961 | 373 |
| 781 | 3300053727 | Ga0500611_002591 | Ga0500611_002591_626_1774 | 373 |
| 782 | 3300053730 | Ga0500645_013828 | Ga0500645_013828_125_1279 | 373 |
| 783 | 3300005841 | Ga0068863_100028865 | Ga0068863_1000288656 | 374 |
| 784 | 3300006058 | Ga0075432_10004187 | Ga0075432_100041874 | 374 |
| 785 | 3300026088 | Ga0207641_10025121 | Ga0207641_100251212 | 374 |
| 786 | 3300027907 | Ga0207428_10036711 | Ga0207428_100367114 | 374 |
| 787 | 3300036401 | Ga0373937_0071330 | Ga0373937_0071330_527_1726 | 374 |
| 788 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_122224_123366 | 374 |
| 789 | 3300049586 | Ga0501070_0159647 | Ga0501070_0159647_164_1294 | 374 |
| 790 | 3300050496 | nmdc:mga07m45_50847_c1 | nmdc:mga07m45_50847_c1_756_1886 | 374 |
| 791 | 3300053108 | Ga0500562_000252 | Ga0500562_000252_8502_9638 | 374 |
| 792 | 3300053177 | Ga0500636_0026651 | Ga0500636_0026651_1027_2163 | 374 |
| 793 | 3300005367 | Ga0070667_100014546 | Ga0070667_1000145463 | 375 |
| 794 | 3300005548 | Ga0070665_100088252 | Ga0070665_1000882523 | 375 |
| 795 | 3300005841 | Ga0068863_100000016 | Ga0068863_10000001691 | 375 |
| 796 | 3300005843 | Ga0068860_100000168 | Ga0068860_10000016816 | 375 |
| 797 | 3300006042 | Ga0075368_10001483 | Ga0075368_100014832 | 375 |
| 798 | 3300006177 | Ga0075362_10000526 | Ga0075362_100005264 | 375 |
| 799 | 3300006195 | Ga0075366_10006887 | Ga0075366_100068874 | 375 |
| 800 | 3300025909 | Ga0207705_10123396 | Ga0207705_101233962 | 375 |
| 801 | 3300025986 | Ga0207658_10007629 | Ga0207658_100076293 | 375 |
| 802 | 3300026035 | Ga0207703_10070059 | Ga0207703_100700593 | 375 |
| 803 | 3300026088 | Ga0207641_10000315 | Ga0207641_1000031523 | 375 |
| 804 | 3300026095 | Ga0207676_10011106 | Ga0207676_100111063 | 375 |
| 805 | 3300027866 | Ga0209813_10000530 | Ga0209813_100005304 | 375 |
| 806 | 3300028379 | Ga0268266_10015509 | Ga0268266_100155096 | 375 |
| 807 | 3300028381 | Ga0268264_10000040 | Ga0268264_10000040120 | 375 |
| 808 | 3300031250 | Ga0265331_10064820 | Ga0265331_100648202 | 375 |
| 809 | 3300031731 | Ga0307405_10003814 | Ga0307405_100038144 | 375 |
| 810 | 3300032133 | Ga0316583_10008936 | Ga0316583_100089364 | 375 |
| 811 | 3300036647 | Ga0316582_0014476 | Ga0316582_0014476_1718_2851 | 375 |
| 812 | 3300036712 | Ga0316584_0074383 | Ga0316584_0074383_561_1694 | 375 |
| 813 | 3300046616 | Ga0495668_0082368 | Ga0495668_0082368_600_1739 | 375 |
| 814 | 3300046660 | Ga0495625_0008151 | Ga0495625_0008151_2007_3146 | 375 |
| 815 | 3300046692 | Ga0495671_0005155 | Ga0495671_0005155_4502_5641 | 375 |
| 816 | 3300048907 | Ga0496104_0014211 | Ga0496104_0014211_43_1179 | 375 |
| 817 | 3300048908 | Ga0496105_0010962 | Ga0496105_0010962_522_1787 | 375 |
| 818 | 3300048921 | Ga0496118_0031432 | Ga0496118_0031432_2552_3688 | 375 |
| 819 | 3300048923 | Ga0496120_0047341 | Ga0496120_0047341_940_2205 | 375 |
| 820 | 3300048924 | Ga0496121_0000526 | Ga0496121_0000526_9474_10610 | 375 |
| 821 | 3300048925 | Ga0496122_0000176 | Ga0496122_0000176_131717_132856 | 375 |
| 822 | 3300048926 | Ga0496123_0000291 | Ga0496123_0000291_22588_23727 | 375 |
| 823 | 3300048929 | Ga0496126_0274736 | Ga0496126_0274736_38_1177 | 375 |
| 824 | 3300050489 | nmdc:mga03683_229_c1 | nmdc:mga03683_229_c1_5422_6552 | 375 |
| 825 | 3300050491 | nmdc:mga00v17_3081_c2 | nmdc:mga00v17_3081_c2_127_1257 | 375 |
| 826 | 3300050494 | nmdc:mga06z11_519_c1 | nmdc:mga06z11_519_c1_10422_11552 | 375 |
| 827 | 3300050495 | nmdc:mga04h51_7426_c1 | nmdc:mga04h51_7426_c1_1097_2227 | 375 |
| 828 | 3300050496 | nmdc:mga07m45_33_c1 | nmdc:mga07m45_33_c1_23403_24533 | 375 |
| 829 | 3300053104 | Ga0500556_0000144 | Ga0500556_0000144_27371_28510 | 375 |
| 830 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_329059_330198 | 375 |
| 831 | 3300053730 | Ga0500645_000780 | Ga0500645_000780_16416_17555 | 375 |
| 832 | iso_pu_bacteria | 2512564014 | 2512643376 | 375 |
| 833 | 3300002459 | JGI24751J29686_10000140 | JGI24751J29686_100001404 | 376 |
| 834 | 3300005289 | Ga0065704_10001493 | Ga0065704_100014934 | 376 |
| 835 | 3300005327 | Ga0070658_10000067 | Ga0070658_1000006786 | 376 |
| 836 | 3300005329 | Ga0070683_100172906 | Ga0070683_1001729062 | 376 |
| 837 | 3300005347 | Ga0070668_100003251 | Ga0070668_1000032519 | 376 |
| 838 | 3300005353 | Ga0070669_100000473 | Ga0070669_10000047327 | 376 |
| 839 | 3300005353 | Ga0070669_100002131 | Ga0070669_10000213115 | 376 |
| 840 | 3300005355 | Ga0070671_100000542 | Ga0070671_10000054212 | 376 |
| 841 | 3300005367 | Ga0070667_100000128 | Ga0070667_10000012856 | 376 |
| 842 | 3300005367 | Ga0070667_100004204 | Ga0070667_1000042047 | 376 |
| 843 | 3300005367 | Ga0070667_100049569 | Ga0070667_1000495692 | 376 |
| 844 | 3300005440 | Ga0070705_100099149 | Ga0070705_1000991492 | 376 |
| 845 | 3300005548 | Ga0070665_100001356 | Ga0070665_1000013569 | 376 |
| 846 | 3300005548 | Ga0070665_100010985 | Ga0070665_1000109857 | 376 |
| 847 | 3300005563 | Ga0068855_100015135 | Ga0068855_1000151353 | 376 |
| 848 | 3300005578 | Ga0068854_100003154 | Ga0068854_1000031545 | 376 |
| 849 | 3300005614 | Ga0068856_100004323 | Ga0068856_1000043232 | 376 |
| 850 | 3300005616 | Ga0068852_100000075 | Ga0068852_10000007541 | 376 |
| 851 | 3300005841 | Ga0068863_100010358 | Ga0068863_1000103586 | 376 |
| 852 | 3300005843 | Ga0068860_100017637 | Ga0068860_1000176374 | 376 |
| 853 | 3300005844 | Ga0068862_100010728 | Ga0068862_1000107282 | 376 |
| 854 | 3300005844 | Ga0068862_100040836 | Ga0068862_1000408362 | 376 |
| 855 | 3300005844 | Ga0068862_100089890 | Ga0068862_1000898902 | 376 |
| 856 | 3300006048 | Ga0075363_100003377 | Ga0075363_1000033773 | 376 |
| 857 | 3300006051 | Ga0075364_10016692 | Ga0075364_100166923 | 376 |
| 858 | 3300006177 | Ga0075362_10000234 | Ga0075362_1000023415 | 376 |
| 859 | 3300006195 | Ga0075366_10000168 | Ga0075366_100001684 | 376 |
| 860 | 3300006195 | Ga0075366_10021504 | Ga0075366_100215044 | 376 |
| 861 | 3300006353 | Ga0075370_10000032 | Ga0075370_100000325 | 376 |
| 862 | 3300006946 | Ga0079104_1008150 | Ga0079104_10081503 | 376 |
| 863 | 3300009011 | Ga0105251_10001861 | Ga0105251_100018613 | 376 |
| 864 | 3300009011 | Ga0105251_10061191 | Ga0105251_100611912 | 376 |
| 865 | 3300009093 | Ga0105240_10010488 | Ga0105240_100104888 | 376 |
| 866 | 3300009101 | Ga0105247_10037912 | Ga0105247_100379121 | 376 |
| 867 | 3300009177 | Ga0105248_10013528 | Ga0105248_100135287 | 376 |
| 868 | 3300009177 | Ga0105248_10024262 | Ga0105248_100242628 | 376 |
| 869 | 3300009551 | Ga0105238_10017115 | Ga0105238_100171159 | 376 |
| 870 | 3300009553 | Ga0105249_10348210 | Ga0105249_103482102 | 376 |
| 871 | 3300013104 | Ga0157370_10053190 | Ga0157370_100531902 | 376 |
| 872 | 3300013306 | Ga0163162_10044800 | Ga0163162_100448003 | 376 |
| 873 | 3300025298 | Ga0209050_1000441 | Ga0209050_100044121 | 376 |
| 874 | 3300025315 | Ga0207697_10015555 | Ga0207697_100155552 | 376 |
| 875 | 3300025735 | Ga0207713_1002460 | Ga0207713_100246014 | 376 |
| 876 | 3300025735 | Ga0207713_1016496 | Ga0207713_10164965 | 376 |
| 877 | 3300025900 | Ga0207710_10035134 | Ga0207710_100351341 | 376 |
| 878 | 3300025909 | Ga0207705_10000075 | Ga0207705_1000007567 | 376 |
| 879 | 3300025913 | Ga0207695_10006069 | Ga0207695_100060698 | 376 |
| 880 | 3300025923 | Ga0207681_10000503 | Ga0207681_1000050313 | 376 |
| 881 | 3300025923 | Ga0207681_10000663 | Ga0207681_100006632 | 376 |
| 882 | 3300025924 | Ga0207694_10009731 | Ga0207694_100097312 | 376 |
| 883 | 3300025925 | Ga0207650_10047790 | Ga0207650_100477902 | 376 |
| 884 | 3300025931 | Ga0207644_10001520 | Ga0207644_1000152010 | 376 |
| 885 | 3300025931 | Ga0207644_10020323 | Ga0207644_100203232 | 376 |
| 886 | 3300025941 | Ga0207711_10002363 | Ga0207711_1000236311 | 376 |
| 887 | 3300025949 | Ga0207667_10013795 | Ga0207667_100137959 | 376 |
| 888 | 3300025949 | Ga0207667_10301320 | Ga0207667_103013202 | 376 |
| 889 | 3300025972 | Ga0207668_10003433 | Ga0207668_100034337 | 376 |
| 890 | 3300025972 | Ga0207668_10003815 | Ga0207668_100038157 | 376 |
| 891 | 3300025981 | Ga0207640_10000570 | Ga0207640_100005703 | 376 |
| 892 | 3300025986 | Ga0207658_10002944 | Ga0207658_100029447 | 376 |
| 893 | 3300025986 | Ga0207658_10025127 | Ga0207658_100251272 | 376 |
| 894 | 3300025986 | Ga0207658_10031477 | Ga0207658_100314774 | 376 |
| 895 | 3300025986 | Ga0207658_10110014 | Ga0207658_101100143 | 376 |
| 896 | 3300026078 | Ga0207702_10037147 | Ga0207702_100371474 | 376 |
| 897 | 3300026088 | Ga0207641_10022838 | Ga0207641_100228382 | 376 |
| 898 | 3300026142 | Ga0207698_10000005 | Ga0207698_10000005181 | 376 |
| 899 | 3300027111 | Ga0209281_1010835 | Ga0209281_10108352 | 376 |
| 900 | 3300028379 | Ga0268266_10000534 | Ga0268266_100005349 | 376 |
| 901 | 3300028379 | Ga0268266_10008419 | Ga0268266_100084197 | 376 |
| 902 | 3300028380 | Ga0268265_10001459 | Ga0268265_100014599 | 376 |
| 903 | 3300028380 | Ga0268265_10013635 | Ga0268265_100136353 | 376 |
| 904 | 3300028381 | Ga0268264_10029925 | Ga0268264_100299252 | 376 |
| 905 | 3300031251 | Ga0265327_10034616 | Ga0265327_100346162 | 376 |
| 906 | 3300031824 | Ga0307413_10061015 | Ga0307413_100610152 | 376 |
| 907 | 3300031824 | Ga0307413_10246634 | Ga0307413_102466342 | 376 |
| 908 | 3300032005 | Ga0307411_10007009 | Ga0307411_100070094 | 376 |
| 909 | 3300044712 | Ga0453684_0260886 | Ga0453684_0260886_809_1939 | 376 |
| 910 | 3300046453 | Ga0495627_001469 | Ga0495627_001469_12432_13565 | 376 |
| 911 | 3300046460 | Ga0495638_0015526 | Ga0495638_0015526_1806_2948 | 376 |
| 912 | 3300046460 | Ga0495638_0043711 | Ga0495638_0043711_63_1208 | 376 |
| 913 | 3300046471 | Ga0495650_0001135 | Ga0495650_0001135_12373_13506 | 376 |
| 914 | 3300046500 | Ga0495596_0000054 | Ga0495596_0000054_51110_52243 | 376 |
| 915 | 3300046500 | Ga0495596_0001629 | Ga0495596_0001629_1598_2728 | 376 |
| 916 | 3300046501 | Ga0495607_0011251 | Ga0495607_0011251_4728_5861 | 376 |
| 917 | 3300046506 | Ga0495583_0032633 | Ga0495583_0032633_702_1835 | 376 |
| 918 | 3300046512 | Ga0495610_0000022 | Ga0495610_0000022_202603_203736 | 376 |
| 919 | 3300046512 | Ga0495610_0000081 | Ga0495610_0000081_48172_49302 | 376 |
| 920 | 3300046512 | Ga0495610_0002317 | Ga0495610_0002317_12556_13686 | 376 |
| 921 | 3300046515 | Ga0495620_0017938 | Ga0495620_0017938_1539_2672 | 376 |
| 922 | 3300046515 | Ga0495620_0076391 | Ga0495620_0076391_31_1164 | 376 |
| 923 | 3300046519 | Ga0495632_0000948 | Ga0495632_0000948_9270_10403 | 376 |
| 924 | 3300046519 | Ga0495632_0008112 | Ga0495632_0008112_550_1683 | 376 |
| 925 | 3300046519 | Ga0495632_0027220 | Ga0495632_0027220_973_2121 | 376 |
| 926 | 3300046522 | Ga0495643_0000077 | Ga0495643_0000077_142008_143138 | 376 |
| 927 | 3300046522 | Ga0495643_0006700 | Ga0495643_0006700_5052_6185 | 376 |
| 928 | 3300046522 | Ga0495643_0015150 | Ga0495643_0015150_2456_3589 | 376 |
| 929 | 3300046522 | Ga0495643_0122045 | Ga0495643_0122045_39_1175 | 376 |
| 930 | 3300046530 | Ga0495654_0041315 | Ga0495654_0041315_990_2132 | 376 |
| 931 | 3300046538 | Ga0495609_0015133 | Ga0495609_0015133_1802_2935 | 376 |
| 932 | 3300047470 | Ga0495681_0000010 | Ga0495681_0000010_53238_54371 | 376 |
| 933 | 3300048090 | Ga0495615_0000150 | Ga0495615_0000150_14453_15583 | 376 |
| 934 | 3300048091 | Ga0495626_0001895 | Ga0495626_0001895_9771_10901 | 376 |
| 935 | 3300048904 | Ga0496101_0041543 | Ga0496101_0041543_295_1428 | 376 |
| 936 | 3300048905 | Ga0496102_0000570 | Ga0496102_0000570_24947_26080 | 376 |
| 937 | 3300048906 | Ga0496103_0000201 | Ga0496103_0000201_51265_52398 | 376 |
| 938 | 3300048906 | Ga0496103_0018844 | Ga0496103_0018844_1015_2145 | 376 |
| 939 | 3300048907 | Ga0496104_0000078 | Ga0496104_0000078_96601_97734 | 376 |
| 940 | 3300048908 | Ga0496105_0000241 | Ga0496105_0000241_1011_2144 | 376 |
| 941 | 3300048915 | Ga0496112_0112199 | Ga0496112_0112199_619_1752 | 376 |
| 942 | 3300048916 | Ga0496113_0017588 | Ga0496113_0017588_1716_2849 | 376 |
| 943 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_364326_365456 | 376 |
| 944 | 3300048920 | Ga0496117_0006507 | Ga0496117_0006507_5233_6366 | 376 |
| 945 | 3300048920 | Ga0496117_0021332 | Ga0496117_0021332_2479_3609 | 376 |
| 946 | 3300048921 | Ga0496118_0012741 | Ga0496118_0012741_3366_4499 | 376 |
| 947 | 3300048922 | Ga0496119_0000114 | Ga0496119_0000114_96601_97734 | 376 |
| 948 | 3300048923 | Ga0496120_0000266 | Ga0496120_0000266_1759_2892 | 376 |
| 949 | 3300048924 | Ga0496121_0000675 | Ga0496121_0000675_47191_48321 | 376 |
| 950 | 3300048924 | Ga0496121_0012385 | Ga0496121_0012385_3741_4871 | 376 |
| 951 | 3300048925 | Ga0496122_0013037 | Ga0496122_0013037_3474_4604 | 376 |
| 952 | 3300048925 | Ga0496122_0016897 | Ga0496122_0016897_169_1311 | 376 |
| 953 | 3300048926 | Ga0496123_0001706 | Ga0496123_0001706_12633_13775 | 376 |
| 954 | 3300048926 | Ga0496123_0001817 | Ga0496123_0001817_23362_24492 | 376 |
| 955 | 3300048926 | Ga0496123_0010209 | Ga0496123_0010209_2474_3607 | 376 |
| 956 | 3300048926 | Ga0496123_0016103 | Ga0496123_0016103_2836_3966 | 376 |
| 957 | 3300048927 | Ga0496124_0001890 | Ga0496124_0001890_4382_5512 | 376 |
| 958 | 3300048927 | Ga0496124_0002608 | Ga0496124_0002608_18118_19251 | 376 |
| 959 | 3300048928 | Ga0496125_0022628 | Ga0496125_0022628_3345_4475 | 376 |
| 960 | 3300048928 | Ga0496125_0037129 | Ga0496125_0037129_1474_2604 | 376 |
| 961 | 3300048929 | Ga0496126_0000173 | Ga0496126_0000173_41667_42800 | 376 |
| 962 | 3300048929 | Ga0496126_0001284 | Ga0496126_0001284_3621_4751 | 376 |
| 963 | 3300048929 | Ga0496126_0095437 | Ga0496126_0095437_485_1618 | 376 |
| 964 | 3300049570 | Ga0501033_0065135 | Ga0501033_0065135_747_1883 | 376 |
| 965 | 3300049744 | Ga0501083_0079449 | Ga0501083_0079449_604_1734 | 376 |
| 966 | 3300049822 | Ga0501035_0168692 | Ga0501035_0168692_600_1760 | 376 |
| 967 | 3300049823 | Ga0501044_0006548 | Ga0501044_0006548_3585_4727 | 376 |
| 968 | 3300050489 | nmdc:mga03683_463_c1 | nmdc:mga03683_463_c1_2358_3491 | 376 |
| 969 | 3300050491 | nmdc:mga00v17_39430_c1 | nmdc:mga00v17_39430_c1_1450_2580 | 376 |
| 970 | 3300050493 | nmdc:mga0k408_110078_c1 | nmdc:mga0k408_110078_c1_282_1412 | 376 |
| 971 | 3300050493 | nmdc:mga0k408_1430_c1 | nmdc:mga0k408_1430_c1_2229_3362 | 376 |
| 972 | 3300050496 | nmdc:mga07m45_30503_c1 | nmdc:mga07m45_30503_c1_702_1844 | 376 |
| 973 | 3300050496 | nmdc:mga07m45_8_c1 | nmdc:mga07m45_8_c1_2178_3311 | 376 |
| 974 | 3300050516 | nmdc:mga0sz30_15458_c1 | nmdc:mga0sz30_15458_c1_446_1576 | 376 |
| 975 | 3300050516 | nmdc:mga0sz30_585_c1 | nmdc:mga0sz30_585_c1_2143_3276 | 376 |
| 976 | 3300053087 | Ga0500643_000004 | Ga0500643_000004_147221_148363 | 376 |
| 977 | 3300053116 | Ga0500592_011306 | Ga0500592_011306_88_1218 | 376 |
| 978 | 3300053121 | Ga0500607_000098 | Ga0500607_000098_1843_2985 | 376 |
| 979 | 3300053121 | Ga0500607_000381 | Ga0500607_000381_5168_6310 | 376 |
| 980 | 3300053122 | Ga0500608_000054 | Ga0500608_000054_33815_34948 | 376 |
| 981 | 3300053136 | Ga0500559_0000607 | Ga0500559_0000607_5122_6264 | 376 |
| 982 | 3300053136 | Ga0500559_0012105 | Ga0500559_0012105_1614_2765 | 376 |
| 983 | 3300053136 | Ga0500559_0024336 | Ga0500559_0024336_1120_2253 | 376 |
| 984 | 3300053140 | Ga0500573_0119818 | Ga0500573_0119818_160_1293 | 376 |
| 985 | 3300053153 | Ga0500616_0001893 | Ga0500616_0001893_16947_18080 | 376 |
| 986 | 3300053156 | Ga0500622_0001014 | Ga0500622_0001014_3496_4662 | 376 |
| 987 | 3300053178 | Ga0500637_0057843 | Ga0500637_0057843_942_2084 | 376 |
| 988 | 3300053723 | Ga0500567_007512 | Ga0500567_007512_2214_3347 | 376 |
| 989 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_179224_180357 | 376 |
| 990 | 3300053730 | Ga0500645_006477 | Ga0500645_006477_2595_3737 | 376 |
| 991 | 2162886007 | SwRhRL2b_contig_2235436 | SwRhRL2b_0637.00008150 | 380 |
| 992 | 3300005289 | Ga0065704_10070176 | Ga0065704_1007017641 | 380 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2as0-assembly1.cif.gz_B | crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase | 0.9268 | 287 | 338 |
| 2w21-assembly1.cif.gz_A-2 | crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. | 0.919 | 16 | 264 |
| 3zv0-assembly1.cif.gz_D | structure of the shq1p-cbf5p complex | 0.9132 | 286 | 346 |
| 3zv0-assembly1.cif.gz_C | structure of the shq1p-cbf5p complex | 0.9126 | 286 | 346 |
| 3uai-assembly1.cif.gz_A | structure of the shq1-cbf5-nop10-gar1 complex from saccharomyces cerevisiae | 0.9107 | 286 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j5tB02 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9745 | 286 | 377 | 2.30.130.10 |
| af_Q54LB6_223_322_2.30.130.10 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9563 | 284 | 377 | 2.30.130.10 |
| af_A0A1D8PU95_3_196_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9459 | 17 | 201 | 3.40.1160.10 |
| 2j5tB02 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9443 | 286 | 377 | 2.30.130.10 |
| af_O13810_285_387_2.30.130.10 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain | 0.9421 | 283 | 377 | 2.30.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355T3B8-F1-model_v4 | Glutamate 5-kinase | 0.9995 | 289 | 377 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |
| AF-A0A4Q3C6E4-F1-model_v4 | Glutamate 5-kinase | 0.9975 | 291 | 375 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |
| AF-A0A435K544-F1-model_v4 | deleted | 0.9939 | 295 | 377 |
|
| AF-A0A259IKD3-F1-model_v4 | deleted | 0.9916 | 291 | 377 |
|
| AF-A0A845Z6K0-F1-model_v4 | Glutamate 5-kinase | 0.9902 | 302 | 377 |
GO:0003723
GO:0004349 GO:0005524 GO:0005829 GO:0006561 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar