F487598

General Info

Members Datasets Scaffolds Average Seq Length
990 440 972 354

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10013618|JGI25153J46596_100136182
Length 398
Sequence VAGKEXQGRTGLTQAXCATSPAGIACALGTHRAEPVGNKAXDILKIAVLGGGNGSFAAAGDLSLAGHEVRLWRRNPADVEAHRAAGGTITVIDRSGRREVRLAAITSSIAEALDAADLVLCPAPAFAQPAIAELAAPHLRDGQVVFLPPGTFGSYIFAYAARSAGNRAEIATAETGTLPWLARKQGPYVVRISGRGARLPTGVFPSRLARHALGVIERAFPNAIEPCGDALSGALMNAGPIIHPPLITFDKWDIHKEGTQPAIRRVTDALDAERMAIREALGYGAPHFPLADHYSKDGEPWMYARDAHDELTESGDWSERLILVEHRYMLEDLRLGLSFLASVAGLAGVQTPLVKAFLAIGSAITGEDFAVKGRTLASLGLGGFDRTELQNHLAEGFR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
5 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
12 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
13 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
14 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
116 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
117 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
118 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
337 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
374 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
375 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
376 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
400 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
405 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
406 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
407 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
408 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
409 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
410 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
414 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
418 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
419 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
420 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
421 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
422 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
423 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
426 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
427 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
432 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
433 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
436 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
437 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
438 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
439 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
440 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.42
Nodule 2.93
Rhizoplane 7.68
Rhizosphere 70.1
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1002599 3300003214 Bacteria 5498
2 JGI25153J46596_10000110 3300003215 Bacteria 93591
3 JGI25153J46596_10000161 3300003215 Bacteria 67388
4 JGI25153J46596_10000354 3300003215 Bacteria 31788
5 JGI25153J46596_10013618 3300003215 Bacteria 3426
6 JGI25160J50197_1001256 3300003354 Bacteria 12850
7 JGI25160J50197_1002809 3300003354 Bacteria 7972
8 JGI25160J50197_1015732 3300003354 Bacteria 2470
9 JGI25404J52841_10002388 3300003659 Bacteria 3542
10 Ga0055539_1005461 3300003752 Bacteria 1652
11 Ga0065165_1000368 3300005262 Bacteria 73904
12 Ga0065165_1008246 3300005262 Bacteria 4924
13 Ga0065165_1009309 3300005262 Bacteria 4422
14 Ga0070658_10003236 3300005327 Bacteria 13450
15 Ga0070658_10010916 3300005327 Bacteria 7281
16 Ga0070658_10175543 3300005327 Bacteria 1801
17 Ga0070683_100001547 3300005329 Bacteria 17802
18 Ga0070683_100044771 3300005329 Bacteria 4082
19 Ga0070683_100302038 3300005329 Bacteria 1523
20 Ga0070690_100013882 3300005330 Bacteria 4774
21 Ga0070670_100045187 3300005331 Bacteria 3786
22 Ga0070670_100279834 3300005331 Bacteria 1457
23 Ga0070680_100010261 3300005336 Bacteria 7219
24 Ga0070680_100179916 3300005336 Bacteria 1781
25 Ga0070680_100218955 3300005336 Bacteria 1606
26 Ga0070680_100238242 3300005336 Bacteria 1538
27 Ga0070689_100109763 3300005340 Bacteria 2193
28 Ga0070691_10017992 3300005341 Bacteria 3254
29 Ga0070691_10020416 3300005341 Bacteria 3061
30 Ga0070691_10071355 3300005341 Bacteria 1686
31 Ga0070668_100181295 3300005347 Bacteria 1720
32 Ga0070669_100033660 3300005353 Bacteria 3708
33 Ga0070671_100014431 3300005355 Bacteria 6384
34 Ga0070671_100034516 3300005355 Bacteria 4187
35 Ga0070671_100294355 3300005355 Bacteria 1382
36 Ga0070673_100115785 3300005364 Bacteria 2229
37 Ga0070688_100078136 3300005365 Bacteria 2134
38 Ga0070709_10003278 3300005434 Bacteria 8702
39 Ga0070714_100041919 3300005435 Bacteria 3865
40 Ga0070714_100044131 3300005435 Bacteria 3773
41 Ga0070714_100085282 3300005435 Bacteria 2758
42 Ga0070714_100356821 3300005435 Bacteria 1374
43 Ga0070713_100034739 3300005436 Bacteria 4054
44 Ga0070713_100051119 3300005436 Bacteria 3418
45 Ga0070713_100094168 3300005436 Bacteria 2582
46 Ga0070713_100312394 3300005436 Bacteria 1450
47 Ga0070710_10000965 3300005437 Bacteria 13640
48 Ga0070710_10074086 3300005437 Bacteria 1970
49 Ga0070711_100026368 3300005439 Bacteria 3808
50 Ga0070711_100056653 3300005439 Bacteria 2711
51 Ga0070711_100080806 3300005439 Bacteria 2315
52 Ga0070700_100044720 3300005441 Bacteria 2729
53 Ga0070694_100037235 3300005444 Bacteria 3226
54 Ga0070663_100044284 3300005455 Bacteria 3136
55 Ga0070663_100054431 3300005455 Bacteria 2860
56 Ga0070663_100072815 3300005455 Bacteria 2504
57 Ga0070678_100041599 3300005456 Bacteria 3259
58 Ga0070662_100079404 3300005457 Bacteria 2440
59 Ga0070681_10000175 3300005458 Bacteria 48999
60 Ga0070681_10006255 3300005458 Bacteria 11581
61 Ga0070681_10016774 3300005458 Bacteria 7312
62 Ga0070681_10098798 3300005458 Bacteria 2865
63 Ga0070698_100036085 3300005471 Bacteria 5110
64 Ga0070698_100088787 3300005471 Bacteria 3076
65 Ga0070679_100004326 3300005530 Bacteria 13112
66 Ga0070679_100014878 3300005530 Bacteria 7475
67 Ga0070679_100038377 3300005530 Bacteria 4761
68 Ga0070679_100050863 3300005530 Bacteria 4128
69 Ga0070679_100066082 3300005530 Bacteria 3605
70 Ga0070679_100247687 3300005530 Bacteria 1738
71 Ga0070684_100003962 3300005535 Bacteria 11212
72 Ga0070684_100006353 3300005535 Bacteria 9134
73 Ga0070684_100014195 3300005535 Bacteria 6444
74 Ga0070684_100041821 3300005535 Bacteria 3953
75 Ga0068853_100016336 3300005539 Bacteria 6107
76 Ga0068853_100047840 3300005539 Bacteria 3671
77 Ga0068853_100125945 3300005539 Bacteria 2288
78 Ga0068853_100210295 3300005539 Bacteria 1773
79 Ga0070672_100059922 3300005543 Bacteria 2996
80 Ga0070695_100001092 3300005545 Bacteria 14841
81 Ga0070696_100061847 3300005546 Bacteria 2620
82 Ga0070665_100018220 3300005548 Bacteria 7043
83 Ga0070665_100020007 3300005548 Bacteria 6721
84 Ga0070665_100101330 3300005548 Bacteria 2883
85 Ga0070665_100136357 3300005548 Bacteria 2457
86 Ga0070665_100227680 3300005548 Bacteria 1864
87 Ga0070665_100385969 3300005548 Bacteria 1408
88 Ga0068855_100026681 3300005563 Bacteria 6911
89 Ga0068855_100035664 3300005563 Bacteria 5923
90 Ga0068855_100062155 3300005563 Bacteria 4361
91 Ga0070664_100131375 3300005564 Bacteria 2199
92 Ga0068857_100085563 3300005577 Bacteria 2818
93 Ga0068857_100141905 3300005577 Bacteria 2171
94 Ga0068857_100311968 3300005577 Bacteria 1451
95 Ga0068856_100000147 3300005614 Bacteria 71694
96 Ga0068856_100033270 3300005614 Bacteria 5047
97 Ga0068856_100083507 3300005614 Bacteria 3172
98 Ga0068856_100148417 3300005614 Bacteria 2353
99 Ga0068856_100200723 3300005614 Bacteria 2009
100 Ga0068852_100008740 3300005616 Bacteria 7488
101 Ga0068852_100054771 3300005616 Bacteria 3439
102 Ga0068852_100091652 3300005616 Bacteria 2720
103 Ga0068852_100340479 3300005616 Bacteria 1462
104 Ga0068859_100378074 3300005617 Bacteria 1512
105 Ga0068864_100011985 3300005618 Bacteria 7159
106 Ga0068864_100172453 3300005618 Bacteria 1973
107 Ga0068863_100112064 3300005841 Bacteria 2598
108 Ga0068863_100122013 3300005841 Bacteria 2486
109 Ga0068858_100037736 3300005842 Bacteria 4481
110 Ga0068858_100304893 3300005842 Bacteria 1520
111 Ga0068858_100400582 3300005842 Bacteria 1319
112 Ga0068860_100000302 3300005843 Bacteria 68581
113 Ga0068860_100101960 3300005843 Bacteria 2738
114 Ga0068862_100112394 3300005844 Bacteria 2392
115 Ga0081455_10000058 3300005937 Bacteria 119171
116 Ga0081455_10000473 3300005937 Bacteria 52197
117 Ga0081455_10003864 3300005937 Bacteria 17077
118 Ga0081455_10005003 3300005937 Bacteria 14660
119 Ga0081455_10014063 3300005937 Bacteria 7866
120 Ga0081455_10015554 3300005937 Bacteria 7387
121 Ga0081455_10037473 3300005937 Bacteria 4305
122 Ga0081538_10023150 3300005981 Bacteria 4474
123 Ga0081540_1000008 3300005983 Bacteria 203702
124 Ga0081540_1000040 3300005983 Bacteria 136968
125 Ga0081540_1003917 3300005983 Bacteria 11594
126 Ga0081540_1009587 3300005983 Bacteria 6661
127 Ga0081540_1010771 3300005983 Bacteria 6148
128 Ga0081540_1024661 3300005983 Bacteria 3484
129 Ga0081539_10000172 3300005985 Bacteria 151505
130 Ga0081539_10000233 3300005985 Bacteria 130647
131 Ga0081539_10039458 3300005985 Bacteria 2785
132 Ga0081539_10054543 3300005985 Bacteria 2231
133 Ga0070717_10028261 3300006028 Bacteria 4488
134 Ga0070717_10032708 3300006028 Bacteria 4193
135 Ga0075365_10005112 3300006038 Bacteria 7042
136 Ga0075365_10015652 3300006038 Bacteria 4593
137 Ga0075365_10150692 3300006038 Bacteria 1618
138 Ga0075365_10189937 3300006038 Bacteria 1437
139 Ga0075368_10000322 3300006042 Bacteria 14006
140 Ga0075363_100011548 3300006048 Bacteria 4233
141 Ga0075363_100137119 3300006048 Bacteria 1376
142 Ga0075364_10015259 3300006051 Bacteria 4762
143 Ga0075364_10029052 3300006051 Bacteria 3544
144 Ga0075364_10084056 3300006051 Bacteria 2107
145 Ga0070712_100003519 3300006175 Bacteria 9636
146 Ga0070712_100121997 3300006175 Bacteria 1962
147 Ga0075367_10023152 3300006178 Bacteria 3491
148 Ga0075367_10024239 3300006178 Bacteria 3422
149 Ga0075367_10109016 3300006178 Bacteria 1698
150 Ga0075369_10060177 3300006186 Bacteria 1656
151 Ga0075366_10002088 3300006195 Bacteria 10148
152 Ga0097621_100011749 3300006237 Bacteria 6466
153 Ga0075370_10003222 3300006353 Bacteria 7724
154 Ga0075370_10035300 3300006353 Bacteria 2806
155 Ga0075370_10045987 3300006353 Bacteria 2469
156 Ga0075370_10053578 3300006353 Bacteria 2290
157 Ga0068871_100011734 3300006358 Bacteria 6436
158 Ga0075428_100001783 3300006844 Bacteria 22990
159 Ga0075428_100039034 3300006844 Bacteria 5226
160 Ga0075428_100086548 3300006844 Bacteria 3418
161 Ga0075428_100093046 3300006844 Bacteria 3286
162 Ga0075428_100136756 3300006844 Bacteria 2664
163 Ga0075428_100282740 3300006844 Bacteria 1785
164 Ga0075430_100001924 3300006846 Bacteria 17039
165 Ga0075430_100150139 3300006846 Bacteria 1940
166 Ga0075430_100184989 3300006846 Bacteria 1732
167 Ga0075431_100000003 3300006847 Bacteria 112884
168 Ga0075431_100005570 3300006847 Bacteria 12435
169 Ga0075431_100261380 3300006847 Bacteria 1756
170 Ga0075431_100306404 3300006847 Bacteria 1604
171 Ga0075433_10005748 3300006852 Bacteria 9756
172 Ga0075434_100030523 3300006871 Bacteria 5308
173 Ga0075429_100000288 3300006880 Bacteria 35542
174 Ga0075429_100132767 3300006880 Bacteria 2178
175 Ga0075429_100191769 3300006880 Bacteria 1790
176 Ga0097620_100378089 3300006931 Bacteria 1512
177 Ga0099825_1028907 3300006941 Bacteria 2636
178 Ga0099824_1021477 3300006942 Bacteria 4495
179 Ga0099822_1001679 3300006943 Bacteria 26417
180 Ga0075435_100038956 3300007076 Bacteria 3792
181 Ga0075435_100053444 3300007076 Bacteria 3258
182 Ga0099794_10012754 3300007265 Bacteria 3639
183 Ga0105240_10022848 3300009093 Bacteria 8285
184 Ga0105240_10077802 3300009093 Bacteria 4086
185 Ga0111539_10007175 3300009094 Bacteria 14285
186 Ga0111539_10007426 3300009094 Bacteria 14048
187 Ga0111539_10012637 3300009094 Bacteria 10577
188 Ga0111539_10280377 3300009094 Bacteria 1939
189 Ga0105245_10016233 3300009098 Bacteria 6491
190 Ga0105245_10067599 3300009098 Bacteria 3237
191 Ga0105245_10113086 3300009098 Bacteria 2528
192 Ga0114129_10000104 3300009147 Bacteria 83195
193 Ga0114129_10004768 3300009147 Bacteria 19169
194 Ga0114129_10009472 3300009147 Bacteria 13882
195 Ga0114129_10141754 3300009147 Bacteria 3294
196 Ga0105243_10099061 3300009148 Bacteria 2415
197 Ga0105241_10020161 3300009174 Bacteria 4925
198 Ga0105241_10021591 3300009174 Bacteria 4760
199 Ga0105242_10188924 3300009176 Bacteria 1822
200 Ga0105248_10103016 3300009177 Bacteria 3217
201 Ga0105248_10532673 3300009177 Bacteria 1325
202 Ga0105237_10007390 3300009545 Bacteria 12032
203 Ga0105237_10030977 3300009545 Bacteria 5426
204 Ga0105237_10082457 3300009545 Bacteria 3207
205 Ga0105237_10141502 3300009545 Bacteria 2400
206 Ga0105237_10191139 3300009545 Bacteria 2047
207 Ga0105238_10088915 3300009551 Bacteria 3075
208 Ga0105238_10333985 3300009551 Bacteria 1503
209 Ga0105238_10347392 3300009551 Bacteria 1472
210 Ga0105249_10292405 3300009553 Bacteria 1631
211 Ga0099796_10003058 3300010159 Bacteria 3805
212 Ga0105239_10010770 3300010375 Bacteria 10216
213 Ga0105239_10117510 3300010375 Bacteria 2951
214 Ga0105239_10344421 3300010375 Bacteria 1682
215 Ga0105246_10003773 3300011119 Bacteria 9185
216 Ga0105246_10079406 3300011119 Bacteria 2333
217 Ga0105246_10131381 3300011119 Bacteria 1871
218 Ga0105246_10237793 3300011119 Bacteria 1438
219 Ga0157370_10089815 3300013104 Bacteria 2886
220 Ga0157369_10012743 3300013105 Bacteria 9534
221 Ga0157369_10020698 3300013105 Bacteria 7355
222 Ga0157369_10068028 3300013105 Bacteria 3827
223 Ga0157369_10129388 3300013105 Bacteria 2676
224 Ga0157369_10173846 3300013105 Bacteria 2268
225 Ga0157374_10013038 3300013296 Bacteria 7248
226 Ga0157374_10021625 3300013296 Bacteria 5728
227 Ga0157374_10095493 3300013296 Bacteria 2843
228 Ga0157378_10101029 3300013297 Bacteria 2634
229 Ga0157378_10132573 3300013297 Bacteria 2308
230 Ga0157378_10573305 3300013297 Bacteria 1137
231 Ga0163162_10013490 3300013306 Bacteria 7977
232 Ga0163162_10291917 3300013306 Bacteria 1762
233 Ga0163162_10530865 3300013306 Bacteria 1306
234 Ga0157372_10009605 3300013307 Bacteria 10280
235 Ga0157372_10353836 3300013307 Bacteria 1711
236 Ga0157372_10569198 3300013307 Bacteria 1321
237 Ga0157372_10588888 3300013307 Bacteria 1296
238 Ga0163163_10005130 3300014325 Bacteria 11291
239 Ga0163163_10089857 3300014325 Bacteria 3084
240 Ga0163163_10132157 3300014325 Bacteria 2536
241 Ga0163163_10322310 3300014325 Bacteria 1599
242 Ga0157380_10375933 3300014326 Bacteria 1339
243 Ga0157377_10088218 3300014745 Bacteria 1827
244 Ga0157376_10484796 3300014969 Bacteria 1212
245 Ga0214544_1000055 3300021320 Bacteria 133217
246 Ga0214542_1003337 3300021321 Bacteria 32859
247 Ga0214545_1000028 3300021324 Bacteria 127957
248 Ga0214543_1000044 3300021327 Bacteria 158132
249 Ga0213876_10000471 3300021384 Bacteria 32066
250 Ga0213871_10000076 3300021441 Bacteria 8335
251 Ga0209563_101020 3300025230 Bacteria 8156
252 Ga0207425_1002884 3300025245 Bacteria 5777
253 Ga0209677_106052 3300025253 Bacteria 2980
254 Ga0209564_1000936 3300025295 Bacteria 37836
255 Ga0209564_1002670 3300025295 Bacteria 13535
256 Ga0209564_1035919 3300025295 Bacteria 1425
257 Ga0209758_1000075 3300025297 Bacteria 271585
258 Ga0209758_1000087 3300025297 Bacteria 254384
259 Ga0209758_1001472 3300025297 Bacteria 27590
260 Ga0209758_1006857 3300025297 Bacteria 7967
261 Ga0209758_1008545 3300025297 Bacteria 6597
262 Ga0209758_1012674 3300025297 Bacteria 4687
263 Ga0209758_1016464 3300025297 Bacteria 3754
264 Ga0209758_1019189 3300025297 Bacteria 3311
265 Ga0209758_1049417 3300025297 Bacteria 1485
266 Ga0209256_1009007 3300025299 Bacteria 4472
267 Ga0207426_1000160 3300025302 Bacteria 174540
268 Ga0207426_1000289 3300025302 Bacteria 99963
269 Ga0209257_1000382 3300025304 Bacteria 88368
270 Ga0209257_1010148 3300025304 Bacteria 4850
271 Ga0207656_10024592 3300025321 Bacteria 2437
272 Ga0207682_10109140 3300025893 Bacteria 1217
273 Ga0207692_10004122 3300025898 Bacteria 5734
274 Ga0207692_10012566 3300025898 Bacteria 3640
275 Ga0207642_10022038 3300025899 Bacteria 2519
276 Ga0207710_10043002 3300025900 Bacteria 2008
277 Ga0207647_10006477 3300025904 Bacteria 8509
278 Ga0207699_10000561 3300025906 Bacteria 18332
279 Ga0207699_10005355 3300025906 Bacteria 6150
280 Ga0207699_10085572 3300025906 Bacteria 1966
281 Ga0207645_10048437 3300025907 Bacteria 2714
282 Ga0207643_10004466 3300025908 Bacteria 7519
283 Ga0207705_10031006 3300025909 Bacteria 3815
284 Ga0207654_10007906 3300025911 Bacteria 5361
285 Ga0207707_10000660 3300025912 Bacteria 34202
286 Ga0207707_10003822 3300025912 Bacteria 13339
287 Ga0207707_10009552 3300025912 Bacteria 8415
288 Ga0207707_10020964 3300025912 Bacteria 5709
289 Ga0207707_10021206 3300025912 Bacteria 5680
290 Ga0207707_10058198 3300025912 Bacteria 3363
291 Ga0207707_10176474 3300025912 Bacteria 1866
292 Ga0207695_10195356 3300025913 Bacteria 1940
293 Ga0207695_10213368 3300025913 Bacteria 1840
294 Ga0207695_10349768 3300025913 Bacteria 1365
295 Ga0207671_10095298 3300025914 Bacteria 2247
296 Ga0207671_10116738 3300025914 Bacteria 2036
297 Ga0207693_10001004 3300025915 Bacteria 25392
298 Ga0207693_10003010 3300025915 Bacteria 14576
299 Ga0207663_10019711 3300025916 Bacteria 3806
300 Ga0207660_10004099 3300025917 Bacteria 9489
301 Ga0207660_10031454 3300025917 Bacteria 3655
302 Ga0207660_10218085 3300025917 Bacteria 1496
303 Ga0207660_10274951 3300025917 Bacteria 1335
304 Ga0207657_10021590 3300025919 Bacteria 6053
305 Ga0207649_10225494 3300025920 Bacteria 1337
306 Ga0207652_10013565 3300025921 Bacteria 6591
307 Ga0207652_10017792 3300025921 Bacteria 5822
308 Ga0207652_10115852 3300025921 Bacteria 2380
309 Ga0207652_10162337 3300025921 Bacteria 2003
310 Ga0207646_10308109 3300025922 Bacteria 1431
311 Ga0207681_10065051 3300025923 Bacteria 2520
312 Ga0207694_10035053 3300025924 Bacteria 3848
313 Ga0207694_10217819 3300025924 Bacteria 1556
314 Ga0207650_10005952 3300025925 Bacteria 8324
315 Ga0207659_10034027 3300025926 Bacteria 3511
316 Ga0207687_10012740 3300025927 Bacteria 5494
317 Ga0207687_10032480 3300025927 Bacteria 3535
318 Ga0207700_10037733 3300025928 Bacteria 3502
319 Ga0207700_10051509 3300025928 Bacteria 3073
320 Ga0207700_10060434 3300025928 Bacteria 2870
321 Ga0207664_10173705 3300025929 Bacteria 1846
322 Ga0207664_10264258 3300025929 Bacteria 1506
323 Ga0207706_10002137 3300025933 Bacteria 19347
324 Ga0207706_10062955 3300025933 Bacteria 3266
325 Ga0207706_10067135 3300025933 Bacteria 3156
326 Ga0207706_10175571 3300025933 Bacteria 1882
327 Ga0207709_10140207 3300025935 Bacteria 1661
328 Ga0207669_10023481 3300025937 Bacteria 3295
329 Ga0207669_10130798 3300025937 Bacteria 1724
330 Ga0207691_10023514 3300025940 Bacteria 5803
331 Ga0207711_10032173 3300025941 Bacteria 4434
332 Ga0207711_10053470 3300025941 Bacteria 3463
333 Ga0207689_10056752 3300025942 Bacteria 3222
334 Ga0207679_10139161 3300025945 Bacteria 1960
335 Ga0207667_10023066 3300025949 Bacteria 6858
336 Ga0207667_10085017 3300025949 Bacteria 3275
337 Ga0207667_10260969 3300025949 Bacteria 1772
338 Ga0207667_10359271 3300025949 Bacteria 1485
339 Ga0207651_10126240 3300025960 Bacteria 1950
340 Ga0207668_10009228 3300025972 Bacteria 5902
341 Ga0207640_10131212 3300025981 Bacteria 1812
342 Ga0207640_10214745 3300025981 Bacteria 1468
343 Ga0207677_10035335 3300026023 Bacteria 3245
344 Ga0207677_10038119 3300026023 Bacteria 3148
345 Ga0207703_10040278 3300026035 Bacteria 3738
346 Ga0207703_10287680 3300026035 Bacteria 1495
347 Ga0207703_10442420 3300026035 Bacteria 1213
348 Ga0207639_10033257 3300026041 Bacteria 3802
349 Ga0207639_10064910 3300026041 Bacteria 2832
350 Ga0207639_10178875 3300026041 Bacteria 1803
351 Ga0207678_10008751 3300026067 Bacteria 8910
352 Ga0207678_10030711 3300026067 Bacteria 4691
353 Ga0207678_10064794 3300026067 Bacteria 3140
354 Ga0207678_10081431 3300026067 Bacteria 2771
355 Ga0207708_10023566 3300026075 Bacteria 4655
356 Ga0207708_10029438 3300026075 Bacteria 4163
357 Ga0207702_10001454 3300026078 Bacteria 23549
358 Ga0207702_10028517 3300026078 Bacteria 4641
359 Ga0207702_10052278 3300026078 Bacteria 3457
360 Ga0207702_10057390 3300026078 Bacteria 3308
361 Ga0207702_10066273 3300026078 Bacteria 3094
362 Ga0207641_10096136 3300026088 Bacteria 2601
363 Ga0207641_10145892 3300026088 Bacteria 2140
364 Ga0207641_10288616 3300026088 Bacteria 1546
365 Ga0207648_10006963 3300026089 Bacteria 11191
366 Ga0207648_10081945 3300026089 Bacteria 2813
367 Ga0207648_10125626 3300026089 Bacteria 2256
368 Ga0207676_10205477 3300026095 Bacteria 1743
369 Ga0207674_10033436 3300026116 Bacteria 5384
370 Ga0207674_10103403 3300026116 Bacteria 2828
371 Ga0207675_100029070 3300026118 Bacteria 5151
372 Ga0207675_100046864 3300026118 Bacteria 4038
373 Ga0207675_100066690 3300026118 Bacteria 3364
374 Ga0207675_100074780 3300026118 Bacteria 3170
375 Ga0207683_10037347 3300026121 Bacteria 4229
376 Ga0207683_10229697 3300026121 Bacteria 1692
377 Ga0207698_10025095 3300026142 Bacteria 4193
378 Ga0207698_10045053 3300026142 Bacteria 3320
379 Ga0207698_10058938 3300026142 Bacteria 2979
380 Ga0207698_10175368 3300026142 Bacteria 1892
381 Ga0207698_10221241 3300026142 Bacteria 1711
382 Ga0207698_10399243 3300026142 Bacteria 1313
383 Ga0209389_1000137 3300027296 Bacteria 63287
384 Ga0209389_1000353 3300027296 Bacteria 27634
385 Ga0209589_1000001 3300027357 Bacteria 794224
386 Ga0209589_1003439 3300027357 Bacteria 27634
387 Ga0209489_100001 3300027361 Bacteria 794224
388 Ga0209489_100192 3300027361 Bacteria 98028
389 Ga0209489_107326 3300027361 Bacteria 16591
390 Ga0209489_107331 3300027361 Bacteria 16585
391 Ga0209700_100001 3300027363 Bacteria 794224
392 Ga0209700_100046 3300027363 Bacteria 159296
393 Ga0209588_1022977 3300027671 Bacteria 1964
394 Ga0209813_10026378 3300027866 Bacteria 1680
395 Ga0207428_10040681 3300027907 Bacteria 3767
396 Ga0268266_10017034 3300028379 Bacteria 6205
397 Ga0268266_10038401 3300028379 Bacteria 4076
398 Ga0268266_10070938 3300028379 Bacteria 3019
399 Ga0268266_10173691 3300028379 Bacteria 1957
400 Ga0268265_10093290 3300028380 Bacteria 2412
401 Ga0268264_10000020 3300028381 Bacteria 483593
402 Ga0268264_10218968 3300028381 Bacteria 1751
403 Ga0265337_1001859 3300028556 Bacteria 10076
404 Ga0265334_10014692 3300028573 Bacteria 3261
405 Ga0265334_10020564 3300028573 Bacteria 2702
406 Ga0265318_10023748 3300028577 Bacteria 2440
407 Ga0265330_10028028 3300031235 Bacteria 2541
408 Ga0265325_10020842 3300031241 Bacteria 3608
409 Ga0265340_10010044 3300031247 Bacteria 5069
410 Ga0265340_10023855 3300031247 Bacteria 3113
411 Ga0265339_10043509 3300031249 Bacteria 2483
412 Ga0265316_10027824 3300031344 Bacteria 4674
413 Ga0307513_10286844 3300031456 Bacteria 1420
414 Ga0307509_10225551 3300031507 Bacteria 1681
415 Ga0307408_100145992 3300031548 Bacteria 1862
416 Ga0265313_10054612 3300031595 Bacteria 1896
417 Ga0307508_10000025 3300031616 Bacteria 174642
418 Ga0307508_10068027 3300031616 Bacteria 3131
419 Ga0265314_10005071 3300031711 Bacteria 12001
420 Ga0265314_10090685 3300031711 Bacteria 1990
421 Ga0265342_10000638 3300031712 Bacteria 36736
422 Ga0307516_10051368 3300031730 Bacteria 4041
423 Ga0307406_10181609 3300031901 Bacteria 1532
424 Ga0307416_100055750 3300032002 Bacteria 3185
425 Ga0307416_100073436 3300032002 Bacteria 2852
426 Ga0307510_10024769 3300033180 Bacteria 6930
427 Ga0307510_10025277 3300033180 Bacteria 6852
428 Ga0307510_10044327 3300033180 Bacteria 4819
429 Ga0307510_10217163 3300033180 Bacteria 1428
430 Ga0373958_0022808 3300034819 Bacteria 1172
431 Ga0373959_0018904 3300034820 Bacteria 1300
432 Ga0373938_0019283 3300034957 Bacteria 1363
433 Ga0373926_0051440 3300035083 Bacteria 1486
434 Ga0373944_0001051 3300035089 Bacteria 6820
435 Ga0373944_0009047 3300035089 Bacteria 2694
436 Ga0373923_0011906 3300035111 Bacteria 3203
437 Ga0373923_0023726 3300035111 Bacteria 2416
438 Ga0373936_0001079 3300035113 Bacteria 9758
439 Ga0373945_0005317 3300035116 Bacteria 4120
440 Ga0373945_0011608 3300035116 Bacteria 2915
441 Ga0373956_0012440 3300035119 Bacteria 3528
442 Ga0373960_0029582 3300035121 Bacteria 1520
443 Ga0373943_0002145 3300035170 Bacteria 8968
444 Ga0373943_0004407 3300035170 Bacteria 6372
445 Ga0373943_0046435 3300035170 Bacteria 2120
446 Ga0373946_0003426 3300035171 Bacteria 5626
447 Ga0373955_0002673 3300035172 Bacteria 7800
448 Ga0373955_0042203 3300035172 Bacteria 2448
449 Ga0373924_0005844 3300035410 Bacteria 4381
450 Ga0373931_0003998 3300035691 Bacteria 6678
451 Ga0373935_0000494 3300035692 Bacteria 20439
452 Ga0373935_0009052 3300035692 Bacteria 5957
453 Ga0373935_0058438 3300035692 Bacteria 2463
454 Ga0373927_0020261 3300035695 Bacteria 4361
455 Ga0373927_0024311 3300035695 Bacteria 3964
456 Ga0373927_0044653 3300035695 Bacteria 2866
457 Ga0373927_0045067 3300035695 Bacteria 2853
458 Ga0373927_0086095 3300035695 Bacteria 2040
459 Ga0373927_0117969 3300035695 Bacteria 1731
460 Ga0373947_0002364 3300035725 Bacteria 11398
461 Ga0373937_0073556 3300036401 Bacteria 3153
462 Ga0373937_0222603 3300036401 Bacteria 1776
463 Ga0373925_0007140 3300037068 Bacteria 8162
464 Ga0373925_0015198 3300037068 Bacteria 5566
465 Ga0373925_0095204 3300037068 Bacteria 2281
466 Ga0395899_0034762 3300037312 Bacteria 3786
467 Ga0395899_0062951 3300037312 Bacteria 2731
468 Ga0395900_0000943 3300037418 Bacteria 37925
469 Ga0395900_0125258 3300037418 Bacteria 2635
470 Ga0395898_0002974 3300037466 Bacteria 19263
471 Ga0395898_0046280 3300037466 Bacteria 4273
472 Ga0395905_0021852 3300037471 Bacteria 6052
473 Ga0395905_0062455 3300037471 Bacteria 3485
474 Ga0395905_0194235 3300037471 Bacteria 1903
475 Ga0395905_0201061 3300037471 Bacteria 1868
476 Ga0395901_0001973 3300038443 Bacteria 21111
477 Ga0436365_0430232 3300039437 Bacteria 1547
478 Ga0436365_1324557 3300039437 Bacteria 36147
479 Ga0436361_0394185 3300039447 Bacteria 2477
480 Ga0436361_0440592 3300039447 Bacteria 3469
481 Ga0436363_0490106 3300039450 Bacteria 3966
482 Ga0436363_1647914 3300039450 Bacteria 3918
483 Ga0436362_0153721 3300039453 Bacteria 3999
484 Ga0436362_1239383 3300039453 Bacteria 3890
485 Ga0466972_0025155 3300044658 Bacteria 2953
486 Ga0466972_0026707 3300044658 Bacteria 2860
487 Ga0466961_0125511 3300044693 Bacteria 1610
488 Ga0466963_0049448 3300044694 Bacteria 2781
489 Ga0466963_0049544 3300044694 Bacteria 2778
490 Ga0466971_0037312 3300044719 Bacteria 2178
491 Ga0466957_0014169 3300044842 Bacteria 4639
492 Ga0466960_0006861 3300044901 Bacteria 4591
493 Ga0466959_0022897 3300045049 Bacteria 4618
494 Ga0466959_0035145 3300045049 Bacteria 3708
495 Ga0466958_0024101 3300045836 Bacteria 3578
496 Ga0466967_0017307 3300045976 Bacteria 5717
497 Ga0466967_0371644 3300045976 Bacteria 1387
498 Ga0495627_000265 3300046453 Bacteria 53539
499 Ga0495603_0000237 3300046455 Bacteria 28782
500 Ga0495603_0023749 3300046455 Bacteria 3709
501 Ga0495603_0024299 3300046455 Bacteria 3664
502 Ga0495603_0041049 3300046455 Bacteria 2768
503 Ga0495603_0083633 3300046455 Bacteria 1869
504 Ga0495629_0000772 3300046459 Bacteria 25859
505 Ga0495629_0080362 3300046459 Bacteria 2276
506 Ga0495629_0082958 3300046459 Bacteria 2237
507 Ga0495629_0093433 3300046459 Bacteria 2099
508 Ga0495638_0006370 3300046460 Bacteria 8597
509 Ga0495638_0022968 3300046460 Bacteria 4086
510 Ga0495638_0065586 3300046460 Bacteria 2234
511 Ga0495641_0004443 3300046461 Bacteria 9917
512 Ga0495641_0026360 3300046461 Bacteria 2836
513 Ga0495651_0083841 3300046462 Bacteria 2402
514 Ga0495653_0000284 3300046463 Bacteria 41113
515 Ga0495650_0017744 3300046471 Bacteria 3559
516 Ga0495650_0078605 3300046471 Bacteria 1277
517 Ga0495580_0001324 3300046472 Bacteria 21841
518 Ga0495580_0046389 3300046472 Bacteria 3083
519 Ga0495582_0000209 3300046473 Bacteria 32511
520 Ga0495582_0150497 3300046473 Bacteria 1321
521 Ga0495639_0000387 3300046475 Bacteria 20931
522 Ga0495639_0018150 3300046475 Bacteria 3060
523 Ga0495662_0032424 3300046476 Bacteria 2523
524 Ga0495662_0078507 3300046476 Bacteria 1604
525 Ga0495664_0007965 3300046477 Bacteria 5899
526 Ga0495664_0017088 3300046477 Bacteria 4144
527 Ga0495584_0018353 3300046491 Bacteria 3555
528 Ga0495584_0060574 3300046491 Bacteria 1903
529 Ga0495585_0016853 3300046492 Bacteria 4232
530 Ga0495585_0019945 3300046492 Bacteria 3859
531 Ga0495585_0058338 3300046492 Bacteria 2130
532 Ga0495594_0000342 3300046499 Bacteria 23227
533 Ga0495594_0021788 3300046499 Bacteria 3422
534 Ga0495594_0041508 3300046499 Bacteria 2519
535 Ga0495594_0105821 3300046499 Bacteria 1584
536 Ga0495583_0097198 3300046506 Bacteria 1261
537 Ga0495606_0000805 3300046507 Bacteria 47853
538 Ga0495606_0002837 3300046507 Bacteria 19219
539 Ga0495606_0126946 3300046507 Bacteria 1520
540 Ga0495608_0046562 3300046511 Bacteria 2886
541 Ga0495608_0179133 3300046511 Bacteria 1341
542 Ga0495610_0101648 3300046512 Bacteria 1287
543 Ga0495618_0036341 3300046514 Bacteria 3091
544 Ga0495630_0062697 3300046517 Bacteria 2792
545 Ga0495631_0000222 3300046518 Bacteria 39049
546 Ga0495631_0051843 3300046518 Bacteria 1792
547 Ga0495632_0044419 3300046519 Bacteria 2217
548 Ga0495632_0073286 3300046519 Bacteria 1642
549 Ga0495643_0059039 3300046522 Bacteria 2040
550 Ga0495643_0100146 3300046522 Bacteria 1486
551 Ga0495644_0047893 3300046523 Bacteria 1605
552 Ga0495648_0003600 3300046524 Bacteria 13558
553 Ga0495648_0136493 3300046524 Bacteria 1296
554 Ga0495663_0043783 3300046525 Bacteria 1368
555 Ga0495666_0023449 3300046526 Bacteria 3052
556 Ga0495652_0023755 3300046529 Bacteria 5433
557 Ga0495652_0210850 3300046529 Bacteria 1467
558 Ga0495654_0004595 3300046530 Bacteria 8152
559 Ga0495654_0100487 3300046530 Bacteria 1332
560 Ga0495665_0000280 3300046531 Bacteria 25894
561 Ga0495665_0003915 3300046531 Bacteria 8056
562 Ga0495640_0001578 3300046533 Bacteria 17975
563 Ga0495640_0032438 3300046533 Bacteria 3721
564 Ga0495640_0040303 3300046533 Bacteria 3271
565 Ga0495586_0116978 3300046535 Bacteria 1487
566 Ga0495598_0003599 3300046537 Bacteria 3304
567 Ga0495598_0023647 3300046537 Bacteria 1657
568 Ga0495621_0021100 3300046539 Bacteria 2144
569 Ga0495645_0003978 3300046543 Bacteria 10080
570 Ga0495645_0238151 3300046543 Bacteria 1216
571 Ga0495622_0004573 3300046557 Bacteria 6407
572 Ga0495622_0028120 3300046557 Bacteria 2625
573 Ga0495633_0062024 3300046558 Bacteria 1750
574 Ga0495667_0097813 3300046559 Bacteria 1900
575 Ga0495667_0107010 3300046559 Bacteria 1807
576 Ga0495656_0001705 3300046615 Bacteria 7199
577 Ga0495656_0042555 3300046615 Bacteria 1902
578 Ga0495656_0060692 3300046615 Bacteria 1649
579 Ga0495668_0032248 3300046616 Bacteria 2949
580 Ga0495634_0000865 3300046642 Bacteria 29129
581 Ga0495634_0020608 3300046642 Bacteria 4673
582 Ga0495611_0050962 3300046648 Bacteria 1865
583 Ga0495611_0114522 3300046648 Bacteria 1256
584 Ga0495625_0213974 3300046660 Bacteria 1266
585 Ga0495635_0017357 3300046663 Bacteria 5028
586 Ga0495659_0005402 3300046664 Bacteria 4019
587 Ga0495659_0049652 3300046664 Bacteria 1524
588 Ga0495657_0011035 3300046675 Bacteria 6774
589 Ga0495599_0049318 3300046678 Bacteria 2639
590 Ga0495599_0134971 3300046678 Bacteria 1532
591 Ga0495646_0095072 3300046680 Bacteria 1715
592 Ga0495647_0000763 3300046681 Bacteria 9576
593 Ga0495647_0024349 3300046681 Bacteria 2203
594 Ga0495658_0012763 3300046683 Bacteria 4265
595 Ga0495658_0032484 3300046683 Bacteria 2850
596 Ga0495613_0003086 3300046689 Bacteria 12448
597 Ga0495613_0056448 3300046689 Bacteria 2883
598 Ga0495613_0220372 3300046689 Bacteria 1332
599 Ga0495624_0001082 3300046690 Bacteria 21523
600 Ga0495624_0002738 3300046690 Bacteria 13256
601 Ga0495624_0070964 3300046690 Bacteria 2168
602 Ga0495670_0032726 3300046691 Bacteria 2586
603 Ga0495671_0022340 3300046692 Bacteria 3316
604 Ga0495589_0019693 3300046794 Bacteria 3455
605 Ga0495600_0001516 3300046809 Bacteria 12897
606 Ga0495581_0022904 3300047315 Bacteria 3618
607 Ga0495581_0104799 3300047315 Bacteria 1643
608 Ga0495604_0012450 3300047317 Bacteria 6765
609 Ga0495604_0103260 3300047317 Bacteria 2091
610 Ga0495604_0115558 3300047317 Bacteria 1950
611 Ga0495636_0031639 3300047318 Bacteria 2170
612 Ga0495636_0096907 3300047318 Bacteria 1286
613 Ga0495674_0004372 3300047319 Bacteria 13583
614 Ga0495672_0011483 3300047320 Bacteria 6248
615 Ga0495672_0138756 3300047320 Bacteria 1272
616 Ga0495676_0009743 3300047321 Bacteria 8733
617 Ga0495676_0018074 3300047321 Bacteria 6220
618 Ga0495676_0104647 3300047321 Bacteria 2088
619 Ga0495680_0058874 3300047322 Bacteria 2967
620 Ga0495680_0157250 3300047322 Bacteria 1653
621 Ga0495687_011591 3300047443 Bacteria 4727
622 Ga0495675_0111997 3300047444 Bacteria 1703
623 Ga0495673_0003053 3300047469 Bacteria 11253
624 Ga0495684_0045233 3300047471 Bacteria 3369
625 Ga0495684_0125066 3300047471 Bacteria 1935
626 Ga0495686_0052830 3300047472 Bacteria 2547
627 Ga0495686_0071631 3300047472 Bacteria 2133
628 Ga0495593_0000238 3300047673 Bacteria 29664
629 Ga0495593_0054623 3300047673 Bacteria 2104
630 Ga0495593_0071101 3300047673 Bacteria 1807
631 Ga0495602_0031146 3300048088 Bacteria 5047
632 Ga0496100_0084672 3300048903 Bacteria 2150
633 Ga0496100_0153102 3300048903 Bacteria 1647
634 Ga0496100_0183003 3300048903 Bacteria 1516
635 Ga0496101_0018685 3300048904 Bacteria 4717
636 Ga0496101_0036513 3300048904 Bacteria 3481
637 Ga0496101_0103084 3300048904 Bacteria 2138
638 Ga0496101_0103753 3300048904 Bacteria 2131
639 Ga0496101_0163331 3300048904 Bacteria 1709
640 Ga0496102_0001874 3300048905 Bacteria 18120
641 Ga0496102_0007483 3300048905 Bacteria 9334
642 Ga0496102_0126920 3300048905 Bacteria 2385
643 Ga0496102_0192820 3300048905 Bacteria 1920
644 Ga0496102_0282168 3300048905 Bacteria 1565
645 Ga0496102_0394904 3300048905 Bacteria 1301
646 Ga0496103_0002168 3300048906 Bacteria 12474
647 Ga0496103_0004621 3300048906 Bacteria 8335
648 Ga0496103_0122197 3300048906 Bacteria 1659
649 Ga0496103_0132742 3300048906 Bacteria 1591
650 Ga0496104_0000411 3300048907 Bacteria 37562
651 Ga0496104_0000594 3300048907 Bacteria 30891
652 Ga0496104_0020184 3300048907 Bacteria 6104
653 Ga0496104_0022321 3300048907 Bacteria 5813
654 Ga0496104_0084202 3300048907 Bacteria 3034
655 Ga0496104_0118822 3300048907 Bacteria 2538
656 Ga0496105_0005229 3300048908 Bacteria 9837
657 Ga0496105_0181428 3300048908 Bacteria 1724
658 Ga0496105_0228308 3300048908 Bacteria 1513
659 Ga0496106_0008194 3300048909 Bacteria 7724
660 Ga0496106_0026256 3300048909 Bacteria 4336
661 Ga0496106_0041334 3300048909 Bacteria 3454
662 Ga0496106_0061499 3300048909 Bacteria 2849
663 Ga0496106_0097128 3300048909 Bacteria 2280
664 Ga0496106_0202666 3300048909 Bacteria 1579
665 Ga0496107_0043909 3300048910 Bacteria 3212
666 Ga0496107_0195249 3300048910 Bacteria 1504
667 Ga0496108_0000244 3300048911 Bacteria 48432
668 Ga0496108_0008496 3300048911 Bacteria 8332
669 Ga0496108_0013227 3300048911 Bacteria 6726
670 Ga0496108_0038758 3300048911 Bacteria 3971
671 Ga0496108_0109145 3300048911 Bacteria 2364
672 Ga0496108_0123258 3300048911 Bacteria 2224
673 Ga0496108_0191020 3300048911 Bacteria 1775
674 Ga0496109_0002677 3300048912 Bacteria 14952
675 Ga0496109_0047462 3300048912 Bacteria 3905
676 Ga0496109_0075355 3300048912 Bacteria 3102
677 Ga0496109_0133662 3300048912 Bacteria 2317
678 Ga0496109_0323262 3300048912 Bacteria 1456
679 Ga0496110_0021529 3300048913 Bacteria 5462
680 Ga0496110_0059222 3300048913 Bacteria 3375
681 Ga0496110_0082180 3300048913 Bacteria 2872
682 Ga0496110_0102035 3300048913 Bacteria 2572
683 Ga0496110_0111312 3300048913 Bacteria 2461
684 Ga0496110_0180931 3300048913 Bacteria 1914
685 Ga0496111_0000320 3300048914 Bacteria 23827
686 Ga0496111_0035990 3300048914 Bacteria 3539
687 Ga0496111_0076159 3300048914 Bacteria 2445
688 Ga0496111_0315801 3300048914 Bacteria 1157
689 Ga0496112_0000111 3300048915 Bacteria 50958
690 Ga0496112_0015510 3300048915 Bacteria 7115
691 Ga0496112_0029058 3300048915 Bacteria 5344
692 Ga0496112_0043753 3300048915 Bacteria 4385
693 Ga0496112_0142350 3300048915 Bacteria 2367
694 Ga0496112_0244245 3300048915 Bacteria 1747
695 Ga0496112_0368481 3300048915 Bacteria 1378
696 Ga0496113_0003916 3300048916 Bacteria 9027
697 Ga0496114_0032861 3300048917 Bacteria 4273
698 Ga0496114_0073413 3300048917 Bacteria 2879
699 Ga0496114_0266892 3300048917 Bacteria 1508
700 Ga0496115_0007927 3300048918 Bacteria 7835
701 Ga0496115_0015981 3300048918 Bacteria 5707
702 Ga0496115_0036848 3300048918 Bacteria 3874
703 Ga0496115_0039572 3300048918 Bacteria 3745
704 Ga0496115_0047535 3300048918 Bacteria 3431
705 Ga0496115_0051539 3300048918 Bacteria 3300
706 Ga0496115_0094542 3300048918 Bacteria 2445
707 Ga0496115_0215288 3300048918 Bacteria 1586
708 Ga0496116_0000520 3300048919 Bacteria 51826
709 Ga0496116_0017384 3300048919 Bacteria 5582
710 Ga0496116_0037607 3300048919 Bacteria 3373
711 Ga0496116_0098756 3300048919 Bacteria 1751
712 Ga0496117_0056104 3300048920 Bacteria 2747
713 Ga0496117_0066703 3300048920 Bacteria 2439
714 Ga0496118_0011335 3300048921 Bacteria 8714
715 Ga0496118_0012281 3300048921 Bacteria 8243
716 Ga0496118_0035772 3300048921 Bacteria 4026
717 Ga0496118_0050582 3300048921 Bacteria 3187
718 Ga0496118_0081687 3300048921 Bacteria 2268
719 Ga0496118_0106816 3300048921 Bacteria 1871
720 Ga0496120_0019887 3300048923 Bacteria 4282
721 Ga0496120_0034572 3300048923 Bacteria 3026
722 Ga0496121_0001361 3300048924 Bacteria 41683
723 Ga0496121_0001375 3300048924 Bacteria 41255
724 Ga0496121_0006808 3300048924 Bacteria 14001
725 Ga0496121_0028079 3300048924 Bacteria 5247
726 Ga0496121_0044552 3300048924 Bacteria 3825
727 Ga0496121_0057700 3300048924 Bacteria 3215
728 Ga0496121_0085872 3300048924 Bacteria 2475
729 Ga0496121_0105676 3300048924 Bacteria 2160
730 Ga0496121_0118335 3300048924 Bacteria 2005
731 Ga0496121_0121076 3300048924 Bacteria 1976
732 Ga0496121_0148293 3300048924 Bacteria 1730
733 Ga0496121_0148733 3300048924 Bacteria 1727
734 Ga0496121_0150329 3300048924 Bacteria 1714
735 Ga0496122_0025290 3300048925 Bacteria 5160
736 Ga0496123_0028625 3300048926 Bacteria 4119
737 Ga0496124_0021977 3300048927 Bacteria 5866
738 Ga0496124_0141364 3300048927 Bacteria 1899
739 Ga0496124_0189544 3300048927 Bacteria 1575
740 Ga0496124_0282579 3300048927 Bacteria 1209
741 Ga0496125_0000202 3300048928 Bacteria 125963
742 Ga0496125_0000810 3300048928 Bacteria 50874
743 Ga0496125_0001999 3300048928 Bacteria 27642
744 Ga0496125_0015391 3300048928 Bacteria 7403
745 Ga0496125_0040960 3300048928 Bacteria 3966
746 Ga0496125_0062019 3300048928 Bacteria 2993
747 Ga0496125_0202362 3300048928 Bacteria 1298
748 Ga0496126_0002650 3300048929 Bacteria 23719
749 Ga0496126_0017938 3300048929 Bacteria 7037
750 Ga0496126_0022992 3300048929 Bacteria 6048
751 Ga0496126_0036078 3300048929 Bacteria 4627
752 Ga0496126_0043418 3300048929 Bacteria 4147
753 Ga0496126_0102054 3300048929 Bacteria 2508
754 Ga0496126_0162275 3300048929 Bacteria 1909
755 Ga0496126_0249038 3300048929 Bacteria 1481
756 Ga0496126_0254762 3300048929 Bacteria 1461
757 Ga0495678_005201 3300049459 Bacteria 7275
758 Ga0501031_0002641 3300049568 Bacteria 11413
759 Ga0501032_0000257 3300049569 Bacteria 44325
760 Ga0501032_0002207 3300049569 Bacteria 15325
761 Ga0501032_0050080 3300049569 Bacteria 2817
762 Ga0501033_0000124 3300049570 Bacteria 74731
763 Ga0501033_0000244 3300049570 Bacteria 52231
764 Ga0501033_0209346 3300049570 Bacteria 1391
765 Ga0501034_0000159 3300049571 Bacteria 127397
766 Ga0501034_0019549 3300049571 Bacteria 6926
767 Ga0501034_0027553 3300049571 Bacteria 5779
768 Ga0501034_0203493 3300049571 Bacteria 1937
769 Ga0501034_0358363 3300049571 Bacteria 1386
770 Ga0501034_0483255 3300049571 Bacteria 1154
771 Ga0501036_0000039 3300049572 Bacteria 83065
772 Ga0501036_0000104 3300049572 Bacteria 52974
773 Ga0501036_0020262 3300049572 Bacteria 5585
774 Ga0501036_0054745 3300049572 Bacteria 3380
775 Ga0501037_0000247 3300049573 Bacteria 46080
776 Ga0501037_0001386 3300049573 Bacteria 17773
777 Ga0501038_0000041 3300049574 Bacteria 120557
778 Ga0501038_0000207 3300049574 Bacteria 50307
779 Ga0501038_0032296 3300049574 Bacteria 4620
780 Ga0501039_0000064 3300049575 Bacteria 83415
781 Ga0501039_0000148 3300049575 Bacteria 47789
782 Ga0501039_0034867 3300049575 Bacteria 3883
783 Ga0501040_0003761 3300049576 Bacteria 9837
784 Ga0501040_0117404 3300049576 Bacteria 1865
785 Ga0501041_0001759 3300049577 Bacteria 12153
786 Ga0501042_0036793 3300049578 Bacteria 3473
787 Ga0501043_0000202 3300049579 Bacteria 54441
788 Ga0501043_0014806 3300049579 Bacteria 6106
789 Ga0501043_0035649 3300049579 Bacteria 3913
790 Ga0501043_0039221 3300049579 Bacteria 3723
791 Ga0501046_0000185 3300049580 Bacteria 63459
792 Ga0501046_0019371 3300049580 Bacteria 5646
793 Ga0501046_0021384 3300049580 Bacteria 5338
794 Ga0501046_0080151 3300049580 Bacteria 2523
795 Ga0501047_0000385 3300049581 Bacteria 49635
796 Ga0501047_0000392 3300049581 Bacteria 49114
797 Ga0501047_0002801 3300049581 Bacteria 16556
798 Ga0501047_0008093 3300049581 Bacteria 9921
799 Ga0501047_0065193 3300049581 Bacteria 3511
800 Ga0501047_0084811 3300049581 Bacteria 3044
801 Ga0501048_0000536 3300049582 Bacteria 26743
802 Ga0501048_0009128 3300049582 Bacteria 7462
803 Ga0501048_0166735 3300049582 Bacteria 1560
804 Ga0501067_0010006 3300049583 Bacteria 5249
805 Ga0501067_0057206 3300049583 Bacteria 2160
806 Ga0501067_0109325 3300049583 Bacteria 1537
807 Ga0501068_0002219 3300049584 Bacteria 10329
808 Ga0501068_0015826 3300049584 Bacteria 4341
809 Ga0501068_0024106 3300049584 Bacteria 3571
810 Ga0501068_0054094 3300049584 Bacteria 2432
811 Ga0501069_0006636 3300049585 Bacteria 6056
812 Ga0501069_0015986 3300049585 Bacteria 4025
813 Ga0501069_0033054 3300049585 Bacteria 2848
814 Ga0501069_0175977 3300049585 Bacteria 1236
815 Ga0501070_0000175 3300049586 Bacteria 59483
816 Ga0501070_0000557 3300049586 Bacteria 34014
817 Ga0501070_0003774 3300049586 Bacteria 13087
818 Ga0501070_0080256 3300049586 Bacteria 2699
819 Ga0501071_0001483 3300049587 Bacteria 13639
820 Ga0501071_0031190 3300049587 Bacteria 3776
821 Ga0501071_0093188 3300049587 Bacteria 2215
822 Ga0501072_0001033 3300049588 Bacteria 20627
823 Ga0501072_0005126 3300049588 Bacteria 9964
824 Ga0501072_0014460 3300049588 Bacteria 6047
825 Ga0501072_0110898 3300049588 Bacteria 2184
826 Ga0501072_0147728 3300049588 Bacteria 1874
827 Ga0501073_0000034 3300049589 Bacteria 95224
828 Ga0501073_0056616 3300049589 Bacteria 2742
829 Ga0501074_0000271 3300049590 Bacteria 29628
830 Ga0501074_0002163 3300049590 Bacteria 13619
831 Ga0501074_0005773 3300049590 Bacteria 8929
832 Ga0501074_0046422 3300049590 Bacteria 3141
833 Ga0501074_0087424 3300049590 Bacteria 2232
834 Ga0501074_0087680 3300049590 Bacteria 2228
835 Ga0501075_0123271 3300049591 Bacteria 1973
836 Ga0501076_0001519 3300049592 Bacteria 15560
837 Ga0501076_0223454 3300049592 Bacteria 1539
838 Ga0501077_0025710 3300049593 Bacteria 3737
839 Ga0501077_0131182 3300049593 Bacteria 1589
840 Ga0501079_0000773 3300049741 Bacteria 21906
841 Ga0501079_0005639 3300049741 Bacteria 9343
842 Ga0501080_0001103 3300049742 Bacteria 22242
843 Ga0501080_0001428 3300049742 Bacteria 20060
844 Ga0501080_0005894 3300049742 Bacteria 10975
845 Ga0501080_0013998 3300049742 Bacteria 7383
846 Ga0501080_0023073 3300049742 Bacteria 5770
847 Ga0501081_0006217 3300049743 Bacteria 7739
848 Ga0501081_0081936 3300049743 Bacteria 2260
849 Ga0501081_0111849 3300049743 Bacteria 1939
850 Ga0501083_0000118 3300049744 Bacteria 54096
851 Ga0501083_0098174 3300049744 Bacteria 1932
852 Ga0501035_0000137 3300049822 Bacteria 89273
853 Ga0501035_0000155 3300049822 Bacteria 84012
854 Ga0501035_0148229 3300049822 Bacteria 2037
855 Ga0501044_0000548 3300049823 Bacteria 45787
856 Ga0501044_0011998 3300049823 Bacteria 9387
857 Ga0501044_0052450 3300049823 Bacteria 4202
858 Ga0501044_0069453 3300049823 Bacteria 3586
859 Ga0501044_0080864 3300049823 Bacteria 3290
860 Ga0501044_0085375 3300049823 Bacteria 3190
861 Ga0501044_0135826 3300049823 Bacteria 2451
862 Ga0501044_0296542 3300049823 Bacteria 1547
863 Ga0501044_0378718 3300049823 Bacteria 1330
864 Ga0501045_0008590 3300049824 Bacteria 7119
865 Ga0501045_0020888 3300049824 Bacteria 4681
866 nmdc:mga00v17_246567_c1 3300050491 Bacteria 1158
867 nmdc:mga0yw44_17052_c1 3300050492 Bacteria 3942
868 nmdc:mga0yw44_2009_c1 3300050492 Bacteria 7778
869 nmdc:mga0yw44_3972_c1 3300050492 Bacteria 6681
870 nmdc:mga0yw44_723_c1 3300050492 Bacteria 12145
871 nmdc:mga0yw44_88345_c1 3300050492 Bacteria 1954
872 nmdc:mga0yw44_9153_c1 3300050492 Bacteria 4984
873 nmdc:mga06z11_105179_c1 3300050494 Bacteria 1555
874 nmdc:mga06z11_6417_c1 3300050494 Bacteria 4784
875 nmdc:mga06z11_85891_c1 3300050494 Bacteria 1698
876 nmdc:mga06z11_87259_c1 3300050494 Bacteria 1687
877 nmdc:mga07m45_64802_c1 3300050496 Bacteria 2074
878 nmdc:mga05p37_112345_c1 3300050507 Bacteria 3350
879 nmdc:mga05p37_1642_c1 3300050507 Bacteria 25943
880 nmdc:mga05p37_220291_c1 3300050507 Bacteria 2290
881 nmdc:mga05p37_23035_c1 3300050507 Bacteria 7555
882 nmdc:mga05p37_292224_c1 3300050507 Bacteria 1939
883 nmdc:mga05p37_7135_c1 3300050507 Bacteria 13176
884 nmdc:mga09592_104844_c1 3300050508 Bacteria 2424
885 nmdc:mga09592_79704_c1 3300050508 Bacteria 2788
886 nmdc:mga09592_8031_c1 3300050508 Bacteria 8581
887 nmdc:mga0qj67_34763_c1 3300050509 Bacteria 3939
888 nmdc:mga0qj67_38684_c1 3300050509 Bacteria 3743
889 nmdc:mga0qj67_43218_c1 3300050509 Bacteria 3549
890 nmdc:mga06r32_130304_c1 3300050510 Bacteria 2487
891 nmdc:mga06r32_189436_c2 3300050510 Bacteria 1397
892 nmdc:mga06r32_267549_c1 3300050510 Bacteria 1697
893 nmdc:mga06r32_33939_c1 3300050510 Bacteria 4809
894 nmdc:mga06r32_349_c1 3300050510 Bacteria 38472
895 nmdc:mga08y16_136680_c1 3300050511 Bacteria 2548
896 nmdc:mga08y16_166391_c1 3300050511 Bacteria 2291
897 nmdc:mga08y16_220786_c1 3300050511 Bacteria 1962
898 nmdc:mga08y16_418694_c1 3300050511 Bacteria 1369
899 nmdc:mga08y16_4843_c1 3300050511 Bacteria 14047
900 nmdc:mga0n895_195013_c1 3300050512 Bacteria 2056
901 nmdc:mga0n895_34790_c1 3300050512 Bacteria 4852
902 nmdc:mga0n895_6898_c1 3300050512 Bacteria 9703
903 nmdc:mga0rr50_217902_c1 3300050513 Bacteria 1575
904 nmdc:mga0rr50_95825_c1 3300050513 Bacteria 2320
905 nmdc:mga08x19_22091_c2 3300050514 Bacteria 1903
906 nmdc:mga0a205_2525_c1 3300050515 Bacteria 16123
907 Ga0495601_0026423 3300053077 Bacteria 3585
908 Ga0495612_0005134 3300053078 Bacteria 5413
909 Ga0500635_0005633 3300053080 Bacteria 3299
910 Ga0500635_0013826 3300053080 Bacteria 2352
911 Ga0495619_0099938 3300053085 Bacteria 1973
912 Ga0495619_0181116 3300053085 Bacteria 1458
913 Ga0500578_0058889 3300053086 Bacteria 2455
914 Ga0500643_000037 3300053087 Bacteria 180821
915 Ga0500583_0035983 3300053092 Bacteria 2213
916 Ga0500651_0001199 3300053093 Bacteria 12870
917 Ga0500651_0034419 3300053093 Bacteria 3194
918 Ga0500566_0000166 3300053094 Bacteria 33843
919 Ga0500566_0001046 3300053094 Bacteria 16010
920 Ga0500566_0002225 3300053094 Bacteria 11453
921 Ga0500640_008096 3300053095 Bacteria 4136
922 Ga0500641_0015896 3300053096 Bacteria 2798
923 Ga0500650_0002778 3300053098 Bacteria 5888
924 Ga0500554_000266 3300053102 Bacteria 11311
925 Ga0500555_000550 3300053103 Bacteria 14953
926 Ga0500556_0000089 3300053104 Bacteria 84468
927 Ga0500569_005744 3300053109 Bacteria 2682
928 Ga0500572_000474 3300053111 Bacteria 13955
929 Ga0500572_000614 3300053111 Bacteria 11989
930 Ga0500592_001069 3300053116 Bacteria 4472
931 Ga0500593_009372 3300053117 Bacteria 4063
932 Ga0500595_001516 3300053119 Bacteria 12336
933 Ga0500595_003730 3300053119 Bacteria 7025
934 Ga0500595_012019 3300053119 Bacteria 3360
935 Ga0500595_014345 3300053119 Bacteria 3007
936 Ga0500608_000206 3300053122 Bacteria 23563
937 Ga0500608_009005 3300053122 Bacteria 4226
938 Ga0500614_001031 3300053123 Bacteria 6928
939 Ga0500642_0000030 3300053130 Bacteria 115114
940 Ga0500652_001206 3300053131 Bacteria 8252
941 Ga0500658_0018285 3300053134 Bacteria 2626
942 Ga0500559_0000136 3300053136 Bacteria 56922
943 Ga0500559_0002659 3300053136 Bacteria 9097
944 Ga0500559_0014866 3300053136 Bacteria 3288
945 Ga0500568_0001309 3300053139 Bacteria 16339
946 Ga0500568_0005713 3300053139 Bacteria 6378
947 Ga0500577_0004724 3300053142 Bacteria 3622
948 Ga0500586_000203 3300053145 Bacteria 11555
949 Ga0500603_000324 3300053150 Bacteria 12495
950 Ga0500603_000501 3300053150 Bacteria 9959
951 Ga0500604_0002842 3300053151 Bacteria 4699
952 Ga0500616_0000026 3300053153 Bacteria 454314
953 Ga0500616_0010648 3300053153 Bacteria 5487
954 Ga0500616_0019257 3300053153 Bacteria 3849
955 Ga0500616_0055446 3300053153 Bacteria 2073
956 Ga0500622_0001149 3300053156 Bacteria 22026
957 Ga0500622_0001752 3300053156 Bacteria 16718
958 Ga0500630_001092 3300053159 Bacteria 12670
959 Ga0500638_050524 3300053162 Bacteria 2011
960 Ga0500639_000112 3300053163 Bacteria 38789
961 Ga0500636_0004341 3300053177 Bacteria 8020
962 Ga0500636_0006283 3300053177 Bacteria 6815
963 Ga0500636_0030053 3300053177 Bacteria 3212
964 Ga0500636_0164031 3300053177 Bacteria 1208
965 Ga0500637_0000582 3300053178 Bacteria 14362
966 Ga0500596_002967 3300053735 Bacteria 3281
967 Ga0500599_004061 3300053736 Bacteria 1801
968 Ga0500601_000014 3300053737 Bacteria 41972
969 Ga0501084_0093192 3300054114 Bacteria 2529
970 Ga0501084_0258846 3300054114 Bacteria 1469
971 Ga0500661_004660 3300055283 Bacteria 2561
972 Ga0530510_0000606 3300061734 Bacteria 23066

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0238151 Ga0495645_0238151_273_1196 297
2 3300026118 Ga0207675_100046864 Ga0207675_1000468642 298
3 3300053177 Ga0500636_0030053 Ga0500636_0030053_796_1875 304
4 3300048909 Ga0496106_0202666 Ga0496106_0202666_606_1556 306
5 iso_pu_bacteria 8006994254 8006999540 314
6 3300025321 Ga0207656_10024592 Ga0207656_100245924 316
7 3300048924 Ga0496121_0001361 Ga0496121_0001361_13377_14366 318
8 3300048927 Ga0496124_0282579 Ga0496124_0282579_96_1136 321
9 3300053078 Ga0495612_0005134 Ga0495612_0005134_987_2081 323
10 3300005434 Ga0070709_10003278 Ga0070709_100032786 324
11 3300025906 Ga0207699_10005355 Ga0207699_100053555 324
12 3300005436 Ga0070713_100051119 Ga0070713_1000511193 326
13 3300006175 Ga0070712_100003519 Ga0070712_1000035193 326
14 3300025915 Ga0207693_10003010 Ga0207693_1000301010 326
15 3300025928 Ga0207700_10037733 Ga0207700_100377333 326
16 3300046543 Ga0495645_0003978 Ga0495645_0003978_3516_4610 327
17 3300053153 Ga0500616_0055446 Ga0500616_0055446_1030_2049 328
18 3300054114 Ga0501084_0258846 Ga0501084_0258846_243_1265 330
19 3300005336 Ga0070680_100238242 Ga0070680_1002382422 331
20 3300037471 Ga0395905_0021852 Ga0395905_0021852_4667_5761 331
21 3300048915 Ga0496112_0000111 Ga0496112_0000111_21195_22289 331
22 3300005330 Ga0070690_100013882 Ga0070690_1000138822 332
23 3300005535 Ga0070684_100014195 Ga0070684_1000141954 332
24 3300006237 Ga0097621_100011749 Ga0097621_1000117495 332
25 3300006358 Ga0068871_100011734 Ga0068871_1000117345 332
26 3300009545 Ga0105237_10141502 Ga0105237_101415022 332
27 3300025914 Ga0207671_10095298 Ga0207671_100952982 332
28 3300035111 Ga0373923_0011906 Ga0373923_0011906_1540_2634 332
29 3300035170 Ga0373943_0046435 Ga0373943_0046435_25_1119 332
30 3300035695 Ga0373927_0045067 Ga0373927_0045067_1105_2199 332
31 3300036401 Ga0373937_0222603 Ga0373937_0222603_298_1392 332
32 3300046459 Ga0495629_0093433 Ga0495629_0093433_248_1342 332
33 3300046475 Ga0495639_0018150 Ga0495639_0018150_149_1243 332
34 3300046476 Ga0495662_0078507 Ga0495662_0078507_177_1271 332
35 3300046477 Ga0495664_0007965 Ga0495664_0007965_4062_5156 332
36 3300046514 Ga0495618_0036341 Ga0495618_0036341_945_2039 332
37 3300046517 Ga0495630_0062697 Ga0495630_0062697_219_1313 332
38 3300046531 Ga0495665_0003915 Ga0495665_0003915_5138_6232 332
39 3300046533 Ga0495640_0032438 Ga0495640_0032438_725_1819 332
40 3300046535 Ga0495586_0116978 Ga0495586_0116978_318_1412 332
41 3300046642 Ga0495634_0020608 Ga0495634_0020608_461_1555 332
42 3300046678 Ga0495599_0134971 Ga0495599_0134971_295_1389 332
43 3300046680 Ga0495646_0095072 Ga0495646_0095072_91_1185 332
44 3300047315 Ga0495581_0104799 Ga0495581_0104799_369_1463 332
45 3300047471 Ga0495684_0045233 Ga0495684_0045233_1902_2996 332
46 3300047673 Ga0495593_0054623 Ga0495593_0054623_34_1128 332
47 3300053153 Ga0500616_0010648 Ga0500616_0010648_1428_2516 332
48 3300005327 Ga0070658_10175543 Ga0070658_101755432 333
49 3300005548 Ga0070665_100136357 Ga0070665_1001363572 333
50 3300028379 Ga0268266_10070938 Ga0268266_100709382 333
51 3300031548 Ga0307408_100145992 Ga0307408_1001459922 333
52 3300032002 Ga0307416_100055750 Ga0307416_1000557503 333
53 3300035089 Ga0373944_0009047 Ga0373944_0009047_223_1317 333
54 3300046472 Ga0495580_0046389 Ga0495580_0046389_654_1748 333
55 3300046506 Ga0495583_0097198 Ga0495583_0097198_21_1052 333
56 3300046681 Ga0495647_0024349 Ga0495647_0024349_428_1522 333
57 3300048918 Ga0496115_0094542 Ga0496115_0094542_12_1043 333
58 3300048921 Ga0496118_0081687 Ga0496118_0081687_755_1849 333
59 3300048929 Ga0496126_0043418 Ga0496126_0043418_2080_3174 333
60 3300053119 Ga0500595_014345 Ga0500595_014345_859_1953 334
61 3300005355 Ga0070671_100034516 Ga0070671_1000345161 335
62 3300046525 Ga0495663_0043783 Ga0495663_0043783_305_1342 335
63 3300047320 Ga0495672_0138756 Ga0495672_0138756_147_1241 335
64 3300048911 Ga0496108_0008496 Ga0496108_0008496_4728_5801 335
65 3300053094 Ga0500566_0001046 Ga0500566_0001046_57_1151 335
66 3300053095 Ga0500640_008096 Ga0500640_008096_653_1747 335
67 3300053111 Ga0500572_000474 Ga0500572_000474_6803_7897 335
68 3300053122 Ga0500608_009005 Ga0500608_009005_312_1406 335
69 3300053123 Ga0500614_001031 Ga0500614_001031_3319_4413 335
70 3300053136 Ga0500559_0014866 Ga0500559_0014866_1329_2423 335
71 3300053150 Ga0500603_000501 Ga0500603_000501_2950_4044 335
72 3300053159 Ga0500630_001092 Ga0500630_001092_4562_5656 335
73 3300053162 Ga0500638_050524 Ga0500638_050524_548_1642 335
74 3300053163 Ga0500639_000112 Ga0500639_000112_22820_23914 335
75 3300005439 Ga0070711_100026368 Ga0070711_1000263683 336
76 3300025898 Ga0207692_10012566 Ga0207692_100125662 336
77 3300005336 Ga0070680_100179916 Ga0070680_1001799161 337
78 3300005341 Ga0070691_10020416 Ga0070691_100204163 337
79 3300005458 Ga0070681_10000175 Ga0070681_1000017526 337
80 3300005530 Ga0070679_100050863 Ga0070679_1000508635 337
81 3300005546 Ga0070696_100061847 Ga0070696_1000618473 337
82 3300006844 Ga0075428_100282740 Ga0075428_1002827402 337
83 3300006846 Ga0075430_100001924 Ga0075430_1000019246 337
84 3300025912 Ga0207707_10000660 Ga0207707_100006609 337
85 3300025917 Ga0207660_10218085 Ga0207660_102180852 337
86 3300006038 Ga0075365_10005112 Ga0075365_100051123 338
87 3300035695 Ga0373927_0086095 Ga0373927_0086095_327_1421 338
88 3300049570 Ga0501033_0209346 Ga0501033_0209346_280_1329 338
89 3300049572 Ga0501036_0054745 Ga0501036_0054745_1922_2971 338
90 3300049574 Ga0501038_0032296 Ga0501038_0032296_2344_3393 338
91 3300049575 Ga0501039_0034867 Ga0501039_0034867_267_1316 338
92 3300049576 Ga0501040_0003761 Ga0501040_0003761_2004_3053 338
93 3300049577 Ga0501041_0001759 Ga0501041_0001759_1765_2814 338
94 3300049580 Ga0501046_0019371 Ga0501046_0019371_926_1975 338
95 3300049587 Ga0501071_0031190 Ga0501071_0031190_1149_2198 338
96 3300049588 Ga0501072_0005126 Ga0501072_0005126_2891_3940 338
97 3300049590 Ga0501074_0087424 Ga0501074_0087424_839_1888 338
98 3300049592 Ga0501076_0001519 Ga0501076_0001519_10592_11641 338
99 3300049741 Ga0501079_0005639 Ga0501079_0005639_1373_2422 338
100 3300049742 Ga0501080_0023073 Ga0501080_0023073_3120_4169 338
101 3300049743 Ga0501081_0006217 Ga0501081_0006217_1772_2821 338
102 3300049824 Ga0501045_0020888 Ga0501045_0020888_2054_3103 338
103 3300050492 nmdc:mga0yw44_9153_c1 nmdc:mga0yw44_9153_c1_1491_2660 338
104 3300061734 Ga0530510_0000606 Ga0530510_0000606_17162_18211 338
105 3300005439 Ga0070711_100080806 Ga0070711_1000808062 339
106 3300025906 Ga0207699_10085572 Ga0207699_100855722 339
107 3300025916 Ga0207663_10019711 Ga0207663_100197112 339
108 3300026067 Ga0207678_10030711 Ga0207678_100307112 339
109 3300046460 Ga0495638_0022968 Ga0495638_0022968_2708_3802 339
110 3300046522 Ga0495643_0100146 Ga0495643_0100146_320_1414 339
111 3300048920 Ga0496117_0066703 Ga0496117_0066703_1007_2101 339
112 3300048924 Ga0496121_0006808 Ga0496121_0006808_1732_2826 339
113 3300048928 Ga0496125_0062019 Ga0496125_0062019_1295_2389 339
114 3300053093 Ga0500651_0034419 Ga0500651_0034419_359_1453 339
115 3300053094 Ga0500566_0002225 Ga0500566_0002225_6064_7158 339
116 3300053104 Ga0500556_0000089 Ga0500556_0000089_6592_7686 339
117 3300053109 Ga0500569_005744 Ga0500569_005744_1563_2657 339
118 3300053116 Ga0500592_001069 Ga0500592_001069_2823_3917 339
119 3300053122 Ga0500608_000206 Ga0500608_000206_493_1587 339
120 3300053153 Ga0500616_0000026 Ga0500616_0000026_81402_82496 339
121 3300053156 Ga0500622_0001149 Ga0500622_0001149_14810_15904 339
122 3300053177 Ga0500636_0006283 Ga0500636_0006283_960_2054 339
123 3300031711 Ga0265314_10005071 Ga0265314_100050718 340
124 3300044694 Ga0466963_0049448 Ga0466963_0049448_1230_2324 340
125 3300045976 Ga0466967_0017307 Ga0466967_0017307_4373_5467 340
126 3300049584 Ga0501068_0015826 Ga0501068_0015826_2703_3755 340
127 3300049587 Ga0501071_0001483 Ga0501071_0001483_4904_5956 340
128 3300049742 Ga0501080_0001428 Ga0501080_0001428_639_1691 340
129 3300005548 Ga0070665_100385969 Ga0070665_1003859692 341
130 3300006051 Ga0075364_10084056 Ga0075364_100840562 341
131 3300009094 Ga0111539_10012637 Ga0111539_100126372 341
132 3300025297 Ga0209758_1012674 Ga0209758_10126742 341
133 3300026035 Ga0207703_10442420 Ga0207703_104424202 341
134 3300005616 Ga0068852_100340479 Ga0068852_1003404792 342
135 3300005985 Ga0081539_10000233 Ga0081539_1000023340 342
136 3300026142 Ga0207698_10221241 Ga0207698_102212412 342
137 3300028380 Ga0268265_10093290 Ga0268265_100932902 342
138 3300028381 Ga0268264_10218968 Ga0268264_102189682 342
139 3300046507 Ga0495606_0126946 Ga0495606_0126946_387_1475 342
140 3300005353 Ga0070669_100033660 Ga0070669_1000336603 343
141 3300005842 Ga0068858_100304893 Ga0068858_1003048932 343
142 iso_pu_bacteria 2891048133 2891049781 343
143 3300006844 Ga0075428_100086548 Ga0075428_1000865482 344
144 3300006847 Ga0075431_100005570 Ga0075431_10000557012 344
145 3300009147 Ga0114129_10004768 Ga0114129_100047686 344
146 3300049582 Ga0501048_0166735 Ga0501048_0166735_263_1330 344
147 3300050507 nmdc:mga05p37_7135_c1 nmdc:mga05p37_7135_c1_2782_3885 344
148 3300050508 nmdc:mga09592_79704_c1 nmdc:mga09592_79704_c1_43_1146 344
149 3300050509 nmdc:mga0qj67_38684_c1 nmdc:mga0qj67_38684_c1_562_1665 344
150 3300050510 nmdc:mga06r32_267549_c1 nmdc:mga06r32_267549_c1_236_1339 344
151 3300025920 Ga0207649_10225494 Ga0207649_102254942 345
152 3300005327 Ga0070658_10003236 Ga0070658_1000323612 346
153 3300005336 Ga0070680_100010261 Ga0070680_1000102612 346
154 3300005435 Ga0070714_100044131 Ga0070714_1000441312 346
155 3300005563 Ga0068855_100026681 Ga0068855_1000266816 346
156 3300005614 Ga0068856_100033270 Ga0068856_1000332704 346
157 3300005616 Ga0068852_100008740 Ga0068852_1000087405 346
158 3300005616 Ga0068852_100054771 Ga0068852_1000547714 346
159 3300013105 Ga0157369_10129388 Ga0157369_101293881 346
160 3300013307 Ga0157372_10569198 Ga0157372_105691982 346
161 3300013307 Ga0157372_10588888 Ga0157372_105888881 346
162 3300025909 Ga0207705_10031006 Ga0207705_100310062 346
163 3300025929 Ga0207664_10264258 Ga0207664_102642582 346
164 3300025949 Ga0207667_10023066 Ga0207667_100230662 346
165 3300025949 Ga0207667_10085017 Ga0207667_100850173 346
166 3300026078 Ga0207702_10052278 Ga0207702_100522782 346
167 3300026142 Ga0207698_10025095 Ga0207698_100250954 346
168 3300026142 Ga0207698_10399243 Ga0207698_103992431 346
169 3300031595 Ga0265313_10054612 Ga0265313_100546122 346
170 3300031712 Ga0265342_10000638 Ga0265342_1000063818 346
171 3300032002 Ga0307416_100073436 Ga0307416_1000734363 346
172 3300039450 Ga0436363_1647914 Ga0436363_1647914_2030_3106 346
173 3300049571 Ga0501034_0203493 Ga0501034_0203493_697_1779 346
174 3300049571 Ga0501034_0483255 Ga0501034_0483255_22_1101 346
175 3300049581 Ga0501047_0008093 Ga0501047_0008093_5181_6260 346
176 3300049581 Ga0501047_0084811 Ga0501047_0084811_1005_2114 346
177 3300049584 Ga0501068_0054094 Ga0501068_0054094_540_1622 346
178 3300049585 Ga0501069_0033054 Ga0501069_0033054_255_1337 346
179 3300049586 Ga0501070_0080256 Ga0501070_0080256_147_1229 346
180 3300049587 Ga0501071_0093188 Ga0501071_0093188_654_1736 346
181 3300049588 Ga0501072_0110898 Ga0501072_0110898_773_1855 346
182 3300049589 Ga0501073_0056616 Ga0501073_0056616_197_1279 346
183 3300049590 Ga0501074_0046422 Ga0501074_0046422_189_1268 346
184 3300049590 Ga0501074_0087680 Ga0501074_0087680_200_1282 346
185 3300034819 Ga0373958_0022808 Ga0373958_0022808_28_1119 347
186 3300034820 Ga0373959_0018904 Ga0373959_0018904_134_1225 347
187 3300035691 Ga0373931_0003998 Ga0373931_0003998_1129_2220 347
188 3300005327 Ga0070658_10010916 Ga0070658_100109161 348
189 3300005336 Ga0070680_100218955 Ga0070680_1002189552 348
190 3300005455 Ga0070663_100072815 Ga0070663_1000728151 348
191 3300005530 Ga0070679_100247687 Ga0070679_1002476871 348
192 3300009093 Ga0105240_10022848 Ga0105240_100228482 348
193 3300025913 Ga0207695_10213368 Ga0207695_102133682 348
194 3300025917 Ga0207660_10274951 Ga0207660_102749511 348
195 3300025949 Ga0207667_10359271 Ga0207667_103592712 348
196 3300025981 Ga0207640_10214745 Ga0207640_102147452 348
197 3300026078 Ga0207702_10057390 Ga0207702_100573904 348
198 3300031247 Ga0265340_10023855 Ga0265340_100238552 348
199 3300044693 Ga0466961_0125511 Ga0466961_0125511_177_1256 348
200 3300044694 Ga0466963_0049544 Ga0466963_0049544_288_1424 348
201 3300044719 Ga0466971_0037312 Ga0466971_0037312_379_1458 348
202 3300044842 Ga0466957_0014169 Ga0466957_0014169_402_1538 348
203 3300045049 Ga0466959_0035145 Ga0466959_0035145_381_1517 348
204 3300045836 Ga0466958_0024101 Ga0466958_0024101_1873_3009 348
205 3300046453 Ga0495627_000265 Ga0495627_000265_25436_26542 348
206 3300046463 Ga0495653_0000284 Ga0495653_0000284_22999_24105 348
207 3300046471 Ga0495650_0017744 Ga0495650_0017744_2319_3425 348
208 3300046507 Ga0495606_0000805 Ga0495606_0000805_33109_34215 348
209 3300046518 Ga0495631_0000222 Ga0495631_0000222_34870_35976 348
210 3300046519 Ga0495632_0044419 Ga0495632_0044419_825_1931 348
211 3300046530 Ga0495654_0004595 Ga0495654_0004595_5623_6729 348
212 3300046530 Ga0495654_0100487 Ga0495654_0100487_92_1198 348
213 3300046692 Ga0495671_0022340 Ga0495671_0022340_2110_3216 348
214 3300047320 Ga0495672_0011483 Ga0495672_0011483_997_2103 348
215 3300048924 Ga0496121_0085872 Ga0496121_0085872_496_1575 348
216 3300049459 Ga0495678_005201 Ga0495678_005201_2963_4069 348
217 3300049569 Ga0501032_0050080 Ga0501032_0050080_1341_2420 348
218 3300049571 Ga0501034_0027553 Ga0501034_0027553_661_1740 348
219 3300049572 Ga0501036_0020262 Ga0501036_0020262_2238_3317 348
220 3300049579 Ga0501043_0039221 Ga0501043_0039221_710_1789 348
221 3300049580 Ga0501046_0021384 Ga0501046_0021384_3758_4810 348
222 3300049822 Ga0501035_0148229 Ga0501035_0148229_140_1219 348
223 3300049823 Ga0501044_0080864 Ga0501044_0080864_979_2058 348
224 3300053077 Ga0495601_0026423 Ga0495601_0026423_274_1353 348
225 3300053177 Ga0500636_0164031 Ga0500636_0164031_28_1107 348
226 3300005530 Ga0070679_100066082 Ga0070679_1000660823 349
227 3300005535 Ga0070684_100003962 Ga0070684_1000039622 349
228 3300025921 Ga0207652_10017792 Ga0207652_100177925 349
229 3300037418 Ga0395900_0000943 Ga0395900_0000943_29730_30806 349
230 3300037466 Ga0395898_0002974 Ga0395898_0002974_8352_9428 349
231 3300037471 Ga0395905_0062455 Ga0395905_0062455_2197_3273 349
232 3300038443 Ga0395901_0001973 Ga0395901_0001973_10540_11616 349
233 3300046471 Ga0495650_0078605 Ga0495650_0078605_169_1248 349
234 3300053111 Ga0500572_000614 Ga0500572_000614_3127_4209 349
235 3300053136 Ga0500559_0002659 Ga0500559_0002659_2114_3196 349
236 iso_pu_bacteria 2508501128 2509148602 349
237 iso_pu_bacteria 2513237101 2513698241 349
238 iso_pu_bacteria 2721755755 2723848571 349
239 iso_pu_bacteria 2728368998 2728755224 349
240 iso_pu_bacteria 2775507049 2776915780 349
241 iso_pu_bacteria 2791355199 2793077555 349
242 iso_pu_bacteria 2874604998 2874606254 349
243 iso_pu_bacteria 2876808645 2876818405 349
244 iso_pu_bacteria 2879110137 2879113184 349
245 iso_pu_bacteria 2889033259 2889036846 349
246 iso_pu_bacteria 2904690495 2904698448 349
247 iso_pu_bacteria 2908756301 2908762540 349
248 iso_pu_bacteria 3005718088 3005721114 349
249 iso_pu_bacteria 8006984368 8006988301 349
250 iso_pu_bacteria 8019547302 8019547775 349
251 3300050511 nmdc:mga08y16_220786_c1 nmdc:mga08y16_220786_c1_818_1897 350
252 3300005937 Ga0081455_10003864 Ga0081455_1000386413 351
253 3300007076 Ga0075435_100053444 Ga0075435_1000534442 351
254 3300013297 Ga0157378_10573305 Ga0157378_105733051 351
255 3300025295 Ga0209564_1000936 Ga0209564_100093619 351
256 3300028577 Ga0265318_10023748 Ga0265318_100237482 351
257 3300046691 Ga0495670_0032726 Ga0495670_0032726_427_1521 351
258 3300048919 Ga0496116_0000520 Ga0496116_0000520_1818_2912 351
259 3300048921 Ga0496118_0011335 Ga0496118_0011335_5352_6446 351
260 3300048923 Ga0496120_0034572 Ga0496120_0034572_1478_2572 351
261 3300048925 Ga0496122_0025290 Ga0496122_0025290_704_1798 351
262 3300048926 Ga0496123_0028625 Ga0496123_0028625_611_1705 351
263 3300050513 nmdc:mga0rr50_217902_c1 nmdc:mga0rr50_217902_c1_62_1153 351
264 3300053098 Ga0500650_0002778 Ga0500650_0002778_1301_2395 351
265 3300053130 Ga0500642_0000030 Ga0500642_0000030_111548_112642 351
266 3300053131 Ga0500652_001206 Ga0500652_001206_5042_6136 351
267 3300053136 Ga0500559_0000136 Ga0500559_0000136_49823_50917 351
268 3300053139 Ga0500568_0001309 Ga0500568_0001309_11975_13069 351
269 3300053145 Ga0500586_000203 Ga0500586_000203_2120_3214 351
270 3300053151 Ga0500604_0002842 Ga0500604_0002842_30_1124 351
271 3300005331 Ga0070670_100279834 Ga0070670_1002798342 352
272 3300009545 Ga0105237_10030977 Ga0105237_100309773 352
273 3300025914 Ga0207671_10116738 Ga0207671_101167382 352
274 3300025922 Ga0207646_10308109 Ga0207646_103081092 352
275 3300026067 Ga0207678_10008751 Ga0207678_100087516 352
276 3300037466 Ga0395898_0046280 Ga0395898_0046280_2126_3217 352
277 3300046524 Ga0495648_0003600 Ga0495648_0003600_4580_5674 352
278 3300049588 Ga0501072_0014460 Ga0501072_0014460_1650_2738 352
279 3300053142 Ga0500577_0004724 Ga0500577_0004724_2254_3348 352
280 3300003214 JGI25165J46597_1002599 JGI25165J46597_10025992 353
281 3300003215 JGI25153J46596_10000110 JGI25153J46596_1000011044 353
282 3300003215 JGI25153J46596_10000161 JGI25153J46596_1000016172 353
283 3300003215 JGI25153J46596_10000354 JGI25153J46596_1000035424 353
284 3300003215 JGI25153J46596_10013618 JGI25153J46596_100136182 353
285 3300003354 JGI25160J50197_1001256 JGI25160J50197_100125612 353
286 3300003354 JGI25160J50197_1002809 JGI25160J50197_10028093 353
287 3300003354 JGI25160J50197_1015732 JGI25160J50197_10157322 353
288 3300003659 JGI25404J52841_10002388 JGI25404J52841_100023885 353
289 3300003752 Ga0055539_1005461 Ga0055539_10054611 353
290 3300005262 Ga0065165_1000368 Ga0065165_10003687 353
291 3300005262 Ga0065165_1008246 Ga0065165_10082464 353
292 3300005262 Ga0065165_1009309 Ga0065165_10093093 353
293 3300005329 Ga0070683_100001547 Ga0070683_1000015472 353
294 3300005329 Ga0070683_100044771 Ga0070683_1000447713 353
295 3300005329 Ga0070683_100302038 Ga0070683_1003020382 353
296 3300005331 Ga0070670_100045187 Ga0070670_1000451873 353
297 3300005340 Ga0070689_100109763 Ga0070689_1001097631 353
298 3300005341 Ga0070691_10017992 Ga0070691_100179922 353
299 3300005341 Ga0070691_10071355 Ga0070691_100713552 353
300 3300005347 Ga0070668_100181295 Ga0070668_1001812951 353
301 3300005355 Ga0070671_100014431 Ga0070671_1000144311 353
302 3300005355 Ga0070671_100294355 Ga0070671_1002943551 353
303 3300005364 Ga0070673_100115785 Ga0070673_1001157852 353
304 3300005365 Ga0070688_100078136 Ga0070688_1000781362 353
305 3300005435 Ga0070714_100041919 Ga0070714_1000419193 353
306 3300005435 Ga0070714_100085282 Ga0070714_1000852822 353
307 3300005435 Ga0070714_100356821 Ga0070714_1003568211 353
308 3300005436 Ga0070713_100034739 Ga0070713_1000347391 353
309 3300005436 Ga0070713_100094168 Ga0070713_1000941682 353
310 3300005436 Ga0070713_100312394 Ga0070713_1003123942 353
311 3300005437 Ga0070710_10000965 Ga0070710_100009657 353
312 3300005437 Ga0070710_10074086 Ga0070710_100740861 353
313 3300005439 Ga0070711_100056653 Ga0070711_1000566532 353
314 3300005441 Ga0070700_100044720 Ga0070700_1000447202 353
315 3300005444 Ga0070694_100037235 Ga0070694_1000372352 353
316 3300005455 Ga0070663_100044284 Ga0070663_1000442842 353
317 3300005455 Ga0070663_100054431 Ga0070663_1000544312 353
318 3300005456 Ga0070678_100041599 Ga0070678_1000415992 353
319 3300005457 Ga0070662_100079404 Ga0070662_1000794042 353
320 3300005458 Ga0070681_10006255 Ga0070681_1000625511 353
321 3300005458 Ga0070681_10016774 Ga0070681_100167745 353
322 3300005458 Ga0070681_10098798 Ga0070681_100987983 353
323 3300005471 Ga0070698_100036085 Ga0070698_1000360854 353
324 3300005471 Ga0070698_100088787 Ga0070698_1000887871 353
325 3300005530 Ga0070679_100004326 Ga0070679_10000432612 353
326 3300005530 Ga0070679_100014878 Ga0070679_1000148783 353
327 3300005530 Ga0070679_100038377 Ga0070679_1000383772 353
328 3300005535 Ga0070684_100006353 Ga0070684_1000063532 353
329 3300005535 Ga0070684_100041821 Ga0070684_1000418213 353
330 3300005539 Ga0068853_100016336 Ga0068853_1000163365 353
331 3300005539 Ga0068853_100047840 Ga0068853_1000478403 353
332 3300005539 Ga0068853_100125945 Ga0068853_1001259452 353
333 3300005539 Ga0068853_100210295 Ga0068853_1002102952 353
334 3300005543 Ga0070672_100059922 Ga0070672_1000599222 353
335 3300005545 Ga0070695_100001092 Ga0070695_1000010925 353
336 3300005548 Ga0070665_100018220 Ga0070665_1000182203 353
337 3300005548 Ga0070665_100020007 Ga0070665_1000200077 353
338 3300005548 Ga0070665_100101330 Ga0070665_1001013303 353
339 3300005548 Ga0070665_100227680 Ga0070665_1002276802 353
340 3300005563 Ga0068855_100035664 Ga0068855_1000356643 353
341 3300005563 Ga0068855_100062155 Ga0068855_1000621553 353
342 3300005564 Ga0070664_100131375 Ga0070664_1001313752 353
343 3300005577 Ga0068857_100085563 Ga0068857_1000855632 353
344 3300005577 Ga0068857_100141905 Ga0068857_1001419051 353
345 3300005577 Ga0068857_100311968 Ga0068857_1003119681 353
346 3300005614 Ga0068856_100000147 Ga0068856_10000014756 353
347 3300005614 Ga0068856_100083507 Ga0068856_1000835074 353
348 3300005614 Ga0068856_100148417 Ga0068856_1001484172 353
349 3300005614 Ga0068856_100200723 Ga0068856_1002007232 353
350 3300005616 Ga0068852_100091652 Ga0068852_1000916523 353
351 3300005617 Ga0068859_100378074 Ga0068859_1003780742 353
352 3300005618 Ga0068864_100011985 Ga0068864_1000119856 353
353 3300005618 Ga0068864_100172453 Ga0068864_1001724532 353
354 3300005841 Ga0068863_100112064 Ga0068863_1001120643 353
355 3300005841 Ga0068863_100122013 Ga0068863_1001220132 353
356 3300005842 Ga0068858_100037736 Ga0068858_1000377363 353
357 3300005842 Ga0068858_100400582 Ga0068858_1004005821 353
358 3300005843 Ga0068860_100000302 Ga0068860_10000030250 353
359 3300005843 Ga0068860_100101960 Ga0068860_1001019603 353
360 3300005844 Ga0068862_100112394 Ga0068862_1001123942 353
361 3300005937 Ga0081455_10000058 Ga0081455_1000005846 353
362 3300005937 Ga0081455_10000473 Ga0081455_1000047349 353
363 3300005937 Ga0081455_10005003 Ga0081455_1000500311 353
364 3300005937 Ga0081455_10014063 Ga0081455_100140635 353
365 3300005937 Ga0081455_10015554 Ga0081455_100155543 353
366 3300005937 Ga0081455_10037473 Ga0081455_100374732 353
367 3300005981 Ga0081538_10023150 Ga0081538_100231503 353
368 3300005983 Ga0081540_1000008 Ga0081540_1000008115 353
369 3300005983 Ga0081540_1000040 Ga0081540_100004054 353
370 3300005983 Ga0081540_1003917 Ga0081540_10039172 353
371 3300005983 Ga0081540_1009587 Ga0081540_10095874 353
372 3300005983 Ga0081540_1010771 Ga0081540_10107712 353
373 3300005983 Ga0081540_1024661 Ga0081540_10246613 353
374 3300005985 Ga0081539_10000172 Ga0081539_10000172100 353
375 3300005985 Ga0081539_10039458 Ga0081539_100394582 353
376 3300005985 Ga0081539_10054543 Ga0081539_100545432 353
377 3300006028 Ga0070717_10028261 Ga0070717_100282612 353
378 3300006028 Ga0070717_10032708 Ga0070717_100327082 353
379 3300006038 Ga0075365_10015652 Ga0075365_100156523 353
380 3300006038 Ga0075365_10150692 Ga0075365_101506922 353
381 3300006038 Ga0075365_10189937 Ga0075365_101899372 353
382 3300006042 Ga0075368_10000322 Ga0075368_1000032211 353
383 3300006048 Ga0075363_100011548 Ga0075363_1000115484 353
384 3300006048 Ga0075363_100137119 Ga0075363_1001371192 353
385 3300006051 Ga0075364_10015259 Ga0075364_100152592 353
386 3300006051 Ga0075364_10029052 Ga0075364_100290522 353
387 3300006175 Ga0070712_100121997 Ga0070712_1001219972 353
388 3300006178 Ga0075367_10023152 Ga0075367_100231523 353
389 3300006178 Ga0075367_10024239 Ga0075367_100242392 353
390 3300006178 Ga0075367_10109016 Ga0075367_101090161 353
391 3300006186 Ga0075369_10060177 Ga0075369_100601772 353
392 3300006195 Ga0075366_10002088 Ga0075366_1000208810 353
393 3300006353 Ga0075370_10003222 Ga0075370_100032228 353
394 3300006353 Ga0075370_10035300 Ga0075370_100353002 353
395 3300006353 Ga0075370_10045987 Ga0075370_100459873 353
396 3300006353 Ga0075370_10053578 Ga0075370_100535782 353
397 3300006844 Ga0075428_100001783 Ga0075428_10000178316 353
398 3300006844 Ga0075428_100039034 Ga0075428_1000390342 353
399 3300006844 Ga0075428_100093046 Ga0075428_1000930464 353
400 3300006844 Ga0075428_100136756 Ga0075428_1001367562 353
401 3300006846 Ga0075430_100150139 Ga0075430_1001501392 353
402 3300006846 Ga0075430_100184989 Ga0075430_1001849892 353
403 3300006847 Ga0075431_100000003 Ga0075431_10000000319 353
404 3300006847 Ga0075431_100261380 Ga0075431_1002613802 353
405 3300006847 Ga0075431_100306404 Ga0075431_1003064042 353
406 3300006852 Ga0075433_10005748 Ga0075433_100057485 353
407 3300006871 Ga0075434_100030523 Ga0075434_1000305232 353
408 3300006880 Ga0075429_100000288 Ga0075429_1000002883 353
409 3300006880 Ga0075429_100132767 Ga0075429_1001327672 353
410 3300006880 Ga0075429_100191769 Ga0075429_1001917692 353
411 3300006931 Ga0097620_100378089 Ga0097620_1003780892 353
412 3300006941 Ga0099825_1028907 Ga0099825_10289072 353
413 3300006942 Ga0099824_1021477 Ga0099824_10214772 353
414 3300006943 Ga0099822_1001679 Ga0099822_100167919 353
415 3300007076 Ga0075435_100038956 Ga0075435_1000389563 353
416 3300007265 Ga0099794_10012754 Ga0099794_100127542 353
417 3300009093 Ga0105240_10077802 Ga0105240_100778023 353
418 3300009094 Ga0111539_10007175 Ga0111539_100071758 353
419 3300009094 Ga0111539_10007426 Ga0111539_1000742616 353
420 3300009094 Ga0111539_10280377 Ga0111539_102803772 353
421 3300009098 Ga0105245_10016233 Ga0105245_100162334 353
422 3300009098 Ga0105245_10067599 Ga0105245_100675991 353
423 3300009098 Ga0105245_10113086 Ga0105245_101130862 353
424 3300009147 Ga0114129_10000104 Ga0114129_1000010414 353
425 3300009147 Ga0114129_10009472 Ga0114129_100094729 353
426 3300009147 Ga0114129_10141754 Ga0114129_101417542 353
427 3300009148 Ga0105243_10099061 Ga0105243_100990612 353
428 3300009174 Ga0105241_10020161 Ga0105241_100201613 353
429 3300009174 Ga0105241_10021591 Ga0105241_100215913 353
430 3300009176 Ga0105242_10188924 Ga0105242_101889242 353
431 3300009177 Ga0105248_10103016 Ga0105248_101030163 353
432 3300009177 Ga0105248_10532673 Ga0105248_105326732 353
433 3300009545 Ga0105237_10007390 Ga0105237_100073909 353
434 3300009545 Ga0105237_10082457 Ga0105237_100824573 353
435 3300009545 Ga0105237_10191139 Ga0105237_101911392 353
436 3300009551 Ga0105238_10088915 Ga0105238_100889152 353
437 3300009551 Ga0105238_10333985 Ga0105238_103339851 353
438 3300009551 Ga0105238_10347392 Ga0105238_103473922 353
439 3300009553 Ga0105249_10292405 Ga0105249_102924052 353
440 3300010159 Ga0099796_10003058 Ga0099796_100030582 353
441 3300010375 Ga0105239_10010770 Ga0105239_100107705 353
442 3300010375 Ga0105239_10117510 Ga0105239_101175102 353
443 3300010375 Ga0105239_10344421 Ga0105239_103444212 353
444 3300011119 Ga0105246_10003773 Ga0105246_100037738 353
445 3300011119 Ga0105246_10079406 Ga0105246_100794062 353
446 3300011119 Ga0105246_10131381 Ga0105246_101313812 353
447 3300011119 Ga0105246_10237793 Ga0105246_102377931 353
448 3300013104 Ga0157370_10089815 Ga0157370_100898151 353
449 3300013105 Ga0157369_10012743 Ga0157369_100127438 353
450 3300013105 Ga0157369_10020698 Ga0157369_100206981 353
451 3300013105 Ga0157369_10068028 Ga0157369_100680283 353
452 3300013105 Ga0157369_10173846 Ga0157369_101738461 353
453 3300013296 Ga0157374_10013038 Ga0157374_100130387 353
454 3300013296 Ga0157374_10021625 Ga0157374_100216256 353
455 3300013296 Ga0157374_10095493 Ga0157374_100954932 353
456 3300013297 Ga0157378_10101029 Ga0157378_101010292 353
457 3300013297 Ga0157378_10132573 Ga0157378_101325732 353
458 3300013306 Ga0163162_10013490 Ga0163162_100134902 353
459 3300013306 Ga0163162_10291917 Ga0163162_102919172 353
460 3300013306 Ga0163162_10530865 Ga0163162_105308651 353
461 3300013307 Ga0157372_10009605 Ga0157372_100096059 353
462 3300013307 Ga0157372_10353836 Ga0157372_103538362 353
463 3300014325 Ga0163163_10005130 Ga0163163_100051305 353
464 3300014325 Ga0163163_10089857 Ga0163163_100898572 353
465 3300014325 Ga0163163_10132157 Ga0163163_101321572 353
466 3300014325 Ga0163163_10322310 Ga0163163_103223102 353
467 3300014326 Ga0157380_10375933 Ga0157380_103759331 353
468 3300014745 Ga0157377_10088218 Ga0157377_100882182 353
469 3300014969 Ga0157376_10484796 Ga0157376_104847961 353
470 3300021320 Ga0214544_1000055 Ga0214544_100005582 353
471 3300021321 Ga0214542_1003337 Ga0214542_100333714 353
472 3300021324 Ga0214545_1000028 Ga0214545_1000028109 353
473 3300021327 Ga0214543_1000044 Ga0214543_100004455 353
474 3300021384 Ga0213876_10000471 Ga0213876_100004718 353
475 3300021441 Ga0213871_10000076 Ga0213871_100000766 353
476 3300025230 Ga0209563_101020 Ga0209563_1010203 353
477 3300025245 Ga0207425_1002884 Ga0207425_10028842 353
478 3300025253 Ga0209677_106052 Ga0209677_1060523 353
479 3300025295 Ga0209564_1002670 Ga0209564_10026709 353
480 3300025295 Ga0209564_1035919 Ga0209564_10359192 353
481 3300025297 Ga0209758_1000075 Ga0209758_100007580 353
482 3300025297 Ga0209758_1000087 Ga0209758_1000087152 353
483 3300025297 Ga0209758_1001472 Ga0209758_10014729 353
484 3300025297 Ga0209758_1006857 Ga0209758_10068578 353
485 3300025297 Ga0209758_1008545 Ga0209758_10085456 353
486 3300025297 Ga0209758_1016464 Ga0209758_10164644 353
487 3300025297 Ga0209758_1019189 Ga0209758_10191892 353
488 3300025297 Ga0209758_1049417 Ga0209758_10494172 353
489 3300025299 Ga0209256_1009007 Ga0209256_10090071 353
490 3300025302 Ga0207426_1000160 Ga0207426_10001603 353
491 3300025302 Ga0207426_1000289 Ga0207426_1000289108 353
492 3300025304 Ga0209257_1000382 Ga0209257_100038277 353
493 3300025304 Ga0209257_1010148 Ga0209257_10101483 353
494 3300025893 Ga0207682_10109140 Ga0207682_101091401 353
495 3300025898 Ga0207692_10004122 Ga0207692_100041224 353
496 3300025899 Ga0207642_10022038 Ga0207642_100220382 353
497 3300025900 Ga0207710_10043002 Ga0207710_100430022 353
498 3300025904 Ga0207647_10006477 Ga0207647_100064778 353
499 3300025906 Ga0207699_10000561 Ga0207699_100005613 353
500 3300025907 Ga0207645_10048437 Ga0207645_100484372 353
501 3300025908 Ga0207643_10004466 Ga0207643_100044662 353
502 3300025911 Ga0207654_10007906 Ga0207654_100079063 353
503 3300025912 Ga0207707_10003822 Ga0207707_1000382211 353
504 3300025912 Ga0207707_10009552 Ga0207707_100095525 353
505 3300025912 Ga0207707_10020964 Ga0207707_100209642 353
506 3300025912 Ga0207707_10021206 Ga0207707_100212064 353
507 3300025912 Ga0207707_10058198 Ga0207707_100581983 353
508 3300025912 Ga0207707_10176474 Ga0207707_101764742 353
509 3300025913 Ga0207695_10195356 Ga0207695_101953562 353
510 3300025913 Ga0207695_10349768 Ga0207695_103497682 353
511 3300025915 Ga0207693_10001004 Ga0207693_100010043 353
512 3300025917 Ga0207660_10004099 Ga0207660_100040994 353
513 3300025917 Ga0207660_10031454 Ga0207660_100314542 353
514 3300025919 Ga0207657_10021590 Ga0207657_100215903 353
515 3300025921 Ga0207652_10013565 Ga0207652_100135654 353
516 3300025921 Ga0207652_10115852 Ga0207652_101158523 353
517 3300025921 Ga0207652_10162337 Ga0207652_101623371 353
518 3300025923 Ga0207681_10065051 Ga0207681_100650512 353
519 3300025924 Ga0207694_10035053 Ga0207694_100350532 353
520 3300025924 Ga0207694_10217819 Ga0207694_102178192 353
521 3300025925 Ga0207650_10005952 Ga0207650_100059523 353
522 3300025926 Ga0207659_10034027 Ga0207659_100340272 353
523 3300025927 Ga0207687_10012740 Ga0207687_100127403 353
524 3300025927 Ga0207687_10032480 Ga0207687_100324802 353
525 3300025928 Ga0207700_10051509 Ga0207700_100515092 353
526 3300025928 Ga0207700_10060434 Ga0207700_100604342 353
527 3300025929 Ga0207664_10173705 Ga0207664_101737051 353
528 3300025933 Ga0207706_10002137 Ga0207706_1000213720 353
529 3300025933 Ga0207706_10062955 Ga0207706_100629553 353
530 3300025933 Ga0207706_10067135 Ga0207706_100671352 353
531 3300025933 Ga0207706_10175571 Ga0207706_101755712 353
532 3300025935 Ga0207709_10140207 Ga0207709_101402072 353
533 3300025937 Ga0207669_10023481 Ga0207669_100234812 353
534 3300025937 Ga0207669_10130798 Ga0207669_101307982 353
535 3300025940 Ga0207691_10023514 Ga0207691_100235142 353
536 3300025941 Ga0207711_10032173 Ga0207711_100321734 353
537 3300025941 Ga0207711_10053470 Ga0207711_100534702 353
538 3300025942 Ga0207689_10056752 Ga0207689_100567523 353
539 3300025945 Ga0207679_10139161 Ga0207679_101391612 353
540 3300025949 Ga0207667_10260969 Ga0207667_102609692 353
541 3300025960 Ga0207651_10126240 Ga0207651_101262402 353
542 3300025972 Ga0207668_10009228 Ga0207668_100092285 353
543 3300025981 Ga0207640_10131212 Ga0207640_101312121 353
544 3300026023 Ga0207677_10035335 Ga0207677_100353352 353
545 3300026023 Ga0207677_10038119 Ga0207677_100381193 353
546 3300026035 Ga0207703_10040278 Ga0207703_100402783 353
547 3300026035 Ga0207703_10287680 Ga0207703_102876802 353
548 3300026041 Ga0207639_10033257 Ga0207639_100332572 353
549 3300026041 Ga0207639_10064910 Ga0207639_100649102 353
550 3300026041 Ga0207639_10178875 Ga0207639_101788752 353
551 3300026067 Ga0207678_10064794 Ga0207678_100647942 353
552 3300026067 Ga0207678_10081431 Ga0207678_100814313 353
553 3300026075 Ga0207708_10023566 Ga0207708_100235662 353
554 3300026075 Ga0207708_10029438 Ga0207708_100294382 353
555 3300026078 Ga0207702_10001454 Ga0207702_1000145413 353
556 3300026078 Ga0207702_10028517 Ga0207702_100285172 353
557 3300026078 Ga0207702_10066273 Ga0207702_100662733 353
558 3300026088 Ga0207641_10096136 Ga0207641_100961362 353
559 3300026088 Ga0207641_10145892 Ga0207641_101458922 353
560 3300026088 Ga0207641_10288616 Ga0207641_102886162 353
561 3300026089 Ga0207648_10006963 Ga0207648_1000696312 353
562 3300026089 Ga0207648_10081945 Ga0207648_100819453 353
563 3300026089 Ga0207648_10125626 Ga0207648_101256262 353
564 3300026095 Ga0207676_10205477 Ga0207676_102054772 353
565 3300026116 Ga0207674_10033436 Ga0207674_100334363 353
566 3300026116 Ga0207674_10103403 Ga0207674_101034032 353
567 3300026118 Ga0207675_100029070 Ga0207675_1000290704 353
568 3300026118 Ga0207675_100066690 Ga0207675_1000666902 353
569 3300026118 Ga0207675_100074780 Ga0207675_1000747802 353
570 3300026121 Ga0207683_10037347 Ga0207683_100373473 353
571 3300026121 Ga0207683_10229697 Ga0207683_102296972 353
572 3300026142 Ga0207698_10045053 Ga0207698_100450533 353
573 3300026142 Ga0207698_10058938 Ga0207698_100589383 353
574 3300026142 Ga0207698_10175368 Ga0207698_101753682 353
575 3300027296 Ga0209389_1000137 Ga0209389_100013752 353
576 3300027296 Ga0209389_1000353 Ga0209389_100035313 353
577 3300027357 Ga0209589_1000001 Ga0209589_1000001493 353
578 3300027357 Ga0209589_1003439 Ga0209589_100343913 353
579 3300027361 Ga0209489_100001 Ga0209489_100001493 353
580 3300027361 Ga0209489_100192 Ga0209489_10019238 353
581 3300027361 Ga0209489_107326 Ga0209489_1073267 353
582 3300027361 Ga0209489_107331 Ga0209489_1073317 353
583 3300027363 Ga0209700_100001 Ga0209700_100001493 353
584 3300027363 Ga0209700_100046 Ga0209700_10004670 353
585 3300027671 Ga0209588_1022977 Ga0209588_10229772 353
586 3300027866 Ga0209813_10026378 Ga0209813_100263782 353
587 3300027907 Ga0207428_10040681 Ga0207428_100406813 353
588 3300028379 Ga0268266_10017034 Ga0268266_100170344 353
589 3300028379 Ga0268266_10038401 Ga0268266_100384012 353
590 3300028379 Ga0268266_10173691 Ga0268266_101736912 353
591 3300028381 Ga0268264_10000020 Ga0268264_10000020152 353
592 3300028556 Ga0265337_1001859 Ga0265337_10018593 353
593 3300028573 Ga0265334_10014692 Ga0265334_100146923 353
594 3300028573 Ga0265334_10020564 Ga0265334_100205642 353
595 3300031235 Ga0265330_10028028 Ga0265330_100280282 353
596 3300031241 Ga0265325_10020842 Ga0265325_100208423 353
597 3300031247 Ga0265340_10010044 Ga0265340_100100444 353
598 3300031249 Ga0265339_10043509 Ga0265339_100435092 353
599 3300031344 Ga0265316_10027824 Ga0265316_100278244 353
600 3300031456 Ga0307513_10286844 Ga0307513_102868442 353
601 3300031507 Ga0307509_10225551 Ga0307509_102255512 353
602 3300031616 Ga0307508_10000025 Ga0307508_1000002516 353
603 3300031616 Ga0307508_10068027 Ga0307508_100680273 353
604 3300031711 Ga0265314_10090685 Ga0265314_100906852 353
605 3300031730 Ga0307516_10051368 Ga0307516_100513683 353
606 3300031901 Ga0307406_10181609 Ga0307406_101816092 353
607 3300033180 Ga0307510_10024769 Ga0307510_100247696 353
608 3300033180 Ga0307510_10025277 Ga0307510_100252772 353
609 3300033180 Ga0307510_10044327 Ga0307510_100443275 353
610 3300033180 Ga0307510_10217163 Ga0307510_102171632 353
611 3300034957 Ga0373938_0019283 Ga0373938_0019283_45_1139 353
612 3300035083 Ga0373926_0051440 Ga0373926_0051440_368_1459 353
613 3300035089 Ga0373944_0001051 Ga0373944_0001051_1465_2556 353
614 3300035111 Ga0373923_0023726 Ga0373923_0023726_540_1634 353
615 3300035113 Ga0373936_0001079 Ga0373936_0001079_934_2028 353
616 3300035116 Ga0373945_0005317 Ga0373945_0005317_1602_2693 353
617 3300035116 Ga0373945_0011608 Ga0373945_0011608_346_1440 353
618 3300035119 Ga0373956_0012440 Ga0373956_0012440_1143_2237 353
619 3300035121 Ga0373960_0029582 Ga0373960_0029582_14_1105 353
620 3300035170 Ga0373943_0002145 Ga0373943_0002145_4003_5097 353
621 3300035170 Ga0373943_0004407 Ga0373943_0004407_1405_2496 353
622 3300035171 Ga0373946_0003426 Ga0373946_0003426_1351_2442 353
623 3300035172 Ga0373955_0002673 Ga0373955_0002673_1755_2849 353
624 3300035172 Ga0373955_0042203 Ga0373955_0042203_710_1804 353
625 3300035410 Ga0373924_0005844 Ga0373924_0005844_2658_3752 353
626 3300035692 Ga0373935_0000494 Ga0373935_0000494_3869_4963 353
627 3300035692 Ga0373935_0009052 Ga0373935_0009052_3377_4468 353
628 3300035692 Ga0373935_0058438 Ga0373935_0058438_763_1857 353
629 3300035695 Ga0373927_0020261 Ga0373927_0020261_1080_2171 353
630 3300035695 Ga0373927_0024311 Ga0373927_0024311_2711_3805 353
631 3300035695 Ga0373927_0044653 Ga0373927_0044653_576_1670 353
632 3300035695 Ga0373927_0117969 Ga0373927_0117969_237_1331 353
633 3300035725 Ga0373947_0002364 Ga0373947_0002364_8611_9702 353
634 3300036401 Ga0373937_0073556 Ga0373937_0073556_1540_2634 353
635 3300037068 Ga0373925_0007140 Ga0373925_0007140_4779_5873 353
636 3300037068 Ga0373925_0015198 Ga0373925_0015198_385_1476 353
637 3300037068 Ga0373925_0095204 Ga0373925_0095204_896_1990 353
638 3300037312 Ga0395899_0034762 Ga0395899_0034762_446_1540 353
639 3300037312 Ga0395899_0062951 Ga0395899_0062951_254_1348 353
640 3300037418 Ga0395900_0125258 Ga0395900_0125258_431_1525 353
641 3300037471 Ga0395905_0194235 Ga0395905_0194235_226_1314 353
642 3300037471 Ga0395905_0201061 Ga0395905_0201061_152_1240 353
643 3300039437 Ga0436365_0430232 Ga0436365_0430232_185_1276 353
644 3300039437 Ga0436365_1324557 Ga0436365_1324557_34737_35831 353
645 3300039447 Ga0436361_0394185 Ga0436361_0394185_637_1731 353
646 3300039447 Ga0436361_0440592 Ga0436361_0440592_774_1868 353
647 3300039450 Ga0436363_0490106 Ga0436363_0490106_1094_2188 353
648 3300039453 Ga0436362_0153721 Ga0436362_0153721_1614_2708 353
649 3300039453 Ga0436362_1239383 Ga0436362_1239383_2137_3231 353
650 3300044658 Ga0466972_0025155 Ga0466972_0025155_1769_2857 353
651 3300044658 Ga0466972_0026707 Ga0466972_0026707_1383_2471 353
652 3300044901 Ga0466960_0006861 Ga0466960_0006861_955_2043 353
653 3300045049 Ga0466959_0022897 Ga0466959_0022897_3437_4531 353
654 3300045976 Ga0466967_0371644 Ga0466967_0371644_63_1157 353
655 3300046455 Ga0495603_0000237 Ga0495603_0000237_20033_21127 353
656 3300046455 Ga0495603_0023749 Ga0495603_0023749_2182_3279 353
657 3300046455 Ga0495603_0024299 Ga0495603_0024299_1898_2989 353
658 3300046455 Ga0495603_0041049 Ga0495603_0041049_1178_2329 353
659 3300046455 Ga0495603_0083633 Ga0495603_0083633_271_1362 353
660 3300046459 Ga0495629_0000772 Ga0495629_0000772_13072_14166 353
661 3300046459 Ga0495629_0080362 Ga0495629_0080362_1092_2183 353
662 3300046459 Ga0495629_0082958 Ga0495629_0082958_693_1784 353
663 3300046460 Ga0495638_0006370 Ga0495638_0006370_6673_7761 353
664 3300046460 Ga0495638_0065586 Ga0495638_0065586_91_1242 353
665 3300046461 Ga0495641_0004443 Ga0495641_0004443_2558_3652 353
666 3300046461 Ga0495641_0026360 Ga0495641_0026360_487_1578 353
667 3300046462 Ga0495651_0083841 Ga0495651_0083841_82_1170 353
668 3300046472 Ga0495580_0001324 Ga0495580_0001324_16882_17976 353
669 3300046473 Ga0495582_0000209 Ga0495582_0000209_16639_17733 353
670 3300046473 Ga0495582_0150497 Ga0495582_0150497_37_1128 353
671 3300046475 Ga0495639_0000387 Ga0495639_0000387_4523_5617 353
672 3300046476 Ga0495662_0032424 Ga0495662_0032424_166_1260 353
673 3300046477 Ga0495664_0017088 Ga0495664_0017088_1797_2891 353
674 3300046491 Ga0495584_0018353 Ga0495584_0018353_729_1817 353
675 3300046491 Ga0495584_0060574 Ga0495584_0060574_266_1357 353
676 3300046492 Ga0495585_0016853 Ga0495585_0016853_2568_3659 353
677 3300046492 Ga0495585_0019945 Ga0495585_0019945_2494_3585 353
678 3300046492 Ga0495585_0058338 Ga0495585_0058338_1016_2107 353
679 3300046499 Ga0495594_0000342 Ga0495594_0000342_12815_13909 353
680 3300046499 Ga0495594_0021788 Ga0495594_0021788_853_1944 353
681 3300046499 Ga0495594_0041508 Ga0495594_0041508_1072_2163 353
682 3300046499 Ga0495594_0105821 Ga0495594_0105821_206_1297 353
683 3300046507 Ga0495606_0002837 Ga0495606_0002837_15759_16853 353
684 3300046511 Ga0495608_0046562 Ga0495608_0046562_310_1398 353
685 3300046511 Ga0495608_0179133 Ga0495608_0179133_84_1178 353
686 3300046512 Ga0495610_0101648 Ga0495610_0101648_123_1211 353
687 3300046518 Ga0495631_0051843 Ga0495631_0051843_601_1692 353
688 3300046519 Ga0495632_0073286 Ga0495632_0073286_166_1317 353
689 3300046522 Ga0495643_0059039 Ga0495643_0059039_263_1351 353
690 3300046523 Ga0495644_0047893 Ga0495644_0047893_87_1178 353
691 3300046524 Ga0495648_0136493 Ga0495648_0136493_104_1192 353
692 3300046526 Ga0495666_0023449 Ga0495666_0023449_690_1784 353
693 3300046529 Ga0495652_0023755 Ga0495652_0023755_3965_5053 353
694 3300046529 Ga0495652_0210850 Ga0495652_0210850_120_1211 353
695 3300046531 Ga0495665_0000280 Ga0495665_0000280_9758_10852 353
696 3300046533 Ga0495640_0001578 Ga0495640_0001578_6858_7952 353
697 3300046533 Ga0495640_0040303 Ga0495640_0040303_124_1218 353
698 3300046537 Ga0495598_0003599 Ga0495598_0003599_745_1839 353
699 3300046537 Ga0495598_0023647 Ga0495598_0023647_197_1288 353
700 3300046539 Ga0495621_0021100 Ga0495621_0021100_919_2010 353
701 3300046557 Ga0495622_0004573 Ga0495622_0004573_1782_2876 353
702 3300046557 Ga0495622_0028120 Ga0495622_0028120_744_1838 353
703 3300046558 Ga0495633_0062024 Ga0495633_0062024_156_1247 353
704 3300046559 Ga0495667_0097813 Ga0495667_0097813_215_1303 353
705 3300046559 Ga0495667_0107010 Ga0495667_0107010_556_1650 353
706 3300046615 Ga0495656_0001705 Ga0495656_0001705_3332_4423 353
707 3300046615 Ga0495656_0042555 Ga0495656_0042555_638_1729 353
708 3300046615 Ga0495656_0060692 Ga0495656_0060692_72_1160 353
709 3300046616 Ga0495668_0032248 Ga0495668_0032248_717_1808 353
710 3300046642 Ga0495634_0000865 Ga0495634_0000865_14964_16058 353
711 3300046648 Ga0495611_0050962 Ga0495611_0050962_640_1791 353
712 3300046648 Ga0495611_0114522 Ga0495611_0114522_110_1201 353
713 3300046660 Ga0495625_0213974 Ga0495625_0213974_131_1225 353
714 3300046663 Ga0495635_0017357 Ga0495635_0017357_1840_2928 353
715 3300046664 Ga0495659_0005402 Ga0495659_0005402_851_1942 353
716 3300046664 Ga0495659_0049652 Ga0495659_0049652_100_1188 353
717 3300046675 Ga0495657_0011035 Ga0495657_0011035_1132_2220 353
718 3300046678 Ga0495599_0049318 Ga0495599_0049318_1128_2216 353
719 3300046681 Ga0495647_0000763 Ga0495647_0000763_8262_9356 353
720 3300046683 Ga0495658_0012763 Ga0495658_0012763_1592_2683 353
721 3300046683 Ga0495658_0032484 Ga0495658_0032484_1512_2606 353
722 3300046689 Ga0495613_0003086 Ga0495613_0003086_7478_8572 353
723 3300046689 Ga0495613_0056448 Ga0495613_0056448_527_1618 353
724 3300046689 Ga0495613_0220372 Ga0495613_0220372_110_1204 353
725 3300046690 Ga0495624_0001082 Ga0495624_0001082_7960_9054 353
726 3300046690 Ga0495624_0002738 Ga0495624_0002738_3991_5082 353
727 3300046690 Ga0495624_0070964 Ga0495624_0070964_427_1518 353
728 3300046794 Ga0495589_0019693 Ga0495589_0019693_1001_2092 353
729 3300046809 Ga0495600_0001516 Ga0495600_0001516_961_2049 353
730 3300047315 Ga0495581_0022904 Ga0495581_0022904_1718_2812 353
731 3300047317 Ga0495604_0012450 Ga0495604_0012450_5284_6372 353
732 3300047317 Ga0495604_0103260 Ga0495604_0103260_828_1922 353
733 3300047317 Ga0495604_0115558 Ga0495604_0115558_465_1556 353
734 3300047318 Ga0495636_0031639 Ga0495636_0031639_957_2051 353
735 3300047318 Ga0495636_0096907 Ga0495636_0096907_96_1190 353
736 3300047319 Ga0495674_0004372 Ga0495674_0004372_6408_7502 353
737 3300047321 Ga0495676_0009743 Ga0495676_0009743_1070_2164 353
738 3300047321 Ga0495676_0018074 Ga0495676_0018074_3110_4261 353
739 3300047321 Ga0495676_0104647 Ga0495676_0104647_326_1417 353
740 3300047322 Ga0495680_0058874 Ga0495680_0058874_646_1734 353
741 3300047322 Ga0495680_0157250 Ga0495680_0157250_66_1160 353
742 3300047443 Ga0495687_011591 Ga0495687_011591_27_1115 353
743 3300047444 Ga0495675_0111997 Ga0495675_0111997_221_1309 353
744 3300047469 Ga0495673_0003053 Ga0495673_0003053_2949_4043 353
745 3300047471 Ga0495684_0125066 Ga0495684_0125066_499_1590 353
746 3300047472 Ga0495686_0052830 Ga0495686_0052830_1280_2368 353
747 3300047472 Ga0495686_0071631 Ga0495686_0071631_303_1394 353
748 3300047673 Ga0495593_0000238 Ga0495593_0000238_12964_14058 353
749 3300047673 Ga0495593_0071101 Ga0495593_0071101_316_1407 353
750 3300048088 Ga0495602_0031146 Ga0495602_0031146_102_1190 353
751 3300048903 Ga0496100_0084672 Ga0496100_0084672_623_1714 353
752 3300048903 Ga0496100_0153102 Ga0496100_0153102_155_1246 353
753 3300048903 Ga0496100_0183003 Ga0496100_0183003_240_1334 353
754 3300048904 Ga0496101_0018685 Ga0496101_0018685_2724_3818 353
755 3300048904 Ga0496101_0036513 Ga0496101_0036513_2375_3469 353
756 3300048904 Ga0496101_0103084 Ga0496101_0103084_376_1464 353
757 3300048904 Ga0496101_0103753 Ga0496101_0103753_580_1671 353
758 3300048904 Ga0496101_0163331 Ga0496101_0163331_45_1136 353
759 3300048905 Ga0496102_0001874 Ga0496102_0001874_11476_12564 353
760 3300048905 Ga0496102_0007483 Ga0496102_0007483_3291_4382 353
761 3300048905 Ga0496102_0126920 Ga0496102_0126920_221_1315 353
762 3300048905 Ga0496102_0192820 Ga0496102_0192820_236_1327 353
763 3300048905 Ga0496102_0282168 Ga0496102_0282168_434_1525 353
764 3300048905 Ga0496102_0394904 Ga0496102_0394904_191_1279 353
765 3300048906 Ga0496103_0002168 Ga0496103_0002168_516_1604 353
766 3300048906 Ga0496103_0004621 Ga0496103_0004621_1772_2863 353
767 3300048906 Ga0496103_0122197 Ga0496103_0122197_354_1448 353
768 3300048906 Ga0496103_0132742 Ga0496103_0132742_83_1174 353
769 3300048907 Ga0496104_0000411 Ga0496104_0000411_17858_18964 353
770 3300048907 Ga0496104_0000594 Ga0496104_0000594_27191_28285 353
771 3300048907 Ga0496104_0020184 Ga0496104_0020184_3136_4227 353
772 3300048907 Ga0496104_0022321 Ga0496104_0022321_628_1716 353
773 3300048907 Ga0496104_0084202 Ga0496104_0084202_1393_2484 353
774 3300048907 Ga0496104_0118822 Ga0496104_0118822_1036_2130 353
775 3300048908 Ga0496105_0005229 Ga0496105_0005229_5993_7084 353
776 3300048908 Ga0496105_0181428 Ga0496105_0181428_334_1425 353
777 3300048908 Ga0496105_0228308 Ga0496105_0228308_187_1281 353
778 3300048909 Ga0496106_0008194 Ga0496106_0008194_4946_6040 353
779 3300048909 Ga0496106_0026256 Ga0496106_0026256_2370_3461 353
780 3300048909 Ga0496106_0041334 Ga0496106_0041334_73_1164 353
781 3300048909 Ga0496106_0061499 Ga0496106_0061499_669_1760 353
782 3300048909 Ga0496106_0097128 Ga0496106_0097128_318_1409 353
783 3300048910 Ga0496107_0043909 Ga0496107_0043909_2001_3092 353
784 3300048910 Ga0496107_0195249 Ga0496107_0195249_65_1156 353
785 3300048911 Ga0496108_0000244 Ga0496108_0000244_31317_32408 353
786 3300048911 Ga0496108_0013227 Ga0496108_0013227_860_1954 353
787 3300048911 Ga0496108_0038758 Ga0496108_0038758_2145_3236 353
788 3300048911 Ga0496108_0109145 Ga0496108_0109145_449_1543 353
789 3300048911 Ga0496108_0123258 Ga0496108_0123258_1103_2197 353
790 3300048911 Ga0496108_0191020 Ga0496108_0191020_154_1263 353
791 3300048912 Ga0496109_0002677 Ga0496109_0002677_6099_7190 353
792 3300048912 Ga0496109_0047462 Ga0496109_0047462_2611_3702 353
793 3300048912 Ga0496109_0075355 Ga0496109_0075355_1332_2423 353
794 3300048912 Ga0496109_0133662 Ga0496109_0133662_292_1383 353
795 3300048912 Ga0496109_0323262 Ga0496109_0323262_56_1165 353
796 3300048913 Ga0496110_0021529 Ga0496110_0021529_2329_3423 353
797 3300048913 Ga0496110_0059222 Ga0496110_0059222_196_1290 353
798 3300048913 Ga0496110_0082180 Ga0496110_0082180_32_1123 353
799 3300048913 Ga0496110_0102035 Ga0496110_0102035_1251_2342 353
800 3300048913 Ga0496110_0111312 Ga0496110_0111312_372_1463 353
801 3300048913 Ga0496110_0180931 Ga0496110_0180931_492_1583 353
802 3300048914 Ga0496111_0000320 Ga0496111_0000320_13227_14318 353
803 3300048914 Ga0496111_0035990 Ga0496111_0035990_188_1279 353
804 3300048914 Ga0496111_0076159 Ga0496111_0076159_57_1145 353
805 3300048914 Ga0496111_0315801 Ga0496111_0315801_13_1107 353
806 3300048915 Ga0496112_0015510 Ga0496112_0015510_4275_5366 353
807 3300048915 Ga0496112_0029058 Ga0496112_0029058_1759_2853 353
808 3300048915 Ga0496112_0043753 Ga0496112_0043753_585_1679 353
809 3300048915 Ga0496112_0142350 Ga0496112_0142350_1036_2130 353
810 3300048915 Ga0496112_0244245 Ga0496112_0244245_253_1344 353
811 3300048915 Ga0496112_0368481 Ga0496112_0368481_208_1299 353
812 3300048916 Ga0496113_0003916 Ga0496113_0003916_6187_7278 353
813 3300048917 Ga0496114_0032861 Ga0496114_0032861_1923_3014 353
814 3300048917 Ga0496114_0073413 Ga0496114_0073413_1432_2523 353
815 3300048917 Ga0496114_0266892 Ga0496114_0266892_208_1296 353
816 3300048918 Ga0496115_0007927 Ga0496115_0007927_1805_2899 353
817 3300048918 Ga0496115_0015981 Ga0496115_0015981_3435_4526 353
818 3300048918 Ga0496115_0036848 Ga0496115_0036848_1030_2124 353
819 3300048918 Ga0496115_0039572 Ga0496115_0039572_230_1321 353
820 3300048918 Ga0496115_0047535 Ga0496115_0047535_625_1716 353
821 3300048918 Ga0496115_0051539 Ga0496115_0051539_1564_2730 353
822 3300048918 Ga0496115_0215288 Ga0496115_0215288_448_1542 353
823 3300048919 Ga0496116_0017384 Ga0496116_0017384_2059_3147 353
824 3300048919 Ga0496116_0037607 Ga0496116_0037607_215_1303 353
825 3300048919 Ga0496116_0098756 Ga0496116_0098756_359_1453 353
826 3300048920 Ga0496117_0056104 Ga0496117_0056104_451_1545 353
827 3300048921 Ga0496118_0012281 Ga0496118_0012281_3914_5008 353
828 3300048921 Ga0496118_0035772 Ga0496118_0035772_1591_2685 353
829 3300048921 Ga0496118_0050582 Ga0496118_0050582_444_1538 353
830 3300048921 Ga0496118_0106816 Ga0496118_0106816_628_1716 353
831 3300048923 Ga0496120_0019887 Ga0496120_0019887_165_1253 353
832 3300048924 Ga0496121_0001375 Ga0496121_0001375_28799_29893 353
833 3300048924 Ga0496121_0028079 Ga0496121_0028079_1501_2595 353
834 3300048924 Ga0496121_0044552 Ga0496121_0044552_2686_3780 353
835 3300048924 Ga0496121_0057700 Ga0496121_0057700_1983_3077 353
836 3300048924 Ga0496121_0105676 Ga0496121_0105676_1021_2115 353
837 3300048924 Ga0496121_0118335 Ga0496121_0118335_764_1852 353
838 3300048924 Ga0496121_0121076 Ga0496121_0121076_279_1373 353
839 3300048924 Ga0496121_0148293 Ga0496121_0148293_365_1453 353
840 3300048924 Ga0496121_0148733 Ga0496121_0148733_60_1151 353
841 3300048924 Ga0496121_0150329 Ga0496121_0150329_473_1561 353
842 3300048927 Ga0496124_0021977 Ga0496124_0021977_1815_2909 353
843 3300048927 Ga0496124_0141364 Ga0496124_0141364_435_1526 353
844 3300048927 Ga0496124_0189544 Ga0496124_0189544_202_1290 353
845 3300048928 Ga0496125_0000202 Ga0496125_0000202_10508_11602 353
846 3300048928 Ga0496125_0000810 Ga0496125_0000810_16435_17526 353
847 3300048928 Ga0496125_0001999 Ga0496125_0001999_22673_23767 353
848 3300048928 Ga0496125_0015391 Ga0496125_0015391_547_1635 353
849 3300048928 Ga0496125_0040960 Ga0496125_0040960_1922_3016 353
850 3300048928 Ga0496125_0202362 Ga0496125_0202362_118_1206 353
851 3300048929 Ga0496126_0002650 Ga0496126_0002650_3634_4725 353
852 3300048929 Ga0496126_0017938 Ga0496126_0017938_5265_6359 353
853 3300048929 Ga0496126_0022992 Ga0496126_0022992_4898_5992 353
854 3300048929 Ga0496126_0036078 Ga0496126_0036078_3395_4489 353
855 3300048929 Ga0496126_0102054 Ga0496126_0102054_942_2036 353
856 3300048929 Ga0496126_0162275 Ga0496126_0162275_399_1487 353
857 3300048929 Ga0496126_0249038 Ga0496126_0249038_292_1380 353
858 3300048929 Ga0496126_0254762 Ga0496126_0254762_177_1271 353
859 3300049568 Ga0501031_0002641 Ga0501031_0002641_5530_6621 353
860 3300049569 Ga0501032_0000257 Ga0501032_0000257_22492_23709 353
861 3300049569 Ga0501032_0002207 Ga0501032_0002207_9625_10716 353
862 3300049570 Ga0501033_0000124 Ga0501033_0000124_4649_5740 353
863 3300049570 Ga0501033_0000244 Ga0501033_0000244_6728_7945 353
864 3300049571 Ga0501034_0000159 Ga0501034_0000159_44287_45504 353
865 3300049571 Ga0501034_0019549 Ga0501034_0019549_4331_5422 353
866 3300049571 Ga0501034_0358363 Ga0501034_0358363_221_1312 353
867 3300049572 Ga0501036_0000039 Ga0501036_0000039_45320_46537 353
868 3300049572 Ga0501036_0000104 Ga0501036_0000104_46918_48009 353
869 3300049573 Ga0501037_0000247 Ga0501037_0000247_6328_7419 353
870 3300049573 Ga0501037_0001386 Ga0501037_0001386_10070_11287 353
871 3300049574 Ga0501038_0000041 Ga0501038_0000041_68328_69419 353
872 3300049574 Ga0501038_0000207 Ga0501038_0000207_17630_18847 353
873 3300049575 Ga0501039_0000064 Ga0501039_0000064_12402_13493 353
874 3300049575 Ga0501039_0000148 Ga0501039_0000148_20908_22125 353
875 3300049576 Ga0501040_0117404 Ga0501040_0117404_177_1268 353
876 3300049578 Ga0501042_0036793 Ga0501042_0036793_2226_3443 353
877 3300049579 Ga0501043_0000202 Ga0501043_0000202_41268_42485 353
878 3300049579 Ga0501043_0014806 Ga0501043_0014806_4161_5252 353
879 3300049579 Ga0501043_0035649 Ga0501043_0035649_2024_3127 353
880 3300049580 Ga0501046_0000185 Ga0501046_0000185_15770_16987 353
881 3300049580 Ga0501046_0080151 Ga0501046_0080151_1400_2491 353
882 3300049581 Ga0501047_0000385 Ga0501047_0000385_4132_5349 353
883 3300049581 Ga0501047_0000392 Ga0501047_0000392_35695_36786 353
884 3300049581 Ga0501047_0002801 Ga0501047_0002801_9818_10912 353
885 3300049581 Ga0501047_0065193 Ga0501047_0065193_1014_2117 353
886 3300049582 Ga0501048_0000536 Ga0501048_0000536_11653_12870 353
887 3300049582 Ga0501048_0009128 Ga0501048_0009128_2045_3136 353
888 3300049583 Ga0501067_0010006 Ga0501067_0010006_1919_3136 353
889 3300049583 Ga0501067_0057206 Ga0501067_0057206_405_1496 353
890 3300049583 Ga0501067_0109325 Ga0501067_0109325_420_1511 353
891 3300049584 Ga0501068_0002219 Ga0501068_0002219_7985_9202 353
892 3300049584 Ga0501068_0024106 Ga0501068_0024106_976_2067 353
893 3300049585 Ga0501069_0006636 Ga0501069_0006636_2726_3943 353
894 3300049585 Ga0501069_0015986 Ga0501069_0015986_1925_3016 353
895 3300049585 Ga0501069_0175977 Ga0501069_0175977_43_1137 353
896 3300049586 Ga0501070_0000175 Ga0501070_0000175_6312_7403 353
897 3300049586 Ga0501070_0000557 Ga0501070_0000557_20715_21932 353
898 3300049586 Ga0501070_0003774 Ga0501070_0003774_8717_9811 353
899 3300049588 Ga0501072_0001033 Ga0501072_0001033_2819_4036 353
900 3300049588 Ga0501072_0147728 Ga0501072_0147728_83_1174 353
901 3300049589 Ga0501073_0000034 Ga0501073_0000034_81683_82900 353
902 3300049590 Ga0501074_0000271 Ga0501074_0000271_23583_24800 353
903 3300049590 Ga0501074_0002163 Ga0501074_0002163_8810_9904 353
904 3300049590 Ga0501074_0005773 Ga0501074_0005773_7759_8850 353
905 3300049591 Ga0501075_0123271 Ga0501075_0123271_480_1571 353
906 3300049592 Ga0501076_0223454 Ga0501076_0223454_111_1202 353
907 3300049593 Ga0501077_0025710 Ga0501077_0025710_2258_3349 353
908 3300049593 Ga0501077_0131182 Ga0501077_0131182_273_1490 353
909 3300049741 Ga0501079_0000773 Ga0501079_0000773_8076_9293 353
910 3300049742 Ga0501080_0001103 Ga0501080_0001103_9441_10658 353
911 3300049742 Ga0501080_0005894 Ga0501080_0005894_1933_3027 353
912 3300049742 Ga0501080_0013998 Ga0501080_0013998_5462_6553 353
913 3300049743 Ga0501081_0081936 Ga0501081_0081936_812_1903 353
914 3300049743 Ga0501081_0111849 Ga0501081_0111849_559_1656 353
915 3300049744 Ga0501083_0000118 Ga0501083_0000118_28563_29780 353
916 3300049744 Ga0501083_0098174 Ga0501083_0098174_341_1432 353
917 3300049822 Ga0501035_0000137 Ga0501035_0000137_11953_13170 353
918 3300049822 Ga0501035_0000155 Ga0501035_0000155_49538_50629 353
919 3300049823 Ga0501044_0000548 Ga0501044_0000548_40312_41529 353
920 3300049823 Ga0501044_0011998 Ga0501044_0011998_5034_6128 353
921 3300049823 Ga0501044_0052450 Ga0501044_0052450_203_1294 353
922 3300049823 Ga0501044_0069453 Ga0501044_0069453_744_1847 353
923 3300049823 Ga0501044_0085375 Ga0501044_0085375_786_1889 353
924 3300049823 Ga0501044_0135826 Ga0501044_0135826_1252_2343 353
925 3300049823 Ga0501044_0296542 Ga0501044_0296542_156_1247 353
926 3300049823 Ga0501044_0378718 Ga0501044_0378718_76_1167 353
927 3300049824 Ga0501045_0008590 Ga0501045_0008590_2232_3449 353
928 3300050491 nmdc:mga00v17_246567_c1 nmdc:mga00v17_246567_c1_16_1107 353
929 3300050492 nmdc:mga0yw44_17052_c1 nmdc:mga0yw44_17052_c1_2610_3698 353
930 3300050492 nmdc:mga0yw44_2009_c1 nmdc:mga0yw44_2009_c1_3486_4574 353
931 3300050492 nmdc:mga0yw44_3972_c1 nmdc:mga0yw44_3972_c1_3628_4719 353
932 3300050492 nmdc:mga0yw44_723_c1 nmdc:mga0yw44_723_c1_169_1257 353
933 3300050492 nmdc:mga0yw44_88345_c1 nmdc:mga0yw44_88345_c1_500_1591 353
934 3300050494 nmdc:mga06z11_105179_c1 nmdc:mga06z11_105179_c1_182_1273 353
935 3300050494 nmdc:mga06z11_6417_c1 nmdc:mga06z11_6417_c1_1748_2839 353
936 3300050494 nmdc:mga06z11_85891_c1 nmdc:mga06z11_85891_c1_104_1207 353
937 3300050494 nmdc:mga06z11_87259_c1 nmdc:mga06z11_87259_c1_32_1120 353
938 3300050496 nmdc:mga07m45_64802_c1 nmdc:mga07m45_64802_c1_213_1301 353
939 3300050507 nmdc:mga05p37_112345_c1 nmdc:mga05p37_112345_c1_2055_3143 353
940 3300050507 nmdc:mga05p37_1642_c1 nmdc:mga05p37_1642_c1_2260_3354 353
941 3300050507 nmdc:mga05p37_220291_c1 nmdc:mga05p37_220291_c1_98_1189 353
942 3300050507 nmdc:mga05p37_23035_c1 nmdc:mga05p37_23035_c1_4163_5254 353
943 3300050507 nmdc:mga05p37_292224_c1 nmdc:mga05p37_292224_c1_110_1201 353
944 3300050508 nmdc:mga09592_104844_c1 nmdc:mga09592_104844_c1_988_2079 353
945 3300050508 nmdc:mga09592_8031_c1 nmdc:mga09592_8031_c1_6727_7821 353
946 3300050509 nmdc:mga0qj67_34763_c1 nmdc:mga0qj67_34763_c1_1966_3057 353
947 3300050509 nmdc:mga0qj67_43218_c1 nmdc:mga0qj67_43218_c1_2362_3453 353
948 3300050510 nmdc:mga06r32_130304_c1 nmdc:mga06r32_130304_c1_416_1507 353
949 3300050510 nmdc:mga06r32_189436_c2 nmdc:mga06r32_189436_c2_262_1353 353
950 3300050510 nmdc:mga06r32_33939_c1 nmdc:mga06r32_33939_c1_1852_2943 353
951 3300050510 nmdc:mga06r32_349_c1 nmdc:mga06r32_349_c1_11989_13083 353
952 3300050511 nmdc:mga08y16_136680_c1 nmdc:mga08y16_136680_c1_685_1776 353
953 3300050511 nmdc:mga08y16_166391_c1 nmdc:mga08y16_166391_c1_120_1211 353
954 3300050511 nmdc:mga08y16_418694_c1 nmdc:mga08y16_418694_c1_216_1307 353
955 3300050511 nmdc:mga08y16_4843_c1 nmdc:mga08y16_4843_c1_367_1461 353
956 3300050512 nmdc:mga0n895_195013_c1 nmdc:mga0n895_195013_c1_291_1382 353
957 3300050512 nmdc:mga0n895_34790_c1 nmdc:mga0n895_34790_c1_1205_2299 353
958 3300050512 nmdc:mga0n895_6898_c1 nmdc:mga0n895_6898_c1_1313_2404 353
959 3300050513 nmdc:mga0rr50_95825_c1 nmdc:mga0rr50_95825_c1_78_1172 353
960 3300050514 nmdc:mga08x19_22091_c2 nmdc:mga08x19_22091_c2_728_1822 353
961 3300050515 nmdc:mga0a205_2525_c1 nmdc:mga0a205_2525_c1_5414_6505 353
962 3300053080 Ga0500635_0005633 Ga0500635_0005633_597_1694 353
963 3300053080 Ga0500635_0013826 Ga0500635_0013826_1178_2272 353
964 3300053085 Ga0495619_0099938 Ga0495619_0099938_337_1428 353
965 3300053085 Ga0495619_0181116 Ga0495619_0181116_310_1398 353
966 3300053086 Ga0500578_0058889 Ga0500578_0058889_328_1416 353
967 3300053087 Ga0500643_000037 Ga0500643_000037_110804_111892 353
968 3300053092 Ga0500583_0035983 Ga0500583_0035983_756_1907 353
969 3300053093 Ga0500651_0001199 Ga0500651_0001199_10090_11184 353
970 3300053094 Ga0500566_0000166 Ga0500566_0000166_12726_13814 353
971 3300053096 Ga0500641_0015896 Ga0500641_0015896_297_1388 353
972 3300053102 Ga0500554_000266 Ga0500554_000266_2418_3515 353
973 3300053103 Ga0500555_000550 Ga0500555_000550_4580_5668 353
974 3300053117 Ga0500593_009372 Ga0500593_009372_1574_2665 353
975 3300053119 Ga0500595_001516 Ga0500595_001516_9083_10177 353
976 3300053119 Ga0500595_003730 Ga0500595_003730_1654_2745 353
977 3300053119 Ga0500595_012019 Ga0500595_012019_1674_2762 353
978 3300053134 Ga0500658_0018285 Ga0500658_0018285_1149_2240 353
979 3300053139 Ga0500568_0005713 Ga0500568_0005713_3367_4455 353
980 3300053150 Ga0500603_000324 Ga0500603_000324_8794_9891 353
981 3300053153 Ga0500616_0019257 Ga0500616_0019257_1260_2348 353
982 3300053156 Ga0500622_0001752 Ga0500622_0001752_6187_7275 353
983 3300053177 Ga0500636_0004341 Ga0500636_0004341_6727_7815 353
984 3300053178 Ga0500637_0000582 Ga0500637_0000582_6611_7708 353
985 3300053735 Ga0500596_002967 Ga0500596_002967_799_1893 353
986 3300053736 Ga0500599_004061 Ga0500599_004061_198_1286 353
987 3300053737 Ga0500601_000014 Ga0500601_000014_29478_30566 353
988 3300054114 Ga0501084_0093192 Ga0501084_0093192_751_1842 353
989 3300055283 Ga0500661_004660 Ga0500661_004660_1388_2476 353
990 iso_pu_bacteria 8006964411 8006968546 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02317

Octopine_DH

NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain

226

365

0.9

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

46

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jrx-assembly2.cif.gz_B crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina 0.979 2 31
1kdg-assembly1.cif.gz_B crystal structure of the flavin domain of cellobiose dehydrogenase 0.9733 2 31
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9681 3 31
1ksu-assembly1.cif.gz_A crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina 0.9677 2 32
1e39-assembly1.cif.gz_A flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine 0.9639 2 32
ID Description Score Start End Superfamily
af_P37906_24_389_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9787 2 32 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9642 2 32 3.50.50.60
3ka7A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9575 2 33 3.50.50.60
5j60C01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9558 2 32 3.50.50.60
2gqfA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9509 2 31 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A317HWC7-F1-model_v4 deleted 0.9951 1 84
AF-A0A810CYI3-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.988 1 352 GO:0016616
GO:0046168
GO:0051287
AF-A0A810CYI3-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9852 1 352 GO:0016616
GO:0046168
GO:0051287
AF-A0A1X3GPC7-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9825 49 352 GO:0016491
AF-A0A317HWC7-F1-model_v4 deleted 0.9721 1 84

Feature Viewer

pLDDT pTM Quality
93.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map