F487598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 440 | 972 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10013618|JGI25153J46596_100136182 |
| Length | 398 |
| Sequence | VAGKEXQGRTGLTQAXCATSPAGIACALGTHRAEPVGNKAXDILKIAVLGGGNGSFAAAGDLSLAGHEVRLWRRNPADVEAHRAAGGTITVIDRSGRREVRLAAITSSIAEALDAADLVLCPAPAFAQPAIAELAAPHLRDGQVVFLPPGTFGSYIFAYAARSAGNRAEIATAETGTLPWLARKQGPYVVRISGRGARLPTGVFPSRLARHALGVIERAFPNAIEPCGDALSGALMNAGPIIHPPLITFDKWDIHKEGTQPAIRRVTDALDAERMAIREALGYGAPHFPLADHYSKDGEPWMYARDAHDELTESGDWSERLILVEHRYMLEDLRLGLSFLASVAGLAGVQTPLVKAFLAIGSAITGEDFAVKGRTLASLGLGGFDRTELQNHLAEGFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 5 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 6 | 2791355199 | |||
| 7 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 8 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 9 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 10 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 11 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 12 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 13 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 14 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 116 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 117 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 118 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 340 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 341 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 342 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 343 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 344 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 345 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 346 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 400 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 401 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 406 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 409 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 412 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 414 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 415 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 419 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 422 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 426 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 431 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 436 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 437 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 438 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 439 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 440 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.42 |
| Nodule | 2.93 |
| Rhizoplane | 7.68 |
| Rhizosphere | 70.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1002599 | 3300003214 | Bacteria | 5498 |
| 2 | JGI25153J46596_10000110 | 3300003215 | Bacteria | 93591 |
| 3 | JGI25153J46596_10000161 | 3300003215 | Bacteria | 67388 |
| 4 | JGI25153J46596_10000354 | 3300003215 | Bacteria | 31788 |
| 5 | JGI25153J46596_10013618 | 3300003215 | Bacteria | 3426 |
| 6 | JGI25160J50197_1001256 | 3300003354 | Bacteria | 12850 |
| 7 | JGI25160J50197_1002809 | 3300003354 | Bacteria | 7972 |
| 8 | JGI25160J50197_1015732 | 3300003354 | Bacteria | 2470 |
| 9 | JGI25404J52841_10002388 | 3300003659 | Bacteria | 3542 |
| 10 | Ga0055539_1005461 | 3300003752 | Bacteria | 1652 |
| 11 | Ga0065165_1000368 | 3300005262 | Bacteria | 73904 |
| 12 | Ga0065165_1008246 | 3300005262 | Bacteria | 4924 |
| 13 | Ga0065165_1009309 | 3300005262 | Bacteria | 4422 |
| 14 | Ga0070658_10003236 | 3300005327 | Bacteria | 13450 |
| 15 | Ga0070658_10010916 | 3300005327 | Bacteria | 7281 |
| 16 | Ga0070658_10175543 | 3300005327 | Bacteria | 1801 |
| 17 | Ga0070683_100001547 | 3300005329 | Bacteria | 17802 |
| 18 | Ga0070683_100044771 | 3300005329 | Bacteria | 4082 |
| 19 | Ga0070683_100302038 | 3300005329 | Bacteria | 1523 |
| 20 | Ga0070690_100013882 | 3300005330 | Bacteria | 4774 |
| 21 | Ga0070670_100045187 | 3300005331 | Bacteria | 3786 |
| 22 | Ga0070670_100279834 | 3300005331 | Bacteria | 1457 |
| 23 | Ga0070680_100010261 | 3300005336 | Bacteria | 7219 |
| 24 | Ga0070680_100179916 | 3300005336 | Bacteria | 1781 |
| 25 | Ga0070680_100218955 | 3300005336 | Bacteria | 1606 |
| 26 | Ga0070680_100238242 | 3300005336 | Bacteria | 1538 |
| 27 | Ga0070689_100109763 | 3300005340 | Bacteria | 2193 |
| 28 | Ga0070691_10017992 | 3300005341 | Bacteria | 3254 |
| 29 | Ga0070691_10020416 | 3300005341 | Bacteria | 3061 |
| 30 | Ga0070691_10071355 | 3300005341 | Bacteria | 1686 |
| 31 | Ga0070668_100181295 | 3300005347 | Bacteria | 1720 |
| 32 | Ga0070669_100033660 | 3300005353 | Bacteria | 3708 |
| 33 | Ga0070671_100014431 | 3300005355 | Bacteria | 6384 |
| 34 | Ga0070671_100034516 | 3300005355 | Bacteria | 4187 |
| 35 | Ga0070671_100294355 | 3300005355 | Bacteria | 1382 |
| 36 | Ga0070673_100115785 | 3300005364 | Bacteria | 2229 |
| 37 | Ga0070688_100078136 | 3300005365 | Bacteria | 2134 |
| 38 | Ga0070709_10003278 | 3300005434 | Bacteria | 8702 |
| 39 | Ga0070714_100041919 | 3300005435 | Bacteria | 3865 |
| 40 | Ga0070714_100044131 | 3300005435 | Bacteria | 3773 |
| 41 | Ga0070714_100085282 | 3300005435 | Bacteria | 2758 |
| 42 | Ga0070714_100356821 | 3300005435 | Bacteria | 1374 |
| 43 | Ga0070713_100034739 | 3300005436 | Bacteria | 4054 |
| 44 | Ga0070713_100051119 | 3300005436 | Bacteria | 3418 |
| 45 | Ga0070713_100094168 | 3300005436 | Bacteria | 2582 |
| 46 | Ga0070713_100312394 | 3300005436 | Bacteria | 1450 |
| 47 | Ga0070710_10000965 | 3300005437 | Bacteria | 13640 |
| 48 | Ga0070710_10074086 | 3300005437 | Bacteria | 1970 |
| 49 | Ga0070711_100026368 | 3300005439 | Bacteria | 3808 |
| 50 | Ga0070711_100056653 | 3300005439 | Bacteria | 2711 |
| 51 | Ga0070711_100080806 | 3300005439 | Bacteria | 2315 |
| 52 | Ga0070700_100044720 | 3300005441 | Bacteria | 2729 |
| 53 | Ga0070694_100037235 | 3300005444 | Bacteria | 3226 |
| 54 | Ga0070663_100044284 | 3300005455 | Bacteria | 3136 |
| 55 | Ga0070663_100054431 | 3300005455 | Bacteria | 2860 |
| 56 | Ga0070663_100072815 | 3300005455 | Bacteria | 2504 |
| 57 | Ga0070678_100041599 | 3300005456 | Bacteria | 3259 |
| 58 | Ga0070662_100079404 | 3300005457 | Bacteria | 2440 |
| 59 | Ga0070681_10000175 | 3300005458 | Bacteria | 48999 |
| 60 | Ga0070681_10006255 | 3300005458 | Bacteria | 11581 |
| 61 | Ga0070681_10016774 | 3300005458 | Bacteria | 7312 |
| 62 | Ga0070681_10098798 | 3300005458 | Bacteria | 2865 |
| 63 | Ga0070698_100036085 | 3300005471 | Bacteria | 5110 |
| 64 | Ga0070698_100088787 | 3300005471 | Bacteria | 3076 |
| 65 | Ga0070679_100004326 | 3300005530 | Bacteria | 13112 |
| 66 | Ga0070679_100014878 | 3300005530 | Bacteria | 7475 |
| 67 | Ga0070679_100038377 | 3300005530 | Bacteria | 4761 |
| 68 | Ga0070679_100050863 | 3300005530 | Bacteria | 4128 |
| 69 | Ga0070679_100066082 | 3300005530 | Bacteria | 3605 |
| 70 | Ga0070679_100247687 | 3300005530 | Bacteria | 1738 |
| 71 | Ga0070684_100003962 | 3300005535 | Bacteria | 11212 |
| 72 | Ga0070684_100006353 | 3300005535 | Bacteria | 9134 |
| 73 | Ga0070684_100014195 | 3300005535 | Bacteria | 6444 |
| 74 | Ga0070684_100041821 | 3300005535 | Bacteria | 3953 |
| 75 | Ga0068853_100016336 | 3300005539 | Bacteria | 6107 |
| 76 | Ga0068853_100047840 | 3300005539 | Bacteria | 3671 |
| 77 | Ga0068853_100125945 | 3300005539 | Bacteria | 2288 |
| 78 | Ga0068853_100210295 | 3300005539 | Bacteria | 1773 |
| 79 | Ga0070672_100059922 | 3300005543 | Bacteria | 2996 |
| 80 | Ga0070695_100001092 | 3300005545 | Bacteria | 14841 |
| 81 | Ga0070696_100061847 | 3300005546 | Bacteria | 2620 |
| 82 | Ga0070665_100018220 | 3300005548 | Bacteria | 7043 |
| 83 | Ga0070665_100020007 | 3300005548 | Bacteria | 6721 |
| 84 | Ga0070665_100101330 | 3300005548 | Bacteria | 2883 |
| 85 | Ga0070665_100136357 | 3300005548 | Bacteria | 2457 |
| 86 | Ga0070665_100227680 | 3300005548 | Bacteria | 1864 |
| 87 | Ga0070665_100385969 | 3300005548 | Bacteria | 1408 |
| 88 | Ga0068855_100026681 | 3300005563 | Bacteria | 6911 |
| 89 | Ga0068855_100035664 | 3300005563 | Bacteria | 5923 |
| 90 | Ga0068855_100062155 | 3300005563 | Bacteria | 4361 |
| 91 | Ga0070664_100131375 | 3300005564 | Bacteria | 2199 |
| 92 | Ga0068857_100085563 | 3300005577 | Bacteria | 2818 |
| 93 | Ga0068857_100141905 | 3300005577 | Bacteria | 2171 |
| 94 | Ga0068857_100311968 | 3300005577 | Bacteria | 1451 |
| 95 | Ga0068856_100000147 | 3300005614 | Bacteria | 71694 |
| 96 | Ga0068856_100033270 | 3300005614 | Bacteria | 5047 |
| 97 | Ga0068856_100083507 | 3300005614 | Bacteria | 3172 |
| 98 | Ga0068856_100148417 | 3300005614 | Bacteria | 2353 |
| 99 | Ga0068856_100200723 | 3300005614 | Bacteria | 2009 |
| 100 | Ga0068852_100008740 | 3300005616 | Bacteria | 7488 |
| 101 | Ga0068852_100054771 | 3300005616 | Bacteria | 3439 |
| 102 | Ga0068852_100091652 | 3300005616 | Bacteria | 2720 |
| 103 | Ga0068852_100340479 | 3300005616 | Bacteria | 1462 |
| 104 | Ga0068859_100378074 | 3300005617 | Bacteria | 1512 |
| 105 | Ga0068864_100011985 | 3300005618 | Bacteria | 7159 |
| 106 | Ga0068864_100172453 | 3300005618 | Bacteria | 1973 |
| 107 | Ga0068863_100112064 | 3300005841 | Bacteria | 2598 |
| 108 | Ga0068863_100122013 | 3300005841 | Bacteria | 2486 |
| 109 | Ga0068858_100037736 | 3300005842 | Bacteria | 4481 |
| 110 | Ga0068858_100304893 | 3300005842 | Bacteria | 1520 |
| 111 | Ga0068858_100400582 | 3300005842 | Bacteria | 1319 |
| 112 | Ga0068860_100000302 | 3300005843 | Bacteria | 68581 |
| 113 | Ga0068860_100101960 | 3300005843 | Bacteria | 2738 |
| 114 | Ga0068862_100112394 | 3300005844 | Bacteria | 2392 |
| 115 | Ga0081455_10000058 | 3300005937 | Bacteria | 119171 |
| 116 | Ga0081455_10000473 | 3300005937 | Bacteria | 52197 |
| 117 | Ga0081455_10003864 | 3300005937 | Bacteria | 17077 |
| 118 | Ga0081455_10005003 | 3300005937 | Bacteria | 14660 |
| 119 | Ga0081455_10014063 | 3300005937 | Bacteria | 7866 |
| 120 | Ga0081455_10015554 | 3300005937 | Bacteria | 7387 |
| 121 | Ga0081455_10037473 | 3300005937 | Bacteria | 4305 |
| 122 | Ga0081538_10023150 | 3300005981 | Bacteria | 4474 |
| 123 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 124 | Ga0081540_1000040 | 3300005983 | Bacteria | 136968 |
| 125 | Ga0081540_1003917 | 3300005983 | Bacteria | 11594 |
| 126 | Ga0081540_1009587 | 3300005983 | Bacteria | 6661 |
| 127 | Ga0081540_1010771 | 3300005983 | Bacteria | 6148 |
| 128 | Ga0081540_1024661 | 3300005983 | Bacteria | 3484 |
| 129 | Ga0081539_10000172 | 3300005985 | Bacteria | 151505 |
| 130 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 131 | Ga0081539_10039458 | 3300005985 | Bacteria | 2785 |
| 132 | Ga0081539_10054543 | 3300005985 | Bacteria | 2231 |
| 133 | Ga0070717_10028261 | 3300006028 | Bacteria | 4488 |
| 134 | Ga0070717_10032708 | 3300006028 | Bacteria | 4193 |
| 135 | Ga0075365_10005112 | 3300006038 | Bacteria | 7042 |
| 136 | Ga0075365_10015652 | 3300006038 | Bacteria | 4593 |
| 137 | Ga0075365_10150692 | 3300006038 | Bacteria | 1618 |
| 138 | Ga0075365_10189937 | 3300006038 | Bacteria | 1437 |
| 139 | Ga0075368_10000322 | 3300006042 | Bacteria | 14006 |
| 140 | Ga0075363_100011548 | 3300006048 | Bacteria | 4233 |
| 141 | Ga0075363_100137119 | 3300006048 | Bacteria | 1376 |
| 142 | Ga0075364_10015259 | 3300006051 | Bacteria | 4762 |
| 143 | Ga0075364_10029052 | 3300006051 | Bacteria | 3544 |
| 144 | Ga0075364_10084056 | 3300006051 | Bacteria | 2107 |
| 145 | Ga0070712_100003519 | 3300006175 | Bacteria | 9636 |
| 146 | Ga0070712_100121997 | 3300006175 | Bacteria | 1962 |
| 147 | Ga0075367_10023152 | 3300006178 | Bacteria | 3491 |
| 148 | Ga0075367_10024239 | 3300006178 | Bacteria | 3422 |
| 149 | Ga0075367_10109016 | 3300006178 | Bacteria | 1698 |
| 150 | Ga0075369_10060177 | 3300006186 | Bacteria | 1656 |
| 151 | Ga0075366_10002088 | 3300006195 | Bacteria | 10148 |
| 152 | Ga0097621_100011749 | 3300006237 | Bacteria | 6466 |
| 153 | Ga0075370_10003222 | 3300006353 | Bacteria | 7724 |
| 154 | Ga0075370_10035300 | 3300006353 | Bacteria | 2806 |
| 155 | Ga0075370_10045987 | 3300006353 | Bacteria | 2469 |
| 156 | Ga0075370_10053578 | 3300006353 | Bacteria | 2290 |
| 157 | Ga0068871_100011734 | 3300006358 | Bacteria | 6436 |
| 158 | Ga0075428_100001783 | 3300006844 | Bacteria | 22990 |
| 159 | Ga0075428_100039034 | 3300006844 | Bacteria | 5226 |
| 160 | Ga0075428_100086548 | 3300006844 | Bacteria | 3418 |
| 161 | Ga0075428_100093046 | 3300006844 | Bacteria | 3286 |
| 162 | Ga0075428_100136756 | 3300006844 | Bacteria | 2664 |
| 163 | Ga0075428_100282740 | 3300006844 | Bacteria | 1785 |
| 164 | Ga0075430_100001924 | 3300006846 | Bacteria | 17039 |
| 165 | Ga0075430_100150139 | 3300006846 | Bacteria | 1940 |
| 166 | Ga0075430_100184989 | 3300006846 | Bacteria | 1732 |
| 167 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 168 | Ga0075431_100005570 | 3300006847 | Bacteria | 12435 |
| 169 | Ga0075431_100261380 | 3300006847 | Bacteria | 1756 |
| 170 | Ga0075431_100306404 | 3300006847 | Bacteria | 1604 |
| 171 | Ga0075433_10005748 | 3300006852 | Bacteria | 9756 |
| 172 | Ga0075434_100030523 | 3300006871 | Bacteria | 5308 |
| 173 | Ga0075429_100000288 | 3300006880 | Bacteria | 35542 |
| 174 | Ga0075429_100132767 | 3300006880 | Bacteria | 2178 |
| 175 | Ga0075429_100191769 | 3300006880 | Bacteria | 1790 |
| 176 | Ga0097620_100378089 | 3300006931 | Bacteria | 1512 |
| 177 | Ga0099825_1028907 | 3300006941 | Bacteria | 2636 |
| 178 | Ga0099824_1021477 | 3300006942 | Bacteria | 4495 |
| 179 | Ga0099822_1001679 | 3300006943 | Bacteria | 26417 |
| 180 | Ga0075435_100038956 | 3300007076 | Bacteria | 3792 |
| 181 | Ga0075435_100053444 | 3300007076 | Bacteria | 3258 |
| 182 | Ga0099794_10012754 | 3300007265 | Bacteria | 3639 |
| 183 | Ga0105240_10022848 | 3300009093 | Bacteria | 8285 |
| 184 | Ga0105240_10077802 | 3300009093 | Bacteria | 4086 |
| 185 | Ga0111539_10007175 | 3300009094 | Bacteria | 14285 |
| 186 | Ga0111539_10007426 | 3300009094 | Bacteria | 14048 |
| 187 | Ga0111539_10012637 | 3300009094 | Bacteria | 10577 |
| 188 | Ga0111539_10280377 | 3300009094 | Bacteria | 1939 |
| 189 | Ga0105245_10016233 | 3300009098 | Bacteria | 6491 |
| 190 | Ga0105245_10067599 | 3300009098 | Bacteria | 3237 |
| 191 | Ga0105245_10113086 | 3300009098 | Bacteria | 2528 |
| 192 | Ga0114129_10000104 | 3300009147 | Bacteria | 83195 |
| 193 | Ga0114129_10004768 | 3300009147 | Bacteria | 19169 |
| 194 | Ga0114129_10009472 | 3300009147 | Bacteria | 13882 |
| 195 | Ga0114129_10141754 | 3300009147 | Bacteria | 3294 |
| 196 | Ga0105243_10099061 | 3300009148 | Bacteria | 2415 |
| 197 | Ga0105241_10020161 | 3300009174 | Bacteria | 4925 |
| 198 | Ga0105241_10021591 | 3300009174 | Bacteria | 4760 |
| 199 | Ga0105242_10188924 | 3300009176 | Bacteria | 1822 |
| 200 | Ga0105248_10103016 | 3300009177 | Bacteria | 3217 |
| 201 | Ga0105248_10532673 | 3300009177 | Bacteria | 1325 |
| 202 | Ga0105237_10007390 | 3300009545 | Bacteria | 12032 |
| 203 | Ga0105237_10030977 | 3300009545 | Bacteria | 5426 |
| 204 | Ga0105237_10082457 | 3300009545 | Bacteria | 3207 |
| 205 | Ga0105237_10141502 | 3300009545 | Bacteria | 2400 |
| 206 | Ga0105237_10191139 | 3300009545 | Bacteria | 2047 |
| 207 | Ga0105238_10088915 | 3300009551 | Bacteria | 3075 |
| 208 | Ga0105238_10333985 | 3300009551 | Bacteria | 1503 |
| 209 | Ga0105238_10347392 | 3300009551 | Bacteria | 1472 |
| 210 | Ga0105249_10292405 | 3300009553 | Bacteria | 1631 |
| 211 | Ga0099796_10003058 | 3300010159 | Bacteria | 3805 |
| 212 | Ga0105239_10010770 | 3300010375 | Bacteria | 10216 |
| 213 | Ga0105239_10117510 | 3300010375 | Bacteria | 2951 |
| 214 | Ga0105239_10344421 | 3300010375 | Bacteria | 1682 |
| 215 | Ga0105246_10003773 | 3300011119 | Bacteria | 9185 |
| 216 | Ga0105246_10079406 | 3300011119 | Bacteria | 2333 |
| 217 | Ga0105246_10131381 | 3300011119 | Bacteria | 1871 |
| 218 | Ga0105246_10237793 | 3300011119 | Bacteria | 1438 |
| 219 | Ga0157370_10089815 | 3300013104 | Bacteria | 2886 |
| 220 | Ga0157369_10012743 | 3300013105 | Bacteria | 9534 |
| 221 | Ga0157369_10020698 | 3300013105 | Bacteria | 7355 |
| 222 | Ga0157369_10068028 | 3300013105 | Bacteria | 3827 |
| 223 | Ga0157369_10129388 | 3300013105 | Bacteria | 2676 |
| 224 | Ga0157369_10173846 | 3300013105 | Bacteria | 2268 |
| 225 | Ga0157374_10013038 | 3300013296 | Bacteria | 7248 |
| 226 | Ga0157374_10021625 | 3300013296 | Bacteria | 5728 |
| 227 | Ga0157374_10095493 | 3300013296 | Bacteria | 2843 |
| 228 | Ga0157378_10101029 | 3300013297 | Bacteria | 2634 |
| 229 | Ga0157378_10132573 | 3300013297 | Bacteria | 2308 |
| 230 | Ga0157378_10573305 | 3300013297 | Bacteria | 1137 |
| 231 | Ga0163162_10013490 | 3300013306 | Bacteria | 7977 |
| 232 | Ga0163162_10291917 | 3300013306 | Bacteria | 1762 |
| 233 | Ga0163162_10530865 | 3300013306 | Bacteria | 1306 |
| 234 | Ga0157372_10009605 | 3300013307 | Bacteria | 10280 |
| 235 | Ga0157372_10353836 | 3300013307 | Bacteria | 1711 |
| 236 | Ga0157372_10569198 | 3300013307 | Bacteria | 1321 |
| 237 | Ga0157372_10588888 | 3300013307 | Bacteria | 1296 |
| 238 | Ga0163163_10005130 | 3300014325 | Bacteria | 11291 |
| 239 | Ga0163163_10089857 | 3300014325 | Bacteria | 3084 |
| 240 | Ga0163163_10132157 | 3300014325 | Bacteria | 2536 |
| 241 | Ga0163163_10322310 | 3300014325 | Bacteria | 1599 |
| 242 | Ga0157380_10375933 | 3300014326 | Bacteria | 1339 |
| 243 | Ga0157377_10088218 | 3300014745 | Bacteria | 1827 |
| 244 | Ga0157376_10484796 | 3300014969 | Bacteria | 1212 |
| 245 | Ga0214544_1000055 | 3300021320 | Bacteria | 133217 |
| 246 | Ga0214542_1003337 | 3300021321 | Bacteria | 32859 |
| 247 | Ga0214545_1000028 | 3300021324 | Bacteria | 127957 |
| 248 | Ga0214543_1000044 | 3300021327 | Bacteria | 158132 |
| 249 | Ga0213876_10000471 | 3300021384 | Bacteria | 32066 |
| 250 | Ga0213871_10000076 | 3300021441 | Bacteria | 8335 |
| 251 | Ga0209563_101020 | 3300025230 | Bacteria | 8156 |
| 252 | Ga0207425_1002884 | 3300025245 | Bacteria | 5777 |
| 253 | Ga0209677_106052 | 3300025253 | Bacteria | 2980 |
| 254 | Ga0209564_1000936 | 3300025295 | Bacteria | 37836 |
| 255 | Ga0209564_1002670 | 3300025295 | Bacteria | 13535 |
| 256 | Ga0209564_1035919 | 3300025295 | Bacteria | 1425 |
| 257 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 258 | Ga0209758_1000087 | 3300025297 | Bacteria | 254384 |
| 259 | Ga0209758_1001472 | 3300025297 | Bacteria | 27590 |
| 260 | Ga0209758_1006857 | 3300025297 | Bacteria | 7967 |
| 261 | Ga0209758_1008545 | 3300025297 | Bacteria | 6597 |
| 262 | Ga0209758_1012674 | 3300025297 | Bacteria | 4687 |
| 263 | Ga0209758_1016464 | 3300025297 | Bacteria | 3754 |
| 264 | Ga0209758_1019189 | 3300025297 | Bacteria | 3311 |
| 265 | Ga0209758_1049417 | 3300025297 | Bacteria | 1485 |
| 266 | Ga0209256_1009007 | 3300025299 | Bacteria | 4472 |
| 267 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 268 | Ga0207426_1000289 | 3300025302 | Bacteria | 99963 |
| 269 | Ga0209257_1000382 | 3300025304 | Bacteria | 88368 |
| 270 | Ga0209257_1010148 | 3300025304 | Bacteria | 4850 |
| 271 | Ga0207656_10024592 | 3300025321 | Bacteria | 2437 |
| 272 | Ga0207682_10109140 | 3300025893 | Bacteria | 1217 |
| 273 | Ga0207692_10004122 | 3300025898 | Bacteria | 5734 |
| 274 | Ga0207692_10012566 | 3300025898 | Bacteria | 3640 |
| 275 | Ga0207642_10022038 | 3300025899 | Bacteria | 2519 |
| 276 | Ga0207710_10043002 | 3300025900 | Bacteria | 2008 |
| 277 | Ga0207647_10006477 | 3300025904 | Bacteria | 8509 |
| 278 | Ga0207699_10000561 | 3300025906 | Bacteria | 18332 |
| 279 | Ga0207699_10005355 | 3300025906 | Bacteria | 6150 |
| 280 | Ga0207699_10085572 | 3300025906 | Bacteria | 1966 |
| 281 | Ga0207645_10048437 | 3300025907 | Bacteria | 2714 |
| 282 | Ga0207643_10004466 | 3300025908 | Bacteria | 7519 |
| 283 | Ga0207705_10031006 | 3300025909 | Bacteria | 3815 |
| 284 | Ga0207654_10007906 | 3300025911 | Bacteria | 5361 |
| 285 | Ga0207707_10000660 | 3300025912 | Bacteria | 34202 |
| 286 | Ga0207707_10003822 | 3300025912 | Bacteria | 13339 |
| 287 | Ga0207707_10009552 | 3300025912 | Bacteria | 8415 |
| 288 | Ga0207707_10020964 | 3300025912 | Bacteria | 5709 |
| 289 | Ga0207707_10021206 | 3300025912 | Bacteria | 5680 |
| 290 | Ga0207707_10058198 | 3300025912 | Bacteria | 3363 |
| 291 | Ga0207707_10176474 | 3300025912 | Bacteria | 1866 |
| 292 | Ga0207695_10195356 | 3300025913 | Bacteria | 1940 |
| 293 | Ga0207695_10213368 | 3300025913 | Bacteria | 1840 |
| 294 | Ga0207695_10349768 | 3300025913 | Bacteria | 1365 |
| 295 | Ga0207671_10095298 | 3300025914 | Bacteria | 2247 |
| 296 | Ga0207671_10116738 | 3300025914 | Bacteria | 2036 |
| 297 | Ga0207693_10001004 | 3300025915 | Bacteria | 25392 |
| 298 | Ga0207693_10003010 | 3300025915 | Bacteria | 14576 |
| 299 | Ga0207663_10019711 | 3300025916 | Bacteria | 3806 |
| 300 | Ga0207660_10004099 | 3300025917 | Bacteria | 9489 |
| 301 | Ga0207660_10031454 | 3300025917 | Bacteria | 3655 |
| 302 | Ga0207660_10218085 | 3300025917 | Bacteria | 1496 |
| 303 | Ga0207660_10274951 | 3300025917 | Bacteria | 1335 |
| 304 | Ga0207657_10021590 | 3300025919 | Bacteria | 6053 |
| 305 | Ga0207649_10225494 | 3300025920 | Bacteria | 1337 |
| 306 | Ga0207652_10013565 | 3300025921 | Bacteria | 6591 |
| 307 | Ga0207652_10017792 | 3300025921 | Bacteria | 5822 |
| 308 | Ga0207652_10115852 | 3300025921 | Bacteria | 2380 |
| 309 | Ga0207652_10162337 | 3300025921 | Bacteria | 2003 |
| 310 | Ga0207646_10308109 | 3300025922 | Bacteria | 1431 |
| 311 | Ga0207681_10065051 | 3300025923 | Bacteria | 2520 |
| 312 | Ga0207694_10035053 | 3300025924 | Bacteria | 3848 |
| 313 | Ga0207694_10217819 | 3300025924 | Bacteria | 1556 |
| 314 | Ga0207650_10005952 | 3300025925 | Bacteria | 8324 |
| 315 | Ga0207659_10034027 | 3300025926 | Bacteria | 3511 |
| 316 | Ga0207687_10012740 | 3300025927 | Bacteria | 5494 |
| 317 | Ga0207687_10032480 | 3300025927 | Bacteria | 3535 |
| 318 | Ga0207700_10037733 | 3300025928 | Bacteria | 3502 |
| 319 | Ga0207700_10051509 | 3300025928 | Bacteria | 3073 |
| 320 | Ga0207700_10060434 | 3300025928 | Bacteria | 2870 |
| 321 | Ga0207664_10173705 | 3300025929 | Bacteria | 1846 |
| 322 | Ga0207664_10264258 | 3300025929 | Bacteria | 1506 |
| 323 | Ga0207706_10002137 | 3300025933 | Bacteria | 19347 |
| 324 | Ga0207706_10062955 | 3300025933 | Bacteria | 3266 |
| 325 | Ga0207706_10067135 | 3300025933 | Bacteria | 3156 |
| 326 | Ga0207706_10175571 | 3300025933 | Bacteria | 1882 |
| 327 | Ga0207709_10140207 | 3300025935 | Bacteria | 1661 |
| 328 | Ga0207669_10023481 | 3300025937 | Bacteria | 3295 |
| 329 | Ga0207669_10130798 | 3300025937 | Bacteria | 1724 |
| 330 | Ga0207691_10023514 | 3300025940 | Bacteria | 5803 |
| 331 | Ga0207711_10032173 | 3300025941 | Bacteria | 4434 |
| 332 | Ga0207711_10053470 | 3300025941 | Bacteria | 3463 |
| 333 | Ga0207689_10056752 | 3300025942 | Bacteria | 3222 |
| 334 | Ga0207679_10139161 | 3300025945 | Bacteria | 1960 |
| 335 | Ga0207667_10023066 | 3300025949 | Bacteria | 6858 |
| 336 | Ga0207667_10085017 | 3300025949 | Bacteria | 3275 |
| 337 | Ga0207667_10260969 | 3300025949 | Bacteria | 1772 |
| 338 | Ga0207667_10359271 | 3300025949 | Bacteria | 1485 |
| 339 | Ga0207651_10126240 | 3300025960 | Bacteria | 1950 |
| 340 | Ga0207668_10009228 | 3300025972 | Bacteria | 5902 |
| 341 | Ga0207640_10131212 | 3300025981 | Bacteria | 1812 |
| 342 | Ga0207640_10214745 | 3300025981 | Bacteria | 1468 |
| 343 | Ga0207677_10035335 | 3300026023 | Bacteria | 3245 |
| 344 | Ga0207677_10038119 | 3300026023 | Bacteria | 3148 |
| 345 | Ga0207703_10040278 | 3300026035 | Bacteria | 3738 |
| 346 | Ga0207703_10287680 | 3300026035 | Bacteria | 1495 |
| 347 | Ga0207703_10442420 | 3300026035 | Bacteria | 1213 |
| 348 | Ga0207639_10033257 | 3300026041 | Bacteria | 3802 |
| 349 | Ga0207639_10064910 | 3300026041 | Bacteria | 2832 |
| 350 | Ga0207639_10178875 | 3300026041 | Bacteria | 1803 |
| 351 | Ga0207678_10008751 | 3300026067 | Bacteria | 8910 |
| 352 | Ga0207678_10030711 | 3300026067 | Bacteria | 4691 |
| 353 | Ga0207678_10064794 | 3300026067 | Bacteria | 3140 |
| 354 | Ga0207678_10081431 | 3300026067 | Bacteria | 2771 |
| 355 | Ga0207708_10023566 | 3300026075 | Bacteria | 4655 |
| 356 | Ga0207708_10029438 | 3300026075 | Bacteria | 4163 |
| 357 | Ga0207702_10001454 | 3300026078 | Bacteria | 23549 |
| 358 | Ga0207702_10028517 | 3300026078 | Bacteria | 4641 |
| 359 | Ga0207702_10052278 | 3300026078 | Bacteria | 3457 |
| 360 | Ga0207702_10057390 | 3300026078 | Bacteria | 3308 |
| 361 | Ga0207702_10066273 | 3300026078 | Bacteria | 3094 |
| 362 | Ga0207641_10096136 | 3300026088 | Bacteria | 2601 |
| 363 | Ga0207641_10145892 | 3300026088 | Bacteria | 2140 |
| 364 | Ga0207641_10288616 | 3300026088 | Bacteria | 1546 |
| 365 | Ga0207648_10006963 | 3300026089 | Bacteria | 11191 |
| 366 | Ga0207648_10081945 | 3300026089 | Bacteria | 2813 |
| 367 | Ga0207648_10125626 | 3300026089 | Bacteria | 2256 |
| 368 | Ga0207676_10205477 | 3300026095 | Bacteria | 1743 |
| 369 | Ga0207674_10033436 | 3300026116 | Bacteria | 5384 |
| 370 | Ga0207674_10103403 | 3300026116 | Bacteria | 2828 |
| 371 | Ga0207675_100029070 | 3300026118 | Bacteria | 5151 |
| 372 | Ga0207675_100046864 | 3300026118 | Bacteria | 4038 |
| 373 | Ga0207675_100066690 | 3300026118 | Bacteria | 3364 |
| 374 | Ga0207675_100074780 | 3300026118 | Bacteria | 3170 |
| 375 | Ga0207683_10037347 | 3300026121 | Bacteria | 4229 |
| 376 | Ga0207683_10229697 | 3300026121 | Bacteria | 1692 |
| 377 | Ga0207698_10025095 | 3300026142 | Bacteria | 4193 |
| 378 | Ga0207698_10045053 | 3300026142 | Bacteria | 3320 |
| 379 | Ga0207698_10058938 | 3300026142 | Bacteria | 2979 |
| 380 | Ga0207698_10175368 | 3300026142 | Bacteria | 1892 |
| 381 | Ga0207698_10221241 | 3300026142 | Bacteria | 1711 |
| 382 | Ga0207698_10399243 | 3300026142 | Bacteria | 1313 |
| 383 | Ga0209389_1000137 | 3300027296 | Bacteria | 63287 |
| 384 | Ga0209389_1000353 | 3300027296 | Bacteria | 27634 |
| 385 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 386 | Ga0209589_1003439 | 3300027357 | Bacteria | 27634 |
| 387 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 388 | Ga0209489_100192 | 3300027361 | Bacteria | 98028 |
| 389 | Ga0209489_107326 | 3300027361 | Bacteria | 16591 |
| 390 | Ga0209489_107331 | 3300027361 | Bacteria | 16585 |
| 391 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 392 | Ga0209700_100046 | 3300027363 | Bacteria | 159296 |
| 393 | Ga0209588_1022977 | 3300027671 | Bacteria | 1964 |
| 394 | Ga0209813_10026378 | 3300027866 | Bacteria | 1680 |
| 395 | Ga0207428_10040681 | 3300027907 | Bacteria | 3767 |
| 396 | Ga0268266_10017034 | 3300028379 | Bacteria | 6205 |
| 397 | Ga0268266_10038401 | 3300028379 | Bacteria | 4076 |
| 398 | Ga0268266_10070938 | 3300028379 | Bacteria | 3019 |
| 399 | Ga0268266_10173691 | 3300028379 | Bacteria | 1957 |
| 400 | Ga0268265_10093290 | 3300028380 | Bacteria | 2412 |
| 401 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 402 | Ga0268264_10218968 | 3300028381 | Bacteria | 1751 |
| 403 | Ga0265337_1001859 | 3300028556 | Bacteria | 10076 |
| 404 | Ga0265334_10014692 | 3300028573 | Bacteria | 3261 |
| 405 | Ga0265334_10020564 | 3300028573 | Bacteria | 2702 |
| 406 | Ga0265318_10023748 | 3300028577 | Bacteria | 2440 |
| 407 | Ga0265330_10028028 | 3300031235 | Bacteria | 2541 |
| 408 | Ga0265325_10020842 | 3300031241 | Bacteria | 3608 |
| 409 | Ga0265340_10010044 | 3300031247 | Bacteria | 5069 |
| 410 | Ga0265340_10023855 | 3300031247 | Bacteria | 3113 |
| 411 | Ga0265339_10043509 | 3300031249 | Bacteria | 2483 |
| 412 | Ga0265316_10027824 | 3300031344 | Bacteria | 4674 |
| 413 | Ga0307513_10286844 | 3300031456 | Bacteria | 1420 |
| 414 | Ga0307509_10225551 | 3300031507 | Bacteria | 1681 |
| 415 | Ga0307408_100145992 | 3300031548 | Bacteria | 1862 |
| 416 | Ga0265313_10054612 | 3300031595 | Bacteria | 1896 |
| 417 | Ga0307508_10000025 | 3300031616 | Bacteria | 174642 |
| 418 | Ga0307508_10068027 | 3300031616 | Bacteria | 3131 |
| 419 | Ga0265314_10005071 | 3300031711 | Bacteria | 12001 |
| 420 | Ga0265314_10090685 | 3300031711 | Bacteria | 1990 |
| 421 | Ga0265342_10000638 | 3300031712 | Bacteria | 36736 |
| 422 | Ga0307516_10051368 | 3300031730 | Bacteria | 4041 |
| 423 | Ga0307406_10181609 | 3300031901 | Bacteria | 1532 |
| 424 | Ga0307416_100055750 | 3300032002 | Bacteria | 3185 |
| 425 | Ga0307416_100073436 | 3300032002 | Bacteria | 2852 |
| 426 | Ga0307510_10024769 | 3300033180 | Bacteria | 6930 |
| 427 | Ga0307510_10025277 | 3300033180 | Bacteria | 6852 |
| 428 | Ga0307510_10044327 | 3300033180 | Bacteria | 4819 |
| 429 | Ga0307510_10217163 | 3300033180 | Bacteria | 1428 |
| 430 | Ga0373958_0022808 | 3300034819 | Bacteria | 1172 |
| 431 | Ga0373959_0018904 | 3300034820 | Bacteria | 1300 |
| 432 | Ga0373938_0019283 | 3300034957 | Bacteria | 1363 |
| 433 | Ga0373926_0051440 | 3300035083 | Bacteria | 1486 |
| 434 | Ga0373944_0001051 | 3300035089 | Bacteria | 6820 |
| 435 | Ga0373944_0009047 | 3300035089 | Bacteria | 2694 |
| 436 | Ga0373923_0011906 | 3300035111 | Bacteria | 3203 |
| 437 | Ga0373923_0023726 | 3300035111 | Bacteria | 2416 |
| 438 | Ga0373936_0001079 | 3300035113 | Bacteria | 9758 |
| 439 | Ga0373945_0005317 | 3300035116 | Bacteria | 4120 |
| 440 | Ga0373945_0011608 | 3300035116 | Bacteria | 2915 |
| 441 | Ga0373956_0012440 | 3300035119 | Bacteria | 3528 |
| 442 | Ga0373960_0029582 | 3300035121 | Bacteria | 1520 |
| 443 | Ga0373943_0002145 | 3300035170 | Bacteria | 8968 |
| 444 | Ga0373943_0004407 | 3300035170 | Bacteria | 6372 |
| 445 | Ga0373943_0046435 | 3300035170 | Bacteria | 2120 |
| 446 | Ga0373946_0003426 | 3300035171 | Bacteria | 5626 |
| 447 | Ga0373955_0002673 | 3300035172 | Bacteria | 7800 |
| 448 | Ga0373955_0042203 | 3300035172 | Bacteria | 2448 |
| 449 | Ga0373924_0005844 | 3300035410 | Bacteria | 4381 |
| 450 | Ga0373931_0003998 | 3300035691 | Bacteria | 6678 |
| 451 | Ga0373935_0000494 | 3300035692 | Bacteria | 20439 |
| 452 | Ga0373935_0009052 | 3300035692 | Bacteria | 5957 |
| 453 | Ga0373935_0058438 | 3300035692 | Bacteria | 2463 |
| 454 | Ga0373927_0020261 | 3300035695 | Bacteria | 4361 |
| 455 | Ga0373927_0024311 | 3300035695 | Bacteria | 3964 |
| 456 | Ga0373927_0044653 | 3300035695 | Bacteria | 2866 |
| 457 | Ga0373927_0045067 | 3300035695 | Bacteria | 2853 |
| 458 | Ga0373927_0086095 | 3300035695 | Bacteria | 2040 |
| 459 | Ga0373927_0117969 | 3300035695 | Bacteria | 1731 |
| 460 | Ga0373947_0002364 | 3300035725 | Bacteria | 11398 |
| 461 | Ga0373937_0073556 | 3300036401 | Bacteria | 3153 |
| 462 | Ga0373937_0222603 | 3300036401 | Bacteria | 1776 |
| 463 | Ga0373925_0007140 | 3300037068 | Bacteria | 8162 |
| 464 | Ga0373925_0015198 | 3300037068 | Bacteria | 5566 |
| 465 | Ga0373925_0095204 | 3300037068 | Bacteria | 2281 |
| 466 | Ga0395899_0034762 | 3300037312 | Bacteria | 3786 |
| 467 | Ga0395899_0062951 | 3300037312 | Bacteria | 2731 |
| 468 | Ga0395900_0000943 | 3300037418 | Bacteria | 37925 |
| 469 | Ga0395900_0125258 | 3300037418 | Bacteria | 2635 |
| 470 | Ga0395898_0002974 | 3300037466 | Bacteria | 19263 |
| 471 | Ga0395898_0046280 | 3300037466 | Bacteria | 4273 |
| 472 | Ga0395905_0021852 | 3300037471 | Bacteria | 6052 |
| 473 | Ga0395905_0062455 | 3300037471 | Bacteria | 3485 |
| 474 | Ga0395905_0194235 | 3300037471 | Bacteria | 1903 |
| 475 | Ga0395905_0201061 | 3300037471 | Bacteria | 1868 |
| 476 | Ga0395901_0001973 | 3300038443 | Bacteria | 21111 |
| 477 | Ga0436365_0430232 | 3300039437 | Bacteria | 1547 |
| 478 | Ga0436365_1324557 | 3300039437 | Bacteria | 36147 |
| 479 | Ga0436361_0394185 | 3300039447 | Bacteria | 2477 |
| 480 | Ga0436361_0440592 | 3300039447 | Bacteria | 3469 |
| 481 | Ga0436363_0490106 | 3300039450 | Bacteria | 3966 |
| 482 | Ga0436363_1647914 | 3300039450 | Bacteria | 3918 |
| 483 | Ga0436362_0153721 | 3300039453 | Bacteria | 3999 |
| 484 | Ga0436362_1239383 | 3300039453 | Bacteria | 3890 |
| 485 | Ga0466972_0025155 | 3300044658 | Bacteria | 2953 |
| 486 | Ga0466972_0026707 | 3300044658 | Bacteria | 2860 |
| 487 | Ga0466961_0125511 | 3300044693 | Bacteria | 1610 |
| 488 | Ga0466963_0049448 | 3300044694 | Bacteria | 2781 |
| 489 | Ga0466963_0049544 | 3300044694 | Bacteria | 2778 |
| 490 | Ga0466971_0037312 | 3300044719 | Bacteria | 2178 |
| 491 | Ga0466957_0014169 | 3300044842 | Bacteria | 4639 |
| 492 | Ga0466960_0006861 | 3300044901 | Bacteria | 4591 |
| 493 | Ga0466959_0022897 | 3300045049 | Bacteria | 4618 |
| 494 | Ga0466959_0035145 | 3300045049 | Bacteria | 3708 |
| 495 | Ga0466958_0024101 | 3300045836 | Bacteria | 3578 |
| 496 | Ga0466967_0017307 | 3300045976 | Bacteria | 5717 |
| 497 | Ga0466967_0371644 | 3300045976 | Bacteria | 1387 |
| 498 | Ga0495627_000265 | 3300046453 | Bacteria | 53539 |
| 499 | Ga0495603_0000237 | 3300046455 | Bacteria | 28782 |
| 500 | Ga0495603_0023749 | 3300046455 | Bacteria | 3709 |
| 501 | Ga0495603_0024299 | 3300046455 | Bacteria | 3664 |
| 502 | Ga0495603_0041049 | 3300046455 | Bacteria | 2768 |
| 503 | Ga0495603_0083633 | 3300046455 | Bacteria | 1869 |
| 504 | Ga0495629_0000772 | 3300046459 | Bacteria | 25859 |
| 505 | Ga0495629_0080362 | 3300046459 | Bacteria | 2276 |
| 506 | Ga0495629_0082958 | 3300046459 | Bacteria | 2237 |
| 507 | Ga0495629_0093433 | 3300046459 | Bacteria | 2099 |
| 508 | Ga0495638_0006370 | 3300046460 | Bacteria | 8597 |
| 509 | Ga0495638_0022968 | 3300046460 | Bacteria | 4086 |
| 510 | Ga0495638_0065586 | 3300046460 | Bacteria | 2234 |
| 511 | Ga0495641_0004443 | 3300046461 | Bacteria | 9917 |
| 512 | Ga0495641_0026360 | 3300046461 | Bacteria | 2836 |
| 513 | Ga0495651_0083841 | 3300046462 | Bacteria | 2402 |
| 514 | Ga0495653_0000284 | 3300046463 | Bacteria | 41113 |
| 515 | Ga0495650_0017744 | 3300046471 | Bacteria | 3559 |
| 516 | Ga0495650_0078605 | 3300046471 | Bacteria | 1277 |
| 517 | Ga0495580_0001324 | 3300046472 | Bacteria | 21841 |
| 518 | Ga0495580_0046389 | 3300046472 | Bacteria | 3083 |
| 519 | Ga0495582_0000209 | 3300046473 | Bacteria | 32511 |
| 520 | Ga0495582_0150497 | 3300046473 | Bacteria | 1321 |
| 521 | Ga0495639_0000387 | 3300046475 | Bacteria | 20931 |
| 522 | Ga0495639_0018150 | 3300046475 | Bacteria | 3060 |
| 523 | Ga0495662_0032424 | 3300046476 | Bacteria | 2523 |
| 524 | Ga0495662_0078507 | 3300046476 | Bacteria | 1604 |
| 525 | Ga0495664_0007965 | 3300046477 | Bacteria | 5899 |
| 526 | Ga0495664_0017088 | 3300046477 | Bacteria | 4144 |
| 527 | Ga0495584_0018353 | 3300046491 | Bacteria | 3555 |
| 528 | Ga0495584_0060574 | 3300046491 | Bacteria | 1903 |
| 529 | Ga0495585_0016853 | 3300046492 | Bacteria | 4232 |
| 530 | Ga0495585_0019945 | 3300046492 | Bacteria | 3859 |
| 531 | Ga0495585_0058338 | 3300046492 | Bacteria | 2130 |
| 532 | Ga0495594_0000342 | 3300046499 | Bacteria | 23227 |
| 533 | Ga0495594_0021788 | 3300046499 | Bacteria | 3422 |
| 534 | Ga0495594_0041508 | 3300046499 | Bacteria | 2519 |
| 535 | Ga0495594_0105821 | 3300046499 | Bacteria | 1584 |
| 536 | Ga0495583_0097198 | 3300046506 | Bacteria | 1261 |
| 537 | Ga0495606_0000805 | 3300046507 | Bacteria | 47853 |
| 538 | Ga0495606_0002837 | 3300046507 | Bacteria | 19219 |
| 539 | Ga0495606_0126946 | 3300046507 | Bacteria | 1520 |
| 540 | Ga0495608_0046562 | 3300046511 | Bacteria | 2886 |
| 541 | Ga0495608_0179133 | 3300046511 | Bacteria | 1341 |
| 542 | Ga0495610_0101648 | 3300046512 | Bacteria | 1287 |
| 543 | Ga0495618_0036341 | 3300046514 | Bacteria | 3091 |
| 544 | Ga0495630_0062697 | 3300046517 | Bacteria | 2792 |
| 545 | Ga0495631_0000222 | 3300046518 | Bacteria | 39049 |
| 546 | Ga0495631_0051843 | 3300046518 | Bacteria | 1792 |
| 547 | Ga0495632_0044419 | 3300046519 | Bacteria | 2217 |
| 548 | Ga0495632_0073286 | 3300046519 | Bacteria | 1642 |
| 549 | Ga0495643_0059039 | 3300046522 | Bacteria | 2040 |
| 550 | Ga0495643_0100146 | 3300046522 | Bacteria | 1486 |
| 551 | Ga0495644_0047893 | 3300046523 | Bacteria | 1605 |
| 552 | Ga0495648_0003600 | 3300046524 | Bacteria | 13558 |
| 553 | Ga0495648_0136493 | 3300046524 | Bacteria | 1296 |
| 554 | Ga0495663_0043783 | 3300046525 | Bacteria | 1368 |
| 555 | Ga0495666_0023449 | 3300046526 | Bacteria | 3052 |
| 556 | Ga0495652_0023755 | 3300046529 | Bacteria | 5433 |
| 557 | Ga0495652_0210850 | 3300046529 | Bacteria | 1467 |
| 558 | Ga0495654_0004595 | 3300046530 | Bacteria | 8152 |
| 559 | Ga0495654_0100487 | 3300046530 | Bacteria | 1332 |
| 560 | Ga0495665_0000280 | 3300046531 | Bacteria | 25894 |
| 561 | Ga0495665_0003915 | 3300046531 | Bacteria | 8056 |
| 562 | Ga0495640_0001578 | 3300046533 | Bacteria | 17975 |
| 563 | Ga0495640_0032438 | 3300046533 | Bacteria | 3721 |
| 564 | Ga0495640_0040303 | 3300046533 | Bacteria | 3271 |
| 565 | Ga0495586_0116978 | 3300046535 | Bacteria | 1487 |
| 566 | Ga0495598_0003599 | 3300046537 | Bacteria | 3304 |
| 567 | Ga0495598_0023647 | 3300046537 | Bacteria | 1657 |
| 568 | Ga0495621_0021100 | 3300046539 | Bacteria | 2144 |
| 569 | Ga0495645_0003978 | 3300046543 | Bacteria | 10080 |
| 570 | Ga0495645_0238151 | 3300046543 | Bacteria | 1216 |
| 571 | Ga0495622_0004573 | 3300046557 | Bacteria | 6407 |
| 572 | Ga0495622_0028120 | 3300046557 | Bacteria | 2625 |
| 573 | Ga0495633_0062024 | 3300046558 | Bacteria | 1750 |
| 574 | Ga0495667_0097813 | 3300046559 | Bacteria | 1900 |
| 575 | Ga0495667_0107010 | 3300046559 | Bacteria | 1807 |
| 576 | Ga0495656_0001705 | 3300046615 | Bacteria | 7199 |
| 577 | Ga0495656_0042555 | 3300046615 | Bacteria | 1902 |
| 578 | Ga0495656_0060692 | 3300046615 | Bacteria | 1649 |
| 579 | Ga0495668_0032248 | 3300046616 | Bacteria | 2949 |
| 580 | Ga0495634_0000865 | 3300046642 | Bacteria | 29129 |
| 581 | Ga0495634_0020608 | 3300046642 | Bacteria | 4673 |
| 582 | Ga0495611_0050962 | 3300046648 | Bacteria | 1865 |
| 583 | Ga0495611_0114522 | 3300046648 | Bacteria | 1256 |
| 584 | Ga0495625_0213974 | 3300046660 | Bacteria | 1266 |
| 585 | Ga0495635_0017357 | 3300046663 | Bacteria | 5028 |
| 586 | Ga0495659_0005402 | 3300046664 | Bacteria | 4019 |
| 587 | Ga0495659_0049652 | 3300046664 | Bacteria | 1524 |
| 588 | Ga0495657_0011035 | 3300046675 | Bacteria | 6774 |
| 589 | Ga0495599_0049318 | 3300046678 | Bacteria | 2639 |
| 590 | Ga0495599_0134971 | 3300046678 | Bacteria | 1532 |
| 591 | Ga0495646_0095072 | 3300046680 | Bacteria | 1715 |
| 592 | Ga0495647_0000763 | 3300046681 | Bacteria | 9576 |
| 593 | Ga0495647_0024349 | 3300046681 | Bacteria | 2203 |
| 594 | Ga0495658_0012763 | 3300046683 | Bacteria | 4265 |
| 595 | Ga0495658_0032484 | 3300046683 | Bacteria | 2850 |
| 596 | Ga0495613_0003086 | 3300046689 | Bacteria | 12448 |
| 597 | Ga0495613_0056448 | 3300046689 | Bacteria | 2883 |
| 598 | Ga0495613_0220372 | 3300046689 | Bacteria | 1332 |
| 599 | Ga0495624_0001082 | 3300046690 | Bacteria | 21523 |
| 600 | Ga0495624_0002738 | 3300046690 | Bacteria | 13256 |
| 601 | Ga0495624_0070964 | 3300046690 | Bacteria | 2168 |
| 602 | Ga0495670_0032726 | 3300046691 | Bacteria | 2586 |
| 603 | Ga0495671_0022340 | 3300046692 | Bacteria | 3316 |
| 604 | Ga0495589_0019693 | 3300046794 | Bacteria | 3455 |
| 605 | Ga0495600_0001516 | 3300046809 | Bacteria | 12897 |
| 606 | Ga0495581_0022904 | 3300047315 | Bacteria | 3618 |
| 607 | Ga0495581_0104799 | 3300047315 | Bacteria | 1643 |
| 608 | Ga0495604_0012450 | 3300047317 | Bacteria | 6765 |
| 609 | Ga0495604_0103260 | 3300047317 | Bacteria | 2091 |
| 610 | Ga0495604_0115558 | 3300047317 | Bacteria | 1950 |
| 611 | Ga0495636_0031639 | 3300047318 | Bacteria | 2170 |
| 612 | Ga0495636_0096907 | 3300047318 | Bacteria | 1286 |
| 613 | Ga0495674_0004372 | 3300047319 | Bacteria | 13583 |
| 614 | Ga0495672_0011483 | 3300047320 | Bacteria | 6248 |
| 615 | Ga0495672_0138756 | 3300047320 | Bacteria | 1272 |
| 616 | Ga0495676_0009743 | 3300047321 | Bacteria | 8733 |
| 617 | Ga0495676_0018074 | 3300047321 | Bacteria | 6220 |
| 618 | Ga0495676_0104647 | 3300047321 | Bacteria | 2088 |
| 619 | Ga0495680_0058874 | 3300047322 | Bacteria | 2967 |
| 620 | Ga0495680_0157250 | 3300047322 | Bacteria | 1653 |
| 621 | Ga0495687_011591 | 3300047443 | Bacteria | 4727 |
| 622 | Ga0495675_0111997 | 3300047444 | Bacteria | 1703 |
| 623 | Ga0495673_0003053 | 3300047469 | Bacteria | 11253 |
| 624 | Ga0495684_0045233 | 3300047471 | Bacteria | 3369 |
| 625 | Ga0495684_0125066 | 3300047471 | Bacteria | 1935 |
| 626 | Ga0495686_0052830 | 3300047472 | Bacteria | 2547 |
| 627 | Ga0495686_0071631 | 3300047472 | Bacteria | 2133 |
| 628 | Ga0495593_0000238 | 3300047673 | Bacteria | 29664 |
| 629 | Ga0495593_0054623 | 3300047673 | Bacteria | 2104 |
| 630 | Ga0495593_0071101 | 3300047673 | Bacteria | 1807 |
| 631 | Ga0495602_0031146 | 3300048088 | Bacteria | 5047 |
| 632 | Ga0496100_0084672 | 3300048903 | Bacteria | 2150 |
| 633 | Ga0496100_0153102 | 3300048903 | Bacteria | 1647 |
| 634 | Ga0496100_0183003 | 3300048903 | Bacteria | 1516 |
| 635 | Ga0496101_0018685 | 3300048904 | Bacteria | 4717 |
| 636 | Ga0496101_0036513 | 3300048904 | Bacteria | 3481 |
| 637 | Ga0496101_0103084 | 3300048904 | Bacteria | 2138 |
| 638 | Ga0496101_0103753 | 3300048904 | Bacteria | 2131 |
| 639 | Ga0496101_0163331 | 3300048904 | Bacteria | 1709 |
| 640 | Ga0496102_0001874 | 3300048905 | Bacteria | 18120 |
| 641 | Ga0496102_0007483 | 3300048905 | Bacteria | 9334 |
| 642 | Ga0496102_0126920 | 3300048905 | Bacteria | 2385 |
| 643 | Ga0496102_0192820 | 3300048905 | Bacteria | 1920 |
| 644 | Ga0496102_0282168 | 3300048905 | Bacteria | 1565 |
| 645 | Ga0496102_0394904 | 3300048905 | Bacteria | 1301 |
| 646 | Ga0496103_0002168 | 3300048906 | Bacteria | 12474 |
| 647 | Ga0496103_0004621 | 3300048906 | Bacteria | 8335 |
| 648 | Ga0496103_0122197 | 3300048906 | Bacteria | 1659 |
| 649 | Ga0496103_0132742 | 3300048906 | Bacteria | 1591 |
| 650 | Ga0496104_0000411 | 3300048907 | Bacteria | 37562 |
| 651 | Ga0496104_0000594 | 3300048907 | Bacteria | 30891 |
| 652 | Ga0496104_0020184 | 3300048907 | Bacteria | 6104 |
| 653 | Ga0496104_0022321 | 3300048907 | Bacteria | 5813 |
| 654 | Ga0496104_0084202 | 3300048907 | Bacteria | 3034 |
| 655 | Ga0496104_0118822 | 3300048907 | Bacteria | 2538 |
| 656 | Ga0496105_0005229 | 3300048908 | Bacteria | 9837 |
| 657 | Ga0496105_0181428 | 3300048908 | Bacteria | 1724 |
| 658 | Ga0496105_0228308 | 3300048908 | Bacteria | 1513 |
| 659 | Ga0496106_0008194 | 3300048909 | Bacteria | 7724 |
| 660 | Ga0496106_0026256 | 3300048909 | Bacteria | 4336 |
| 661 | Ga0496106_0041334 | 3300048909 | Bacteria | 3454 |
| 662 | Ga0496106_0061499 | 3300048909 | Bacteria | 2849 |
| 663 | Ga0496106_0097128 | 3300048909 | Bacteria | 2280 |
| 664 | Ga0496106_0202666 | 3300048909 | Bacteria | 1579 |
| 665 | Ga0496107_0043909 | 3300048910 | Bacteria | 3212 |
| 666 | Ga0496107_0195249 | 3300048910 | Bacteria | 1504 |
| 667 | Ga0496108_0000244 | 3300048911 | Bacteria | 48432 |
| 668 | Ga0496108_0008496 | 3300048911 | Bacteria | 8332 |
| 669 | Ga0496108_0013227 | 3300048911 | Bacteria | 6726 |
| 670 | Ga0496108_0038758 | 3300048911 | Bacteria | 3971 |
| 671 | Ga0496108_0109145 | 3300048911 | Bacteria | 2364 |
| 672 | Ga0496108_0123258 | 3300048911 | Bacteria | 2224 |
| 673 | Ga0496108_0191020 | 3300048911 | Bacteria | 1775 |
| 674 | Ga0496109_0002677 | 3300048912 | Bacteria | 14952 |
| 675 | Ga0496109_0047462 | 3300048912 | Bacteria | 3905 |
| 676 | Ga0496109_0075355 | 3300048912 | Bacteria | 3102 |
| 677 | Ga0496109_0133662 | 3300048912 | Bacteria | 2317 |
| 678 | Ga0496109_0323262 | 3300048912 | Bacteria | 1456 |
| 679 | Ga0496110_0021529 | 3300048913 | Bacteria | 5462 |
| 680 | Ga0496110_0059222 | 3300048913 | Bacteria | 3375 |
| 681 | Ga0496110_0082180 | 3300048913 | Bacteria | 2872 |
| 682 | Ga0496110_0102035 | 3300048913 | Bacteria | 2572 |
| 683 | Ga0496110_0111312 | 3300048913 | Bacteria | 2461 |
| 684 | Ga0496110_0180931 | 3300048913 | Bacteria | 1914 |
| 685 | Ga0496111_0000320 | 3300048914 | Bacteria | 23827 |
| 686 | Ga0496111_0035990 | 3300048914 | Bacteria | 3539 |
| 687 | Ga0496111_0076159 | 3300048914 | Bacteria | 2445 |
| 688 | Ga0496111_0315801 | 3300048914 | Bacteria | 1157 |
| 689 | Ga0496112_0000111 | 3300048915 | Bacteria | 50958 |
| 690 | Ga0496112_0015510 | 3300048915 | Bacteria | 7115 |
| 691 | Ga0496112_0029058 | 3300048915 | Bacteria | 5344 |
| 692 | Ga0496112_0043753 | 3300048915 | Bacteria | 4385 |
| 693 | Ga0496112_0142350 | 3300048915 | Bacteria | 2367 |
| 694 | Ga0496112_0244245 | 3300048915 | Bacteria | 1747 |
| 695 | Ga0496112_0368481 | 3300048915 | Bacteria | 1378 |
| 696 | Ga0496113_0003916 | 3300048916 | Bacteria | 9027 |
| 697 | Ga0496114_0032861 | 3300048917 | Bacteria | 4273 |
| 698 | Ga0496114_0073413 | 3300048917 | Bacteria | 2879 |
| 699 | Ga0496114_0266892 | 3300048917 | Bacteria | 1508 |
| 700 | Ga0496115_0007927 | 3300048918 | Bacteria | 7835 |
| 701 | Ga0496115_0015981 | 3300048918 | Bacteria | 5707 |
| 702 | Ga0496115_0036848 | 3300048918 | Bacteria | 3874 |
| 703 | Ga0496115_0039572 | 3300048918 | Bacteria | 3745 |
| 704 | Ga0496115_0047535 | 3300048918 | Bacteria | 3431 |
| 705 | Ga0496115_0051539 | 3300048918 | Bacteria | 3300 |
| 706 | Ga0496115_0094542 | 3300048918 | Bacteria | 2445 |
| 707 | Ga0496115_0215288 | 3300048918 | Bacteria | 1586 |
| 708 | Ga0496116_0000520 | 3300048919 | Bacteria | 51826 |
| 709 | Ga0496116_0017384 | 3300048919 | Bacteria | 5582 |
| 710 | Ga0496116_0037607 | 3300048919 | Bacteria | 3373 |
| 711 | Ga0496116_0098756 | 3300048919 | Bacteria | 1751 |
| 712 | Ga0496117_0056104 | 3300048920 | Bacteria | 2747 |
| 713 | Ga0496117_0066703 | 3300048920 | Bacteria | 2439 |
| 714 | Ga0496118_0011335 | 3300048921 | Bacteria | 8714 |
| 715 | Ga0496118_0012281 | 3300048921 | Bacteria | 8243 |
| 716 | Ga0496118_0035772 | 3300048921 | Bacteria | 4026 |
| 717 | Ga0496118_0050582 | 3300048921 | Bacteria | 3187 |
| 718 | Ga0496118_0081687 | 3300048921 | Bacteria | 2268 |
| 719 | Ga0496118_0106816 | 3300048921 | Bacteria | 1871 |
| 720 | Ga0496120_0019887 | 3300048923 | Bacteria | 4282 |
| 721 | Ga0496120_0034572 | 3300048923 | Bacteria | 3026 |
| 722 | Ga0496121_0001361 | 3300048924 | Bacteria | 41683 |
| 723 | Ga0496121_0001375 | 3300048924 | Bacteria | 41255 |
| 724 | Ga0496121_0006808 | 3300048924 | Bacteria | 14001 |
| 725 | Ga0496121_0028079 | 3300048924 | Bacteria | 5247 |
| 726 | Ga0496121_0044552 | 3300048924 | Bacteria | 3825 |
| 727 | Ga0496121_0057700 | 3300048924 | Bacteria | 3215 |
| 728 | Ga0496121_0085872 | 3300048924 | Bacteria | 2475 |
| 729 | Ga0496121_0105676 | 3300048924 | Bacteria | 2160 |
| 730 | Ga0496121_0118335 | 3300048924 | Bacteria | 2005 |
| 731 | Ga0496121_0121076 | 3300048924 | Bacteria | 1976 |
| 732 | Ga0496121_0148293 | 3300048924 | Bacteria | 1730 |
| 733 | Ga0496121_0148733 | 3300048924 | Bacteria | 1727 |
| 734 | Ga0496121_0150329 | 3300048924 | Bacteria | 1714 |
| 735 | Ga0496122_0025290 | 3300048925 | Bacteria | 5160 |
| 736 | Ga0496123_0028625 | 3300048926 | Bacteria | 4119 |
| 737 | Ga0496124_0021977 | 3300048927 | Bacteria | 5866 |
| 738 | Ga0496124_0141364 | 3300048927 | Bacteria | 1899 |
| 739 | Ga0496124_0189544 | 3300048927 | Bacteria | 1575 |
| 740 | Ga0496124_0282579 | 3300048927 | Bacteria | 1209 |
| 741 | Ga0496125_0000202 | 3300048928 | Bacteria | 125963 |
| 742 | Ga0496125_0000810 | 3300048928 | Bacteria | 50874 |
| 743 | Ga0496125_0001999 | 3300048928 | Bacteria | 27642 |
| 744 | Ga0496125_0015391 | 3300048928 | Bacteria | 7403 |
| 745 | Ga0496125_0040960 | 3300048928 | Bacteria | 3966 |
| 746 | Ga0496125_0062019 | 3300048928 | Bacteria | 2993 |
| 747 | Ga0496125_0202362 | 3300048928 | Bacteria | 1298 |
| 748 | Ga0496126_0002650 | 3300048929 | Bacteria | 23719 |
| 749 | Ga0496126_0017938 | 3300048929 | Bacteria | 7037 |
| 750 | Ga0496126_0022992 | 3300048929 | Bacteria | 6048 |
| 751 | Ga0496126_0036078 | 3300048929 | Bacteria | 4627 |
| 752 | Ga0496126_0043418 | 3300048929 | Bacteria | 4147 |
| 753 | Ga0496126_0102054 | 3300048929 | Bacteria | 2508 |
| 754 | Ga0496126_0162275 | 3300048929 | Bacteria | 1909 |
| 755 | Ga0496126_0249038 | 3300048929 | Bacteria | 1481 |
| 756 | Ga0496126_0254762 | 3300048929 | Bacteria | 1461 |
| 757 | Ga0495678_005201 | 3300049459 | Bacteria | 7275 |
| 758 | Ga0501031_0002641 | 3300049568 | Bacteria | 11413 |
| 759 | Ga0501032_0000257 | 3300049569 | Bacteria | 44325 |
| 760 | Ga0501032_0002207 | 3300049569 | Bacteria | 15325 |
| 761 | Ga0501032_0050080 | 3300049569 | Bacteria | 2817 |
| 762 | Ga0501033_0000124 | 3300049570 | Bacteria | 74731 |
| 763 | Ga0501033_0000244 | 3300049570 | Bacteria | 52231 |
| 764 | Ga0501033_0209346 | 3300049570 | Bacteria | 1391 |
| 765 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 766 | Ga0501034_0019549 | 3300049571 | Bacteria | 6926 |
| 767 | Ga0501034_0027553 | 3300049571 | Bacteria | 5779 |
| 768 | Ga0501034_0203493 | 3300049571 | Bacteria | 1937 |
| 769 | Ga0501034_0358363 | 3300049571 | Bacteria | 1386 |
| 770 | Ga0501034_0483255 | 3300049571 | Bacteria | 1154 |
| 771 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 772 | Ga0501036_0000104 | 3300049572 | Bacteria | 52974 |
| 773 | Ga0501036_0020262 | 3300049572 | Bacteria | 5585 |
| 774 | Ga0501036_0054745 | 3300049572 | Bacteria | 3380 |
| 775 | Ga0501037_0000247 | 3300049573 | Bacteria | 46080 |
| 776 | Ga0501037_0001386 | 3300049573 | Bacteria | 17773 |
| 777 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 778 | Ga0501038_0000207 | 3300049574 | Bacteria | 50307 |
| 779 | Ga0501038_0032296 | 3300049574 | Bacteria | 4620 |
| 780 | Ga0501039_0000064 | 3300049575 | Bacteria | 83415 |
| 781 | Ga0501039_0000148 | 3300049575 | Bacteria | 47789 |
| 782 | Ga0501039_0034867 | 3300049575 | Bacteria | 3883 |
| 783 | Ga0501040_0003761 | 3300049576 | Bacteria | 9837 |
| 784 | Ga0501040_0117404 | 3300049576 | Bacteria | 1865 |
| 785 | Ga0501041_0001759 | 3300049577 | Bacteria | 12153 |
| 786 | Ga0501042_0036793 | 3300049578 | Bacteria | 3473 |
| 787 | Ga0501043_0000202 | 3300049579 | Bacteria | 54441 |
| 788 | Ga0501043_0014806 | 3300049579 | Bacteria | 6106 |
| 789 | Ga0501043_0035649 | 3300049579 | Bacteria | 3913 |
| 790 | Ga0501043_0039221 | 3300049579 | Bacteria | 3723 |
| 791 | Ga0501046_0000185 | 3300049580 | Bacteria | 63459 |
| 792 | Ga0501046_0019371 | 3300049580 | Bacteria | 5646 |
| 793 | Ga0501046_0021384 | 3300049580 | Bacteria | 5338 |
| 794 | Ga0501046_0080151 | 3300049580 | Bacteria | 2523 |
| 795 | Ga0501047_0000385 | 3300049581 | Bacteria | 49635 |
| 796 | Ga0501047_0000392 | 3300049581 | Bacteria | 49114 |
| 797 | Ga0501047_0002801 | 3300049581 | Bacteria | 16556 |
| 798 | Ga0501047_0008093 | 3300049581 | Bacteria | 9921 |
| 799 | Ga0501047_0065193 | 3300049581 | Bacteria | 3511 |
| 800 | Ga0501047_0084811 | 3300049581 | Bacteria | 3044 |
| 801 | Ga0501048_0000536 | 3300049582 | Bacteria | 26743 |
| 802 | Ga0501048_0009128 | 3300049582 | Bacteria | 7462 |
| 803 | Ga0501048_0166735 | 3300049582 | Bacteria | 1560 |
| 804 | Ga0501067_0010006 | 3300049583 | Bacteria | 5249 |
| 805 | Ga0501067_0057206 | 3300049583 | Bacteria | 2160 |
| 806 | Ga0501067_0109325 | 3300049583 | Bacteria | 1537 |
| 807 | Ga0501068_0002219 | 3300049584 | Bacteria | 10329 |
| 808 | Ga0501068_0015826 | 3300049584 | Bacteria | 4341 |
| 809 | Ga0501068_0024106 | 3300049584 | Bacteria | 3571 |
| 810 | Ga0501068_0054094 | 3300049584 | Bacteria | 2432 |
| 811 | Ga0501069_0006636 | 3300049585 | Bacteria | 6056 |
| 812 | Ga0501069_0015986 | 3300049585 | Bacteria | 4025 |
| 813 | Ga0501069_0033054 | 3300049585 | Bacteria | 2848 |
| 814 | Ga0501069_0175977 | 3300049585 | Bacteria | 1236 |
| 815 | Ga0501070_0000175 | 3300049586 | Bacteria | 59483 |
| 816 | Ga0501070_0000557 | 3300049586 | Bacteria | 34014 |
| 817 | Ga0501070_0003774 | 3300049586 | Bacteria | 13087 |
| 818 | Ga0501070_0080256 | 3300049586 | Bacteria | 2699 |
| 819 | Ga0501071_0001483 | 3300049587 | Bacteria | 13639 |
| 820 | Ga0501071_0031190 | 3300049587 | Bacteria | 3776 |
| 821 | Ga0501071_0093188 | 3300049587 | Bacteria | 2215 |
| 822 | Ga0501072_0001033 | 3300049588 | Bacteria | 20627 |
| 823 | Ga0501072_0005126 | 3300049588 | Bacteria | 9964 |
| 824 | Ga0501072_0014460 | 3300049588 | Bacteria | 6047 |
| 825 | Ga0501072_0110898 | 3300049588 | Bacteria | 2184 |
| 826 | Ga0501072_0147728 | 3300049588 | Bacteria | 1874 |
| 827 | Ga0501073_0000034 | 3300049589 | Bacteria | 95224 |
| 828 | Ga0501073_0056616 | 3300049589 | Bacteria | 2742 |
| 829 | Ga0501074_0000271 | 3300049590 | Bacteria | 29628 |
| 830 | Ga0501074_0002163 | 3300049590 | Bacteria | 13619 |
| 831 | Ga0501074_0005773 | 3300049590 | Bacteria | 8929 |
| 832 | Ga0501074_0046422 | 3300049590 | Bacteria | 3141 |
| 833 | Ga0501074_0087424 | 3300049590 | Bacteria | 2232 |
| 834 | Ga0501074_0087680 | 3300049590 | Bacteria | 2228 |
| 835 | Ga0501075_0123271 | 3300049591 | Bacteria | 1973 |
| 836 | Ga0501076_0001519 | 3300049592 | Bacteria | 15560 |
| 837 | Ga0501076_0223454 | 3300049592 | Bacteria | 1539 |
| 838 | Ga0501077_0025710 | 3300049593 | Bacteria | 3737 |
| 839 | Ga0501077_0131182 | 3300049593 | Bacteria | 1589 |
| 840 | Ga0501079_0000773 | 3300049741 | Bacteria | 21906 |
| 841 | Ga0501079_0005639 | 3300049741 | Bacteria | 9343 |
| 842 | Ga0501080_0001103 | 3300049742 | Bacteria | 22242 |
| 843 | Ga0501080_0001428 | 3300049742 | Bacteria | 20060 |
| 844 | Ga0501080_0005894 | 3300049742 | Bacteria | 10975 |
| 845 | Ga0501080_0013998 | 3300049742 | Bacteria | 7383 |
| 846 | Ga0501080_0023073 | 3300049742 | Bacteria | 5770 |
| 847 | Ga0501081_0006217 | 3300049743 | Bacteria | 7739 |
| 848 | Ga0501081_0081936 | 3300049743 | Bacteria | 2260 |
| 849 | Ga0501081_0111849 | 3300049743 | Bacteria | 1939 |
| 850 | Ga0501083_0000118 | 3300049744 | Bacteria | 54096 |
| 851 | Ga0501083_0098174 | 3300049744 | Bacteria | 1932 |
| 852 | Ga0501035_0000137 | 3300049822 | Bacteria | 89273 |
| 853 | Ga0501035_0000155 | 3300049822 | Bacteria | 84012 |
| 854 | Ga0501035_0148229 | 3300049822 | Bacteria | 2037 |
| 855 | Ga0501044_0000548 | 3300049823 | Bacteria | 45787 |
| 856 | Ga0501044_0011998 | 3300049823 | Bacteria | 9387 |
| 857 | Ga0501044_0052450 | 3300049823 | Bacteria | 4202 |
| 858 | Ga0501044_0069453 | 3300049823 | Bacteria | 3586 |
| 859 | Ga0501044_0080864 | 3300049823 | Bacteria | 3290 |
| 860 | Ga0501044_0085375 | 3300049823 | Bacteria | 3190 |
| 861 | Ga0501044_0135826 | 3300049823 | Bacteria | 2451 |
| 862 | Ga0501044_0296542 | 3300049823 | Bacteria | 1547 |
| 863 | Ga0501044_0378718 | 3300049823 | Bacteria | 1330 |
| 864 | Ga0501045_0008590 | 3300049824 | Bacteria | 7119 |
| 865 | Ga0501045_0020888 | 3300049824 | Bacteria | 4681 |
| 866 | nmdc:mga00v17_246567_c1 | 3300050491 | Bacteria | 1158 |
| 867 | nmdc:mga0yw44_17052_c1 | 3300050492 | Bacteria | 3942 |
| 868 | nmdc:mga0yw44_2009_c1 | 3300050492 | Bacteria | 7778 |
| 869 | nmdc:mga0yw44_3972_c1 | 3300050492 | Bacteria | 6681 |
| 870 | nmdc:mga0yw44_723_c1 | 3300050492 | Bacteria | 12145 |
| 871 | nmdc:mga0yw44_88345_c1 | 3300050492 | Bacteria | 1954 |
| 872 | nmdc:mga0yw44_9153_c1 | 3300050492 | Bacteria | 4984 |
| 873 | nmdc:mga06z11_105179_c1 | 3300050494 | Bacteria | 1555 |
| 874 | nmdc:mga06z11_6417_c1 | 3300050494 | Bacteria | 4784 |
| 875 | nmdc:mga06z11_85891_c1 | 3300050494 | Bacteria | 1698 |
| 876 | nmdc:mga06z11_87259_c1 | 3300050494 | Bacteria | 1687 |
| 877 | nmdc:mga07m45_64802_c1 | 3300050496 | Bacteria | 2074 |
| 878 | nmdc:mga05p37_112345_c1 | 3300050507 | Bacteria | 3350 |
| 879 | nmdc:mga05p37_1642_c1 | 3300050507 | Bacteria | 25943 |
| 880 | nmdc:mga05p37_220291_c1 | 3300050507 | Bacteria | 2290 |
| 881 | nmdc:mga05p37_23035_c1 | 3300050507 | Bacteria | 7555 |
| 882 | nmdc:mga05p37_292224_c1 | 3300050507 | Bacteria | 1939 |
| 883 | nmdc:mga05p37_7135_c1 | 3300050507 | Bacteria | 13176 |
| 884 | nmdc:mga09592_104844_c1 | 3300050508 | Bacteria | 2424 |
| 885 | nmdc:mga09592_79704_c1 | 3300050508 | Bacteria | 2788 |
| 886 | nmdc:mga09592_8031_c1 | 3300050508 | Bacteria | 8581 |
| 887 | nmdc:mga0qj67_34763_c1 | 3300050509 | Bacteria | 3939 |
| 888 | nmdc:mga0qj67_38684_c1 | 3300050509 | Bacteria | 3743 |
| 889 | nmdc:mga0qj67_43218_c1 | 3300050509 | Bacteria | 3549 |
| 890 | nmdc:mga06r32_130304_c1 | 3300050510 | Bacteria | 2487 |
| 891 | nmdc:mga06r32_189436_c2 | 3300050510 | Bacteria | 1397 |
| 892 | nmdc:mga06r32_267549_c1 | 3300050510 | Bacteria | 1697 |
| 893 | nmdc:mga06r32_33939_c1 | 3300050510 | Bacteria | 4809 |
| 894 | nmdc:mga06r32_349_c1 | 3300050510 | Bacteria | 38472 |
| 895 | nmdc:mga08y16_136680_c1 | 3300050511 | Bacteria | 2548 |
| 896 | nmdc:mga08y16_166391_c1 | 3300050511 | Bacteria | 2291 |
| 897 | nmdc:mga08y16_220786_c1 | 3300050511 | Bacteria | 1962 |
| 898 | nmdc:mga08y16_418694_c1 | 3300050511 | Bacteria | 1369 |
| 899 | nmdc:mga08y16_4843_c1 | 3300050511 | Bacteria | 14047 |
| 900 | nmdc:mga0n895_195013_c1 | 3300050512 | Bacteria | 2056 |
| 901 | nmdc:mga0n895_34790_c1 | 3300050512 | Bacteria | 4852 |
| 902 | nmdc:mga0n895_6898_c1 | 3300050512 | Bacteria | 9703 |
| 903 | nmdc:mga0rr50_217902_c1 | 3300050513 | Bacteria | 1575 |
| 904 | nmdc:mga0rr50_95825_c1 | 3300050513 | Bacteria | 2320 |
| 905 | nmdc:mga08x19_22091_c2 | 3300050514 | Bacteria | 1903 |
| 906 | nmdc:mga0a205_2525_c1 | 3300050515 | Bacteria | 16123 |
| 907 | Ga0495601_0026423 | 3300053077 | Bacteria | 3585 |
| 908 | Ga0495612_0005134 | 3300053078 | Bacteria | 5413 |
| 909 | Ga0500635_0005633 | 3300053080 | Bacteria | 3299 |
| 910 | Ga0500635_0013826 | 3300053080 | Bacteria | 2352 |
| 911 | Ga0495619_0099938 | 3300053085 | Bacteria | 1973 |
| 912 | Ga0495619_0181116 | 3300053085 | Bacteria | 1458 |
| 913 | Ga0500578_0058889 | 3300053086 | Bacteria | 2455 |
| 914 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 915 | Ga0500583_0035983 | 3300053092 | Bacteria | 2213 |
| 916 | Ga0500651_0001199 | 3300053093 | Bacteria | 12870 |
| 917 | Ga0500651_0034419 | 3300053093 | Bacteria | 3194 |
| 918 | Ga0500566_0000166 | 3300053094 | Bacteria | 33843 |
| 919 | Ga0500566_0001046 | 3300053094 | Bacteria | 16010 |
| 920 | Ga0500566_0002225 | 3300053094 | Bacteria | 11453 |
| 921 | Ga0500640_008096 | 3300053095 | Bacteria | 4136 |
| 922 | Ga0500641_0015896 | 3300053096 | Bacteria | 2798 |
| 923 | Ga0500650_0002778 | 3300053098 | Bacteria | 5888 |
| 924 | Ga0500554_000266 | 3300053102 | Bacteria | 11311 |
| 925 | Ga0500555_000550 | 3300053103 | Bacteria | 14953 |
| 926 | Ga0500556_0000089 | 3300053104 | Bacteria | 84468 |
| 927 | Ga0500569_005744 | 3300053109 | Bacteria | 2682 |
| 928 | Ga0500572_000474 | 3300053111 | Bacteria | 13955 |
| 929 | Ga0500572_000614 | 3300053111 | Bacteria | 11989 |
| 930 | Ga0500592_001069 | 3300053116 | Bacteria | 4472 |
| 931 | Ga0500593_009372 | 3300053117 | Bacteria | 4063 |
| 932 | Ga0500595_001516 | 3300053119 | Bacteria | 12336 |
| 933 | Ga0500595_003730 | 3300053119 | Bacteria | 7025 |
| 934 | Ga0500595_012019 | 3300053119 | Bacteria | 3360 |
| 935 | Ga0500595_014345 | 3300053119 | Bacteria | 3007 |
| 936 | Ga0500608_000206 | 3300053122 | Bacteria | 23563 |
| 937 | Ga0500608_009005 | 3300053122 | Bacteria | 4226 |
| 938 | Ga0500614_001031 | 3300053123 | Bacteria | 6928 |
| 939 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 940 | Ga0500652_001206 | 3300053131 | Bacteria | 8252 |
| 941 | Ga0500658_0018285 | 3300053134 | Bacteria | 2626 |
| 942 | Ga0500559_0000136 | 3300053136 | Bacteria | 56922 |
| 943 | Ga0500559_0002659 | 3300053136 | Bacteria | 9097 |
| 944 | Ga0500559_0014866 | 3300053136 | Bacteria | 3288 |
| 945 | Ga0500568_0001309 | 3300053139 | Bacteria | 16339 |
| 946 | Ga0500568_0005713 | 3300053139 | Bacteria | 6378 |
| 947 | Ga0500577_0004724 | 3300053142 | Bacteria | 3622 |
| 948 | Ga0500586_000203 | 3300053145 | Bacteria | 11555 |
| 949 | Ga0500603_000324 | 3300053150 | Bacteria | 12495 |
| 950 | Ga0500603_000501 | 3300053150 | Bacteria | 9959 |
| 951 | Ga0500604_0002842 | 3300053151 | Bacteria | 4699 |
| 952 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 953 | Ga0500616_0010648 | 3300053153 | Bacteria | 5487 |
| 954 | Ga0500616_0019257 | 3300053153 | Bacteria | 3849 |
| 955 | Ga0500616_0055446 | 3300053153 | Bacteria | 2073 |
| 956 | Ga0500622_0001149 | 3300053156 | Bacteria | 22026 |
| 957 | Ga0500622_0001752 | 3300053156 | Bacteria | 16718 |
| 958 | Ga0500630_001092 | 3300053159 | Bacteria | 12670 |
| 959 | Ga0500638_050524 | 3300053162 | Bacteria | 2011 |
| 960 | Ga0500639_000112 | 3300053163 | Bacteria | 38789 |
| 961 | Ga0500636_0004341 | 3300053177 | Bacteria | 8020 |
| 962 | Ga0500636_0006283 | 3300053177 | Bacteria | 6815 |
| 963 | Ga0500636_0030053 | 3300053177 | Bacteria | 3212 |
| 964 | Ga0500636_0164031 | 3300053177 | Bacteria | 1208 |
| 965 | Ga0500637_0000582 | 3300053178 | Bacteria | 14362 |
| 966 | Ga0500596_002967 | 3300053735 | Bacteria | 3281 |
| 967 | Ga0500599_004061 | 3300053736 | Bacteria | 1801 |
| 968 | Ga0500601_000014 | 3300053737 | Bacteria | 41972 |
| 969 | Ga0501084_0093192 | 3300054114 | Bacteria | 2529 |
| 970 | Ga0501084_0258846 | 3300054114 | Bacteria | 1469 |
| 971 | Ga0500661_004660 | 3300055283 | Bacteria | 2561 |
| 972 | Ga0530510_0000606 | 3300061734 | Bacteria | 23066 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0238151 | Ga0495645_0238151_273_1196 | 297 |
| 2 | 3300026118 | Ga0207675_100046864 | Ga0207675_1000468642 | 298 |
| 3 | 3300053177 | Ga0500636_0030053 | Ga0500636_0030053_796_1875 | 304 |
| 4 | 3300048909 | Ga0496106_0202666 | Ga0496106_0202666_606_1556 | 306 |
| 5 | iso_pu_bacteria | 8006994254 | 8006999540 | 314 |
| 6 | 3300025321 | Ga0207656_10024592 | Ga0207656_100245924 | 316 |
| 7 | 3300048924 | Ga0496121_0001361 | Ga0496121_0001361_13377_14366 | 318 |
| 8 | 3300048927 | Ga0496124_0282579 | Ga0496124_0282579_96_1136 | 321 |
| 9 | 3300053078 | Ga0495612_0005134 | Ga0495612_0005134_987_2081 | 323 |
| 10 | 3300005434 | Ga0070709_10003278 | Ga0070709_100032786 | 324 |
| 11 | 3300025906 | Ga0207699_10005355 | Ga0207699_100053555 | 324 |
| 12 | 3300005436 | Ga0070713_100051119 | Ga0070713_1000511193 | 326 |
| 13 | 3300006175 | Ga0070712_100003519 | Ga0070712_1000035193 | 326 |
| 14 | 3300025915 | Ga0207693_10003010 | Ga0207693_1000301010 | 326 |
| 15 | 3300025928 | Ga0207700_10037733 | Ga0207700_100377333 | 326 |
| 16 | 3300046543 | Ga0495645_0003978 | Ga0495645_0003978_3516_4610 | 327 |
| 17 | 3300053153 | Ga0500616_0055446 | Ga0500616_0055446_1030_2049 | 328 |
| 18 | 3300054114 | Ga0501084_0258846 | Ga0501084_0258846_243_1265 | 330 |
| 19 | 3300005336 | Ga0070680_100238242 | Ga0070680_1002382422 | 331 |
| 20 | 3300037471 | Ga0395905_0021852 | Ga0395905_0021852_4667_5761 | 331 |
| 21 | 3300048915 | Ga0496112_0000111 | Ga0496112_0000111_21195_22289 | 331 |
| 22 | 3300005330 | Ga0070690_100013882 | Ga0070690_1000138822 | 332 |
| 23 | 3300005535 | Ga0070684_100014195 | Ga0070684_1000141954 | 332 |
| 24 | 3300006237 | Ga0097621_100011749 | Ga0097621_1000117495 | 332 |
| 25 | 3300006358 | Ga0068871_100011734 | Ga0068871_1000117345 | 332 |
| 26 | 3300009545 | Ga0105237_10141502 | Ga0105237_101415022 | 332 |
| 27 | 3300025914 | Ga0207671_10095298 | Ga0207671_100952982 | 332 |
| 28 | 3300035111 | Ga0373923_0011906 | Ga0373923_0011906_1540_2634 | 332 |
| 29 | 3300035170 | Ga0373943_0046435 | Ga0373943_0046435_25_1119 | 332 |
| 30 | 3300035695 | Ga0373927_0045067 | Ga0373927_0045067_1105_2199 | 332 |
| 31 | 3300036401 | Ga0373937_0222603 | Ga0373937_0222603_298_1392 | 332 |
| 32 | 3300046459 | Ga0495629_0093433 | Ga0495629_0093433_248_1342 | 332 |
| 33 | 3300046475 | Ga0495639_0018150 | Ga0495639_0018150_149_1243 | 332 |
| 34 | 3300046476 | Ga0495662_0078507 | Ga0495662_0078507_177_1271 | 332 |
| 35 | 3300046477 | Ga0495664_0007965 | Ga0495664_0007965_4062_5156 | 332 |
| 36 | 3300046514 | Ga0495618_0036341 | Ga0495618_0036341_945_2039 | 332 |
| 37 | 3300046517 | Ga0495630_0062697 | Ga0495630_0062697_219_1313 | 332 |
| 38 | 3300046531 | Ga0495665_0003915 | Ga0495665_0003915_5138_6232 | 332 |
| 39 | 3300046533 | Ga0495640_0032438 | Ga0495640_0032438_725_1819 | 332 |
| 40 | 3300046535 | Ga0495586_0116978 | Ga0495586_0116978_318_1412 | 332 |
| 41 | 3300046642 | Ga0495634_0020608 | Ga0495634_0020608_461_1555 | 332 |
| 42 | 3300046678 | Ga0495599_0134971 | Ga0495599_0134971_295_1389 | 332 |
| 43 | 3300046680 | Ga0495646_0095072 | Ga0495646_0095072_91_1185 | 332 |
| 44 | 3300047315 | Ga0495581_0104799 | Ga0495581_0104799_369_1463 | 332 |
| 45 | 3300047471 | Ga0495684_0045233 | Ga0495684_0045233_1902_2996 | 332 |
| 46 | 3300047673 | Ga0495593_0054623 | Ga0495593_0054623_34_1128 | 332 |
| 47 | 3300053153 | Ga0500616_0010648 | Ga0500616_0010648_1428_2516 | 332 |
| 48 | 3300005327 | Ga0070658_10175543 | Ga0070658_101755432 | 333 |
| 49 | 3300005548 | Ga0070665_100136357 | Ga0070665_1001363572 | 333 |
| 50 | 3300028379 | Ga0268266_10070938 | Ga0268266_100709382 | 333 |
| 51 | 3300031548 | Ga0307408_100145992 | Ga0307408_1001459922 | 333 |
| 52 | 3300032002 | Ga0307416_100055750 | Ga0307416_1000557503 | 333 |
| 53 | 3300035089 | Ga0373944_0009047 | Ga0373944_0009047_223_1317 | 333 |
| 54 | 3300046472 | Ga0495580_0046389 | Ga0495580_0046389_654_1748 | 333 |
| 55 | 3300046506 | Ga0495583_0097198 | Ga0495583_0097198_21_1052 | 333 |
| 56 | 3300046681 | Ga0495647_0024349 | Ga0495647_0024349_428_1522 | 333 |
| 57 | 3300048918 | Ga0496115_0094542 | Ga0496115_0094542_12_1043 | 333 |
| 58 | 3300048921 | Ga0496118_0081687 | Ga0496118_0081687_755_1849 | 333 |
| 59 | 3300048929 | Ga0496126_0043418 | Ga0496126_0043418_2080_3174 | 333 |
| 60 | 3300053119 | Ga0500595_014345 | Ga0500595_014345_859_1953 | 334 |
| 61 | 3300005355 | Ga0070671_100034516 | Ga0070671_1000345161 | 335 |
| 62 | 3300046525 | Ga0495663_0043783 | Ga0495663_0043783_305_1342 | 335 |
| 63 | 3300047320 | Ga0495672_0138756 | Ga0495672_0138756_147_1241 | 335 |
| 64 | 3300048911 | Ga0496108_0008496 | Ga0496108_0008496_4728_5801 | 335 |
| 65 | 3300053094 | Ga0500566_0001046 | Ga0500566_0001046_57_1151 | 335 |
| 66 | 3300053095 | Ga0500640_008096 | Ga0500640_008096_653_1747 | 335 |
| 67 | 3300053111 | Ga0500572_000474 | Ga0500572_000474_6803_7897 | 335 |
| 68 | 3300053122 | Ga0500608_009005 | Ga0500608_009005_312_1406 | 335 |
| 69 | 3300053123 | Ga0500614_001031 | Ga0500614_001031_3319_4413 | 335 |
| 70 | 3300053136 | Ga0500559_0014866 | Ga0500559_0014866_1329_2423 | 335 |
| 71 | 3300053150 | Ga0500603_000501 | Ga0500603_000501_2950_4044 | 335 |
| 72 | 3300053159 | Ga0500630_001092 | Ga0500630_001092_4562_5656 | 335 |
| 73 | 3300053162 | Ga0500638_050524 | Ga0500638_050524_548_1642 | 335 |
| 74 | 3300053163 | Ga0500639_000112 | Ga0500639_000112_22820_23914 | 335 |
| 75 | 3300005439 | Ga0070711_100026368 | Ga0070711_1000263683 | 336 |
| 76 | 3300025898 | Ga0207692_10012566 | Ga0207692_100125662 | 336 |
| 77 | 3300005336 | Ga0070680_100179916 | Ga0070680_1001799161 | 337 |
| 78 | 3300005341 | Ga0070691_10020416 | Ga0070691_100204163 | 337 |
| 79 | 3300005458 | Ga0070681_10000175 | Ga0070681_1000017526 | 337 |
| 80 | 3300005530 | Ga0070679_100050863 | Ga0070679_1000508635 | 337 |
| 81 | 3300005546 | Ga0070696_100061847 | Ga0070696_1000618473 | 337 |
| 82 | 3300006844 | Ga0075428_100282740 | Ga0075428_1002827402 | 337 |
| 83 | 3300006846 | Ga0075430_100001924 | Ga0075430_1000019246 | 337 |
| 84 | 3300025912 | Ga0207707_10000660 | Ga0207707_100006609 | 337 |
| 85 | 3300025917 | Ga0207660_10218085 | Ga0207660_102180852 | 337 |
| 86 | 3300006038 | Ga0075365_10005112 | Ga0075365_100051123 | 338 |
| 87 | 3300035695 | Ga0373927_0086095 | Ga0373927_0086095_327_1421 | 338 |
| 88 | 3300049570 | Ga0501033_0209346 | Ga0501033_0209346_280_1329 | 338 |
| 89 | 3300049572 | Ga0501036_0054745 | Ga0501036_0054745_1922_2971 | 338 |
| 90 | 3300049574 | Ga0501038_0032296 | Ga0501038_0032296_2344_3393 | 338 |
| 91 | 3300049575 | Ga0501039_0034867 | Ga0501039_0034867_267_1316 | 338 |
| 92 | 3300049576 | Ga0501040_0003761 | Ga0501040_0003761_2004_3053 | 338 |
| 93 | 3300049577 | Ga0501041_0001759 | Ga0501041_0001759_1765_2814 | 338 |
| 94 | 3300049580 | Ga0501046_0019371 | Ga0501046_0019371_926_1975 | 338 |
| 95 | 3300049587 | Ga0501071_0031190 | Ga0501071_0031190_1149_2198 | 338 |
| 96 | 3300049588 | Ga0501072_0005126 | Ga0501072_0005126_2891_3940 | 338 |
| 97 | 3300049590 | Ga0501074_0087424 | Ga0501074_0087424_839_1888 | 338 |
| 98 | 3300049592 | Ga0501076_0001519 | Ga0501076_0001519_10592_11641 | 338 |
| 99 | 3300049741 | Ga0501079_0005639 | Ga0501079_0005639_1373_2422 | 338 |
| 100 | 3300049742 | Ga0501080_0023073 | Ga0501080_0023073_3120_4169 | 338 |
| 101 | 3300049743 | Ga0501081_0006217 | Ga0501081_0006217_1772_2821 | 338 |
| 102 | 3300049824 | Ga0501045_0020888 | Ga0501045_0020888_2054_3103 | 338 |
| 103 | 3300050492 | nmdc:mga0yw44_9153_c1 | nmdc:mga0yw44_9153_c1_1491_2660 | 338 |
| 104 | 3300061734 | Ga0530510_0000606 | Ga0530510_0000606_17162_18211 | 338 |
| 105 | 3300005439 | Ga0070711_100080806 | Ga0070711_1000808062 | 339 |
| 106 | 3300025906 | Ga0207699_10085572 | Ga0207699_100855722 | 339 |
| 107 | 3300025916 | Ga0207663_10019711 | Ga0207663_100197112 | 339 |
| 108 | 3300026067 | Ga0207678_10030711 | Ga0207678_100307112 | 339 |
| 109 | 3300046460 | Ga0495638_0022968 | Ga0495638_0022968_2708_3802 | 339 |
| 110 | 3300046522 | Ga0495643_0100146 | Ga0495643_0100146_320_1414 | 339 |
| 111 | 3300048920 | Ga0496117_0066703 | Ga0496117_0066703_1007_2101 | 339 |
| 112 | 3300048924 | Ga0496121_0006808 | Ga0496121_0006808_1732_2826 | 339 |
| 113 | 3300048928 | Ga0496125_0062019 | Ga0496125_0062019_1295_2389 | 339 |
| 114 | 3300053093 | Ga0500651_0034419 | Ga0500651_0034419_359_1453 | 339 |
| 115 | 3300053094 | Ga0500566_0002225 | Ga0500566_0002225_6064_7158 | 339 |
| 116 | 3300053104 | Ga0500556_0000089 | Ga0500556_0000089_6592_7686 | 339 |
| 117 | 3300053109 | Ga0500569_005744 | Ga0500569_005744_1563_2657 | 339 |
| 118 | 3300053116 | Ga0500592_001069 | Ga0500592_001069_2823_3917 | 339 |
| 119 | 3300053122 | Ga0500608_000206 | Ga0500608_000206_493_1587 | 339 |
| 120 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_81402_82496 | 339 |
| 121 | 3300053156 | Ga0500622_0001149 | Ga0500622_0001149_14810_15904 | 339 |
| 122 | 3300053177 | Ga0500636_0006283 | Ga0500636_0006283_960_2054 | 339 |
| 123 | 3300031711 | Ga0265314_10005071 | Ga0265314_100050718 | 340 |
| 124 | 3300044694 | Ga0466963_0049448 | Ga0466963_0049448_1230_2324 | 340 |
| 125 | 3300045976 | Ga0466967_0017307 | Ga0466967_0017307_4373_5467 | 340 |
| 126 | 3300049584 | Ga0501068_0015826 | Ga0501068_0015826_2703_3755 | 340 |
| 127 | 3300049587 | Ga0501071_0001483 | Ga0501071_0001483_4904_5956 | 340 |
| 128 | 3300049742 | Ga0501080_0001428 | Ga0501080_0001428_639_1691 | 340 |
| 129 | 3300005548 | Ga0070665_100385969 | Ga0070665_1003859692 | 341 |
| 130 | 3300006051 | Ga0075364_10084056 | Ga0075364_100840562 | 341 |
| 131 | 3300009094 | Ga0111539_10012637 | Ga0111539_100126372 | 341 |
| 132 | 3300025297 | Ga0209758_1012674 | Ga0209758_10126742 | 341 |
| 133 | 3300026035 | Ga0207703_10442420 | Ga0207703_104424202 | 341 |
| 134 | 3300005616 | Ga0068852_100340479 | Ga0068852_1003404792 | 342 |
| 135 | 3300005985 | Ga0081539_10000233 | Ga0081539_1000023340 | 342 |
| 136 | 3300026142 | Ga0207698_10221241 | Ga0207698_102212412 | 342 |
| 137 | 3300028380 | Ga0268265_10093290 | Ga0268265_100932902 | 342 |
| 138 | 3300028381 | Ga0268264_10218968 | Ga0268264_102189682 | 342 |
| 139 | 3300046507 | Ga0495606_0126946 | Ga0495606_0126946_387_1475 | 342 |
| 140 | 3300005353 | Ga0070669_100033660 | Ga0070669_1000336603 | 343 |
| 141 | 3300005842 | Ga0068858_100304893 | Ga0068858_1003048932 | 343 |
| 142 | iso_pu_bacteria | 2891048133 | 2891049781 | 343 |
| 143 | 3300006844 | Ga0075428_100086548 | Ga0075428_1000865482 | 344 |
| 144 | 3300006847 | Ga0075431_100005570 | Ga0075431_10000557012 | 344 |
| 145 | 3300009147 | Ga0114129_10004768 | Ga0114129_100047686 | 344 |
| 146 | 3300049582 | Ga0501048_0166735 | Ga0501048_0166735_263_1330 | 344 |
| 147 | 3300050507 | nmdc:mga05p37_7135_c1 | nmdc:mga05p37_7135_c1_2782_3885 | 344 |
| 148 | 3300050508 | nmdc:mga09592_79704_c1 | nmdc:mga09592_79704_c1_43_1146 | 344 |
| 149 | 3300050509 | nmdc:mga0qj67_38684_c1 | nmdc:mga0qj67_38684_c1_562_1665 | 344 |
| 150 | 3300050510 | nmdc:mga06r32_267549_c1 | nmdc:mga06r32_267549_c1_236_1339 | 344 |
| 151 | 3300025920 | Ga0207649_10225494 | Ga0207649_102254942 | 345 |
| 152 | 3300005327 | Ga0070658_10003236 | Ga0070658_1000323612 | 346 |
| 153 | 3300005336 | Ga0070680_100010261 | Ga0070680_1000102612 | 346 |
| 154 | 3300005435 | Ga0070714_100044131 | Ga0070714_1000441312 | 346 |
| 155 | 3300005563 | Ga0068855_100026681 | Ga0068855_1000266816 | 346 |
| 156 | 3300005614 | Ga0068856_100033270 | Ga0068856_1000332704 | 346 |
| 157 | 3300005616 | Ga0068852_100008740 | Ga0068852_1000087405 | 346 |
| 158 | 3300005616 | Ga0068852_100054771 | Ga0068852_1000547714 | 346 |
| 159 | 3300013105 | Ga0157369_10129388 | Ga0157369_101293881 | 346 |
| 160 | 3300013307 | Ga0157372_10569198 | Ga0157372_105691982 | 346 |
| 161 | 3300013307 | Ga0157372_10588888 | Ga0157372_105888881 | 346 |
| 162 | 3300025909 | Ga0207705_10031006 | Ga0207705_100310062 | 346 |
| 163 | 3300025929 | Ga0207664_10264258 | Ga0207664_102642582 | 346 |
| 164 | 3300025949 | Ga0207667_10023066 | Ga0207667_100230662 | 346 |
| 165 | 3300025949 | Ga0207667_10085017 | Ga0207667_100850173 | 346 |
| 166 | 3300026078 | Ga0207702_10052278 | Ga0207702_100522782 | 346 |
| 167 | 3300026142 | Ga0207698_10025095 | Ga0207698_100250954 | 346 |
| 168 | 3300026142 | Ga0207698_10399243 | Ga0207698_103992431 | 346 |
| 169 | 3300031595 | Ga0265313_10054612 | Ga0265313_100546122 | 346 |
| 170 | 3300031712 | Ga0265342_10000638 | Ga0265342_1000063818 | 346 |
| 171 | 3300032002 | Ga0307416_100073436 | Ga0307416_1000734363 | 346 |
| 172 | 3300039450 | Ga0436363_1647914 | Ga0436363_1647914_2030_3106 | 346 |
| 173 | 3300049571 | Ga0501034_0203493 | Ga0501034_0203493_697_1779 | 346 |
| 174 | 3300049571 | Ga0501034_0483255 | Ga0501034_0483255_22_1101 | 346 |
| 175 | 3300049581 | Ga0501047_0008093 | Ga0501047_0008093_5181_6260 | 346 |
| 176 | 3300049581 | Ga0501047_0084811 | Ga0501047_0084811_1005_2114 | 346 |
| 177 | 3300049584 | Ga0501068_0054094 | Ga0501068_0054094_540_1622 | 346 |
| 178 | 3300049585 | Ga0501069_0033054 | Ga0501069_0033054_255_1337 | 346 |
| 179 | 3300049586 | Ga0501070_0080256 | Ga0501070_0080256_147_1229 | 346 |
| 180 | 3300049587 | Ga0501071_0093188 | Ga0501071_0093188_654_1736 | 346 |
| 181 | 3300049588 | Ga0501072_0110898 | Ga0501072_0110898_773_1855 | 346 |
| 182 | 3300049589 | Ga0501073_0056616 | Ga0501073_0056616_197_1279 | 346 |
| 183 | 3300049590 | Ga0501074_0046422 | Ga0501074_0046422_189_1268 | 346 |
| 184 | 3300049590 | Ga0501074_0087680 | Ga0501074_0087680_200_1282 | 346 |
| 185 | 3300034819 | Ga0373958_0022808 | Ga0373958_0022808_28_1119 | 347 |
| 186 | 3300034820 | Ga0373959_0018904 | Ga0373959_0018904_134_1225 | 347 |
| 187 | 3300035691 | Ga0373931_0003998 | Ga0373931_0003998_1129_2220 | 347 |
| 188 | 3300005327 | Ga0070658_10010916 | Ga0070658_100109161 | 348 |
| 189 | 3300005336 | Ga0070680_100218955 | Ga0070680_1002189552 | 348 |
| 190 | 3300005455 | Ga0070663_100072815 | Ga0070663_1000728151 | 348 |
| 191 | 3300005530 | Ga0070679_100247687 | Ga0070679_1002476871 | 348 |
| 192 | 3300009093 | Ga0105240_10022848 | Ga0105240_100228482 | 348 |
| 193 | 3300025913 | Ga0207695_10213368 | Ga0207695_102133682 | 348 |
| 194 | 3300025917 | Ga0207660_10274951 | Ga0207660_102749511 | 348 |
| 195 | 3300025949 | Ga0207667_10359271 | Ga0207667_103592712 | 348 |
| 196 | 3300025981 | Ga0207640_10214745 | Ga0207640_102147452 | 348 |
| 197 | 3300026078 | Ga0207702_10057390 | Ga0207702_100573904 | 348 |
| 198 | 3300031247 | Ga0265340_10023855 | Ga0265340_100238552 | 348 |
| 199 | 3300044693 | Ga0466961_0125511 | Ga0466961_0125511_177_1256 | 348 |
| 200 | 3300044694 | Ga0466963_0049544 | Ga0466963_0049544_288_1424 | 348 |
| 201 | 3300044719 | Ga0466971_0037312 | Ga0466971_0037312_379_1458 | 348 |
| 202 | 3300044842 | Ga0466957_0014169 | Ga0466957_0014169_402_1538 | 348 |
| 203 | 3300045049 | Ga0466959_0035145 | Ga0466959_0035145_381_1517 | 348 |
| 204 | 3300045836 | Ga0466958_0024101 | Ga0466958_0024101_1873_3009 | 348 |
| 205 | 3300046453 | Ga0495627_000265 | Ga0495627_000265_25436_26542 | 348 |
| 206 | 3300046463 | Ga0495653_0000284 | Ga0495653_0000284_22999_24105 | 348 |
| 207 | 3300046471 | Ga0495650_0017744 | Ga0495650_0017744_2319_3425 | 348 |
| 208 | 3300046507 | Ga0495606_0000805 | Ga0495606_0000805_33109_34215 | 348 |
| 209 | 3300046518 | Ga0495631_0000222 | Ga0495631_0000222_34870_35976 | 348 |
| 210 | 3300046519 | Ga0495632_0044419 | Ga0495632_0044419_825_1931 | 348 |
| 211 | 3300046530 | Ga0495654_0004595 | Ga0495654_0004595_5623_6729 | 348 |
| 212 | 3300046530 | Ga0495654_0100487 | Ga0495654_0100487_92_1198 | 348 |
| 213 | 3300046692 | Ga0495671_0022340 | Ga0495671_0022340_2110_3216 | 348 |
| 214 | 3300047320 | Ga0495672_0011483 | Ga0495672_0011483_997_2103 | 348 |
| 215 | 3300048924 | Ga0496121_0085872 | Ga0496121_0085872_496_1575 | 348 |
| 216 | 3300049459 | Ga0495678_005201 | Ga0495678_005201_2963_4069 | 348 |
| 217 | 3300049569 | Ga0501032_0050080 | Ga0501032_0050080_1341_2420 | 348 |
| 218 | 3300049571 | Ga0501034_0027553 | Ga0501034_0027553_661_1740 | 348 |
| 219 | 3300049572 | Ga0501036_0020262 | Ga0501036_0020262_2238_3317 | 348 |
| 220 | 3300049579 | Ga0501043_0039221 | Ga0501043_0039221_710_1789 | 348 |
| 221 | 3300049580 | Ga0501046_0021384 | Ga0501046_0021384_3758_4810 | 348 |
| 222 | 3300049822 | Ga0501035_0148229 | Ga0501035_0148229_140_1219 | 348 |
| 223 | 3300049823 | Ga0501044_0080864 | Ga0501044_0080864_979_2058 | 348 |
| 224 | 3300053077 | Ga0495601_0026423 | Ga0495601_0026423_274_1353 | 348 |
| 225 | 3300053177 | Ga0500636_0164031 | Ga0500636_0164031_28_1107 | 348 |
| 226 | 3300005530 | Ga0070679_100066082 | Ga0070679_1000660823 | 349 |
| 227 | 3300005535 | Ga0070684_100003962 | Ga0070684_1000039622 | 349 |
| 228 | 3300025921 | Ga0207652_10017792 | Ga0207652_100177925 | 349 |
| 229 | 3300037418 | Ga0395900_0000943 | Ga0395900_0000943_29730_30806 | 349 |
| 230 | 3300037466 | Ga0395898_0002974 | Ga0395898_0002974_8352_9428 | 349 |
| 231 | 3300037471 | Ga0395905_0062455 | Ga0395905_0062455_2197_3273 | 349 |
| 232 | 3300038443 | Ga0395901_0001973 | Ga0395901_0001973_10540_11616 | 349 |
| 233 | 3300046471 | Ga0495650_0078605 | Ga0495650_0078605_169_1248 | 349 |
| 234 | 3300053111 | Ga0500572_000614 | Ga0500572_000614_3127_4209 | 349 |
| 235 | 3300053136 | Ga0500559_0002659 | Ga0500559_0002659_2114_3196 | 349 |
| 236 | iso_pu_bacteria | 2508501128 | 2509148602 | 349 |
| 237 | iso_pu_bacteria | 2513237101 | 2513698241 | 349 |
| 238 | iso_pu_bacteria | 2721755755 | 2723848571 | 349 |
| 239 | iso_pu_bacteria | 2728368998 | 2728755224 | 349 |
| 240 | iso_pu_bacteria | 2775507049 | 2776915780 | 349 |
| 241 | iso_pu_bacteria | 2791355199 | 2793077555 | 349 |
| 242 | iso_pu_bacteria | 2874604998 | 2874606254 | 349 |
| 243 | iso_pu_bacteria | 2876808645 | 2876818405 | 349 |
| 244 | iso_pu_bacteria | 2879110137 | 2879113184 | 349 |
| 245 | iso_pu_bacteria | 2889033259 | 2889036846 | 349 |
| 246 | iso_pu_bacteria | 2904690495 | 2904698448 | 349 |
| 247 | iso_pu_bacteria | 2908756301 | 2908762540 | 349 |
| 248 | iso_pu_bacteria | 3005718088 | 3005721114 | 349 |
| 249 | iso_pu_bacteria | 8006984368 | 8006988301 | 349 |
| 250 | iso_pu_bacteria | 8019547302 | 8019547775 | 349 |
| 251 | 3300050511 | nmdc:mga08y16_220786_c1 | nmdc:mga08y16_220786_c1_818_1897 | 350 |
| 252 | 3300005937 | Ga0081455_10003864 | Ga0081455_1000386413 | 351 |
| 253 | 3300007076 | Ga0075435_100053444 | Ga0075435_1000534442 | 351 |
| 254 | 3300013297 | Ga0157378_10573305 | Ga0157378_105733051 | 351 |
| 255 | 3300025295 | Ga0209564_1000936 | Ga0209564_100093619 | 351 |
| 256 | 3300028577 | Ga0265318_10023748 | Ga0265318_100237482 | 351 |
| 257 | 3300046691 | Ga0495670_0032726 | Ga0495670_0032726_427_1521 | 351 |
| 258 | 3300048919 | Ga0496116_0000520 | Ga0496116_0000520_1818_2912 | 351 |
| 259 | 3300048921 | Ga0496118_0011335 | Ga0496118_0011335_5352_6446 | 351 |
| 260 | 3300048923 | Ga0496120_0034572 | Ga0496120_0034572_1478_2572 | 351 |
| 261 | 3300048925 | Ga0496122_0025290 | Ga0496122_0025290_704_1798 | 351 |
| 262 | 3300048926 | Ga0496123_0028625 | Ga0496123_0028625_611_1705 | 351 |
| 263 | 3300050513 | nmdc:mga0rr50_217902_c1 | nmdc:mga0rr50_217902_c1_62_1153 | 351 |
| 264 | 3300053098 | Ga0500650_0002778 | Ga0500650_0002778_1301_2395 | 351 |
| 265 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_111548_112642 | 351 |
| 266 | 3300053131 | Ga0500652_001206 | Ga0500652_001206_5042_6136 | 351 |
| 267 | 3300053136 | Ga0500559_0000136 | Ga0500559_0000136_49823_50917 | 351 |
| 268 | 3300053139 | Ga0500568_0001309 | Ga0500568_0001309_11975_13069 | 351 |
| 269 | 3300053145 | Ga0500586_000203 | Ga0500586_000203_2120_3214 | 351 |
| 270 | 3300053151 | Ga0500604_0002842 | Ga0500604_0002842_30_1124 | 351 |
| 271 | 3300005331 | Ga0070670_100279834 | Ga0070670_1002798342 | 352 |
| 272 | 3300009545 | Ga0105237_10030977 | Ga0105237_100309773 | 352 |
| 273 | 3300025914 | Ga0207671_10116738 | Ga0207671_101167382 | 352 |
| 274 | 3300025922 | Ga0207646_10308109 | Ga0207646_103081092 | 352 |
| 275 | 3300026067 | Ga0207678_10008751 | Ga0207678_100087516 | 352 |
| 276 | 3300037466 | Ga0395898_0046280 | Ga0395898_0046280_2126_3217 | 352 |
| 277 | 3300046524 | Ga0495648_0003600 | Ga0495648_0003600_4580_5674 | 352 |
| 278 | 3300049588 | Ga0501072_0014460 | Ga0501072_0014460_1650_2738 | 352 |
| 279 | 3300053142 | Ga0500577_0004724 | Ga0500577_0004724_2254_3348 | 352 |
| 280 | 3300003214 | JGI25165J46597_1002599 | JGI25165J46597_10025992 | 353 |
| 281 | 3300003215 | JGI25153J46596_10000110 | JGI25153J46596_1000011044 | 353 |
| 282 | 3300003215 | JGI25153J46596_10000161 | JGI25153J46596_1000016172 | 353 |
| 283 | 3300003215 | JGI25153J46596_10000354 | JGI25153J46596_1000035424 | 353 |
| 284 | 3300003215 | JGI25153J46596_10013618 | JGI25153J46596_100136182 | 353 |
| 285 | 3300003354 | JGI25160J50197_1001256 | JGI25160J50197_100125612 | 353 |
| 286 | 3300003354 | JGI25160J50197_1002809 | JGI25160J50197_10028093 | 353 |
| 287 | 3300003354 | JGI25160J50197_1015732 | JGI25160J50197_10157322 | 353 |
| 288 | 3300003659 | JGI25404J52841_10002388 | JGI25404J52841_100023885 | 353 |
| 289 | 3300003752 | Ga0055539_1005461 | Ga0055539_10054611 | 353 |
| 290 | 3300005262 | Ga0065165_1000368 | Ga0065165_10003687 | 353 |
| 291 | 3300005262 | Ga0065165_1008246 | Ga0065165_10082464 | 353 |
| 292 | 3300005262 | Ga0065165_1009309 | Ga0065165_10093093 | 353 |
| 293 | 3300005329 | Ga0070683_100001547 | Ga0070683_1000015472 | 353 |
| 294 | 3300005329 | Ga0070683_100044771 | Ga0070683_1000447713 | 353 |
| 295 | 3300005329 | Ga0070683_100302038 | Ga0070683_1003020382 | 353 |
| 296 | 3300005331 | Ga0070670_100045187 | Ga0070670_1000451873 | 353 |
| 297 | 3300005340 | Ga0070689_100109763 | Ga0070689_1001097631 | 353 |
| 298 | 3300005341 | Ga0070691_10017992 | Ga0070691_100179922 | 353 |
| 299 | 3300005341 | Ga0070691_10071355 | Ga0070691_100713552 | 353 |
| 300 | 3300005347 | Ga0070668_100181295 | Ga0070668_1001812951 | 353 |
| 301 | 3300005355 | Ga0070671_100014431 | Ga0070671_1000144311 | 353 |
| 302 | 3300005355 | Ga0070671_100294355 | Ga0070671_1002943551 | 353 |
| 303 | 3300005364 | Ga0070673_100115785 | Ga0070673_1001157852 | 353 |
| 304 | 3300005365 | Ga0070688_100078136 | Ga0070688_1000781362 | 353 |
| 305 | 3300005435 | Ga0070714_100041919 | Ga0070714_1000419193 | 353 |
| 306 | 3300005435 | Ga0070714_100085282 | Ga0070714_1000852822 | 353 |
| 307 | 3300005435 | Ga0070714_100356821 | Ga0070714_1003568211 | 353 |
| 308 | 3300005436 | Ga0070713_100034739 | Ga0070713_1000347391 | 353 |
| 309 | 3300005436 | Ga0070713_100094168 | Ga0070713_1000941682 | 353 |
| 310 | 3300005436 | Ga0070713_100312394 | Ga0070713_1003123942 | 353 |
| 311 | 3300005437 | Ga0070710_10000965 | Ga0070710_100009657 | 353 |
| 312 | 3300005437 | Ga0070710_10074086 | Ga0070710_100740861 | 353 |
| 313 | 3300005439 | Ga0070711_100056653 | Ga0070711_1000566532 | 353 |
| 314 | 3300005441 | Ga0070700_100044720 | Ga0070700_1000447202 | 353 |
| 315 | 3300005444 | Ga0070694_100037235 | Ga0070694_1000372352 | 353 |
| 316 | 3300005455 | Ga0070663_100044284 | Ga0070663_1000442842 | 353 |
| 317 | 3300005455 | Ga0070663_100054431 | Ga0070663_1000544312 | 353 |
| 318 | 3300005456 | Ga0070678_100041599 | Ga0070678_1000415992 | 353 |
| 319 | 3300005457 | Ga0070662_100079404 | Ga0070662_1000794042 | 353 |
| 320 | 3300005458 | Ga0070681_10006255 | Ga0070681_1000625511 | 353 |
| 321 | 3300005458 | Ga0070681_10016774 | Ga0070681_100167745 | 353 |
| 322 | 3300005458 | Ga0070681_10098798 | Ga0070681_100987983 | 353 |
| 323 | 3300005471 | Ga0070698_100036085 | Ga0070698_1000360854 | 353 |
| 324 | 3300005471 | Ga0070698_100088787 | Ga0070698_1000887871 | 353 |
| 325 | 3300005530 | Ga0070679_100004326 | Ga0070679_10000432612 | 353 |
| 326 | 3300005530 | Ga0070679_100014878 | Ga0070679_1000148783 | 353 |
| 327 | 3300005530 | Ga0070679_100038377 | Ga0070679_1000383772 | 353 |
| 328 | 3300005535 | Ga0070684_100006353 | Ga0070684_1000063532 | 353 |
| 329 | 3300005535 | Ga0070684_100041821 | Ga0070684_1000418213 | 353 |
| 330 | 3300005539 | Ga0068853_100016336 | Ga0068853_1000163365 | 353 |
| 331 | 3300005539 | Ga0068853_100047840 | Ga0068853_1000478403 | 353 |
| 332 | 3300005539 | Ga0068853_100125945 | Ga0068853_1001259452 | 353 |
| 333 | 3300005539 | Ga0068853_100210295 | Ga0068853_1002102952 | 353 |
| 334 | 3300005543 | Ga0070672_100059922 | Ga0070672_1000599222 | 353 |
| 335 | 3300005545 | Ga0070695_100001092 | Ga0070695_1000010925 | 353 |
| 336 | 3300005548 | Ga0070665_100018220 | Ga0070665_1000182203 | 353 |
| 337 | 3300005548 | Ga0070665_100020007 | Ga0070665_1000200077 | 353 |
| 338 | 3300005548 | Ga0070665_100101330 | Ga0070665_1001013303 | 353 |
| 339 | 3300005548 | Ga0070665_100227680 | Ga0070665_1002276802 | 353 |
| 340 | 3300005563 | Ga0068855_100035664 | Ga0068855_1000356643 | 353 |
| 341 | 3300005563 | Ga0068855_100062155 | Ga0068855_1000621553 | 353 |
| 342 | 3300005564 | Ga0070664_100131375 | Ga0070664_1001313752 | 353 |
| 343 | 3300005577 | Ga0068857_100085563 | Ga0068857_1000855632 | 353 |
| 344 | 3300005577 | Ga0068857_100141905 | Ga0068857_1001419051 | 353 |
| 345 | 3300005577 | Ga0068857_100311968 | Ga0068857_1003119681 | 353 |
| 346 | 3300005614 | Ga0068856_100000147 | Ga0068856_10000014756 | 353 |
| 347 | 3300005614 | Ga0068856_100083507 | Ga0068856_1000835074 | 353 |
| 348 | 3300005614 | Ga0068856_100148417 | Ga0068856_1001484172 | 353 |
| 349 | 3300005614 | Ga0068856_100200723 | Ga0068856_1002007232 | 353 |
| 350 | 3300005616 | Ga0068852_100091652 | Ga0068852_1000916523 | 353 |
| 351 | 3300005617 | Ga0068859_100378074 | Ga0068859_1003780742 | 353 |
| 352 | 3300005618 | Ga0068864_100011985 | Ga0068864_1000119856 | 353 |
| 353 | 3300005618 | Ga0068864_100172453 | Ga0068864_1001724532 | 353 |
| 354 | 3300005841 | Ga0068863_100112064 | Ga0068863_1001120643 | 353 |
| 355 | 3300005841 | Ga0068863_100122013 | Ga0068863_1001220132 | 353 |
| 356 | 3300005842 | Ga0068858_100037736 | Ga0068858_1000377363 | 353 |
| 357 | 3300005842 | Ga0068858_100400582 | Ga0068858_1004005821 | 353 |
| 358 | 3300005843 | Ga0068860_100000302 | Ga0068860_10000030250 | 353 |
| 359 | 3300005843 | Ga0068860_100101960 | Ga0068860_1001019603 | 353 |
| 360 | 3300005844 | Ga0068862_100112394 | Ga0068862_1001123942 | 353 |
| 361 | 3300005937 | Ga0081455_10000058 | Ga0081455_1000005846 | 353 |
| 362 | 3300005937 | Ga0081455_10000473 | Ga0081455_1000047349 | 353 |
| 363 | 3300005937 | Ga0081455_10005003 | Ga0081455_1000500311 | 353 |
| 364 | 3300005937 | Ga0081455_10014063 | Ga0081455_100140635 | 353 |
| 365 | 3300005937 | Ga0081455_10015554 | Ga0081455_100155543 | 353 |
| 366 | 3300005937 | Ga0081455_10037473 | Ga0081455_100374732 | 353 |
| 367 | 3300005981 | Ga0081538_10023150 | Ga0081538_100231503 | 353 |
| 368 | 3300005983 | Ga0081540_1000008 | Ga0081540_1000008115 | 353 |
| 369 | 3300005983 | Ga0081540_1000040 | Ga0081540_100004054 | 353 |
| 370 | 3300005983 | Ga0081540_1003917 | Ga0081540_10039172 | 353 |
| 371 | 3300005983 | Ga0081540_1009587 | Ga0081540_10095874 | 353 |
| 372 | 3300005983 | Ga0081540_1010771 | Ga0081540_10107712 | 353 |
| 373 | 3300005983 | Ga0081540_1024661 | Ga0081540_10246613 | 353 |
| 374 | 3300005985 | Ga0081539_10000172 | Ga0081539_10000172100 | 353 |
| 375 | 3300005985 | Ga0081539_10039458 | Ga0081539_100394582 | 353 |
| 376 | 3300005985 | Ga0081539_10054543 | Ga0081539_100545432 | 353 |
| 377 | 3300006028 | Ga0070717_10028261 | Ga0070717_100282612 | 353 |
| 378 | 3300006028 | Ga0070717_10032708 | Ga0070717_100327082 | 353 |
| 379 | 3300006038 | Ga0075365_10015652 | Ga0075365_100156523 | 353 |
| 380 | 3300006038 | Ga0075365_10150692 | Ga0075365_101506922 | 353 |
| 381 | 3300006038 | Ga0075365_10189937 | Ga0075365_101899372 | 353 |
| 382 | 3300006042 | Ga0075368_10000322 | Ga0075368_1000032211 | 353 |
| 383 | 3300006048 | Ga0075363_100011548 | Ga0075363_1000115484 | 353 |
| 384 | 3300006048 | Ga0075363_100137119 | Ga0075363_1001371192 | 353 |
| 385 | 3300006051 | Ga0075364_10015259 | Ga0075364_100152592 | 353 |
| 386 | 3300006051 | Ga0075364_10029052 | Ga0075364_100290522 | 353 |
| 387 | 3300006175 | Ga0070712_100121997 | Ga0070712_1001219972 | 353 |
| 388 | 3300006178 | Ga0075367_10023152 | Ga0075367_100231523 | 353 |
| 389 | 3300006178 | Ga0075367_10024239 | Ga0075367_100242392 | 353 |
| 390 | 3300006178 | Ga0075367_10109016 | Ga0075367_101090161 | 353 |
| 391 | 3300006186 | Ga0075369_10060177 | Ga0075369_100601772 | 353 |
| 392 | 3300006195 | Ga0075366_10002088 | Ga0075366_1000208810 | 353 |
| 393 | 3300006353 | Ga0075370_10003222 | Ga0075370_100032228 | 353 |
| 394 | 3300006353 | Ga0075370_10035300 | Ga0075370_100353002 | 353 |
| 395 | 3300006353 | Ga0075370_10045987 | Ga0075370_100459873 | 353 |
| 396 | 3300006353 | Ga0075370_10053578 | Ga0075370_100535782 | 353 |
| 397 | 3300006844 | Ga0075428_100001783 | Ga0075428_10000178316 | 353 |
| 398 | 3300006844 | Ga0075428_100039034 | Ga0075428_1000390342 | 353 |
| 399 | 3300006844 | Ga0075428_100093046 | Ga0075428_1000930464 | 353 |
| 400 | 3300006844 | Ga0075428_100136756 | Ga0075428_1001367562 | 353 |
| 401 | 3300006846 | Ga0075430_100150139 | Ga0075430_1001501392 | 353 |
| 402 | 3300006846 | Ga0075430_100184989 | Ga0075430_1001849892 | 353 |
| 403 | 3300006847 | Ga0075431_100000003 | Ga0075431_10000000319 | 353 |
| 404 | 3300006847 | Ga0075431_100261380 | Ga0075431_1002613802 | 353 |
| 405 | 3300006847 | Ga0075431_100306404 | Ga0075431_1003064042 | 353 |
| 406 | 3300006852 | Ga0075433_10005748 | Ga0075433_100057485 | 353 |
| 407 | 3300006871 | Ga0075434_100030523 | Ga0075434_1000305232 | 353 |
| 408 | 3300006880 | Ga0075429_100000288 | Ga0075429_1000002883 | 353 |
| 409 | 3300006880 | Ga0075429_100132767 | Ga0075429_1001327672 | 353 |
| 410 | 3300006880 | Ga0075429_100191769 | Ga0075429_1001917692 | 353 |
| 411 | 3300006931 | Ga0097620_100378089 | Ga0097620_1003780892 | 353 |
| 412 | 3300006941 | Ga0099825_1028907 | Ga0099825_10289072 | 353 |
| 413 | 3300006942 | Ga0099824_1021477 | Ga0099824_10214772 | 353 |
| 414 | 3300006943 | Ga0099822_1001679 | Ga0099822_100167919 | 353 |
| 415 | 3300007076 | Ga0075435_100038956 | Ga0075435_1000389563 | 353 |
| 416 | 3300007265 | Ga0099794_10012754 | Ga0099794_100127542 | 353 |
| 417 | 3300009093 | Ga0105240_10077802 | Ga0105240_100778023 | 353 |
| 418 | 3300009094 | Ga0111539_10007175 | Ga0111539_100071758 | 353 |
| 419 | 3300009094 | Ga0111539_10007426 | Ga0111539_1000742616 | 353 |
| 420 | 3300009094 | Ga0111539_10280377 | Ga0111539_102803772 | 353 |
| 421 | 3300009098 | Ga0105245_10016233 | Ga0105245_100162334 | 353 |
| 422 | 3300009098 | Ga0105245_10067599 | Ga0105245_100675991 | 353 |
| 423 | 3300009098 | Ga0105245_10113086 | Ga0105245_101130862 | 353 |
| 424 | 3300009147 | Ga0114129_10000104 | Ga0114129_1000010414 | 353 |
| 425 | 3300009147 | Ga0114129_10009472 | Ga0114129_100094729 | 353 |
| 426 | 3300009147 | Ga0114129_10141754 | Ga0114129_101417542 | 353 |
| 427 | 3300009148 | Ga0105243_10099061 | Ga0105243_100990612 | 353 |
| 428 | 3300009174 | Ga0105241_10020161 | Ga0105241_100201613 | 353 |
| 429 | 3300009174 | Ga0105241_10021591 | Ga0105241_100215913 | 353 |
| 430 | 3300009176 | Ga0105242_10188924 | Ga0105242_101889242 | 353 |
| 431 | 3300009177 | Ga0105248_10103016 | Ga0105248_101030163 | 353 |
| 432 | 3300009177 | Ga0105248_10532673 | Ga0105248_105326732 | 353 |
| 433 | 3300009545 | Ga0105237_10007390 | Ga0105237_100073909 | 353 |
| 434 | 3300009545 | Ga0105237_10082457 | Ga0105237_100824573 | 353 |
| 435 | 3300009545 | Ga0105237_10191139 | Ga0105237_101911392 | 353 |
| 436 | 3300009551 | Ga0105238_10088915 | Ga0105238_100889152 | 353 |
| 437 | 3300009551 | Ga0105238_10333985 | Ga0105238_103339851 | 353 |
| 438 | 3300009551 | Ga0105238_10347392 | Ga0105238_103473922 | 353 |
| 439 | 3300009553 | Ga0105249_10292405 | Ga0105249_102924052 | 353 |
| 440 | 3300010159 | Ga0099796_10003058 | Ga0099796_100030582 | 353 |
| 441 | 3300010375 | Ga0105239_10010770 | Ga0105239_100107705 | 353 |
| 442 | 3300010375 | Ga0105239_10117510 | Ga0105239_101175102 | 353 |
| 443 | 3300010375 | Ga0105239_10344421 | Ga0105239_103444212 | 353 |
| 444 | 3300011119 | Ga0105246_10003773 | Ga0105246_100037738 | 353 |
| 445 | 3300011119 | Ga0105246_10079406 | Ga0105246_100794062 | 353 |
| 446 | 3300011119 | Ga0105246_10131381 | Ga0105246_101313812 | 353 |
| 447 | 3300011119 | Ga0105246_10237793 | Ga0105246_102377931 | 353 |
| 448 | 3300013104 | Ga0157370_10089815 | Ga0157370_100898151 | 353 |
| 449 | 3300013105 | Ga0157369_10012743 | Ga0157369_100127438 | 353 |
| 450 | 3300013105 | Ga0157369_10020698 | Ga0157369_100206981 | 353 |
| 451 | 3300013105 | Ga0157369_10068028 | Ga0157369_100680283 | 353 |
| 452 | 3300013105 | Ga0157369_10173846 | Ga0157369_101738461 | 353 |
| 453 | 3300013296 | Ga0157374_10013038 | Ga0157374_100130387 | 353 |
| 454 | 3300013296 | Ga0157374_10021625 | Ga0157374_100216256 | 353 |
| 455 | 3300013296 | Ga0157374_10095493 | Ga0157374_100954932 | 353 |
| 456 | 3300013297 | Ga0157378_10101029 | Ga0157378_101010292 | 353 |
| 457 | 3300013297 | Ga0157378_10132573 | Ga0157378_101325732 | 353 |
| 458 | 3300013306 | Ga0163162_10013490 | Ga0163162_100134902 | 353 |
| 459 | 3300013306 | Ga0163162_10291917 | Ga0163162_102919172 | 353 |
| 460 | 3300013306 | Ga0163162_10530865 | Ga0163162_105308651 | 353 |
| 461 | 3300013307 | Ga0157372_10009605 | Ga0157372_100096059 | 353 |
| 462 | 3300013307 | Ga0157372_10353836 | Ga0157372_103538362 | 353 |
| 463 | 3300014325 | Ga0163163_10005130 | Ga0163163_100051305 | 353 |
| 464 | 3300014325 | Ga0163163_10089857 | Ga0163163_100898572 | 353 |
| 465 | 3300014325 | Ga0163163_10132157 | Ga0163163_101321572 | 353 |
| 466 | 3300014325 | Ga0163163_10322310 | Ga0163163_103223102 | 353 |
| 467 | 3300014326 | Ga0157380_10375933 | Ga0157380_103759331 | 353 |
| 468 | 3300014745 | Ga0157377_10088218 | Ga0157377_100882182 | 353 |
| 469 | 3300014969 | Ga0157376_10484796 | Ga0157376_104847961 | 353 |
| 470 | 3300021320 | Ga0214544_1000055 | Ga0214544_100005582 | 353 |
| 471 | 3300021321 | Ga0214542_1003337 | Ga0214542_100333714 | 353 |
| 472 | 3300021324 | Ga0214545_1000028 | Ga0214545_1000028109 | 353 |
| 473 | 3300021327 | Ga0214543_1000044 | Ga0214543_100004455 | 353 |
| 474 | 3300021384 | Ga0213876_10000471 | Ga0213876_100004718 | 353 |
| 475 | 3300021441 | Ga0213871_10000076 | Ga0213871_100000766 | 353 |
| 476 | 3300025230 | Ga0209563_101020 | Ga0209563_1010203 | 353 |
| 477 | 3300025245 | Ga0207425_1002884 | Ga0207425_10028842 | 353 |
| 478 | 3300025253 | Ga0209677_106052 | Ga0209677_1060523 | 353 |
| 479 | 3300025295 | Ga0209564_1002670 | Ga0209564_10026709 | 353 |
| 480 | 3300025295 | Ga0209564_1035919 | Ga0209564_10359192 | 353 |
| 481 | 3300025297 | Ga0209758_1000075 | Ga0209758_100007580 | 353 |
| 482 | 3300025297 | Ga0209758_1000087 | Ga0209758_1000087152 | 353 |
| 483 | 3300025297 | Ga0209758_1001472 | Ga0209758_10014729 | 353 |
| 484 | 3300025297 | Ga0209758_1006857 | Ga0209758_10068578 | 353 |
| 485 | 3300025297 | Ga0209758_1008545 | Ga0209758_10085456 | 353 |
| 486 | 3300025297 | Ga0209758_1016464 | Ga0209758_10164644 | 353 |
| 487 | 3300025297 | Ga0209758_1019189 | Ga0209758_10191892 | 353 |
| 488 | 3300025297 | Ga0209758_1049417 | Ga0209758_10494172 | 353 |
| 489 | 3300025299 | Ga0209256_1009007 | Ga0209256_10090071 | 353 |
| 490 | 3300025302 | Ga0207426_1000160 | Ga0207426_10001603 | 353 |
| 491 | 3300025302 | Ga0207426_1000289 | Ga0207426_1000289108 | 353 |
| 492 | 3300025304 | Ga0209257_1000382 | Ga0209257_100038277 | 353 |
| 493 | 3300025304 | Ga0209257_1010148 | Ga0209257_10101483 | 353 |
| 494 | 3300025893 | Ga0207682_10109140 | Ga0207682_101091401 | 353 |
| 495 | 3300025898 | Ga0207692_10004122 | Ga0207692_100041224 | 353 |
| 496 | 3300025899 | Ga0207642_10022038 | Ga0207642_100220382 | 353 |
| 497 | 3300025900 | Ga0207710_10043002 | Ga0207710_100430022 | 353 |
| 498 | 3300025904 | Ga0207647_10006477 | Ga0207647_100064778 | 353 |
| 499 | 3300025906 | Ga0207699_10000561 | Ga0207699_100005613 | 353 |
| 500 | 3300025907 | Ga0207645_10048437 | Ga0207645_100484372 | 353 |
| 501 | 3300025908 | Ga0207643_10004466 | Ga0207643_100044662 | 353 |
| 502 | 3300025911 | Ga0207654_10007906 | Ga0207654_100079063 | 353 |
| 503 | 3300025912 | Ga0207707_10003822 | Ga0207707_1000382211 | 353 |
| 504 | 3300025912 | Ga0207707_10009552 | Ga0207707_100095525 | 353 |
| 505 | 3300025912 | Ga0207707_10020964 | Ga0207707_100209642 | 353 |
| 506 | 3300025912 | Ga0207707_10021206 | Ga0207707_100212064 | 353 |
| 507 | 3300025912 | Ga0207707_10058198 | Ga0207707_100581983 | 353 |
| 508 | 3300025912 | Ga0207707_10176474 | Ga0207707_101764742 | 353 |
| 509 | 3300025913 | Ga0207695_10195356 | Ga0207695_101953562 | 353 |
| 510 | 3300025913 | Ga0207695_10349768 | Ga0207695_103497682 | 353 |
| 511 | 3300025915 | Ga0207693_10001004 | Ga0207693_100010043 | 353 |
| 512 | 3300025917 | Ga0207660_10004099 | Ga0207660_100040994 | 353 |
| 513 | 3300025917 | Ga0207660_10031454 | Ga0207660_100314542 | 353 |
| 514 | 3300025919 | Ga0207657_10021590 | Ga0207657_100215903 | 353 |
| 515 | 3300025921 | Ga0207652_10013565 | Ga0207652_100135654 | 353 |
| 516 | 3300025921 | Ga0207652_10115852 | Ga0207652_101158523 | 353 |
| 517 | 3300025921 | Ga0207652_10162337 | Ga0207652_101623371 | 353 |
| 518 | 3300025923 | Ga0207681_10065051 | Ga0207681_100650512 | 353 |
| 519 | 3300025924 | Ga0207694_10035053 | Ga0207694_100350532 | 353 |
| 520 | 3300025924 | Ga0207694_10217819 | Ga0207694_102178192 | 353 |
| 521 | 3300025925 | Ga0207650_10005952 | Ga0207650_100059523 | 353 |
| 522 | 3300025926 | Ga0207659_10034027 | Ga0207659_100340272 | 353 |
| 523 | 3300025927 | Ga0207687_10012740 | Ga0207687_100127403 | 353 |
| 524 | 3300025927 | Ga0207687_10032480 | Ga0207687_100324802 | 353 |
| 525 | 3300025928 | Ga0207700_10051509 | Ga0207700_100515092 | 353 |
| 526 | 3300025928 | Ga0207700_10060434 | Ga0207700_100604342 | 353 |
| 527 | 3300025929 | Ga0207664_10173705 | Ga0207664_101737051 | 353 |
| 528 | 3300025933 | Ga0207706_10002137 | Ga0207706_1000213720 | 353 |
| 529 | 3300025933 | Ga0207706_10062955 | Ga0207706_100629553 | 353 |
| 530 | 3300025933 | Ga0207706_10067135 | Ga0207706_100671352 | 353 |
| 531 | 3300025933 | Ga0207706_10175571 | Ga0207706_101755712 | 353 |
| 532 | 3300025935 | Ga0207709_10140207 | Ga0207709_101402072 | 353 |
| 533 | 3300025937 | Ga0207669_10023481 | Ga0207669_100234812 | 353 |
| 534 | 3300025937 | Ga0207669_10130798 | Ga0207669_101307982 | 353 |
| 535 | 3300025940 | Ga0207691_10023514 | Ga0207691_100235142 | 353 |
| 536 | 3300025941 | Ga0207711_10032173 | Ga0207711_100321734 | 353 |
| 537 | 3300025941 | Ga0207711_10053470 | Ga0207711_100534702 | 353 |
| 538 | 3300025942 | Ga0207689_10056752 | Ga0207689_100567523 | 353 |
| 539 | 3300025945 | Ga0207679_10139161 | Ga0207679_101391612 | 353 |
| 540 | 3300025949 | Ga0207667_10260969 | Ga0207667_102609692 | 353 |
| 541 | 3300025960 | Ga0207651_10126240 | Ga0207651_101262402 | 353 |
| 542 | 3300025972 | Ga0207668_10009228 | Ga0207668_100092285 | 353 |
| 543 | 3300025981 | Ga0207640_10131212 | Ga0207640_101312121 | 353 |
| 544 | 3300026023 | Ga0207677_10035335 | Ga0207677_100353352 | 353 |
| 545 | 3300026023 | Ga0207677_10038119 | Ga0207677_100381193 | 353 |
| 546 | 3300026035 | Ga0207703_10040278 | Ga0207703_100402783 | 353 |
| 547 | 3300026035 | Ga0207703_10287680 | Ga0207703_102876802 | 353 |
| 548 | 3300026041 | Ga0207639_10033257 | Ga0207639_100332572 | 353 |
| 549 | 3300026041 | Ga0207639_10064910 | Ga0207639_100649102 | 353 |
| 550 | 3300026041 | Ga0207639_10178875 | Ga0207639_101788752 | 353 |
| 551 | 3300026067 | Ga0207678_10064794 | Ga0207678_100647942 | 353 |
| 552 | 3300026067 | Ga0207678_10081431 | Ga0207678_100814313 | 353 |
| 553 | 3300026075 | Ga0207708_10023566 | Ga0207708_100235662 | 353 |
| 554 | 3300026075 | Ga0207708_10029438 | Ga0207708_100294382 | 353 |
| 555 | 3300026078 | Ga0207702_10001454 | Ga0207702_1000145413 | 353 |
| 556 | 3300026078 | Ga0207702_10028517 | Ga0207702_100285172 | 353 |
| 557 | 3300026078 | Ga0207702_10066273 | Ga0207702_100662733 | 353 |
| 558 | 3300026088 | Ga0207641_10096136 | Ga0207641_100961362 | 353 |
| 559 | 3300026088 | Ga0207641_10145892 | Ga0207641_101458922 | 353 |
| 560 | 3300026088 | Ga0207641_10288616 | Ga0207641_102886162 | 353 |
| 561 | 3300026089 | Ga0207648_10006963 | Ga0207648_1000696312 | 353 |
| 562 | 3300026089 | Ga0207648_10081945 | Ga0207648_100819453 | 353 |
| 563 | 3300026089 | Ga0207648_10125626 | Ga0207648_101256262 | 353 |
| 564 | 3300026095 | Ga0207676_10205477 | Ga0207676_102054772 | 353 |
| 565 | 3300026116 | Ga0207674_10033436 | Ga0207674_100334363 | 353 |
| 566 | 3300026116 | Ga0207674_10103403 | Ga0207674_101034032 | 353 |
| 567 | 3300026118 | Ga0207675_100029070 | Ga0207675_1000290704 | 353 |
| 568 | 3300026118 | Ga0207675_100066690 | Ga0207675_1000666902 | 353 |
| 569 | 3300026118 | Ga0207675_100074780 | Ga0207675_1000747802 | 353 |
| 570 | 3300026121 | Ga0207683_10037347 | Ga0207683_100373473 | 353 |
| 571 | 3300026121 | Ga0207683_10229697 | Ga0207683_102296972 | 353 |
| 572 | 3300026142 | Ga0207698_10045053 | Ga0207698_100450533 | 353 |
| 573 | 3300026142 | Ga0207698_10058938 | Ga0207698_100589383 | 353 |
| 574 | 3300026142 | Ga0207698_10175368 | Ga0207698_101753682 | 353 |
| 575 | 3300027296 | Ga0209389_1000137 | Ga0209389_100013752 | 353 |
| 576 | 3300027296 | Ga0209389_1000353 | Ga0209389_100035313 | 353 |
| 577 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001493 | 353 |
| 578 | 3300027357 | Ga0209589_1003439 | Ga0209589_100343913 | 353 |
| 579 | 3300027361 | Ga0209489_100001 | Ga0209489_100001493 | 353 |
| 580 | 3300027361 | Ga0209489_100192 | Ga0209489_10019238 | 353 |
| 581 | 3300027361 | Ga0209489_107326 | Ga0209489_1073267 | 353 |
| 582 | 3300027361 | Ga0209489_107331 | Ga0209489_1073317 | 353 |
| 583 | 3300027363 | Ga0209700_100001 | Ga0209700_100001493 | 353 |
| 584 | 3300027363 | Ga0209700_100046 | Ga0209700_10004670 | 353 |
| 585 | 3300027671 | Ga0209588_1022977 | Ga0209588_10229772 | 353 |
| 586 | 3300027866 | Ga0209813_10026378 | Ga0209813_100263782 | 353 |
| 587 | 3300027907 | Ga0207428_10040681 | Ga0207428_100406813 | 353 |
| 588 | 3300028379 | Ga0268266_10017034 | Ga0268266_100170344 | 353 |
| 589 | 3300028379 | Ga0268266_10038401 | Ga0268266_100384012 | 353 |
| 590 | 3300028379 | Ga0268266_10173691 | Ga0268266_101736912 | 353 |
| 591 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020152 | 353 |
| 592 | 3300028556 | Ga0265337_1001859 | Ga0265337_10018593 | 353 |
| 593 | 3300028573 | Ga0265334_10014692 | Ga0265334_100146923 | 353 |
| 594 | 3300028573 | Ga0265334_10020564 | Ga0265334_100205642 | 353 |
| 595 | 3300031235 | Ga0265330_10028028 | Ga0265330_100280282 | 353 |
| 596 | 3300031241 | Ga0265325_10020842 | Ga0265325_100208423 | 353 |
| 597 | 3300031247 | Ga0265340_10010044 | Ga0265340_100100444 | 353 |
| 598 | 3300031249 | Ga0265339_10043509 | Ga0265339_100435092 | 353 |
| 599 | 3300031344 | Ga0265316_10027824 | Ga0265316_100278244 | 353 |
| 600 | 3300031456 | Ga0307513_10286844 | Ga0307513_102868442 | 353 |
| 601 | 3300031507 | Ga0307509_10225551 | Ga0307509_102255512 | 353 |
| 602 | 3300031616 | Ga0307508_10000025 | Ga0307508_1000002516 | 353 |
| 603 | 3300031616 | Ga0307508_10068027 | Ga0307508_100680273 | 353 |
| 604 | 3300031711 | Ga0265314_10090685 | Ga0265314_100906852 | 353 |
| 605 | 3300031730 | Ga0307516_10051368 | Ga0307516_100513683 | 353 |
| 606 | 3300031901 | Ga0307406_10181609 | Ga0307406_101816092 | 353 |
| 607 | 3300033180 | Ga0307510_10024769 | Ga0307510_100247696 | 353 |
| 608 | 3300033180 | Ga0307510_10025277 | Ga0307510_100252772 | 353 |
| 609 | 3300033180 | Ga0307510_10044327 | Ga0307510_100443275 | 353 |
| 610 | 3300033180 | Ga0307510_10217163 | Ga0307510_102171632 | 353 |
| 611 | 3300034957 | Ga0373938_0019283 | Ga0373938_0019283_45_1139 | 353 |
| 612 | 3300035083 | Ga0373926_0051440 | Ga0373926_0051440_368_1459 | 353 |
| 613 | 3300035089 | Ga0373944_0001051 | Ga0373944_0001051_1465_2556 | 353 |
| 614 | 3300035111 | Ga0373923_0023726 | Ga0373923_0023726_540_1634 | 353 |
| 615 | 3300035113 | Ga0373936_0001079 | Ga0373936_0001079_934_2028 | 353 |
| 616 | 3300035116 | Ga0373945_0005317 | Ga0373945_0005317_1602_2693 | 353 |
| 617 | 3300035116 | Ga0373945_0011608 | Ga0373945_0011608_346_1440 | 353 |
| 618 | 3300035119 | Ga0373956_0012440 | Ga0373956_0012440_1143_2237 | 353 |
| 619 | 3300035121 | Ga0373960_0029582 | Ga0373960_0029582_14_1105 | 353 |
| 620 | 3300035170 | Ga0373943_0002145 | Ga0373943_0002145_4003_5097 | 353 |
| 621 | 3300035170 | Ga0373943_0004407 | Ga0373943_0004407_1405_2496 | 353 |
| 622 | 3300035171 | Ga0373946_0003426 | Ga0373946_0003426_1351_2442 | 353 |
| 623 | 3300035172 | Ga0373955_0002673 | Ga0373955_0002673_1755_2849 | 353 |
| 624 | 3300035172 | Ga0373955_0042203 | Ga0373955_0042203_710_1804 | 353 |
| 625 | 3300035410 | Ga0373924_0005844 | Ga0373924_0005844_2658_3752 | 353 |
| 626 | 3300035692 | Ga0373935_0000494 | Ga0373935_0000494_3869_4963 | 353 |
| 627 | 3300035692 | Ga0373935_0009052 | Ga0373935_0009052_3377_4468 | 353 |
| 628 | 3300035692 | Ga0373935_0058438 | Ga0373935_0058438_763_1857 | 353 |
| 629 | 3300035695 | Ga0373927_0020261 | Ga0373927_0020261_1080_2171 | 353 |
| 630 | 3300035695 | Ga0373927_0024311 | Ga0373927_0024311_2711_3805 | 353 |
| 631 | 3300035695 | Ga0373927_0044653 | Ga0373927_0044653_576_1670 | 353 |
| 632 | 3300035695 | Ga0373927_0117969 | Ga0373927_0117969_237_1331 | 353 |
| 633 | 3300035725 | Ga0373947_0002364 | Ga0373947_0002364_8611_9702 | 353 |
| 634 | 3300036401 | Ga0373937_0073556 | Ga0373937_0073556_1540_2634 | 353 |
| 635 | 3300037068 | Ga0373925_0007140 | Ga0373925_0007140_4779_5873 | 353 |
| 636 | 3300037068 | Ga0373925_0015198 | Ga0373925_0015198_385_1476 | 353 |
| 637 | 3300037068 | Ga0373925_0095204 | Ga0373925_0095204_896_1990 | 353 |
| 638 | 3300037312 | Ga0395899_0034762 | Ga0395899_0034762_446_1540 | 353 |
| 639 | 3300037312 | Ga0395899_0062951 | Ga0395899_0062951_254_1348 | 353 |
| 640 | 3300037418 | Ga0395900_0125258 | Ga0395900_0125258_431_1525 | 353 |
| 641 | 3300037471 | Ga0395905_0194235 | Ga0395905_0194235_226_1314 | 353 |
| 642 | 3300037471 | Ga0395905_0201061 | Ga0395905_0201061_152_1240 | 353 |
| 643 | 3300039437 | Ga0436365_0430232 | Ga0436365_0430232_185_1276 | 353 |
| 644 | 3300039437 | Ga0436365_1324557 | Ga0436365_1324557_34737_35831 | 353 |
| 645 | 3300039447 | Ga0436361_0394185 | Ga0436361_0394185_637_1731 | 353 |
| 646 | 3300039447 | Ga0436361_0440592 | Ga0436361_0440592_774_1868 | 353 |
| 647 | 3300039450 | Ga0436363_0490106 | Ga0436363_0490106_1094_2188 | 353 |
| 648 | 3300039453 | Ga0436362_0153721 | Ga0436362_0153721_1614_2708 | 353 |
| 649 | 3300039453 | Ga0436362_1239383 | Ga0436362_1239383_2137_3231 | 353 |
| 650 | 3300044658 | Ga0466972_0025155 | Ga0466972_0025155_1769_2857 | 353 |
| 651 | 3300044658 | Ga0466972_0026707 | Ga0466972_0026707_1383_2471 | 353 |
| 652 | 3300044901 | Ga0466960_0006861 | Ga0466960_0006861_955_2043 | 353 |
| 653 | 3300045049 | Ga0466959_0022897 | Ga0466959_0022897_3437_4531 | 353 |
| 654 | 3300045976 | Ga0466967_0371644 | Ga0466967_0371644_63_1157 | 353 |
| 655 | 3300046455 | Ga0495603_0000237 | Ga0495603_0000237_20033_21127 | 353 |
| 656 | 3300046455 | Ga0495603_0023749 | Ga0495603_0023749_2182_3279 | 353 |
| 657 | 3300046455 | Ga0495603_0024299 | Ga0495603_0024299_1898_2989 | 353 |
| 658 | 3300046455 | Ga0495603_0041049 | Ga0495603_0041049_1178_2329 | 353 |
| 659 | 3300046455 | Ga0495603_0083633 | Ga0495603_0083633_271_1362 | 353 |
| 660 | 3300046459 | Ga0495629_0000772 | Ga0495629_0000772_13072_14166 | 353 |
| 661 | 3300046459 | Ga0495629_0080362 | Ga0495629_0080362_1092_2183 | 353 |
| 662 | 3300046459 | Ga0495629_0082958 | Ga0495629_0082958_693_1784 | 353 |
| 663 | 3300046460 | Ga0495638_0006370 | Ga0495638_0006370_6673_7761 | 353 |
| 664 | 3300046460 | Ga0495638_0065586 | Ga0495638_0065586_91_1242 | 353 |
| 665 | 3300046461 | Ga0495641_0004443 | Ga0495641_0004443_2558_3652 | 353 |
| 666 | 3300046461 | Ga0495641_0026360 | Ga0495641_0026360_487_1578 | 353 |
| 667 | 3300046462 | Ga0495651_0083841 | Ga0495651_0083841_82_1170 | 353 |
| 668 | 3300046472 | Ga0495580_0001324 | Ga0495580_0001324_16882_17976 | 353 |
| 669 | 3300046473 | Ga0495582_0000209 | Ga0495582_0000209_16639_17733 | 353 |
| 670 | 3300046473 | Ga0495582_0150497 | Ga0495582_0150497_37_1128 | 353 |
| 671 | 3300046475 | Ga0495639_0000387 | Ga0495639_0000387_4523_5617 | 353 |
| 672 | 3300046476 | Ga0495662_0032424 | Ga0495662_0032424_166_1260 | 353 |
| 673 | 3300046477 | Ga0495664_0017088 | Ga0495664_0017088_1797_2891 | 353 |
| 674 | 3300046491 | Ga0495584_0018353 | Ga0495584_0018353_729_1817 | 353 |
| 675 | 3300046491 | Ga0495584_0060574 | Ga0495584_0060574_266_1357 | 353 |
| 676 | 3300046492 | Ga0495585_0016853 | Ga0495585_0016853_2568_3659 | 353 |
| 677 | 3300046492 | Ga0495585_0019945 | Ga0495585_0019945_2494_3585 | 353 |
| 678 | 3300046492 | Ga0495585_0058338 | Ga0495585_0058338_1016_2107 | 353 |
| 679 | 3300046499 | Ga0495594_0000342 | Ga0495594_0000342_12815_13909 | 353 |
| 680 | 3300046499 | Ga0495594_0021788 | Ga0495594_0021788_853_1944 | 353 |
| 681 | 3300046499 | Ga0495594_0041508 | Ga0495594_0041508_1072_2163 | 353 |
| 682 | 3300046499 | Ga0495594_0105821 | Ga0495594_0105821_206_1297 | 353 |
| 683 | 3300046507 | Ga0495606_0002837 | Ga0495606_0002837_15759_16853 | 353 |
| 684 | 3300046511 | Ga0495608_0046562 | Ga0495608_0046562_310_1398 | 353 |
| 685 | 3300046511 | Ga0495608_0179133 | Ga0495608_0179133_84_1178 | 353 |
| 686 | 3300046512 | Ga0495610_0101648 | Ga0495610_0101648_123_1211 | 353 |
| 687 | 3300046518 | Ga0495631_0051843 | Ga0495631_0051843_601_1692 | 353 |
| 688 | 3300046519 | Ga0495632_0073286 | Ga0495632_0073286_166_1317 | 353 |
| 689 | 3300046522 | Ga0495643_0059039 | Ga0495643_0059039_263_1351 | 353 |
| 690 | 3300046523 | Ga0495644_0047893 | Ga0495644_0047893_87_1178 | 353 |
| 691 | 3300046524 | Ga0495648_0136493 | Ga0495648_0136493_104_1192 | 353 |
| 692 | 3300046526 | Ga0495666_0023449 | Ga0495666_0023449_690_1784 | 353 |
| 693 | 3300046529 | Ga0495652_0023755 | Ga0495652_0023755_3965_5053 | 353 |
| 694 | 3300046529 | Ga0495652_0210850 | Ga0495652_0210850_120_1211 | 353 |
| 695 | 3300046531 | Ga0495665_0000280 | Ga0495665_0000280_9758_10852 | 353 |
| 696 | 3300046533 | Ga0495640_0001578 | Ga0495640_0001578_6858_7952 | 353 |
| 697 | 3300046533 | Ga0495640_0040303 | Ga0495640_0040303_124_1218 | 353 |
| 698 | 3300046537 | Ga0495598_0003599 | Ga0495598_0003599_745_1839 | 353 |
| 699 | 3300046537 | Ga0495598_0023647 | Ga0495598_0023647_197_1288 | 353 |
| 700 | 3300046539 | Ga0495621_0021100 | Ga0495621_0021100_919_2010 | 353 |
| 701 | 3300046557 | Ga0495622_0004573 | Ga0495622_0004573_1782_2876 | 353 |
| 702 | 3300046557 | Ga0495622_0028120 | Ga0495622_0028120_744_1838 | 353 |
| 703 | 3300046558 | Ga0495633_0062024 | Ga0495633_0062024_156_1247 | 353 |
| 704 | 3300046559 | Ga0495667_0097813 | Ga0495667_0097813_215_1303 | 353 |
| 705 | 3300046559 | Ga0495667_0107010 | Ga0495667_0107010_556_1650 | 353 |
| 706 | 3300046615 | Ga0495656_0001705 | Ga0495656_0001705_3332_4423 | 353 |
| 707 | 3300046615 | Ga0495656_0042555 | Ga0495656_0042555_638_1729 | 353 |
| 708 | 3300046615 | Ga0495656_0060692 | Ga0495656_0060692_72_1160 | 353 |
| 709 | 3300046616 | Ga0495668_0032248 | Ga0495668_0032248_717_1808 | 353 |
| 710 | 3300046642 | Ga0495634_0000865 | Ga0495634_0000865_14964_16058 | 353 |
| 711 | 3300046648 | Ga0495611_0050962 | Ga0495611_0050962_640_1791 | 353 |
| 712 | 3300046648 | Ga0495611_0114522 | Ga0495611_0114522_110_1201 | 353 |
| 713 | 3300046660 | Ga0495625_0213974 | Ga0495625_0213974_131_1225 | 353 |
| 714 | 3300046663 | Ga0495635_0017357 | Ga0495635_0017357_1840_2928 | 353 |
| 715 | 3300046664 | Ga0495659_0005402 | Ga0495659_0005402_851_1942 | 353 |
| 716 | 3300046664 | Ga0495659_0049652 | Ga0495659_0049652_100_1188 | 353 |
| 717 | 3300046675 | Ga0495657_0011035 | Ga0495657_0011035_1132_2220 | 353 |
| 718 | 3300046678 | Ga0495599_0049318 | Ga0495599_0049318_1128_2216 | 353 |
| 719 | 3300046681 | Ga0495647_0000763 | Ga0495647_0000763_8262_9356 | 353 |
| 720 | 3300046683 | Ga0495658_0012763 | Ga0495658_0012763_1592_2683 | 353 |
| 721 | 3300046683 | Ga0495658_0032484 | Ga0495658_0032484_1512_2606 | 353 |
| 722 | 3300046689 | Ga0495613_0003086 | Ga0495613_0003086_7478_8572 | 353 |
| 723 | 3300046689 | Ga0495613_0056448 | Ga0495613_0056448_527_1618 | 353 |
| 724 | 3300046689 | Ga0495613_0220372 | Ga0495613_0220372_110_1204 | 353 |
| 725 | 3300046690 | Ga0495624_0001082 | Ga0495624_0001082_7960_9054 | 353 |
| 726 | 3300046690 | Ga0495624_0002738 | Ga0495624_0002738_3991_5082 | 353 |
| 727 | 3300046690 | Ga0495624_0070964 | Ga0495624_0070964_427_1518 | 353 |
| 728 | 3300046794 | Ga0495589_0019693 | Ga0495589_0019693_1001_2092 | 353 |
| 729 | 3300046809 | Ga0495600_0001516 | Ga0495600_0001516_961_2049 | 353 |
| 730 | 3300047315 | Ga0495581_0022904 | Ga0495581_0022904_1718_2812 | 353 |
| 731 | 3300047317 | Ga0495604_0012450 | Ga0495604_0012450_5284_6372 | 353 |
| 732 | 3300047317 | Ga0495604_0103260 | Ga0495604_0103260_828_1922 | 353 |
| 733 | 3300047317 | Ga0495604_0115558 | Ga0495604_0115558_465_1556 | 353 |
| 734 | 3300047318 | Ga0495636_0031639 | Ga0495636_0031639_957_2051 | 353 |
| 735 | 3300047318 | Ga0495636_0096907 | Ga0495636_0096907_96_1190 | 353 |
| 736 | 3300047319 | Ga0495674_0004372 | Ga0495674_0004372_6408_7502 | 353 |
| 737 | 3300047321 | Ga0495676_0009743 | Ga0495676_0009743_1070_2164 | 353 |
| 738 | 3300047321 | Ga0495676_0018074 | Ga0495676_0018074_3110_4261 | 353 |
| 739 | 3300047321 | Ga0495676_0104647 | Ga0495676_0104647_326_1417 | 353 |
| 740 | 3300047322 | Ga0495680_0058874 | Ga0495680_0058874_646_1734 | 353 |
| 741 | 3300047322 | Ga0495680_0157250 | Ga0495680_0157250_66_1160 | 353 |
| 742 | 3300047443 | Ga0495687_011591 | Ga0495687_011591_27_1115 | 353 |
| 743 | 3300047444 | Ga0495675_0111997 | Ga0495675_0111997_221_1309 | 353 |
| 744 | 3300047469 | Ga0495673_0003053 | Ga0495673_0003053_2949_4043 | 353 |
| 745 | 3300047471 | Ga0495684_0125066 | Ga0495684_0125066_499_1590 | 353 |
| 746 | 3300047472 | Ga0495686_0052830 | Ga0495686_0052830_1280_2368 | 353 |
| 747 | 3300047472 | Ga0495686_0071631 | Ga0495686_0071631_303_1394 | 353 |
| 748 | 3300047673 | Ga0495593_0000238 | Ga0495593_0000238_12964_14058 | 353 |
| 749 | 3300047673 | Ga0495593_0071101 | Ga0495593_0071101_316_1407 | 353 |
| 750 | 3300048088 | Ga0495602_0031146 | Ga0495602_0031146_102_1190 | 353 |
| 751 | 3300048903 | Ga0496100_0084672 | Ga0496100_0084672_623_1714 | 353 |
| 752 | 3300048903 | Ga0496100_0153102 | Ga0496100_0153102_155_1246 | 353 |
| 753 | 3300048903 | Ga0496100_0183003 | Ga0496100_0183003_240_1334 | 353 |
| 754 | 3300048904 | Ga0496101_0018685 | Ga0496101_0018685_2724_3818 | 353 |
| 755 | 3300048904 | Ga0496101_0036513 | Ga0496101_0036513_2375_3469 | 353 |
| 756 | 3300048904 | Ga0496101_0103084 | Ga0496101_0103084_376_1464 | 353 |
| 757 | 3300048904 | Ga0496101_0103753 | Ga0496101_0103753_580_1671 | 353 |
| 758 | 3300048904 | Ga0496101_0163331 | Ga0496101_0163331_45_1136 | 353 |
| 759 | 3300048905 | Ga0496102_0001874 | Ga0496102_0001874_11476_12564 | 353 |
| 760 | 3300048905 | Ga0496102_0007483 | Ga0496102_0007483_3291_4382 | 353 |
| 761 | 3300048905 | Ga0496102_0126920 | Ga0496102_0126920_221_1315 | 353 |
| 762 | 3300048905 | Ga0496102_0192820 | Ga0496102_0192820_236_1327 | 353 |
| 763 | 3300048905 | Ga0496102_0282168 | Ga0496102_0282168_434_1525 | 353 |
| 764 | 3300048905 | Ga0496102_0394904 | Ga0496102_0394904_191_1279 | 353 |
| 765 | 3300048906 | Ga0496103_0002168 | Ga0496103_0002168_516_1604 | 353 |
| 766 | 3300048906 | Ga0496103_0004621 | Ga0496103_0004621_1772_2863 | 353 |
| 767 | 3300048906 | Ga0496103_0122197 | Ga0496103_0122197_354_1448 | 353 |
| 768 | 3300048906 | Ga0496103_0132742 | Ga0496103_0132742_83_1174 | 353 |
| 769 | 3300048907 | Ga0496104_0000411 | Ga0496104_0000411_17858_18964 | 353 |
| 770 | 3300048907 | Ga0496104_0000594 | Ga0496104_0000594_27191_28285 | 353 |
| 771 | 3300048907 | Ga0496104_0020184 | Ga0496104_0020184_3136_4227 | 353 |
| 772 | 3300048907 | Ga0496104_0022321 | Ga0496104_0022321_628_1716 | 353 |
| 773 | 3300048907 | Ga0496104_0084202 | Ga0496104_0084202_1393_2484 | 353 |
| 774 | 3300048907 | Ga0496104_0118822 | Ga0496104_0118822_1036_2130 | 353 |
| 775 | 3300048908 | Ga0496105_0005229 | Ga0496105_0005229_5993_7084 | 353 |
| 776 | 3300048908 | Ga0496105_0181428 | Ga0496105_0181428_334_1425 | 353 |
| 777 | 3300048908 | Ga0496105_0228308 | Ga0496105_0228308_187_1281 | 353 |
| 778 | 3300048909 | Ga0496106_0008194 | Ga0496106_0008194_4946_6040 | 353 |
| 779 | 3300048909 | Ga0496106_0026256 | Ga0496106_0026256_2370_3461 | 353 |
| 780 | 3300048909 | Ga0496106_0041334 | Ga0496106_0041334_73_1164 | 353 |
| 781 | 3300048909 | Ga0496106_0061499 | Ga0496106_0061499_669_1760 | 353 |
| 782 | 3300048909 | Ga0496106_0097128 | Ga0496106_0097128_318_1409 | 353 |
| 783 | 3300048910 | Ga0496107_0043909 | Ga0496107_0043909_2001_3092 | 353 |
| 784 | 3300048910 | Ga0496107_0195249 | Ga0496107_0195249_65_1156 | 353 |
| 785 | 3300048911 | Ga0496108_0000244 | Ga0496108_0000244_31317_32408 | 353 |
| 786 | 3300048911 | Ga0496108_0013227 | Ga0496108_0013227_860_1954 | 353 |
| 787 | 3300048911 | Ga0496108_0038758 | Ga0496108_0038758_2145_3236 | 353 |
| 788 | 3300048911 | Ga0496108_0109145 | Ga0496108_0109145_449_1543 | 353 |
| 789 | 3300048911 | Ga0496108_0123258 | Ga0496108_0123258_1103_2197 | 353 |
| 790 | 3300048911 | Ga0496108_0191020 | Ga0496108_0191020_154_1263 | 353 |
| 791 | 3300048912 | Ga0496109_0002677 | Ga0496109_0002677_6099_7190 | 353 |
| 792 | 3300048912 | Ga0496109_0047462 | Ga0496109_0047462_2611_3702 | 353 |
| 793 | 3300048912 | Ga0496109_0075355 | Ga0496109_0075355_1332_2423 | 353 |
| 794 | 3300048912 | Ga0496109_0133662 | Ga0496109_0133662_292_1383 | 353 |
| 795 | 3300048912 | Ga0496109_0323262 | Ga0496109_0323262_56_1165 | 353 |
| 796 | 3300048913 | Ga0496110_0021529 | Ga0496110_0021529_2329_3423 | 353 |
| 797 | 3300048913 | Ga0496110_0059222 | Ga0496110_0059222_196_1290 | 353 |
| 798 | 3300048913 | Ga0496110_0082180 | Ga0496110_0082180_32_1123 | 353 |
| 799 | 3300048913 | Ga0496110_0102035 | Ga0496110_0102035_1251_2342 | 353 |
| 800 | 3300048913 | Ga0496110_0111312 | Ga0496110_0111312_372_1463 | 353 |
| 801 | 3300048913 | Ga0496110_0180931 | Ga0496110_0180931_492_1583 | 353 |
| 802 | 3300048914 | Ga0496111_0000320 | Ga0496111_0000320_13227_14318 | 353 |
| 803 | 3300048914 | Ga0496111_0035990 | Ga0496111_0035990_188_1279 | 353 |
| 804 | 3300048914 | Ga0496111_0076159 | Ga0496111_0076159_57_1145 | 353 |
| 805 | 3300048914 | Ga0496111_0315801 | Ga0496111_0315801_13_1107 | 353 |
| 806 | 3300048915 | Ga0496112_0015510 | Ga0496112_0015510_4275_5366 | 353 |
| 807 | 3300048915 | Ga0496112_0029058 | Ga0496112_0029058_1759_2853 | 353 |
| 808 | 3300048915 | Ga0496112_0043753 | Ga0496112_0043753_585_1679 | 353 |
| 809 | 3300048915 | Ga0496112_0142350 | Ga0496112_0142350_1036_2130 | 353 |
| 810 | 3300048915 | Ga0496112_0244245 | Ga0496112_0244245_253_1344 | 353 |
| 811 | 3300048915 | Ga0496112_0368481 | Ga0496112_0368481_208_1299 | 353 |
| 812 | 3300048916 | Ga0496113_0003916 | Ga0496113_0003916_6187_7278 | 353 |
| 813 | 3300048917 | Ga0496114_0032861 | Ga0496114_0032861_1923_3014 | 353 |
| 814 | 3300048917 | Ga0496114_0073413 | Ga0496114_0073413_1432_2523 | 353 |
| 815 | 3300048917 | Ga0496114_0266892 | Ga0496114_0266892_208_1296 | 353 |
| 816 | 3300048918 | Ga0496115_0007927 | Ga0496115_0007927_1805_2899 | 353 |
| 817 | 3300048918 | Ga0496115_0015981 | Ga0496115_0015981_3435_4526 | 353 |
| 818 | 3300048918 | Ga0496115_0036848 | Ga0496115_0036848_1030_2124 | 353 |
| 819 | 3300048918 | Ga0496115_0039572 | Ga0496115_0039572_230_1321 | 353 |
| 820 | 3300048918 | Ga0496115_0047535 | Ga0496115_0047535_625_1716 | 353 |
| 821 | 3300048918 | Ga0496115_0051539 | Ga0496115_0051539_1564_2730 | 353 |
| 822 | 3300048918 | Ga0496115_0215288 | Ga0496115_0215288_448_1542 | 353 |
| 823 | 3300048919 | Ga0496116_0017384 | Ga0496116_0017384_2059_3147 | 353 |
| 824 | 3300048919 | Ga0496116_0037607 | Ga0496116_0037607_215_1303 | 353 |
| 825 | 3300048919 | Ga0496116_0098756 | Ga0496116_0098756_359_1453 | 353 |
| 826 | 3300048920 | Ga0496117_0056104 | Ga0496117_0056104_451_1545 | 353 |
| 827 | 3300048921 | Ga0496118_0012281 | Ga0496118_0012281_3914_5008 | 353 |
| 828 | 3300048921 | Ga0496118_0035772 | Ga0496118_0035772_1591_2685 | 353 |
| 829 | 3300048921 | Ga0496118_0050582 | Ga0496118_0050582_444_1538 | 353 |
| 830 | 3300048921 | Ga0496118_0106816 | Ga0496118_0106816_628_1716 | 353 |
| 831 | 3300048923 | Ga0496120_0019887 | Ga0496120_0019887_165_1253 | 353 |
| 832 | 3300048924 | Ga0496121_0001375 | Ga0496121_0001375_28799_29893 | 353 |
| 833 | 3300048924 | Ga0496121_0028079 | Ga0496121_0028079_1501_2595 | 353 |
| 834 | 3300048924 | Ga0496121_0044552 | Ga0496121_0044552_2686_3780 | 353 |
| 835 | 3300048924 | Ga0496121_0057700 | Ga0496121_0057700_1983_3077 | 353 |
| 836 | 3300048924 | Ga0496121_0105676 | Ga0496121_0105676_1021_2115 | 353 |
| 837 | 3300048924 | Ga0496121_0118335 | Ga0496121_0118335_764_1852 | 353 |
| 838 | 3300048924 | Ga0496121_0121076 | Ga0496121_0121076_279_1373 | 353 |
| 839 | 3300048924 | Ga0496121_0148293 | Ga0496121_0148293_365_1453 | 353 |
| 840 | 3300048924 | Ga0496121_0148733 | Ga0496121_0148733_60_1151 | 353 |
| 841 | 3300048924 | Ga0496121_0150329 | Ga0496121_0150329_473_1561 | 353 |
| 842 | 3300048927 | Ga0496124_0021977 | Ga0496124_0021977_1815_2909 | 353 |
| 843 | 3300048927 | Ga0496124_0141364 | Ga0496124_0141364_435_1526 | 353 |
| 844 | 3300048927 | Ga0496124_0189544 | Ga0496124_0189544_202_1290 | 353 |
| 845 | 3300048928 | Ga0496125_0000202 | Ga0496125_0000202_10508_11602 | 353 |
| 846 | 3300048928 | Ga0496125_0000810 | Ga0496125_0000810_16435_17526 | 353 |
| 847 | 3300048928 | Ga0496125_0001999 | Ga0496125_0001999_22673_23767 | 353 |
| 848 | 3300048928 | Ga0496125_0015391 | Ga0496125_0015391_547_1635 | 353 |
| 849 | 3300048928 | Ga0496125_0040960 | Ga0496125_0040960_1922_3016 | 353 |
| 850 | 3300048928 | Ga0496125_0202362 | Ga0496125_0202362_118_1206 | 353 |
| 851 | 3300048929 | Ga0496126_0002650 | Ga0496126_0002650_3634_4725 | 353 |
| 852 | 3300048929 | Ga0496126_0017938 | Ga0496126_0017938_5265_6359 | 353 |
| 853 | 3300048929 | Ga0496126_0022992 | Ga0496126_0022992_4898_5992 | 353 |
| 854 | 3300048929 | Ga0496126_0036078 | Ga0496126_0036078_3395_4489 | 353 |
| 855 | 3300048929 | Ga0496126_0102054 | Ga0496126_0102054_942_2036 | 353 |
| 856 | 3300048929 | Ga0496126_0162275 | Ga0496126_0162275_399_1487 | 353 |
| 857 | 3300048929 | Ga0496126_0249038 | Ga0496126_0249038_292_1380 | 353 |
| 858 | 3300048929 | Ga0496126_0254762 | Ga0496126_0254762_177_1271 | 353 |
| 859 | 3300049568 | Ga0501031_0002641 | Ga0501031_0002641_5530_6621 | 353 |
| 860 | 3300049569 | Ga0501032_0000257 | Ga0501032_0000257_22492_23709 | 353 |
| 861 | 3300049569 | Ga0501032_0002207 | Ga0501032_0002207_9625_10716 | 353 |
| 862 | 3300049570 | Ga0501033_0000124 | Ga0501033_0000124_4649_5740 | 353 |
| 863 | 3300049570 | Ga0501033_0000244 | Ga0501033_0000244_6728_7945 | 353 |
| 864 | 3300049571 | Ga0501034_0000159 | Ga0501034_0000159_44287_45504 | 353 |
| 865 | 3300049571 | Ga0501034_0019549 | Ga0501034_0019549_4331_5422 | 353 |
| 866 | 3300049571 | Ga0501034_0358363 | Ga0501034_0358363_221_1312 | 353 |
| 867 | 3300049572 | Ga0501036_0000039 | Ga0501036_0000039_45320_46537 | 353 |
| 868 | 3300049572 | Ga0501036_0000104 | Ga0501036_0000104_46918_48009 | 353 |
| 869 | 3300049573 | Ga0501037_0000247 | Ga0501037_0000247_6328_7419 | 353 |
| 870 | 3300049573 | Ga0501037_0001386 | Ga0501037_0001386_10070_11287 | 353 |
| 871 | 3300049574 | Ga0501038_0000041 | Ga0501038_0000041_68328_69419 | 353 |
| 872 | 3300049574 | Ga0501038_0000207 | Ga0501038_0000207_17630_18847 | 353 |
| 873 | 3300049575 | Ga0501039_0000064 | Ga0501039_0000064_12402_13493 | 353 |
| 874 | 3300049575 | Ga0501039_0000148 | Ga0501039_0000148_20908_22125 | 353 |
| 875 | 3300049576 | Ga0501040_0117404 | Ga0501040_0117404_177_1268 | 353 |
| 876 | 3300049578 | Ga0501042_0036793 | Ga0501042_0036793_2226_3443 | 353 |
| 877 | 3300049579 | Ga0501043_0000202 | Ga0501043_0000202_41268_42485 | 353 |
| 878 | 3300049579 | Ga0501043_0014806 | Ga0501043_0014806_4161_5252 | 353 |
| 879 | 3300049579 | Ga0501043_0035649 | Ga0501043_0035649_2024_3127 | 353 |
| 880 | 3300049580 | Ga0501046_0000185 | Ga0501046_0000185_15770_16987 | 353 |
| 881 | 3300049580 | Ga0501046_0080151 | Ga0501046_0080151_1400_2491 | 353 |
| 882 | 3300049581 | Ga0501047_0000385 | Ga0501047_0000385_4132_5349 | 353 |
| 883 | 3300049581 | Ga0501047_0000392 | Ga0501047_0000392_35695_36786 | 353 |
| 884 | 3300049581 | Ga0501047_0002801 | Ga0501047_0002801_9818_10912 | 353 |
| 885 | 3300049581 | Ga0501047_0065193 | Ga0501047_0065193_1014_2117 | 353 |
| 886 | 3300049582 | Ga0501048_0000536 | Ga0501048_0000536_11653_12870 | 353 |
| 887 | 3300049582 | Ga0501048_0009128 | Ga0501048_0009128_2045_3136 | 353 |
| 888 | 3300049583 | Ga0501067_0010006 | Ga0501067_0010006_1919_3136 | 353 |
| 889 | 3300049583 | Ga0501067_0057206 | Ga0501067_0057206_405_1496 | 353 |
| 890 | 3300049583 | Ga0501067_0109325 | Ga0501067_0109325_420_1511 | 353 |
| 891 | 3300049584 | Ga0501068_0002219 | Ga0501068_0002219_7985_9202 | 353 |
| 892 | 3300049584 | Ga0501068_0024106 | Ga0501068_0024106_976_2067 | 353 |
| 893 | 3300049585 | Ga0501069_0006636 | Ga0501069_0006636_2726_3943 | 353 |
| 894 | 3300049585 | Ga0501069_0015986 | Ga0501069_0015986_1925_3016 | 353 |
| 895 | 3300049585 | Ga0501069_0175977 | Ga0501069_0175977_43_1137 | 353 |
| 896 | 3300049586 | Ga0501070_0000175 | Ga0501070_0000175_6312_7403 | 353 |
| 897 | 3300049586 | Ga0501070_0000557 | Ga0501070_0000557_20715_21932 | 353 |
| 898 | 3300049586 | Ga0501070_0003774 | Ga0501070_0003774_8717_9811 | 353 |
| 899 | 3300049588 | Ga0501072_0001033 | Ga0501072_0001033_2819_4036 | 353 |
| 900 | 3300049588 | Ga0501072_0147728 | Ga0501072_0147728_83_1174 | 353 |
| 901 | 3300049589 | Ga0501073_0000034 | Ga0501073_0000034_81683_82900 | 353 |
| 902 | 3300049590 | Ga0501074_0000271 | Ga0501074_0000271_23583_24800 | 353 |
| 903 | 3300049590 | Ga0501074_0002163 | Ga0501074_0002163_8810_9904 | 353 |
| 904 | 3300049590 | Ga0501074_0005773 | Ga0501074_0005773_7759_8850 | 353 |
| 905 | 3300049591 | Ga0501075_0123271 | Ga0501075_0123271_480_1571 | 353 |
| 906 | 3300049592 | Ga0501076_0223454 | Ga0501076_0223454_111_1202 | 353 |
| 907 | 3300049593 | Ga0501077_0025710 | Ga0501077_0025710_2258_3349 | 353 |
| 908 | 3300049593 | Ga0501077_0131182 | Ga0501077_0131182_273_1490 | 353 |
| 909 | 3300049741 | Ga0501079_0000773 | Ga0501079_0000773_8076_9293 | 353 |
| 910 | 3300049742 | Ga0501080_0001103 | Ga0501080_0001103_9441_10658 | 353 |
| 911 | 3300049742 | Ga0501080_0005894 | Ga0501080_0005894_1933_3027 | 353 |
| 912 | 3300049742 | Ga0501080_0013998 | Ga0501080_0013998_5462_6553 | 353 |
| 913 | 3300049743 | Ga0501081_0081936 | Ga0501081_0081936_812_1903 | 353 |
| 914 | 3300049743 | Ga0501081_0111849 | Ga0501081_0111849_559_1656 | 353 |
| 915 | 3300049744 | Ga0501083_0000118 | Ga0501083_0000118_28563_29780 | 353 |
| 916 | 3300049744 | Ga0501083_0098174 | Ga0501083_0098174_341_1432 | 353 |
| 917 | 3300049822 | Ga0501035_0000137 | Ga0501035_0000137_11953_13170 | 353 |
| 918 | 3300049822 | Ga0501035_0000155 | Ga0501035_0000155_49538_50629 | 353 |
| 919 | 3300049823 | Ga0501044_0000548 | Ga0501044_0000548_40312_41529 | 353 |
| 920 | 3300049823 | Ga0501044_0011998 | Ga0501044_0011998_5034_6128 | 353 |
| 921 | 3300049823 | Ga0501044_0052450 | Ga0501044_0052450_203_1294 | 353 |
| 922 | 3300049823 | Ga0501044_0069453 | Ga0501044_0069453_744_1847 | 353 |
| 923 | 3300049823 | Ga0501044_0085375 | Ga0501044_0085375_786_1889 | 353 |
| 924 | 3300049823 | Ga0501044_0135826 | Ga0501044_0135826_1252_2343 | 353 |
| 925 | 3300049823 | Ga0501044_0296542 | Ga0501044_0296542_156_1247 | 353 |
| 926 | 3300049823 | Ga0501044_0378718 | Ga0501044_0378718_76_1167 | 353 |
| 927 | 3300049824 | Ga0501045_0008590 | Ga0501045_0008590_2232_3449 | 353 |
| 928 | 3300050491 | nmdc:mga00v17_246567_c1 | nmdc:mga00v17_246567_c1_16_1107 | 353 |
| 929 | 3300050492 | nmdc:mga0yw44_17052_c1 | nmdc:mga0yw44_17052_c1_2610_3698 | 353 |
| 930 | 3300050492 | nmdc:mga0yw44_2009_c1 | nmdc:mga0yw44_2009_c1_3486_4574 | 353 |
| 931 | 3300050492 | nmdc:mga0yw44_3972_c1 | nmdc:mga0yw44_3972_c1_3628_4719 | 353 |
| 932 | 3300050492 | nmdc:mga0yw44_723_c1 | nmdc:mga0yw44_723_c1_169_1257 | 353 |
| 933 | 3300050492 | nmdc:mga0yw44_88345_c1 | nmdc:mga0yw44_88345_c1_500_1591 | 353 |
| 934 | 3300050494 | nmdc:mga06z11_105179_c1 | nmdc:mga06z11_105179_c1_182_1273 | 353 |
| 935 | 3300050494 | nmdc:mga06z11_6417_c1 | nmdc:mga06z11_6417_c1_1748_2839 | 353 |
| 936 | 3300050494 | nmdc:mga06z11_85891_c1 | nmdc:mga06z11_85891_c1_104_1207 | 353 |
| 937 | 3300050494 | nmdc:mga06z11_87259_c1 | nmdc:mga06z11_87259_c1_32_1120 | 353 |
| 938 | 3300050496 | nmdc:mga07m45_64802_c1 | nmdc:mga07m45_64802_c1_213_1301 | 353 |
| 939 | 3300050507 | nmdc:mga05p37_112345_c1 | nmdc:mga05p37_112345_c1_2055_3143 | 353 |
| 940 | 3300050507 | nmdc:mga05p37_1642_c1 | nmdc:mga05p37_1642_c1_2260_3354 | 353 |
| 941 | 3300050507 | nmdc:mga05p37_220291_c1 | nmdc:mga05p37_220291_c1_98_1189 | 353 |
| 942 | 3300050507 | nmdc:mga05p37_23035_c1 | nmdc:mga05p37_23035_c1_4163_5254 | 353 |
| 943 | 3300050507 | nmdc:mga05p37_292224_c1 | nmdc:mga05p37_292224_c1_110_1201 | 353 |
| 944 | 3300050508 | nmdc:mga09592_104844_c1 | nmdc:mga09592_104844_c1_988_2079 | 353 |
| 945 | 3300050508 | nmdc:mga09592_8031_c1 | nmdc:mga09592_8031_c1_6727_7821 | 353 |
| 946 | 3300050509 | nmdc:mga0qj67_34763_c1 | nmdc:mga0qj67_34763_c1_1966_3057 | 353 |
| 947 | 3300050509 | nmdc:mga0qj67_43218_c1 | nmdc:mga0qj67_43218_c1_2362_3453 | 353 |
| 948 | 3300050510 | nmdc:mga06r32_130304_c1 | nmdc:mga06r32_130304_c1_416_1507 | 353 |
| 949 | 3300050510 | nmdc:mga06r32_189436_c2 | nmdc:mga06r32_189436_c2_262_1353 | 353 |
| 950 | 3300050510 | nmdc:mga06r32_33939_c1 | nmdc:mga06r32_33939_c1_1852_2943 | 353 |
| 951 | 3300050510 | nmdc:mga06r32_349_c1 | nmdc:mga06r32_349_c1_11989_13083 | 353 |
| 952 | 3300050511 | nmdc:mga08y16_136680_c1 | nmdc:mga08y16_136680_c1_685_1776 | 353 |
| 953 | 3300050511 | nmdc:mga08y16_166391_c1 | nmdc:mga08y16_166391_c1_120_1211 | 353 |
| 954 | 3300050511 | nmdc:mga08y16_418694_c1 | nmdc:mga08y16_418694_c1_216_1307 | 353 |
| 955 | 3300050511 | nmdc:mga08y16_4843_c1 | nmdc:mga08y16_4843_c1_367_1461 | 353 |
| 956 | 3300050512 | nmdc:mga0n895_195013_c1 | nmdc:mga0n895_195013_c1_291_1382 | 353 |
| 957 | 3300050512 | nmdc:mga0n895_34790_c1 | nmdc:mga0n895_34790_c1_1205_2299 | 353 |
| 958 | 3300050512 | nmdc:mga0n895_6898_c1 | nmdc:mga0n895_6898_c1_1313_2404 | 353 |
| 959 | 3300050513 | nmdc:mga0rr50_95825_c1 | nmdc:mga0rr50_95825_c1_78_1172 | 353 |
| 960 | 3300050514 | nmdc:mga08x19_22091_c2 | nmdc:mga08x19_22091_c2_728_1822 | 353 |
| 961 | 3300050515 | nmdc:mga0a205_2525_c1 | nmdc:mga0a205_2525_c1_5414_6505 | 353 |
| 962 | 3300053080 | Ga0500635_0005633 | Ga0500635_0005633_597_1694 | 353 |
| 963 | 3300053080 | Ga0500635_0013826 | Ga0500635_0013826_1178_2272 | 353 |
| 964 | 3300053085 | Ga0495619_0099938 | Ga0495619_0099938_337_1428 | 353 |
| 965 | 3300053085 | Ga0495619_0181116 | Ga0495619_0181116_310_1398 | 353 |
| 966 | 3300053086 | Ga0500578_0058889 | Ga0500578_0058889_328_1416 | 353 |
| 967 | 3300053087 | Ga0500643_000037 | Ga0500643_000037_110804_111892 | 353 |
| 968 | 3300053092 | Ga0500583_0035983 | Ga0500583_0035983_756_1907 | 353 |
| 969 | 3300053093 | Ga0500651_0001199 | Ga0500651_0001199_10090_11184 | 353 |
| 970 | 3300053094 | Ga0500566_0000166 | Ga0500566_0000166_12726_13814 | 353 |
| 971 | 3300053096 | Ga0500641_0015896 | Ga0500641_0015896_297_1388 | 353 |
| 972 | 3300053102 | Ga0500554_000266 | Ga0500554_000266_2418_3515 | 353 |
| 973 | 3300053103 | Ga0500555_000550 | Ga0500555_000550_4580_5668 | 353 |
| 974 | 3300053117 | Ga0500593_009372 | Ga0500593_009372_1574_2665 | 353 |
| 975 | 3300053119 | Ga0500595_001516 | Ga0500595_001516_9083_10177 | 353 |
| 976 | 3300053119 | Ga0500595_003730 | Ga0500595_003730_1654_2745 | 353 |
| 977 | 3300053119 | Ga0500595_012019 | Ga0500595_012019_1674_2762 | 353 |
| 978 | 3300053134 | Ga0500658_0018285 | Ga0500658_0018285_1149_2240 | 353 |
| 979 | 3300053139 | Ga0500568_0005713 | Ga0500568_0005713_3367_4455 | 353 |
| 980 | 3300053150 | Ga0500603_000324 | Ga0500603_000324_8794_9891 | 353 |
| 981 | 3300053153 | Ga0500616_0019257 | Ga0500616_0019257_1260_2348 | 353 |
| 982 | 3300053156 | Ga0500622_0001752 | Ga0500622_0001752_6187_7275 | 353 |
| 983 | 3300053177 | Ga0500636_0004341 | Ga0500636_0004341_6727_7815 | 353 |
| 984 | 3300053178 | Ga0500637_0000582 | Ga0500637_0000582_6611_7708 | 353 |
| 985 | 3300053735 | Ga0500596_002967 | Ga0500596_002967_799_1893 | 353 |
| 986 | 3300053736 | Ga0500599_004061 | Ga0500599_004061_198_1286 | 353 |
| 987 | 3300053737 | Ga0500601_000014 | Ga0500601_000014_29478_30566 | 353 |
| 988 | 3300054114 | Ga0501084_0093192 | Ga0501084_0093192_751_1842 | 353 |
| 989 | 3300055283 | Ga0500661_004660 | Ga0500661_004660_1388_2476 | 353 |
| 990 | iso_pu_bacteria | 8006964411 | 8006968546 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jrx-assembly2.cif.gz_B | crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina | 0.979 | 2 | 31 |
| 1kdg-assembly1.cif.gz_B | crystal structure of the flavin domain of cellobiose dehydrogenase | 0.9733 | 2 | 31 |
| 5nmw-assembly2.cif.gz_D | crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad | 0.9681 | 3 | 31 |
| 1ksu-assembly1.cif.gz_A | crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina | 0.9677 | 2 | 32 |
| 1e39-assembly1.cif.gz_A | flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine | 0.9639 | 2 | 32 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37906_24_389_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9787 | 2 | 32 | 3.50.50.60 |
| af_Q54H99_9_164_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9642 | 2 | 32 | 3.50.50.60 |
| 3ka7A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9575 | 2 | 33 | 3.50.50.60 |
| 5j60C01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9558 | 2 | 32 | 3.50.50.60 |
| 2gqfA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9509 | 2 | 31 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317HWC7-F1-model_v4 | deleted | 0.9951 | 1 | 84 |
|
| AF-A0A810CYI3-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.988 | 1 | 352 |
GO:0016616
GO:0046168 GO:0051287 |
| AF-A0A810CYI3-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.9852 | 1 | 352 |
GO:0016616
GO:0046168 GO:0051287 |
| AF-A0A1X3GPC7-F1-model_v4 | Glycerol-3-phosphate dehydrogenase | 0.9825 | 49 | 352 |
GO:0016491
|
| AF-A0A317HWC7-F1-model_v4 | deleted | 0.9721 | 1 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar