F487585

General Info

Members Datasets Scaffolds Average Seq Length
989 669 691 333

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000319|Ga0157378_1000031949
Length 335
Sequence VKAFIVDRYKKGGALRLGEMPEPAVRDHDVLVAVHAAALNPLDAKIRDGEFKLILPYRLPLILGNDVAGVVVRVGPKVRRFKPGDEVYARPSKDRIGTFAEYIAMDEADVALKPRNLSMEEAASVPLVALTAWQVLIERAELKQGQKVLIHAGSGGVGAFAIQLAKHLGATVATTTSTTNVDVVIDYKKENFARVLSGYDVVLNSLGKDTLEQSIDVLKPGGKLISISGPPDVAFAKENGLNWFLQQVMRLLSFGIRTKANRRGISYSFLFMRANGEQLGKITSLIEAGVIRQVVDRIFPFREFNEGMRYLETGRAVGKVVIRVGANENAHPGVP

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
17 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
21 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
22 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
23 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
24 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
25 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
26 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
27 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
28 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
29 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
30 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
31 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
32 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
33 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
34 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
35 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
36 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
37 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
38 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
39 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
40 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
41 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
42 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
43 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
44 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
45 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
46 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
47 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
48 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
49 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
50 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
51 2643221573 Lysobacter sp. Root604 Isolate Unclassified
52 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
53 2643221596 Acidovorax sp. Root70 Isolate Unclassified
54 2643221609 Acidovorax sp. Root217 Isolate Unclassified
55 2643221611 Acidovorax sp. Root219 Isolate Unclassified
56 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
57 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
58 2643221626 Ensifer sp. Root31 Isolate Unclassified
59 2643221640 Caulobacter sp. Root342 Isolate Unclassified
60 2643221642 Caulobacter sp. Root343 Isolate Unclassified
61 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
62 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
63 2643221659 Ensifer sp. Root127 Isolate Unclassified
64 2643221698 Ensifer sp. Root142 Isolate Unclassified
65 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
66 2643221719 Rhizobium sp. Root274 Isolate Unclassified
67 2643221720 Lysobacter sp. Root916 Isolate Unclassified
68 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
69 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
70 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
71 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
72 2738541277 Variovorax sp. GV051 Isolate Unclassified
73 2738541283 Pedobacter sp. OK701 Isolate Unclassified
74 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
75 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
76 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
77 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
78 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
79 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
80 2738543019 Variovorax sp. GV040 Isolate Unclassified
81 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
82 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
83 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
84 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
85 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
86 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
87 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
88 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
89 2791355263 Rhizobium chutanense C5 Isolate Nodule
90 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
91 2802429633 Rhizobium anhuiense J3 Isolate Nodule
92 2802429634 Rhizobium anhuiense S10 Isolate Nodule
93 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
94 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
95 2802429637 Rhizobium anhuiense C15 Isolate Nodule
96 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
97 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
98 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
99 2818991435 Caulobacter henricii 536 Isolate Unclassified
100 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
101 2818991450 Burkholderia sp. 604 Isolate Unclassified
102 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
103 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
104 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
105 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
106 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
107 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
108 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
109 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
110 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
111 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
112 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
113 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
114 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
115 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
116 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
117 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
118 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
119 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
120 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
121 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
122 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
123 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
124 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
125 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
126 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
127 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
128 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
129 2844163670 Ensifer sp. 1H6 Isolate Unclassified
130 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
131 2851182111 Bosea sp. Tri-44 Isolate Nodule
132 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
133 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
134 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
135 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
136 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
137 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
138 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
139 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
140 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
141 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
142 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
143 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
144 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
145 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
146 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
147 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
148 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
149 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
150 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
151 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
152 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
153 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
154 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
155 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
156 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
157 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
158 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
159 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
160 2885198086 Variovorax sp. 679 Isolate Unclassified
161 2885211737 Variovorax sp. 553 Isolate Unclassified
162 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
163 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
164 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
165 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
166 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
167 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
168 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
169 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
170 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
171 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
172 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
173 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
174 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
175 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
176 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
177 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
178 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
179 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
180 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
181 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
182 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
183 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
184 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
185 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
186 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
187 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
188 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
189 2928070936 Variovorax gossypii 1167 Isolate Unclassified
190 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
191 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
192 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
193 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
194 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
195 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
196 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
197 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
198 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
199 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
200 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
201 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
202 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
203 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
204 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
205 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
206 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
207 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
208 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
209 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
210 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
211 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
212 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
213 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
214 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
215 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
216 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
217 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
218 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
219 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
220 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
221 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
222 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
223 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
224 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
225 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
226 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
227 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
228 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
229 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
230 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
231 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
232 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
233 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
234 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
235 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
236 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
237 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
238 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
239 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
240 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
241 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
242 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
243 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
244 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
245 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
246 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
247 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
248 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
249 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
250 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
251 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
252 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
253 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
254 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
255 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
256 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
257 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
258 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
259 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
260 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
261 3004167301 Mesorhizobium loti 582 Isolate Unclassified
262 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
263 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
264 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
265 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
266 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
267 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
268 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
269 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
270 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
271 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
272 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
273 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
274 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
275 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
276 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
277 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
278 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
279 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
280 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
281 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
282 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
283 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
284 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
285 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
286 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
287 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
288 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
289 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
290 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
291 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
292 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
293 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
294 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
295 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
296 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
297 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
298 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
299 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
300 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
301 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
302 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
303 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
304 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
305 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
306 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
307 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
308 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
309 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
310 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
311 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
312 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
313 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
314 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
315 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
316 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
317 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
318 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
319 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
320 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
321 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
322 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
323 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
324 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
325 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
326 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
327 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
328 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
329 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
330 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
331 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
332 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
333 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
334 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
335 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
336 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
337 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
338 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
339 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
340 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
341 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
342 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
343 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
344 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
345 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
346 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
347 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
348 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
349 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
350 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
351 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
352 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
353 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
354 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
355 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
356 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
357 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
358 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
359 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
360 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
361 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
362 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
363 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
364 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
365 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
366 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
367 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
368 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
369 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
370 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
371 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
372 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
373 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
374 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
375 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
376 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
377 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
378 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
379 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
380 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
381 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
382 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
383 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
384 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
385 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
386 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
387 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
388 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
389 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
390 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
391 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
392 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
393 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
394 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
396 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
397 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
398 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
400 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
401 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
403 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
404 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
453 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
454 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
458 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
459 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
460 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
461 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
462 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
463 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
464 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
465 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
466 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
467 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
468 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
469 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
470 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
471 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
472 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
473 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
474 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
475 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
476 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
477 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
478 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
479 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
480 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
481 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
482 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
483 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
484 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
485 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
486 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
487 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
488 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
489 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
490 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
491 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
492 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
493 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
494 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
495 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
496 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
497 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
498 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
499 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
500 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
501 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
502 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
503 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
504 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
505 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
506 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
507 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
508 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
509 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
510 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
511 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
512 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
513 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
514 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
515 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
516 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
517 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
518 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
519 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
520 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
521 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
522 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
523 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
524 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
525 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
526 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
527 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
528 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
529 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
530 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
531 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
532 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
533 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
534 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
535 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
536 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
537 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
538 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
539 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
540 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
541 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
542 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
543 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
544 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
545 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
546 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
547 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
548 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
549 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
550 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
551 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
552 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
553 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
554 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
555 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
556 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
557 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
558 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
559 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
560 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
563 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
564 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
565 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
566 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
567 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
568 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
569 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
570 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
571 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
572 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
573 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
574 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
575 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
576 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
577 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
578 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
579 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
580 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
581 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
582 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
583 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
584 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
585 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
586 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
587 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
588 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
589 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
590 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
591 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
592 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
593 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
594 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
598 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
599 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
600 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
601 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
602 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
603 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
604 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
605 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
606 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
607 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
608 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
609 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
610 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
611 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
612 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
613 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
614 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
615 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
616 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
617 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
618 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
619 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
620 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
621 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
622 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
623 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
624 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
625 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
626 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
627 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
628 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
629 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
630 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
631 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
632 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
633 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
634 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
635 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
636 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
637 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
638 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
639 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
640 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
641 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
642 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
643 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
644 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
645 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
646 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
647 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
648 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
649 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
650 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
651 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
652 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
653 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
654 8005258706 Rhizobium sp. R693 Isolate Nodule
655 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
656 8005321885 Rhizobium sp. R72 Isolate Nodule
657 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
658 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
659 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
660 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
661 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
662 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
663 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
664 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
665 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
666 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
667 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
668 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
669 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.87
Metatranscriptomes 0
Isolates 30.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 17.8
Rhizoplane 1.82
Rhizosphere 56.52
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001788 3300001979 Bacteria 9857
2 JGI24739J22299_10008123 3300001989 Bacteria 3918
3 JGI24739J22299_10023597 3300001989 Bacteria 2173
4 JGI24737J22298_10003380 3300001990 Bacteria 5642
5 JGI24737J22298_10004822 3300001990 Bacteria 4683
6 JGI24743J22301_10006797 3300001991 Bacteria 1963
7 JGI24738J21930_10001816 3300002075 Bacteria 5787
8 JGI24738J21930_10010554 3300002075 Bacteria 2054
9 JGI25156J39149_1000873 3300002705 Bacteria 15026
10 JGI25156J39149_1001284 3300002705 Bacteria 10895
11 JGI25162J39368_1000642 3300002737 Bacteria 24772
12 JGI25154J39366_1000069 3300002738 Bacteria 96438
13 JGI25154J39366_1001801 3300002738 Bacteria 6715
14 JGI25157J39369_1000851 3300002741 Bacteria 15031
15 JGI25151J46595_10001575 3300003187 Bacteria 15220
16 JGI25165J46597_1000999 3300003214 Bacteria 18766
17 JGI25165J46597_1001072 3300003214 Bacteria 17563
18 JGI25165J46597_1002307 3300003214 Bacteria 6506
19 JGI25153J46596_10001714 3300003215 Bacteria 12988
20 rootL2_10004516 3300003322 Bacteria 8575
21 rootL2_10363542 3300003322 Unclassified 1741
22 JGI25160J50197_1012841 3300003354 Bacteria 2885
23 JGI25161J50226_1002832 3300003374 Bacteria 4250
24 Ga0055539_1000513 3300003752 Bacteria 11908
25 Ga0055524_1012206 3300003775 Bacteria 3312
26 Ga0055531_10000965 3300003794 Bacteria 23016
27 Ga0058692_1000035 3300003856 Bacteria 152983
28 Ga0055543_1001188 3300004625 Bacteria 10960
29 Ga0065165_1000241 3300005262 Bacteria 93644
30 Ga0065165_1002670 3300005262 Bacteria 14404
31 Ga0065715_10089106 3300005293 Bacteria 14278
32 Ga0070658_10005121 3300005327 Bacteria 10670
33 Ga0070658_10041562 3300005327 Bacteria 3710
34 Ga0070670_100043399 3300005331 Bacteria 3865
35 Ga0068869_100051298 3300005334 Bacteria 2993
36 Ga0068869_100072738 3300005334 Bacteria 2548
37 Ga0068869_100454803 3300005334 Bacteria 1062
38 Ga0070666_10025670 3300005335 Bacteria 3843
39 Ga0070666_10193979 3300005335 Bacteria 1428
40 Ga0068868_100087708 3300005338 Bacteria 2503
41 Ga0070660_100133936 3300005339 Bacteria 1985
42 Ga0070660_100188043 3300005339 Bacteria 1672
43 Ga0070660_100252382 3300005339 Bacteria 1439
44 Ga0070668_100053824 3300005347 Bacteria 3103
45 Ga0070668_100203068 3300005347 Bacteria 1628
46 Ga0070669_100204096 3300005353 Bacteria 1557
47 Ga0070675_100276405 3300005354 Bacteria 1475
48 Ga0070675_100388678 3300005354 Bacteria 1243
49 Ga0070671_100122939 3300005355 Bacteria 2184
50 Ga0070671_100153126 3300005355 Bacteria 1947
51 Ga0070674_100033790 3300005356 Bacteria 3408
52 Ga0070674_100249814 3300005356 Bacteria 1393
53 Ga0070673_100029907 3300005364 Bacteria 4068
54 Ga0070673_100048494 3300005364 Bacteria 3311
55 Ga0070659_100001718 3300005366 Bacteria 15751
56 Ga0070659_100028187 3300005366 Bacteria 4334
57 Ga0070659_100162400 3300005366 Bacteria 1827
58 Ga0070667_100057349 3300005367 Bacteria 3292
59 Ga0070667_100290157 3300005367 Bacteria 1471
60 Ga0070705_100075763 3300005440 Bacteria 2049
61 Ga0070700_100076132 3300005441 Bacteria 2154
62 Ga0070708_100118089 3300005445 Bacteria 2443
63 Ga0070708_100205401 3300005445 Bacteria 1845
64 Ga0070662_100000167 3300005457 Bacteria 38204
65 Ga0070662_100079420 3300005457 Bacteria 2440
66 Ga0070662_100220601 3300005457 Bacteria 1513
67 Ga0068867_100126997 3300005459 Bacteria 1977
68 Ga0068867_100134289 3300005459 Bacteria 1927
69 Ga0070706_100003698 3300005467 Bacteria 14968
70 Ga0070706_100193872 3300005467 Bacteria 1898
71 Ga0070707_100005425 3300005468 Bacteria 11927
72 Ga0070707_100108298 3300005468 Bacteria 2695
73 Ga0070698_100054281 3300005471 Bacteria 4069
74 Ga0070698_100147290 3300005471 Bacteria 2303
75 Ga0070698_100487148 3300005471 Bacteria 1170
76 Ga0070699_100007692 3300005518 Bacteria 9368
77 Ga0070699_100227605 3300005518 Bacteria 1662
78 Ga0070679_100221311 3300005530 Bacteria 1854
79 Ga0070684_100051678 3300005535 Bacteria 3571
80 Ga0070697_100006095 3300005536 Bacteria 9327
81 Ga0070697_100296960 3300005536 Bacteria 1388
82 Ga0068853_100018261 3300005539 Bacteria 5803
83 Ga0068853_100156821 3300005539 Bacteria 2051
84 Ga0070672_100001960 3300005543 Bacteria 12906
85 Ga0070672_100074753 3300005543 Bacteria 2704
86 Ga0070665_100000006 3300005548 Bacteria 718034
87 Ga0070665_100007151 3300005548 Bacteria 11349
88 Ga0070665_100016065 3300005548 Bacteria 7512
89 Ga0070665_100303727 3300005548 Bacteria 1599
90 Ga0070704_100024496 3300005549 Bacteria 3960
91 Ga0070704_100181522 3300005549 Bacteria 1684
92 Ga0070704_100425153 3300005549 Bacteria 1138
93 Ga0068855_100007578 3300005563 Bacteria 13132
94 Ga0068855_100064015 3300005563 Bacteria 4289
95 Ga0068855_100275068 3300005563 Bacteria 1871
96 Ga0068855_100343998 3300005563 Bacteria 1644
97 Ga0068857_100000489 3300005577 Bacteria 28341
98 Ga0068857_100117345 3300005577 Bacteria 2395
99 Ga0068857_100220463 3300005577 Bacteria 1732
100 Ga0068854_100008799 3300005578 Bacteria 6497
101 Ga0068854_100071479 3300005578 Bacteria 2538
102 Ga0068856_100000991 3300005614 Bacteria 30324
103 Ga0068856_100041460 3300005614 Bacteria 4524
104 Ga0068856_100209029 3300005614 Bacteria 1967
105 Ga0068852_100052049 3300005616 Bacteria 3518
106 Ga0068852_100117952 3300005616 Bacteria 2424
107 Ga0068852_100122678 3300005616 Bacteria 2382
108 Ga0068859_100000151 3300005617 Bacteria 66183
109 Ga0068859_100007089 3300005617 Bacteria 11377
110 Ga0068861_100001690 3300005719 Bacteria 14160
111 Ga0068851_10010112 3300005834 Bacteria 4396
112 Ga0068851_10018502 3300005834 Bacteria 3356
113 Ga0068851_10105116 3300005834 Bacteria 1502
114 Ga0068863_100026949 3300005841 Bacteria 5480
115 Ga0068863_100054170 3300005841 Bacteria 3801
116 Ga0068863_100117728 3300005841 Bacteria 2532
117 Ga0068863_100250274 3300005841 Bacteria 1711
118 Ga0068863_100456958 3300005841 Bacteria 1254
119 Ga0068858_100000273 3300005842 Bacteria 55482
120 Ga0068858_100006378 3300005842 Bacteria 11490
121 Ga0068858_100008996 3300005842 Bacteria 9552
122 Ga0068858_100113852 3300005842 Bacteria 2526
123 Ga0068858_100365369 3300005842 Bacteria 1383
124 Ga0068860_100046091 3300005843 Bacteria 4157
125 Ga0068860_100341009 3300005843 Bacteria 1473
126 Ga0068862_100020999 3300005844 Bacteria 5456
127 Ga0068862_100024533 3300005844 Bacteria 5061
128 Ga0068862_100234316 3300005844 Bacteria 1666
129 Ga0068862_100284396 3300005844 Bacteria 1517
130 Ga0070717_10006422 3300006028 Bacteria 8647
131 Ga0070717_10101276 3300006028 Bacteria 2446
132 Ga0075365_10002167 3300006038 Bacteria 9449
133 Ga0075365_10144624 3300006038 Bacteria 1652
134 Ga0075368_10007659 3300006042 Bacteria 3817
135 Ga0075368_10019634 3300006042 Bacteria 2552
136 Ga0075364_10106867 3300006051 Bacteria 1865
137 Ga0075432_10013171 3300006058 Bacteria 2809
138 Ga0070715_10063920 3300006163 Bacteria 1624
139 Ga0075362_10000508 3300006177 Bacteria 11381
140 Ga0075367_10036200 3300006178 Bacteria 2861
141 Ga0075367_10176970 3300006178 Bacteria 1329
142 Ga0075369_10005799 3300006186 Bacteria 4637
143 Ga0075369_10023666 3300006186 Bacteria 2540
144 Ga0075366_10001556 3300006195 Bacteria 11484
145 Ga0075366_10015983 3300006195 Bacteria 4309
146 Ga0075366_10034597 3300006195 Bacteria 2976
147 Ga0075366_10121530 3300006195 Unclassified 1574
148 Ga0075370_10008118 3300006353 Bacteria 5390
149 Ga0075370_10052305 3300006353 Bacteria 2317
150 Ga0075370_10058171 3300006353 Bacteria 2198
151 Ga0075428_100026574 3300006844 Bacteria 6408
152 Ga0075428_100100604 3300006844 Bacteria 3152
153 Ga0075430_100010209 3300006846 Bacteria 7952
154 Ga0075430_100037469 3300006846 Bacteria 4110
155 Ga0075430_100129903 3300006846 Bacteria 2100
156 Ga0075431_100113557 3300006847 Bacteria 2796
157 Ga0075434_100017992 3300006871 Bacteria 6820
158 Ga0075429_100006117 3300006880 Bacteria 10402
159 Ga0075429_100049552 3300006880 Bacteria 3652
160 Ga0068865_100180466 3300006881 Bacteria 1625
161 Ga0075436_100087478 3300006914 Bacteria 2164
162 Ga0097620_100000151 3300006931 Bacteria 66183
163 Ga0097620_100007089 3300006931 Bacteria 11377
164 Ga0075435_100041263 3300007076 Bacteria 3688
165 Ga0105251_10000837 3300009011 Bacteria 27603
166 Ga0105244_10003082 3300009036 Bacteria 12199
167 Ga0105244_10030578 3300009036 Bacteria 2864
168 Ga0105240_10000142 3300009093 Bacteria 146932
169 Ga0105240_10068267 3300009093 Bacteria 4403
170 Ga0105240_10085783 3300009093 Bacteria 3857
171 Ga0105240_10095230 3300009093 Bacteria 3630
172 Ga0105240_10108637 3300009093 Bacteria 3360
173 Ga0105240_10472789 3300009093 Bacteria 1399
174 Ga0111539_10348399 3300009094 Bacteria 1724
175 Ga0105245_10102479 3300009098 Bacteria 2651
176 Ga0105247_10014016 3300009101 Bacteria 4807
177 Ga0105247_10035380 3300009101 Bacteria 3044
178 Ga0114129_10561688 3300009147 Unclassified 1483
179 Ga0105243_10005104 3300009148 Bacteria 10305
180 Ga0105243_10218194 3300009148 Bacteria 1684
181 Ga0105241_10012545 3300009174 Bacteria 6216
182 Ga0105241_10027870 3300009174 Bacteria 4207
183 Ga0105241_10064139 3300009174 Bacteria 2836
184 Ga0105248_10000764 3300009177 Bacteria 36109
185 Ga0105248_10132844 3300009177 Bacteria 2808
186 Ga0105248_10139030 3300009177 Bacteria 2740
187 Ga0105248_10301610 3300009177 Bacteria 1804
188 Ga0105237_10053876 3300009545 Bacteria 4033
189 Ga0105237_10131081 3300009545 Bacteria 2501
190 Ga0105237_10358871 3300009545 Bacteria 1462
191 Ga0105238_10038755 3300009551 Bacteria 4839
192 Ga0105238_10113596 3300009551 Bacteria 2688
193 Ga0105238_10222572 3300009551 Bacteria 1863
194 Ga0105249_10019476 3300009553 Bacteria 6055
195 Ga0123342_1017216 3300009766 Bacteria 6065
196 Ga0105239_10009037 3300010375 Bacteria 11282
197 Ga0105239_10033221 3300010375 Bacteria 5666
198 Ga0105239_10044778 3300010375 Bacteria 4850
199 Ga0105239_10062150 3300010375 Bacteria 4099
200 Ga0105239_10064171 3300010375 Bacteria 4032
201 Ga0105239_10072703 3300010375 Bacteria 3781
202 Ga0105239_10081086 3300010375 Bacteria 3571
203 Ga0105239_10722216 3300010375 Bacteria 1140
204 Ga0105246_10051609 3300011119 Bacteria 2825
205 Ga0105246_10062221 3300011119 Bacteria 2599
206 Ga0105246_10148420 3300011119 Bacteria 1772
207 Ga0157373_10048454 3300013100 Bacteria 3029
208 Ga0157373_10056285 3300013100 Bacteria 2793
209 Ga0157373_10057525 3300013100 Bacteria 2758
210 Ga0157370_10001666 3300013104 Bacteria 27356
211 Ga0157370_10018690 3300013104 Bacteria 6969
212 Ga0157370_10122823 3300013104 Bacteria 2425
213 Ga0157369_10027598 3300013105 Bacteria 6290
214 Ga0157369_10031335 3300013105 Bacteria 5855
215 Ga0157369_10098085 3300013105 Bacteria 3126
216 Ga0157369_10103270 3300013105 Bacteria 3036
217 Ga0157374_10004368 3300013296 Bacteria 11900
218 Ga0157374_10007769 3300013296 Bacteria 9154
219 Ga0157374_10065564 3300013296 Bacteria 3411
220 Ga0157374_10179313 3300013296 Bacteria 2069
221 Ga0157374_10204448 3300013296 Bacteria 1935
222 Ga0157378_10000319 3300013297 Bacteria 47265
223 Ga0163162_10137842 3300013306 Bacteria 2551
224 Ga0157372_10018994 3300013307 Bacteria 7397
225 Ga0157372_10043036 3300013307 Bacteria 4998
226 Ga0157375_10003013 3300013308 Bacteria 14623
227 Ga0163163_10034598 3300014325 Bacteria 4895
228 Ga0157380_10057383 3300014326 Bacteria 3100
229 Ga0182008_10025740 3300014497 Bacteria 2988
230 Ga0182008_10039458 3300014497 Bacteria 2359
231 Ga0182008_10046900 3300014497 Bacteria 2147
232 Ga0157379_10008013 3300014968 Bacteria 9166
233 Ga0157379_10022204 3300014968 Bacteria 5622
234 Ga0157376_10407585 3300014969 Bacteria 1316
235 Ga0182006_1013342 3300015261 Bacteria 3567
236 Ga0182006_1013820 3300015261 Bacteria 3492
237 Ga0182006_1027109 3300015261 Bacteria 2341
238 Ga0182006_1042021 3300015261 Bacteria 1793
239 Ga0182007_10000445 3300015262 Bacteria 25030
240 Ga0182007_10005878 3300015262 Bacteria 5332
241 Ga0182007_10010414 3300015262 Bacteria 3675
242 Ga0163161_10123495 3300017792 Bacteria 1947
243 Ga0163161_10220475 3300017792 Bacteria 1469
244 Ga0163161_10247922 3300017792 Bacteria 1387
245 Ga0209437_100179 3300025233 Bacteria 134210
246 Ga0209437_102131 3300025233 Bacteria 3989
247 Ga0207425_1003095 3300025245 Bacteria 5499
248 Ga0209646_1000299 3300025246 Bacteria 40564
249 Ga0209026_1000382 3300025250 Bacteria 40564
250 Ga0209677_100222 3300025253 Bacteria 40564
251 Ga0209677_101959 3300025253 Bacteria 8209
252 Ga0209759_1000085 3300025256 Bacteria 168382
253 Ga0209759_1000529 3300025256 Bacteria 40564
254 Ga0209129_1000566 3300025258 Bacteria 25492
255 Ga0209233_1000185 3300025261 Bacteria 133788
256 Ga0209233_1000263 3300025261 Bacteria 79293
257 Ga0209455_1005371 3300025272 Bacteria 3975
258 Ga0209025_1000082 3300025294 Bacteria 265613
259 Ga0209758_1000319 3300025297 Bacteria 92649
260 Ga0209758_1003930 3300025297 Bacteria 12947
261 Ga0209758_1049084 3300025297 Bacteria 1494
262 Ga0209050_1000221 3300025298 Bacteria 126843
263 Ga0209256_1000794 3300025299 Bacteria 40601
264 Ga0207426_1000210 3300025302 Bacteria 138932
265 Ga0209257_1000538 3300025304 Bacteria 65300
266 Ga0207656_10057803 3300025321 Bacteria 1693
267 Ga0207655_1004047 3300025728 Bacteria 10557
268 Ga0207713_1000336 3300025735 Bacteria 52391
269 Ga0207653_10045597 3300025885 Bacteria 1448
270 Ga0207642_10072020 3300025899 Bacteria 1648
271 Ga0207710_10004946 3300025900 Bacteria 5774
272 Ga0207680_10090403 3300025903 Bacteria 1946
273 Ga0207647_10000209 3300025904 Bacteria 47604
274 Ga0207647_10000515 3300025904 Bacteria 30820
275 Ga0207647_10101113 3300025904 Bacteria 1710
276 Ga0207645_10042759 3300025907 Bacteria 2899
277 Ga0207705_10000607 3300025909 Bacteria 30025
278 Ga0207684_10009256 3300025910 Bacteria 8706
279 Ga0207684_10071261 3300025910 Bacteria 2954
280 Ga0207684_10081248 3300025910 Bacteria 2758
281 Ga0207684_10235168 3300025910 Bacteria 1581
282 Ga0207654_10042723 3300025911 Bacteria 2567
283 Ga0207695_10000234 3300025913 Bacteria 146987
284 Ga0207695_10076941 3300025913 Bacteria 3391
285 Ga0207695_10251458 3300025913 Bacteria 1667
286 Ga0207695_10305432 3300025913 Bacteria 1482
287 Ga0207671_10000234 3300025914 Bacteria 83448
288 Ga0207671_10059513 3300025914 Bacteria 2833
289 Ga0207657_10002587 3300025919 Bacteria 19578
290 Ga0207657_10074458 3300025919 Bacteria 2867
291 Ga0207657_10185208 3300025919 Bacteria 1682
292 Ga0207657_10329041 3300025919 Bacteria 1207
293 Ga0207657_10342764 3300025919 Bacteria 1179
294 Ga0207652_10087941 3300025921 Bacteria 2725
295 Ga0207646_10003418 3300025922 Bacteria 17930
296 Ga0207681_10115444 3300025923 Bacteria 1960
297 Ga0207694_10013955 3300025924 Bacteria 6057
298 Ga0207694_10083669 3300025924 Bacteria 2509
299 Ga0207650_10038633 3300025925 Bacteria 3487
300 Ga0207659_10351313 3300025926 Unclassified 1223
301 Ga0207687_10042786 3300025927 Bacteria 3118
302 Ga0207644_10042344 3300025931 Bacteria 3227
303 Ga0207644_10140771 3300025931 Bacteria 1858
304 Ga0207644_10168459 3300025931 Bacteria 1708
305 Ga0207690_10004275 3300025932 Bacteria 8432
306 Ga0207690_10013606 3300025932 Bacteria 4892
307 Ga0207706_10000257 3300025933 Bacteria 57965
308 Ga0207706_10019903 3300025933 Bacteria 6033
309 Ga0207706_10098669 3300025933 Bacteria 2569
310 Ga0207706_10115917 3300025933 Bacteria 2356
311 Ga0207686_10176222 3300025934 Bacteria 1512
312 Ga0207669_10022696 3300025937 Bacteria 3338
313 Ga0207691_10099715 3300025940 Bacteria 2593
314 Ga0207691_10101366 3300025940 Bacteria 2569
315 Ga0207711_10005529 3300025941 Bacteria 10687
316 Ga0207689_10050301 3300025942 Bacteria 3437
317 Ga0207689_10061444 3300025942 Bacteria 3089
318 Ga0207667_10003616 3300025949 Bacteria 19076
319 Ga0207667_10011742 3300025949 Bacteria 10157
320 Ga0207667_10070109 3300025949 Bacteria 3649
321 Ga0207667_10267979 3300025949 Bacteria 1746
322 Ga0207651_10009347 3300025960 Bacteria 5360
323 Ga0207651_10014951 3300025960 Bacteria 4496
324 Ga0207712_10101881 3300025961 Bacteria 2136
325 Ga0207668_10045810 3300025972 Bacteria 2985
326 Ga0207668_10132961 3300025972 Bacteria 1902
327 Ga0207658_10095119 3300025986 Bacteria 2320
328 Ga0207677_10132242 3300026023 Bacteria 1897
329 Ga0207677_10165885 3300026023 Bacteria 1721
330 Ga0207703_10000403 3300026035 Bacteria 46432
331 Ga0207703_10005587 3300026035 Bacteria 10096
332 Ga0207703_10006415 3300026035 Bacteria 9402
333 Ga0207703_10161961 3300026035 Bacteria 1960
334 Ga0207703_10177879 3300026035 Bacteria 1876
335 Ga0207703_10421249 3300026035 Bacteria 1242
336 Ga0207639_10034832 3300026041 Bacteria 3723
337 Ga0207639_10165050 3300026041 Bacteria 1870
338 Ga0207678_10046737 3300026067 Bacteria 3743
339 Ga0207678_10157794 3300026067 Bacteria 1937
340 Ga0207708_10015977 3300026075 Bacteria 5637
341 Ga0207702_10000308 3300026078 Bacteria 55913
342 Ga0207702_10096893 3300026078 Bacteria 2595
343 Ga0207641_10315288 3300026088 Bacteria 1481
344 Ga0207641_10321578 3300026088 Bacteria 1467
345 Ga0207648_10012463 3300026089 Bacteria 7960
346 Ga0207676_10490367 3300026095 Bacteria 1165
347 Ga0207674_10006843 3300026116 Bacteria 13372
348 Ga0207674_10012468 3300026116 Bacteria 9499
349 Ga0207674_10161660 3300026116 Bacteria 2194
350 Ga0207674_10179049 3300026116 Bacteria 2072
351 Ga0207675_100000049 3300026118 Bacteria 84016
352 Ga0207675_100215474 3300026118 Bacteria 1849
353 Ga0207698_10063959 3300026142 Bacteria 2882
354 Ga0207698_10134992 3300026142 Bacteria 2116
355 Ga0207698_10266661 3300026142 Bacteria 1576
356 Ga0207698_10580566 3300026142 Bacteria 1103
357 Ga0209371_1000043 3300027312 Bacteria 331009
358 Ga0209371_1000693 3300027312 Bacteria 28682
359 Ga0207428_10203424 3300027907 Bacteria 1490
360 Ga0268266_10000010 3300028379 Bacteria 1030233
361 Ga0268266_10022317 3300028379 Bacteria 5395
362 Ga0268266_10044623 3300028379 Bacteria 3790
363 Ga0268265_10000554 3300028380 Bacteria 38099
364 Ga0268265_10120267 3300028380 Bacteria 2162
365 Ga0268265_10276271 3300028380 Bacteria 1501
366 Ga0268264_10034265 3300028381 Bacteria 4175
367 Ga0268264_10127727 3300028381 Bacteria 2249
368 Ga0307517_10006006 3300028786 Bacteria 18095
369 Ga0307517_10195873 3300028786 Bacteria 1273
370 Ga0307515_10023583 3300028794 Bacteria 10775
371 Ga0307515_10104763 3300028794 Bacteria 3375
372 Ga0307515_10213156 3300028794 Bacteria 1770
373 Ga0307515_10320094 3300028794 Bacteria 1218
374 Ga0268256_1000044 3300030500 Bacteria 330997
375 Ga0268256_1003158 3300030500 Bacteria 7671
376 Ga0307511_10005062 3300030521 Bacteria 13442
377 Ga0316177_1027618 3300030731 Bacteria 2660
378 Ga0316177_1054620 3300030731 Bacteria 3918
379 Ga0314311_1034637 3300030733 Bacteria 15856
380 Ga0316182_1382167 3300030745 Bacteria 2095
381 Ga0265331_10006389 3300031250 Bacteria 6977
382 Ga0265327_10000776 3300031251 Bacteria 49288
383 Ga0307513_10031414 3300031456 Bacteria 6015
384 Ga0307513_10223624 3300031456 Bacteria 1701
385 Ga0307509_10251876 3300031507 Bacteria 1549
386 Ga0307408_100045052 3300031548 Bacteria 3148
387 Ga0307508_10000011 3300031616 Bacteria 248001
388 Ga0307508_10166018 3300031616 Bacteria 1811
389 Ga0307508_10197080 3300031616 Bacteria 1615
390 Ga0307516_10029463 3300031730 Bacteria 5551
391 Ga0307405_10074830 3300031731 Bacteria 2191
392 Ga0307405_10082389 3300031731 Bacteria 2106
393 Ga0307405_10112653 3300031731 Bacteria 1846
394 Ga0307413_10015987 3300031824 Bacteria 3861
395 Ga0307413_10040896 3300031824 Bacteria 2710
396 Ga0307413_10083185 3300031824 Bacteria 2059
397 Ga0307413_10201367 3300031824 Bacteria 1438
398 Ga0307410_10059987 3300031852 Bacteria 2598
399 Ga0307410_10203726 3300031852 Bacteria 1512
400 Ga0307406_10000348 3300031901 Bacteria 26954
401 Ga0307406_10018310 3300031901 Bacteria 4090
402 Ga0307406_10105655 3300031901 Bacteria 1927
403 Ga0307406_10192149 3300031901 Bacteria 1495
404 Ga0307407_10018450 3300031903 Bacteria 3529
405 Ga0307412_10000002 3300031911 Bacteria 743446
406 Ga0307412_10012181 3300031911 Bacteria 5001
407 Ga0307412_10064347 3300031911 Bacteria 2478
408 Ga0307412_10130063 3300031911 Bacteria 1827
409 Ga0307409_100046305 3300031995 Bacteria 3291
410 Ga0307409_100434140 3300031995 Bacteria 1263
411 Ga0307416_100007386 3300032002 Bacteria 6984
412 Ga0307416_100044158 3300032002 Bacteria 3496
413 Ga0307416_100087157 3300032002 Bacteria 2664
414 Ga0307414_10000449 3300032004 Bacteria 21733
415 Ga0307414_10006402 3300032004 Bacteria 6564
416 Ga0307414_10030580 3300032004 Bacteria 3520
417 Ga0307414_10047460 3300032004 Bacteria 2955
418 Ga0307414_10079892 3300032004 Bacteria 2389
419 Ga0307414_10114750 3300032004 Bacteria 2058
420 Ga0307414_10456842 3300032004 Bacteria 1121
421 Ga0307411_10018881 3300032005 Bacteria 3968
422 Ga0307411_10033515 3300032005 Bacteria 3186
423 Ga0307411_10076867 3300032005 Bacteria 2283
424 Ga0307411_10095807 3300032005 Bacteria 2084
425 Ga0307411_10121251 3300032005 Bacteria 1892
426 Ga0307411_10150027 3300032005 Bacteria 1731
427 Ga0307415_100002524 3300032126 Bacteria 9145
428 Ga0307415_100060274 3300032126 Bacteria 2621
429 Ga0307415_100175145 3300032126 Bacteria 1677
430 Ga0307510_10000038 3300033180 Bacteria 106256
431 Ga0307510_10001244 3300033180 Bacteria 27679
432 Ga0307510_10021309 3300033180 Bacteria 7553
433 Ga0373937_0171774 3300036401 Bacteria 2034
434 Ga0395900_0067817 3300037418 Bacteria 3665
435 Ga0395905_0001404 3300037471 Bacteria 29151
436 Ga0395905_0142624 3300037471 Bacteria 2253
437 Ga0395905_0200010 3300037471 Bacteria 1873
438 Ga0395905_0350576 3300037471 Bacteria 1368
439 Ga0395901_0497604 3300038443 Bacteria 1241
440 Ga0436363_1258129 3300039450 Bacteria 2874
441 Ga0439438_000156 3300041405 Bacteria 31119
442 Ga0439447_000119 3300041407 Bacteria 26584
443 Ga0439447_000835 3300041407 Bacteria 11291
444 Ga0439447_003351 3300041407 Bacteria 5700
445 Ga0439466_0004964 3300041411 Bacteria 5110
446 Ga0439465_0004512 3300041413 Bacteria 4500
447 Ga0451793_0479790 3300041452 Bacteria 3720
448 Ga0451795_0032520 3300041456 Bacteria 2482
449 Ga0451798_0892919 3300041458 Bacteria 1884
450 Ga0451800_0392314 3300041459 Bacteria 6297
451 Ga0451853_1117171 3300041512 Bacteria 1422
452 Ga0439431_0042390 3300041997 Bacteria 1162
453 Ga0439432_015862 3300042006 Bacteria 2537
454 Ga0439450_033524 3300042008 Bacteria 1165
455 Ga0439457_000344 3300042014 Bacteria 12945
456 Ga0439457_020551 3300042014 Bacteria 1465
457 Ga0450897_001337 3300042128 Bacteria 1663
458 Ga0451577_0002536 3300042876 Bacteria 21608
459 Ga0451577_0286976 3300042876 Bacteria 1491
460 Ga0453683_0064422 3300044673 Bacteria 2291
461 Ga0453684_0000353 3300044712 Bacteria 191059
462 Ga0453684_0006286 3300044712 Bacteria 22724
463 Ga0453684_0107062 3300044712 Bacteria 3405
464 Ga0451576_0029879 3300045051 Bacteria 5829
465 Ga0451576_0070120 3300045051 Bacteria 3648
466 Ga0495627_000331 3300046453 Bacteria 45362
467 Ga0495592_0000365 3300046454 Bacteria 35662
468 Ga0495591_001338 3300046458 Bacteria 15489
469 Ga0495629_0002327 3300046459 Bacteria 14641
470 Ga0495638_0011307 3300046460 Bacteria 6151
471 Ga0495638_0033665 3300046460 Bacteria 3276
472 Ga0495638_0074968 3300046460 Bacteria 2063
473 Ga0495638_0082992 3300046460 Bacteria 1942
474 Ga0495638_0109978 3300046460 Bacteria 1638
475 Ga0495651_0031485 3300046462 Bacteria 4136
476 Ga0495653_0044885 3300046463 Bacteria 3428
477 Ga0495580_0001754 3300046472 Bacteria 19061
478 Ga0495580_0050085 3300046472 Bacteria 2953
479 Ga0495582_0021696 3300046473 Bacteria 3514
480 Ga0495582_0086888 3300046473 Bacteria 1740
481 Ga0495605_0041917 3300046474 Bacteria 2278
482 Ga0495605_0090807 3300046474 Bacteria 1416
483 Ga0495662_0093665 3300046476 Bacteria 1466
484 Ga0495664_0015337 3300046477 Bacteria 4355
485 Ga0495584_0057005 3300046491 Bacteria 1966
486 Ga0495585_0001312 3300046492 Bacteria 19806
487 Ga0495585_0028214 3300046492 Bacteria 3202
488 Ga0495596_0002121 3300046500 Bacteria 10856
489 Ga0495596_0007856 3300046500 Bacteria 4780
490 Ga0495607_0115014 3300046501 Bacteria 1421
491 Ga0495583_0004366 3300046506 Bacteria 10181
492 Ga0495606_0014221 3300046507 Bacteria 6227
493 Ga0495606_0090702 3300046507 Bacteria 1880
494 Ga0495606_0180150 3300046507 Bacteria 1219
495 Ga0495608_0017253 3300046511 Bacteria 4996
496 Ga0495610_0005616 3300046512 Bacteria 8854
497 Ga0495616_0063544 3300046513 Bacteria 1804
498 Ga0495618_0013317 3300046514 Bacteria 5005
499 Ga0495620_0012967 3300046515 Bacteria 4283
500 Ga0495620_0062069 3300046515 Bacteria 1553
501 Ga0495628_0008078 3300046516 Bacteria 9052
502 Ga0495628_0025243 3300046516 Bacteria 4855
503 Ga0495630_0024065 3300046517 Bacteria 4503
504 Ga0495631_0003492 3300046518 Bacteria 8591
505 Ga0495632_0000615 3300046519 Bacteria 32915
506 Ga0495643_0022266 3300046522 Bacteria 3618
507 Ga0495648_0000650 3300046524 Bacteria 37082
508 Ga0495648_0003114 3300046524 Bacteria 14787
509 Ga0495648_0031744 3300046524 Bacteria 3475
510 Ga0495648_0044815 3300046524 Bacteria 2757
511 Ga0495648_0095850 3300046524 Bacteria 1650
512 Ga0495666_0011584 3300046526 Bacteria 4395
513 Ga0495652_0027497 3300046529 Bacteria 5009
514 Ga0495654_0008860 3300046530 Bacteria 5532
515 Ga0495665_0015494 3300046531 Bacteria 4105
516 Ga0495665_0026698 3300046531 Bacteria 3101
517 Ga0495640_0026245 3300046533 Bacteria 4212
518 Ga0495586_0133825 3300046535 Bacteria 1389
519 Ga0495587_0012329 3300046536 Bacteria 5385
520 Ga0495587_0044837 3300046536 Bacteria 2630
521 Ga0495609_0029155 3300046538 Bacteria 2514
522 Ga0495597_0020551 3300046542 Bacteria 3074
523 Ga0495667_0035781 3300046559 Bacteria 3317
524 Ga0495668_0005238 3300046616 Bacteria 8884
525 Ga0495668_0005998 3300046616 Bacteria 8065
526 Ga0495668_0006677 3300046616 Bacteria 7512
527 Ga0495668_0129691 3300046616 Bacteria 1380
528 Ga0495634_0034802 3300046642 Bacteria 3453
529 Ga0495611_0000338 3300046648 Bacteria 30531
530 Ga0495611_0043288 3300046648 Bacteria 2013
531 Ga0495625_0000398 3300046660 Bacteria 66474
532 Ga0495625_0002639 3300046660 Bacteria 19152
533 Ga0495625_0005332 3300046660 Bacteria 11778
534 Ga0495625_0023964 3300046660 Bacteria 4654
535 Ga0495625_0045187 3300046660 Bacteria 3185
536 Ga0495625_0055265 3300046660 Bacteria 2831
537 Ga0495635_0004307 3300046663 Bacteria 9857
538 Ga0495661_0008892 3300046665 Bacteria 6917
539 Ga0495661_0022964 3300046665 Bacteria 4054
540 Ga0495661_0049329 3300046665 Bacteria 2553
541 Ga0495657_0042048 3300046675 Bacteria 3123
542 Ga0495599_0028843 3300046678 Bacteria 3478
543 Ga0495646_0019414 3300046680 Bacteria 4304
544 Ga0495669_0057008 3300046684 Bacteria 1762
545 Ga0495613_0003319 3300046689 Bacteria 12051
546 Ga0495624_0001210 3300046690 Bacteria 20399
547 Ga0495624_0010782 3300046690 Bacteria 6299
548 Ga0495649_0020224 3300046694 Bacteria 3734
549 Ga0495589_0012592 3300046794 Bacteria 4375
550 Ga0495600_0018671 3300046809 Bacteria 4421
551 Ga0495660_0030605 3300046810 Bacteria 3031
552 Ga0495604_0004068 3300047317 Bacteria 11623
553 Ga0495604_0015789 3300047317 Bacteria 6027
554 Ga0495636_0002305 3300047318 Bacteria 7330
555 Ga0495636_0044306 3300047318 Bacteria 1852
556 Ga0495636_0077057 3300047318 Bacteria 1431
557 Ga0495674_0002116 3300047319 Bacteria 19499
558 Ga0495674_0002272 3300047319 Bacteria 18868
559 Ga0495672_0004957 3300047320 Bacteria 10693
560 Ga0495676_0016536 3300047321 Bacteria 6543
561 Ga0495676_0082230 3300047321 Bacteria 2438
562 Ga0495680_0023678 3300047322 Bacteria 5102
563 Ga0495680_0154093 3300047322 Bacteria 1673
564 Ga0495683_0011094 3300047323 Bacteria 4749
565 Ga0495687_001236 3300047443 Bacteria 24392
566 Ga0495687_027256 3300047443 Bacteria 2676
567 Ga0495687_050697 3300047443 Bacteria 1767
568 Ga0495687_058816 3300047443 Bacteria 1593
569 Ga0495675_0020835 3300047444 Bacteria 4172
570 Ga0495679_000183 3300047446 Bacteria 56008
571 Ga0495679_008362 3300047446 Bacteria 4213
572 Ga0495673_0014057 3300047469 Bacteria 4176
573 Ga0495681_0067650 3300047470 Bacteria 1627
574 Ga0495593_0001368 3300047673 Bacteria 14246
575 Ga0495593_0001757 3300047673 Bacteria 12828
576 Ga0495602_0035786 3300048088 Bacteria 4626
577 Ga0495614_0011632 3300048089 Bacteria 3869
578 Ga0495626_0011713 3300048091 Bacteria 4626
579 Ga0496101_0250648 3300048904 Bacteria 1379
580 Ga0496103_0153161 3300048906 Bacteria 1477
581 Ga0496104_0010697 3300048907 Bacteria 8204
582 Ga0496105_0043074 3300048908 Bacteria 3723
583 Ga0496106_0012180 3300048909 Bacteria 6347
584 Ga0496107_0055487 3300048910 Bacteria 2862
585 Ga0496112_0015518 3300048915 Bacteria 7114
586 Ga0496116_0013736 3300048919 Bacteria 6510
587 Ga0496117_0002431 3300048920 Bacteria 23546
588 Ga0496117_0009276 3300048920 Bacteria 9193
589 Ga0496117_0047085 3300048920 Bacteria 3096
590 Ga0496117_0087514 3300048920 Bacteria 2019
591 Ga0496118_0005091 3300048921 Bacteria 15118
592 Ga0496119_0028863 3300048922 Bacteria 3775
593 Ga0496121_0003338 3300048924 Bacteria 23036
594 Ga0496121_0017890 3300048924 Bacteria 7192
595 Ga0496123_0030984 3300048926 Bacteria 3902
596 Ga0496124_0023755 3300048927 Bacteria 5588
597 Ga0496125_0001021 3300048928 Bacteria 43477
598 Ga0496125_0009713 3300048928 Bacteria 9824
599 Ga0496125_0068580 3300048928 Bacteria 2789
600 Ga0496126_0069428 3300048929 Bacteria 3143
601 Ga0496126_0173482 3300048929 Bacteria 1835
602 Ga0495682_0006252 3300049460 Bacteria 4839
603 Ga0495682_0011202 3300049460 Bacteria 3455
604 Ga0495682_0045654 3300049460 Bacteria 1600
605 Ga0501297_009640 3300049520 Bacteria 1083
606 Ga0501034_0287285 3300049571 Bacteria 1584
607 Ga0501038_0014418 3300049574 Bacteria 7202
608 Ga0501249_003383 3300049679 Bacteria 3199
609 Ga0501249_024246 3300049679 Bacteria 1336
610 Ga0501262_000019 3300049759 Bacteria 23083
611 Ga0501266_000190 3300049763 Bacteria 7859
612 Ga0501212_020169 3300049851 Bacteria 1026
613 nmdc:mga03683_13362_c1 3300050489 Bacteria 3020
614 nmdc:mga03n38_17482_c1 3300050490 Bacteria 2137
615 nmdc:mga00v17_37146_c2 3300050491 Bacteria 2197
616 nmdc:mga00v17_4_c1 3300050491 Bacteria 238758
617 nmdc:mga0k408_115892_c1 3300050493 Unclassified 1585
618 nmdc:mga0k408_19195_c1 3300050493 Bacteria 3818
619 nmdc:mga0k408_3654_c1 3300050493 Bacteria 8141
620 nmdc:mga0k408_39926_c2 3300050493 Bacteria 1246
621 nmdc:mga0k408_41120_c1 3300050493 Bacteria 2661
622 nmdc:mga0k408_9698_c1 3300050493 Bacteria 5199
623 nmdc:mga06z11_18457_c1 3300050494 Bacteria 3186
624 nmdc:mga06z11_22063_c1 3300050494 Bacteria 2967
625 nmdc:mga07m45_4202_c1 3300050496 Bacteria 7040
626 nmdc:mga05p37_250037_c1 3300050507 Bacteria 2127
627 nmdc:mga08y16_308720_c1 3300050511 Bacteria 1629
628 nmdc:mga0n895_359_c1 3300050512 Bacteria 30652
629 nmdc:mga0rr50_15494_c1 3300050513 Bacteria 5034
630 nmdc:mga0a205_5241_c1 3300050515 Bacteria 10392
631 nmdc:mga0sz30_33157_c1 3300050516 Bacteria 2145
632 nmdc:mga0sz30_718_c1 3300050516 Bacteria 12197
633 Ga0500610_0000398 3300053079 Bacteria 13232
634 Ga0500635_0027882 3300053080 Bacteria 1799
635 Ga0500578_0000002 3300053086 Bacteria 293507
636 Ga0500578_0059895 3300053086 Bacteria 2433
637 Ga0500643_000007 3300053087 Bacteria 462836
638 Ga0500643_000023 3300053087 Bacteria 273090
639 Ga0500643_000485 3300053087 Bacteria 28889
640 Ga0500644_0000316 3300053088 Bacteria 25207
641 Ga0500644_0001815 3300053088 Bacteria 5518
642 Ga0500646_0005804 3300053090 Bacteria 3129
643 Ga0500646_0012785 3300053090 Bacteria 2170
644 Ga0500646_0017594 3300053090 Bacteria 1876
645 Ga0500646_0031569 3300053090 Bacteria 1458
646 Ga0500646_0032025 3300053090 Bacteria 1449
647 Ga0500583_0000330 3300053092 Bacteria 15790
648 Ga0500651_0011141 3300053093 Bacteria 5412
649 Ga0500651_0036634 3300053093 Bacteria 3091
650 Ga0500566_0024737 3300053094 Bacteria 3523
651 Ga0500650_0068764 3300053098 Bacteria 1655
652 Ga0500562_000050 3300053108 Bacteria 60058
653 Ga0500594_0000743 3300053118 Bacteria 6936
654 Ga0500595_000113 3300053119 Bacteria 53829
655 Ga0500607_022569 3300053121 Bacteria 3537
656 Ga0500642_0008557 3300053130 Bacteria 3511
657 Ga0500652_002040 3300053131 Bacteria 6083
658 Ga0500652_005790 3300053131 Bacteria 3926
659 Ga0500655_011094 3300053133 Bacteria 1630
660 Ga0500658_0000009 3300053134 Bacteria 270303
661 Ga0500658_0001322 3300053134 Bacteria 10025
662 Ga0500658_0009256 3300053134 Bacteria 3633
663 Ga0500559_0000038 3300053136 Bacteria 109922
664 Ga0500559_0016915 3300053136 Bacteria 3081
665 Ga0500561_0000073 3300053137 Bacteria 19888
666 Ga0500568_0000205 3300053139 Bacteria 51687
667 Ga0500568_0010186 3300053139 Bacteria 4418
668 Ga0500577_0010259 3300053142 Bacteria 2751
669 Ga0500604_0000807 3300053151 Bacteria 8632
670 Ga0500604_0008000 3300053151 Bacteria 2805
671 Ga0500604_0021103 3300053151 Bacteria 1839
672 Ga0500616_0002510 3300053153 Bacteria 15189
673 Ga0500620_004905 3300053155 Bacteria 3041
674 Ga0500622_0000227 3300053156 Bacteria 58653
675 Ga0500622_0000290 3300053156 Bacteria 51286
676 Ga0500622_0001746 3300053156 Bacteria 16757
677 Ga0500622_0002334 3300053156 Bacteria 13843
678 Ga0500622_0003764 3300053156 Bacteria 9907
679 Ga0500622_0004702 3300053156 Bacteria 8445
680 Ga0500622_0019763 3300053156 Bacteria 3576
681 Ga0500627_0036272 3300053158 Bacteria 2098
682 Ga0500633_0004460 3300053160 Bacteria 3213
683 Ga0500636_0014267 3300053177 Bacteria 4672
684 Ga0500636_0017930 3300053177 Bacteria 4185
685 Ga0500636_0026685 3300053177 Bacteria 3411
686 Ga0500636_0035954 3300053177 Bacteria 2931
687 Ga0500645_001097 3300053730 Bacteria 14801
688 Ga0500645_030402 3300053730 Unclassified 1625
689 Ga0500587_003299 3300053739 Bacteria 2264
690 Ga0500661_002854 3300055283 Bacteria 3257
691 Ga0500661_003700 3300055283 Unclassified 2871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003354 JGI25160J50197_1012841 JGI25160J50197_10128412 317
2 3300003374 JGI25161J50226_1002832 JGI25161J50226_10028323 317
3 3300004625 Ga0055543_1001188 Ga0055543_10011886 317
4 3300025302 Ga0207426_1000210 Ga0207426_100021088 317
5 3300049851 Ga0501212_020169 Ga0501212_020169_13_966 317
6 3300050507 nmdc:mga05p37_250037_c1 nmdc:mga05p37_250037_c1_394_1395 318
7 3300005334 Ga0068869_100454803 Ga0068869_1004548031 319
8 3300005335 Ga0070666_10193979 Ga0070666_101939791 319
9 3300005364 Ga0070673_100029907 Ga0070673_1000299075 319
10 3300005543 Ga0070672_100074753 Ga0070672_1000747533 319
11 3300005841 Ga0068863_100250274 Ga0068863_1002502743 319
12 3300025940 Ga0207691_10099715 Ga0207691_100997153 319
13 3300025960 Ga0207651_10009347 Ga0207651_100093473 319
14 3300026088 Ga0207641_10321578 Ga0207641_103215782 319
15 3300053160 Ga0500633_0004460 Ga0500633_0004460_859_1860 321
16 iso_pu_bacteria 2906427513 2906434582 322
17 iso_pu_bacteria 2582581315 2585328027 323
18 3300025910 Ga0207684_10071261 Ga0207684_100712612 324
19 3300025919 Ga0207657_10329041 Ga0207657_103290411 324
20 3300028794 Ga0307515_10213156 Ga0307515_102131562 324
21 3300033180 Ga0307510_10021309 Ga0307510_100213094 324
22 3300046515 Ga0495620_0062069 Ga0495620_0062069_120_1121 324
23 3300049679 Ga0501249_003383 Ga0501249_003383_1290_2291 324
24 3300053087 Ga0500643_000007 Ga0500643_000007_28299_29300 324
25 3300053088 Ga0500644_0001815 Ga0500644_0001815_3748_4749 324
26 3300053118 Ga0500594_0000743 Ga0500594_0000743_3960_4961 324
27 3300053136 Ga0500559_0000038 Ga0500559_0000038_101522_102523 324
28 3300053156 Ga0500622_0004702 Ga0500622_0004702_603_1604 324
29 3300053177 Ga0500636_0017930 Ga0500636_0017930_1728_2729 324
30 3300006353 Ga0075370_10058171 Ga0075370_100581713 325
31 3300013297 Ga0157378_10000319 Ga0157378_1000031949 325
32 3300030733 Ga0314311_1034637 Ga0314311_103463711 325
33 3300031911 Ga0307412_10012181 Ga0307412_100121815 325
34 iso_pu_bacteria 2885198086 2885204640 325
35 iso_pu_bacteria 2885211737 2885218293 325
36 3300005339 Ga0070660_100188043 Ga0070660_1001880431 326
37 3300005457 Ga0070662_100000167 Ga0070662_10000016721 326
38 3300005563 Ga0068855_100275068 Ga0068855_1002750682 326
39 3300005616 Ga0068852_100052049 Ga0068852_1000520492 326
40 3300009174 Ga0105241_10012545 Ga0105241_100125455 326
41 3300011119 Ga0105246_10062221 Ga0105246_100622213 326
42 3300013100 Ga0157373_10057525 Ga0157373_100575253 326
43 3300013296 Ga0157374_10004368 Ga0157374_100043685 326
44 3300025904 Ga0207647_10000209 Ga0207647_1000020947 326
45 3300025919 Ga0207657_10185208 Ga0207657_101852082 326
46 3300025933 Ga0207706_10000257 Ga0207706_1000025719 326
47 3300026035 Ga0207703_10161961 Ga0207703_101619612 326
48 3300026142 Ga0207698_10266661 Ga0207698_102666611 326
49 iso_pu_bacteria 8003314358 8003322940 327
50 iso_pu_bacteria 2818991450 2819621343 328
51 3300031901 Ga0307406_10018310 Ga0307406_100183103 329
52 3300031911 Ga0307412_10130063 Ga0307412_101300632 329
53 3300032005 Ga0307411_10121251 Ga0307411_101212512 329
54 3300032126 Ga0307415_100002524 Ga0307415_1000025247 329
55 iso_pu_bacteria 2508501050 2508731839 329
56 iso_pu_bacteria 2508501127 2509142552 329
57 iso_pu_bacteria 2510065019 2510136659 329
58 iso_pu_bacteria 2510917020 2511121787 329
59 iso_pu_bacteria 2510917022 2511134170 329
60 iso_pu_bacteria 2510917026 2511173894 329
61 iso_pu_bacteria 2510917030 2511198709 329
62 iso_pu_bacteria 2511231003 2511251464 329
63 iso_pu_bacteria 2512047030 2512346687 329
64 iso_pu_bacteria 2512875024 2512960015 329
65 iso_pu_bacteria 2513237084 2513569462 329
66 iso_pu_bacteria 2513237103 2513709928 329
67 iso_pu_bacteria 2513237138 2513866128 329
68 iso_pu_bacteria 2513237144 2513910854 329
69 iso_pu_bacteria 2513237159 2513996851 329
70 iso_pu_bacteria 2513237164 2514035964 329
71 iso_pu_bacteria 2516653077 2517041786 329
72 iso_pu_bacteria 2517093000 2517099227 329
73 iso_pu_bacteria 2524023250 2524613303 329
74 iso_pu_bacteria 2582581306 2585266601 329
75 iso_pu_bacteria 2582581307 2585273573 329
76 iso_pu_bacteria 2582581308 2585279601 329
77 iso_pu_bacteria 2582581316 2585334022 329
78 iso_pu_bacteria 2582581865 2585387616 329
79 iso_pu_bacteria 2582581866 2585393210 329
80 iso_pu_bacteria 2582581867 2585404758 329
81 iso_pu_bacteria 2585427526 2585524308 329
82 iso_pu_bacteria 2585427527 2585535680 329
83 iso_pu_bacteria 2585427530 2585551058 329
84 iso_pu_bacteria 2585427531 2585559746 329
85 iso_pu_bacteria 2585427590 2585823383 329
86 iso_pu_bacteria 2585427608 2585900434 329
87 iso_pu_bacteria 2585427609 2585906074 329
88 iso_pu_bacteria 2585428106 2587918729 329
89 iso_pu_bacteria 2585428125 2587978811 329
90 iso_pu_bacteria 2599185214 2599627698 329
91 iso_pu_bacteria 2599185226 2599677267 329
92 iso_pu_bacteria 2599185227 2599684712 329
93 iso_pu_bacteria 2599185229 2599696621 329
94 iso_pu_bacteria 2615840626 2616306388 329
95 iso_pu_bacteria 2617270742 2617382355 329
96 iso_pu_bacteria 2643221573 2643878321 329
97 iso_pu_bacteria 2643221592 2643969450 329
98 iso_pu_bacteria 2643221596 2643990690 329
99 iso_pu_bacteria 2643221609 2644060416 329
100 iso_pu_bacteria 2643221611 2644076155 329
101 iso_pu_bacteria 2643221625 2644143750 329
102 iso_pu_bacteria 2643221626 2644146178 329
103 iso_pu_bacteria 2643221640 2644225376 329
104 iso_pu_bacteria 2643221642 2644232684 329
105 iso_pu_bacteria 2643221648 2644276544 329
106 iso_pu_bacteria 2643221653 2644297026 329
107 iso_pu_bacteria 2643221659 2644332806 329
108 iso_pu_bacteria 2643221698 2644540286 329
109 iso_pu_bacteria 2643221715 2644639887 329
110 iso_pu_bacteria 2643221719 2644655279 329
111 iso_pu_bacteria 2643221720 2644659626 329
112 iso_pu_bacteria 2657244999 2657682111 329
113 iso_pu_bacteria 2667528174 2671115997 329
114 iso_pu_bacteria 2687453392 2688598029 329
115 iso_pu_bacteria 2690316117 2692319489 329
116 iso_pu_bacteria 2738541277 2738717890 329
117 iso_pu_bacteria 2738541283 2738755163 329
118 iso_pu_bacteria 2738541296 2738820538 329
119 iso_pu_bacteria 2738541298 2738833018 329
120 iso_pu_bacteria 2738541306 2738874545 329
121 iso_pu_bacteria 2738543002 2739186175 329
122 iso_pu_bacteria 2738543004 2739197190 329
123 iso_pu_bacteria 2738543008 2739221143 329
124 iso_pu_bacteria 2738543019 2739278576 329
125 iso_pu_bacteria 2738543028 2739332561 329
126 iso_pu_bacteria 2751185821 2753458321 329
127 iso_pu_bacteria 2751185897 2753763065 329
128 iso_pu_bacteria 2756170246 2756672088 329
129 iso_pu_bacteria 2765235802 2765465370 329
130 iso_pu_bacteria 2767802442 2770199203 329
131 iso_pu_bacteria 2775507266 2778179248 329
132 iso_pu_bacteria 2791355091 2792623284 329
133 iso_pu_bacteria 2791355263 2793344857 329
134 iso_pu_bacteria 2802429268 2804751129 329
135 iso_pu_bacteria 2802429633 2806045705 329
136 iso_pu_bacteria 2802429634 2806053275 329
137 iso_pu_bacteria 2802429635 2806062316 329
138 iso_pu_bacteria 2802429636 2806066356 329
139 iso_pu_bacteria 2802429637 2806073064 329
140 iso_pu_bacteria 2808606386 2808983711 329
141 iso_pu_bacteria 2808606415 2809129375 329
142 iso_pu_bacteria 2808606419 2809149570 329
143 iso_pu_bacteria 2818991435 2819539496 329
144 iso_pu_bacteria 2818991442 2819578065 329
145 iso_pu_bacteria 2818991453 2819638456 329
146 iso_pu_bacteria 2818991454 2819649278 329
147 iso_pu_bacteria 2838022645 2838026732 329
148 iso_pu_bacteria 2838029111 2838034151 329
149 iso_pu_bacteria 2838042994 2838045796 329
150 iso_pu_bacteria 2838680041 2838686216 329
151 iso_pu_bacteria 2838707686 2838713979 329
152 iso_pu_bacteria 2839993093 2839994979 329
153 iso_pu_bacteria 2840764183 2840769872 329
154 iso_pu_bacteria 2842077413 2842083377 329
155 iso_pu_bacteria 2842110456 2842115652 329
156 iso_pu_bacteria 2842118031 2842124324 329
157 iso_pu_bacteria 2842198810 2842202335 329
158 iso_pu_bacteria 2842217011 2842222107 329
159 iso_pu_bacteria 2842237096 2842243340 329
160 iso_pu_bacteria 2842291075 2842297522 329
161 iso_pu_bacteria 2842304105 2842308770 329
162 iso_pu_bacteria 2842370503 2842376607 329
163 iso_pu_bacteria 2842377471 2842383860 329
164 iso_pu_bacteria 2842384541 2842390947 329
165 iso_pu_bacteria 2842475841 2842480881 329
166 iso_pu_bacteria 2842502639 2842507508 329
167 iso_pu_bacteria 2842521101 2842522912 329
168 iso_pu_bacteria 2842718218 2842719704 329
169 iso_pu_bacteria 2844002411 2844007963 329
170 iso_pu_bacteria 2844009547 2844013253 329
171 iso_pu_bacteria 2844163670 2844167216 329
172 iso_pu_bacteria 2847417321 2847422009 329
173 iso_pu_bacteria 2851182111 2851186247 329
174 iso_pu_bacteria 2852618963 2852619722 329
175 iso_pu_bacteria 2856320880 2856326992 329
176 iso_pu_bacteria 2856334872 2856338128 329
177 iso_pu_bacteria 2856342000 2856344295 329
178 iso_pu_bacteria 2856349417 2856355949 329
179 iso_pu_bacteria 2856356410 2856363680 329
180 iso_pu_bacteria 2869169390 2869173354 329
181 iso_pu_bacteria 2869234852 2869239267 329
182 iso_pu_bacteria 2869242130 2869248345 329
183 iso_pu_bacteria 2869249662 2869256412 329
184 iso_pu_bacteria 2869256925 2869260758 329
185 iso_pu_bacteria 2869278585 2869283462 329
186 iso_pu_bacteria 2871435913 2871435994 329
187 iso_pu_bacteria 2871474448 2871476746 329
188 iso_pu_bacteria 2871481445 2871486757 329
189 iso_pu_bacteria 2871488783 2871492563 329
190 iso_pu_bacteria 2874131515 2874132663 329
191 iso_pu_bacteria 2874168670 2874169324 329
192 iso_pu_bacteria 2876386047 2876387505 329
193 iso_pu_bacteria 2876808645 2876815588 329
194 iso_pu_bacteria 2878730984 2878737842 329
195 iso_pu_bacteria 2878753008 2878758445 329
196 iso_pu_bacteria 2878788777 2878793235 329
197 iso_pu_bacteria 2879110137 2879116504 329
198 iso_pu_bacteria 2881155292 2881157992 329
199 iso_pu_bacteria 2881853255 2881859459 329
200 iso_pu_bacteria 2881861095 2881867363 329
201 iso_pu_bacteria 2882912400 2882913395 329
202 iso_pu_bacteria 2885318864 2885319924 329
203 iso_pu_bacteria 2885342637 2885348075 329
204 iso_pu_bacteria 2885350715 2885352933 329
205 iso_pu_bacteria 2886848708 2886849591 329
206 iso_pu_bacteria 2899845264 2899847450 329
207 iso_pu_bacteria 2903492973 2903496706 329
208 iso_pu_bacteria 2903513507 2903519944 329
209 iso_pu_bacteria 2904578770 2904581536 329
210 iso_pu_bacteria 2906363423 2906364103 329
211 iso_pu_bacteria 2906370794 2906375285 329
212 iso_pu_bacteria 2906393657 2906395027 329
213 iso_pu_bacteria 2906401398 2906405799 329
214 iso_pu_bacteria 2916028427 2916028659 329
215 iso_pu_bacteria 2916055098 2916056049 329
216 iso_pu_bacteria 2919100787 2919108204 329
217 iso_pu_bacteria 2919119836 2919122771 329
218 iso_pu_bacteria 2919130084 2919131303 329
219 iso_pu_bacteria 2921263974 2921264283 329
220 iso_pu_bacteria 2922151315 2922157868 329
221 iso_pu_bacteria 2923556063 2923562402 329
222 iso_pu_bacteria 2924172951 2924179476 329
223 iso_pu_bacteria 2924710171 2924716234 329
224 iso_pu_bacteria 2924733363 2924734938 329
225 iso_pu_bacteria 2924741084 2924741721 329
226 iso_pu_bacteria 2924784321 2924785027 329
227 iso_pu_bacteria 2928070936 2928078252 329
228 iso_pu_bacteria 2928503688 2928503850 329
229 iso_pu_bacteria 2928521798 2928525977 329
230 iso_pu_bacteria 2929177148 2929182041 329
231 iso_pu_bacteria 2929195423 2929196548 329
232 iso_pu_bacteria 2929921140 2929925906 329
233 iso_pu_bacteria 2932794094 2932795332 329
234 iso_pu_bacteria 2932801729 2932805862 329
235 iso_pu_bacteria 2933570622 2933575100 329
236 iso_pu_bacteria 2933586486 2933591619 329
237 iso_pu_bacteria 2935703347 2935708191 329
238 iso_pu_bacteria 2935883170 2935883775 329
239 iso_pu_bacteria 2935894831 2935900965 329
240 iso_pu_bacteria 2936002035 2936009427 329
241 iso_pu_bacteria 2936367885 2936370328 329
242 iso_pu_bacteria 2937016420 2937017998 329
243 iso_pu_bacteria 2937042894 2937047645 329
244 iso_pu_bacteria 2937071275 2937075848 329
245 iso_pu_bacteria 2937126314 2937126589 329
246 iso_pu_bacteria 2937861824 2937868949 329
247 iso_pu_bacteria 2937972304 2937979822 329
248 iso_pu_bacteria 2937980651 2937986880 329
249 iso_pu_bacteria 2945909444 2945912742 329
250 iso_pu_bacteria 2945934425 2945938681 329
251 iso_pu_bacteria 2945945610 2945947552 329
252 iso_pu_bacteria 2945977869 2945977982 329
253 iso_pu_bacteria 2945984333 2945984997 329
254 iso_pu_bacteria 2946013367 2946016165 329
255 iso_pu_bacteria 2954011201 2954011932 329
256 iso_pu_bacteria 2957478035 2957478262 329
257 iso_pu_bacteria 2958034702 2958039975 329
258 iso_pu_bacteria 2958041894 2958054319 329
259 iso_pu_bacteria 2958071322 2958071643 329
260 iso_pu_bacteria 2958092219 2958097982 329
261 iso_pu_bacteria 2958108152 2958111878 329
262 iso_pu_bacteria 2958122699 2958124145 329
263 iso_pu_bacteria 2961127735 2961133700 329
264 iso_pu_bacteria 2961170736 2961173362 329
265 iso_pu_bacteria 2961183825 2961184961 329
266 iso_pu_bacteria 2964705432 2964706873 329
267 iso_pu_bacteria 2965032056 2965036081 329
268 iso_pu_bacteria 2967742019 2967744211 329
269 iso_pu_bacteria 2967775926 2967780354 329
270 iso_pu_bacteria 2967996073 2967998532 329
271 iso_pu_bacteria 2968003550 2968006042 329
272 iso_pu_bacteria 2968138860 2968138867 329
273 iso_pu_bacteria 2970177841 2970178935 329
274 iso_pu_bacteria 2970503327 2970505955 329
275 iso_pu_bacteria 2970510686 2970515782 329
276 iso_pu_bacteria 2970524798 2970528194 329
277 iso_pu_bacteria 2970532167 2970535461 329
278 iso_pu_bacteria 2970593180 2970598112 329
279 iso_pu_bacteria 2970619444 2970619541 329
280 iso_pu_bacteria 2970627176 2970628152 329
281 iso_pu_bacteria 2977821940 2977826978 329
282 iso_pu_bacteria 2977828996 2977833747 329
283 iso_pu_bacteria 2977851361 2977854821 329
284 iso_pu_bacteria 2977872689 2977874883 329
285 iso_pu_bacteria 2977898635 2977905780 329
286 iso_pu_bacteria 2977915119 2977916529 329
287 iso_pu_bacteria 2977950692 2977957116 329
288 iso_pu_bacteria 2977957713 2977958069 329
289 iso_pu_bacteria 2979764755 2979768284 329
290 iso_pu_bacteria 2979793036 2979795753 329
291 iso_pu_bacteria 2979808191 2979810676 329
292 iso_pu_bacteria 2987673487 2987678707 329
293 iso_pu_bacteria 2990703756 2990708680 329
294 iso_pu_bacteria 2996310559 2996315093 329
295 iso_pu_bacteria 2996386984 2996388910 329
296 iso_pu_bacteria 3002141150 3002143022 329
297 iso_pu_bacteria 3004167301 3004168305 329
298 iso_pu_bacteria 3004195979 3004197796 329
299 iso_pu_bacteria 3004232784 3004233354 329
300 iso_pu_bacteria 3004239961 3004242157 329
301 iso_pu_bacteria 3004248173 3004250122 329
302 iso_pu_bacteria 3004268573 3004272950 329
303 iso_pu_bacteria 3004289098 3004293549 329
304 iso_pu_bacteria 3004334049 3004335091 329
305 iso_pu_bacteria 3005416602 3005416857 329
306 iso_pu_bacteria 3005506211 3005512795 329
307 iso_pu_bacteria 3005718088 3005719876 329
308 iso_pu_bacteria 639633055 639651857 329
309 iso_pu_bacteria 641736151 642426414 329
310 iso_pu_bacteria 642555113 642621616 329
311 iso_pu_bacteria 649633066 649872561 329
312 iso_pu_bacteria 8004361976 8004364851 329
313 iso_pu_bacteria 8004374579 8004379961 329
314 iso_pu_bacteria 8004633249 8004639763 329
315 iso_pu_bacteria 8004727605 8004732505 329
316 iso_pu_bacteria 8005314921 8005315939 329
317 iso_pu_bacteria 8005376324 8005382004 329
318 iso_pu_bacteria 8005556819 8005562240 329
319 iso_pu_bacteria 8005563573 8005566995 329
320 iso_pu_bacteria 8005570704 8005576633 329
321 iso_pu_bacteria 8018163183 8018166039 329
322 iso_pu_bacteria 8023680758 8023688199 329
323 iso_pu_bacteria 8024479707 8024483855 329
324 iso_pu_bacteria 8054285046 8054291378 329
325 iso_pu_bacteria 8055266321 8055269823 329
326 iso_pu_bacteria 8055617313 8055620325 329
327 iso_pu_bacteria 8057874678 8057878552 329
328 3300031456 Ga0307513_10223624 Ga0307513_102236242 330
329 3300053134 Ga0500658_0001322 Ga0500658_0001322_2552_3607 330
330 iso_pu_bacteria 2515154189 2516021016 330
331 iso_pu_bacteria 2643221622 2644128837 330
332 iso_pu_bacteria 2937848649 2937854009 330
333 iso_pu_bacteria 2977922695 2977928617 330
334 iso_pu_bacteria 3004211236 3004212015 330
335 iso_pu_bacteria 3004218560 3004224680 330
336 3300001991 JGI24743J22301_10006797 JGI24743J22301_100067971 331
337 3300005338 Ga0068868_100087708 Ga0068868_1000877083 331
338 3300005355 Ga0070671_100122939 Ga0070671_1001229392 331
339 3300005355 Ga0070671_100153126 Ga0070671_1001531262 331
340 3300005356 Ga0070674_100249814 Ga0070674_1002498141 331
341 3300005364 Ga0070673_100048494 Ga0070673_1000484943 331
342 3300005441 Ga0070700_100076132 Ga0070700_1000761321 331
343 3300005459 Ga0068867_100126997 Ga0068867_1001269972 331
344 3300005834 Ga0068851_10105116 Ga0068851_101051162 331
345 3300005844 Ga0068862_100020999 Ga0068862_1000209991 331
346 3300009148 Ga0105243_10218194 Ga0105243_102181942 331
347 3300010375 Ga0105239_10062150 Ga0105239_100621504 331
348 3300014326 Ga0157380_10057383 Ga0157380_100573832 331
349 3300025903 Ga0207680_10090403 Ga0207680_100904032 331
350 3300025907 Ga0207645_10042759 Ga0207645_100427592 331
351 3300025923 Ga0207681_10115444 Ga0207681_101154442 331
352 3300025931 Ga0207644_10168459 Ga0207644_101684592 331
353 3300025933 Ga0207706_10019903 Ga0207706_100199032 331
354 3300025960 Ga0207651_10014951 Ga0207651_100149514 331
355 3300026075 Ga0207708_10015977 Ga0207708_100159776 331
356 3300026089 Ga0207648_10012463 Ga0207648_100124633 331
357 3300026118 Ga0207675_100215474 Ga0207675_1002154741 331
358 3300031731 Ga0307405_10082389 Ga0307405_100823892 331
359 3300031901 Ga0307406_10192149 Ga0307406_101921492 331
360 3300031995 Ga0307409_100046305 Ga0307409_1000463053 331
361 3300031995 Ga0307409_100434140 Ga0307409_1004341401 331
362 3300032002 Ga0307416_100007386 Ga0307416_1000073864 331
363 3300032126 Ga0307415_100060274 Ga0307415_1000602742 331
364 3300039450 Ga0436363_1258129 Ga0436363_1258129_1238_2290 331
365 3300042008 Ga0439450_033524 Ga0439450_033524_124_1119 331
366 iso_pu_bacteria 8057575449 8057582319 331
367 3300001989 JGI24739J22299_10008123 JGI24739J22299_100081233 332
368 3300001990 JGI24737J22298_10004822 JGI24737J22298_100048224 332
369 3300002075 JGI24738J21930_10010554 JGI24738J21930_100105541 332
370 3300005467 Ga0070706_100003698 Ga0070706_10000369810 332
371 3300005468 Ga0070707_100005425 Ga0070707_10000542512 332
372 3300005518 Ga0070699_100007692 Ga0070699_1000076922 332
373 3300005536 Ga0070697_100006095 Ga0070697_10000609510 332
374 3300005842 Ga0068858_100113852 Ga0068858_1001138522 332
375 3300006028 Ga0070717_10006422 Ga0070717_100064222 332
376 3300006881 Ga0068865_100180466 Ga0068865_1001804662 332
377 3300009011 Ga0105251_10000837 Ga0105251_100008379 332
378 3300013105 Ga0157369_10103270 Ga0157369_101032703 332
379 3300014968 Ga0157379_10022204 Ga0157379_100222042 332
380 3300015262 Ga0182007_10005878 Ga0182007_100058784 332
381 3300025735 Ga0207713_1000336 Ga0207713_100033648 332
382 3300025899 Ga0207642_10072020 Ga0207642_100720202 332
383 3300025910 Ga0207684_10009256 Ga0207684_100092568 332
384 3300025922 Ga0207646_10003418 Ga0207646_100034183 332
385 3300025931 Ga0207644_10042344 Ga0207644_100423442 332
386 3300030731 Ga0316177_1054620 Ga0316177_10546201 332
387 3300031456 Ga0307513_10031414 Ga0307513_100314145 332
388 3300048919 Ga0496116_0013736 Ga0496116_0013736_2850_3848 332
389 3300048920 Ga0496117_0087514 Ga0496117_0087514_325_1323 332
390 3300048928 Ga0496125_0001021 Ga0496125_0001021_16819_17817 332
391 iso_pu_bacteria 2585428057 2587728480 332
392 3300001979 JGI24740J21852_10001788 JGI24740J21852_100017886 333
393 3300001989 JGI24739J22299_10023597 JGI24739J22299_100235972 333
394 3300001990 JGI24737J22298_10003380 JGI24737J22298_100033803 333
395 3300002075 JGI24738J21930_10001816 JGI24738J21930_100018162 333
396 3300002705 JGI25156J39149_1000873 JGI25156J39149_10008732 333
397 3300002705 JGI25156J39149_1001284 JGI25156J39149_10012842 333
398 3300002737 JGI25162J39368_1000642 JGI25162J39368_100064212 333
399 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006918 333
400 3300002738 JGI25154J39366_1001801 JGI25154J39366_10018013 333
401 3300002741 JGI25157J39369_1000851 JGI25157J39369_10008512 333
402 3300003187 JGI25151J46595_10001575 JGI25151J46595_100015753 333
403 3300003214 JGI25165J46597_1000999 JGI25165J46597_10009998 333
404 3300003214 JGI25165J46597_1001072 JGI25165J46597_100107211 333
405 3300003214 JGI25165J46597_1002307 JGI25165J46597_10023078 333
406 3300003215 JGI25153J46596_10001714 JGI25153J46596_100017147 333
407 3300003322 rootL2_10004516 rootL2_100045163 333
408 3300003322 rootL2_10363542 rootL2_103635423 333
409 3300003752 Ga0055539_1000513 Ga0055539_10005132 333
410 3300003775 Ga0055524_1012206 Ga0055524_10122062 333
411 3300003794 Ga0055531_10000965 Ga0055531_1000096510 333
412 3300003856 Ga0058692_1000035 Ga0058692_100003561 333
413 3300005262 Ga0065165_1000241 Ga0065165_100024169 333
414 3300005262 Ga0065165_1002670 Ga0065165_10026701 333
415 3300005293 Ga0065715_10089106 Ga0065715_100891068 333
416 3300005327 Ga0070658_10005121 Ga0070658_100051214 333
417 3300005327 Ga0070658_10041562 Ga0070658_100415622 333
418 3300005331 Ga0070670_100043399 Ga0070670_1000433993 333
419 3300005334 Ga0068869_100051298 Ga0068869_1000512984 333
420 3300005334 Ga0068869_100072738 Ga0068869_1000727382 333
421 3300005335 Ga0070666_10025670 Ga0070666_100256704 333
422 3300005339 Ga0070660_100133936 Ga0070660_1001339362 333
423 3300005339 Ga0070660_100252382 Ga0070660_1002523821 333
424 3300005347 Ga0070668_100053824 Ga0070668_1000538242 333
425 3300005347 Ga0070668_100203068 Ga0070668_1002030681 333
426 3300005353 Ga0070669_100204096 Ga0070669_1002040962 333
427 3300005354 Ga0070675_100276405 Ga0070675_1002764052 333
428 3300005354 Ga0070675_100388678 Ga0070675_1003886782 333
429 3300005356 Ga0070674_100033790 Ga0070674_1000337902 333
430 3300005366 Ga0070659_100001718 Ga0070659_10000171810 333
431 3300005366 Ga0070659_100028187 Ga0070659_1000281873 333
432 3300005366 Ga0070659_100162400 Ga0070659_1001624001 333
433 3300005367 Ga0070667_100057349 Ga0070667_1000573495 333
434 3300005367 Ga0070667_100290157 Ga0070667_1002901572 333
435 3300005440 Ga0070705_100075763 Ga0070705_1000757632 333
436 3300005445 Ga0070708_100118089 Ga0070708_1001180892 333
437 3300005445 Ga0070708_100205401 Ga0070708_1002054012 333
438 3300005457 Ga0070662_100079420 Ga0070662_1000794202 333
439 3300005457 Ga0070662_100220601 Ga0070662_1002206011 333
440 3300005459 Ga0068867_100134289 Ga0068867_1001342891 333
441 3300005467 Ga0070706_100193872 Ga0070706_1001938721 333
442 3300005468 Ga0070707_100108298 Ga0070707_1001082983 333
443 3300005471 Ga0070698_100054281 Ga0070698_1000542812 333
444 3300005471 Ga0070698_100147290 Ga0070698_1001472902 333
445 3300005471 Ga0070698_100487148 Ga0070698_1004871481 333
446 3300005518 Ga0070699_100227605 Ga0070699_1002276051 333
447 3300005530 Ga0070679_100221311 Ga0070679_1002213112 333
448 3300005535 Ga0070684_100051678 Ga0070684_1000516783 333
449 3300005536 Ga0070697_100296960 Ga0070697_1002969602 333
450 3300005539 Ga0068853_100018261 Ga0068853_1000182612 333
451 3300005539 Ga0068853_100156821 Ga0068853_1001568212 333
452 3300005543 Ga0070672_100001960 Ga0070672_10000196012 333
453 3300005548 Ga0070665_100000006 Ga0070665_100000006427 333
454 3300005548 Ga0070665_100007151 Ga0070665_1000071514 333
455 3300005548 Ga0070665_100016065 Ga0070665_1000160655 333
456 3300005548 Ga0070665_100303727 Ga0070665_1003037272 333
457 3300005549 Ga0070704_100024496 Ga0070704_1000244962 333
458 3300005549 Ga0070704_100181522 Ga0070704_1001815222 333
459 3300005549 Ga0070704_100425153 Ga0070704_1004251531 333
460 3300005563 Ga0068855_100007578 Ga0068855_1000075786 333
461 3300005563 Ga0068855_100064015 Ga0068855_1000640153 333
462 3300005563 Ga0068855_100343998 Ga0068855_1003439982 333
463 3300005577 Ga0068857_100000489 Ga0068857_10000048925 333
464 3300005577 Ga0068857_100117345 Ga0068857_1001173452 333
465 3300005577 Ga0068857_100220463 Ga0068857_1002204632 333
466 3300005578 Ga0068854_100008799 Ga0068854_1000087991 333
467 3300005578 Ga0068854_100071479 Ga0068854_1000714792 333
468 3300005614 Ga0068856_100000991 Ga0068856_1000009912 333
469 3300005614 Ga0068856_100041460 Ga0068856_1000414606 333
470 3300005614 Ga0068856_100209029 Ga0068856_1002090292 333
471 3300005616 Ga0068852_100117952 Ga0068852_1001179524 333
472 3300005616 Ga0068852_100122678 Ga0068852_1001226781 333
473 3300005617 Ga0068859_100000151 Ga0068859_10000015134 333
474 3300005617 Ga0068859_100007089 Ga0068859_10000708914 333
475 3300005719 Ga0068861_100001690 Ga0068861_1000016907 333
476 3300005834 Ga0068851_10010112 Ga0068851_100101122 333
477 3300005834 Ga0068851_10018502 Ga0068851_100185023 333
478 3300005841 Ga0068863_100026949 Ga0068863_1000269492 333
479 3300005841 Ga0068863_100054170 Ga0068863_1000541705 333
480 3300005841 Ga0068863_100117728 Ga0068863_1001177282 333
481 3300005841 Ga0068863_100456958 Ga0068863_1004569582 333
482 3300005842 Ga0068858_100000273 Ga0068858_10000027334 333
483 3300005842 Ga0068858_100006378 Ga0068858_1000063782 333
484 3300005842 Ga0068858_100008996 Ga0068858_1000089962 333
485 3300005842 Ga0068858_100365369 Ga0068858_1003653692 333
486 3300005843 Ga0068860_100046091 Ga0068860_1000460912 333
487 3300005843 Ga0068860_100341009 Ga0068860_1003410092 333
488 3300005844 Ga0068862_100024533 Ga0068862_1000245334 333
489 3300005844 Ga0068862_100234316 Ga0068862_1002343162 333
490 3300005844 Ga0068862_100284396 Ga0068862_1002843962 333
491 3300006028 Ga0070717_10101276 Ga0070717_101012762 333
492 3300006038 Ga0075365_10002167 Ga0075365_100021671 333
493 3300006038 Ga0075365_10144624 Ga0075365_101446242 333
494 3300006042 Ga0075368_10007659 Ga0075368_100076592 333
495 3300006042 Ga0075368_10019634 Ga0075368_100196341 333
496 3300006051 Ga0075364_10106867 Ga0075364_101068671 333
497 3300006058 Ga0075432_10013171 Ga0075432_100131712 333
498 3300006163 Ga0070715_10063920 Ga0070715_100639202 333
499 3300006177 Ga0075362_10000508 Ga0075362_1000050811 333
500 3300006178 Ga0075367_10036200 Ga0075367_100362003 333
501 3300006178 Ga0075367_10176970 Ga0075367_101769701 333
502 3300006186 Ga0075369_10005799 Ga0075369_100057992 333
503 3300006186 Ga0075369_10023666 Ga0075369_100236661 333
504 3300006195 Ga0075366_10001556 Ga0075366_100015567 333
505 3300006195 Ga0075366_10015983 Ga0075366_100159833 333
506 3300006195 Ga0075366_10034597 Ga0075366_100345972 333
507 3300006195 Ga0075366_10121530 Ga0075366_101215301 333
508 3300006353 Ga0075370_10008118 Ga0075370_100081184 333
509 3300006353 Ga0075370_10052305 Ga0075370_100523052 333
510 3300006844 Ga0075428_100026574 Ga0075428_1000265743 333
511 3300006844 Ga0075428_100100604 Ga0075428_1001006043 333
512 3300006846 Ga0075430_100010209 Ga0075430_1000102092 333
513 3300006846 Ga0075430_100037469 Ga0075430_1000374696 333
514 3300006846 Ga0075430_100129903 Ga0075430_1001299033 333
515 3300006847 Ga0075431_100113557 Ga0075431_1001135573 333
516 3300006871 Ga0075434_100017992 Ga0075434_1000179924 333
517 3300006880 Ga0075429_100006117 Ga0075429_1000061178 333
518 3300006880 Ga0075429_100049552 Ga0075429_1000495524 333
519 3300006914 Ga0075436_100087478 Ga0075436_1000874782 333
520 3300006931 Ga0097620_100000151 Ga0097620_10000015134 333
521 3300006931 Ga0097620_100007089 Ga0097620_1000070895 333
522 3300007076 Ga0075435_100041263 Ga0075435_1000412635 333
523 3300009036 Ga0105244_10003082 Ga0105244_100030826 333
524 3300009036 Ga0105244_10030578 Ga0105244_100305783 333
525 3300009093 Ga0105240_10000142 Ga0105240_10000142100 333
526 3300009093 Ga0105240_10068267 Ga0105240_100682674 333
527 3300009093 Ga0105240_10085783 Ga0105240_100857834 333
528 3300009093 Ga0105240_10095230 Ga0105240_100952305 333
529 3300009093 Ga0105240_10108637 Ga0105240_101086375 333
530 3300009093 Ga0105240_10472789 Ga0105240_104727892 333
531 3300009094 Ga0111539_10348399 Ga0111539_103483992 333
532 3300009098 Ga0105245_10102479 Ga0105245_101024792 333
533 3300009101 Ga0105247_10014016 Ga0105247_100140165 333
534 3300009101 Ga0105247_10035380 Ga0105247_100353804 333
535 3300009147 Ga0114129_10561688 Ga0114129_105616882 333
536 3300009148 Ga0105243_10005104 Ga0105243_1000510412 333
537 3300009174 Ga0105241_10027870 Ga0105241_100278702 333
538 3300009174 Ga0105241_10064139 Ga0105241_100641393 333
539 3300009177 Ga0105248_10000764 Ga0105248_1000076426 333
540 3300009177 Ga0105248_10132844 Ga0105248_101328442 333
541 3300009177 Ga0105248_10139030 Ga0105248_101390303 333
542 3300009177 Ga0105248_10301610 Ga0105248_103016102 333
543 3300009545 Ga0105237_10053876 Ga0105237_100538763 333
544 3300009545 Ga0105237_10131081 Ga0105237_101310812 333
545 3300009545 Ga0105237_10358871 Ga0105237_103588712 333
546 3300009551 Ga0105238_10038755 Ga0105238_100387552 333
547 3300009551 Ga0105238_10113596 Ga0105238_101135962 333
548 3300009551 Ga0105238_10222572 Ga0105238_102225722 333
549 3300009553 Ga0105249_10019476 Ga0105249_100194763 333
550 3300009766 Ga0123342_1017216 Ga0123342_10172162 333
551 3300010375 Ga0105239_10009037 Ga0105239_100090378 333
552 3300010375 Ga0105239_10033221 Ga0105239_100332213 333
553 3300010375 Ga0105239_10044778 Ga0105239_100447784 333
554 3300010375 Ga0105239_10064171 Ga0105239_100641716 333
555 3300010375 Ga0105239_10072703 Ga0105239_100727031 333
556 3300010375 Ga0105239_10081086 Ga0105239_100810862 333
557 3300010375 Ga0105239_10722216 Ga0105239_107222162 333
558 3300011119 Ga0105246_10051609 Ga0105246_100516092 333
559 3300011119 Ga0105246_10148420 Ga0105246_101484202 333
560 3300013100 Ga0157373_10048454 Ga0157373_100484544 333
561 3300013100 Ga0157373_10056285 Ga0157373_100562853 333
562 3300013104 Ga0157370_10001666 Ga0157370_1000166621 333
563 3300013104 Ga0157370_10018690 Ga0157370_100186907 333
564 3300013104 Ga0157370_10122823 Ga0157370_101228232 333
565 3300013105 Ga0157369_10027598 Ga0157369_100275986 333
566 3300013105 Ga0157369_10031335 Ga0157369_100313355 333
567 3300013105 Ga0157369_10098085 Ga0157369_100980853 333
568 3300013296 Ga0157374_10007769 Ga0157374_100077692 333
569 3300013296 Ga0157374_10065564 Ga0157374_100655642 333
570 3300013296 Ga0157374_10179313 Ga0157374_101793132 333
571 3300013296 Ga0157374_10204448 Ga0157374_102044482 333
572 3300013306 Ga0163162_10137842 Ga0163162_101378423 333
573 3300013307 Ga0157372_10018994 Ga0157372_100189944 333
574 3300013307 Ga0157372_10043036 Ga0157372_100430369 333
575 3300013308 Ga0157375_10003013 Ga0157375_100030134 333
576 3300014325 Ga0163163_10034598 Ga0163163_100345985 333
577 3300014497 Ga0182008_10025740 Ga0182008_100257403 333
578 3300014497 Ga0182008_10039458 Ga0182008_100394581 333
579 3300014497 Ga0182008_10046900 Ga0182008_100469003 333
580 3300014968 Ga0157379_10008013 Ga0157379_100080133 333
581 3300014969 Ga0157376_10407585 Ga0157376_104075852 333
582 3300015261 Ga0182006_1013342 Ga0182006_10133422 333
583 3300015261 Ga0182006_1013820 Ga0182006_10138204 333
584 3300015261 Ga0182006_1027109 Ga0182006_10271092 333
585 3300015261 Ga0182006_1042021 Ga0182006_10420211 333
586 3300015262 Ga0182007_10000445 Ga0182007_1000044518 333
587 3300015262 Ga0182007_10010414 Ga0182007_100104143 333
588 3300017792 Ga0163161_10123495 Ga0163161_101234952 333
589 3300017792 Ga0163161_10220475 Ga0163161_102204752 333
590 3300017792 Ga0163161_10247922 Ga0163161_102479221 333
591 3300025233 Ga0209437_100179 Ga0209437_10017940 333
592 3300025233 Ga0209437_102131 Ga0209437_1021313 333
593 3300025245 Ga0207425_1003095 Ga0207425_10030951 333
594 3300025246 Ga0209646_1000299 Ga0209646_10002993 333
595 3300025250 Ga0209026_1000382 Ga0209026_10003823 333
596 3300025253 Ga0209677_100222 Ga0209677_1002223 333
597 3300025253 Ga0209677_101959 Ga0209677_1019594 333
598 3300025256 Ga0209759_1000085 Ga0209759_100008575 333
599 3300025256 Ga0209759_1000529 Ga0209759_10005293 333
600 3300025258 Ga0209129_1000566 Ga0209129_100056616 333
601 3300025261 Ga0209233_1000185 Ga0209233_100018539 333
602 3300025261 Ga0209233_1000263 Ga0209233_100026351 333
603 3300025272 Ga0209455_1005371 Ga0209455_10053715 333
604 3300025294 Ga0209025_1000082 Ga0209025_1000082141 333
605 3300025297 Ga0209758_1000319 Ga0209758_100031938 333
606 3300025297 Ga0209758_1003930 Ga0209758_100393011 333
607 3300025297 Ga0209758_1049084 Ga0209758_10490841 333
608 3300025298 Ga0209050_1000221 Ga0209050_100022150 333
609 3300025299 Ga0209256_1000794 Ga0209256_10007948 333
610 3300025304 Ga0209257_1000538 Ga0209257_100053856 333
611 3300025321 Ga0207656_10057803 Ga0207656_100578032 333
612 3300025728 Ga0207655_1004047 Ga0207655_100404716 333
613 3300025885 Ga0207653_10045597 Ga0207653_100455972 333
614 3300025900 Ga0207710_10004946 Ga0207710_100049464 333
615 3300025904 Ga0207647_10000515 Ga0207647_100005156 333
616 3300025904 Ga0207647_10101113 Ga0207647_101011132 333
617 3300025909 Ga0207705_10000607 Ga0207705_100006078 333
618 3300025910 Ga0207684_10081248 Ga0207684_100812484 333
619 3300025910 Ga0207684_10235168 Ga0207684_102351681 333
620 3300025911 Ga0207654_10042723 Ga0207654_100427232 333
621 3300025913 Ga0207695_10000234 Ga0207695_10000234101 333
622 3300025913 Ga0207695_10076941 Ga0207695_100769413 333
623 3300025913 Ga0207695_10251458 Ga0207695_102514582 333
624 3300025913 Ga0207695_10305432 Ga0207695_103054322 333
625 3300025914 Ga0207671_10000234 Ga0207671_1000023436 333
626 3300025914 Ga0207671_10059513 Ga0207671_100595133 333
627 3300025919 Ga0207657_10002587 Ga0207657_100025876 333
628 3300025919 Ga0207657_10074458 Ga0207657_100744583 333
629 3300025919 Ga0207657_10342764 Ga0207657_103427641 333
630 3300025921 Ga0207652_10087941 Ga0207652_100879412 333
631 3300025924 Ga0207694_10013955 Ga0207694_100139553 333
632 3300025924 Ga0207694_10083669 Ga0207694_100836692 333
633 3300025925 Ga0207650_10038633 Ga0207650_100386332 333
634 3300025926 Ga0207659_10351313 Ga0207659_103513132 333
635 3300025927 Ga0207687_10042786 Ga0207687_100427863 333
636 3300025931 Ga0207644_10140771 Ga0207644_101407712 333
637 3300025932 Ga0207690_10004275 Ga0207690_1000427511 333
638 3300025932 Ga0207690_10013606 Ga0207690_100136063 333
639 3300025933 Ga0207706_10098669 Ga0207706_100986692 333
640 3300025933 Ga0207706_10115917 Ga0207706_101159173 333
641 3300025934 Ga0207686_10176222 Ga0207686_101762222 333
642 3300025937 Ga0207669_10022696 Ga0207669_100226962 333
643 3300025940 Ga0207691_10101366 Ga0207691_101013662 333
644 3300025941 Ga0207711_10005529 Ga0207711_100055293 333
645 3300025942 Ga0207689_10050301 Ga0207689_100503014 333
646 3300025942 Ga0207689_10061444 Ga0207689_100614443 333
647 3300025949 Ga0207667_10003616 Ga0207667_1000361619 333
648 3300025949 Ga0207667_10011742 Ga0207667_100117426 333
649 3300025949 Ga0207667_10070109 Ga0207667_100701092 333
650 3300025949 Ga0207667_10267979 Ga0207667_102679791 333
651 3300025961 Ga0207712_10101881 Ga0207712_101018813 333
652 3300025972 Ga0207668_10045810 Ga0207668_100458102 333
653 3300025972 Ga0207668_10132961 Ga0207668_101329612 333
654 3300025986 Ga0207658_10095119 Ga0207658_100951191 333
655 3300026023 Ga0207677_10132242 Ga0207677_101322422 333
656 3300026023 Ga0207677_10165885 Ga0207677_101658851 333
657 3300026035 Ga0207703_10000403 Ga0207703_1000040316 333
658 3300026035 Ga0207703_10005587 Ga0207703_1000558712 333
659 3300026035 Ga0207703_10006415 Ga0207703_100064157 333
660 3300026035 Ga0207703_10177879 Ga0207703_101778792 333
661 3300026035 Ga0207703_10421249 Ga0207703_104212492 333
662 3300026041 Ga0207639_10034832 Ga0207639_100348323 333
663 3300026041 Ga0207639_10165050 Ga0207639_101650502 333
664 3300026067 Ga0207678_10046737 Ga0207678_100467373 333
665 3300026067 Ga0207678_10157794 Ga0207678_101577942 333
666 3300026078 Ga0207702_10000308 Ga0207702_1000030826 333
667 3300026078 Ga0207702_10096893 Ga0207702_100968932 333
668 3300026088 Ga0207641_10315288 Ga0207641_103152882 333
669 3300026095 Ga0207676_10490367 Ga0207676_104903671 333
670 3300026116 Ga0207674_10006843 Ga0207674_1000684313 333
671 3300026116 Ga0207674_10012468 Ga0207674_100124687 333
672 3300026116 Ga0207674_10161660 Ga0207674_101616601 333
673 3300026116 Ga0207674_10179049 Ga0207674_101790492 333
674 3300026118 Ga0207675_100000049 Ga0207675_10000004988 333
675 3300026142 Ga0207698_10063959 Ga0207698_100639593 333
676 3300026142 Ga0207698_10134992 Ga0207698_101349922 333
677 3300026142 Ga0207698_10580566 Ga0207698_105805661 333
678 3300027312 Ga0209371_1000043 Ga0209371_100004374 333
679 3300027312 Ga0209371_1000693 Ga0209371_100069318 333
680 3300027907 Ga0207428_10203424 Ga0207428_102034241 333
681 3300028379 Ga0268266_10000010 Ga0268266_10000010507 333
682 3300028379 Ga0268266_10022317 Ga0268266_100223173 333
683 3300028379 Ga0268266_10044623 Ga0268266_100446232 333
684 3300028380 Ga0268265_10000554 Ga0268265_1000055424 333
685 3300028380 Ga0268265_10120267 Ga0268265_101202672 333
686 3300028380 Ga0268265_10276271 Ga0268265_102762712 333
687 3300028381 Ga0268264_10034265 Ga0268264_100342656 333
688 3300028381 Ga0268264_10127727 Ga0268264_101277272 333
689 3300028786 Ga0307517_10006006 Ga0307517_1000600621 333
690 3300028786 Ga0307517_10195873 Ga0307517_101958731 333
691 3300028794 Ga0307515_10023583 Ga0307515_100235834 333
692 3300028794 Ga0307515_10104763 Ga0307515_101047634 333
693 3300028794 Ga0307515_10320094 Ga0307515_103200941 333
694 3300030500 Ga0268256_1000044 Ga0268256_100004474 333
695 3300030500 Ga0268256_1003158 Ga0268256_10031584 333
696 3300030521 Ga0307511_10005062 Ga0307511_100050624 333
697 3300030731 Ga0316177_1027618 Ga0316177_10276183 333
698 3300030745 Ga0316182_1382167 Ga0316182_13821672 333
699 3300031250 Ga0265331_10006389 Ga0265331_100063899 333
700 3300031251 Ga0265327_10000776 Ga0265327_100007769 333
701 3300031507 Ga0307509_10251876 Ga0307509_102518762 333
702 3300031548 Ga0307408_100045052 Ga0307408_1000450522 333
703 3300031616 Ga0307508_10000011 Ga0307508_10000011181 333
704 3300031616 Ga0307508_10166018 Ga0307508_101660182 333
705 3300031616 Ga0307508_10197080 Ga0307508_101970802 333
706 3300031730 Ga0307516_10029463 Ga0307516_100294635 333
707 3300031731 Ga0307405_10074830 Ga0307405_100748301 333
708 3300031731 Ga0307405_10112653 Ga0307405_101126531 333
709 3300031824 Ga0307413_10015987 Ga0307413_100159872 333
710 3300031824 Ga0307413_10040896 Ga0307413_100408962 333
711 3300031824 Ga0307413_10083185 Ga0307413_100831852 333
712 3300031824 Ga0307413_10201367 Ga0307413_102013672 333
713 3300031852 Ga0307410_10059987 Ga0307410_100599871 333
714 3300031852 Ga0307410_10203726 Ga0307410_102037261 333
715 3300031901 Ga0307406_10000348 Ga0307406_1000034820 333
716 3300031901 Ga0307406_10105655 Ga0307406_101056552 333
717 3300031903 Ga0307407_10018450 Ga0307407_100184504 333
718 3300031911 Ga0307412_10000002 Ga0307412_10000002244 333
719 3300031911 Ga0307412_10064347 Ga0307412_100643472 333
720 3300032002 Ga0307416_100044158 Ga0307416_1000441584 333
721 3300032002 Ga0307416_100087157 Ga0307416_1000871571 333
722 3300032004 Ga0307414_10000449 Ga0307414_1000044910 333
723 3300032004 Ga0307414_10006402 Ga0307414_100064021 333
724 3300032004 Ga0307414_10030580 Ga0307414_100305802 333
725 3300032004 Ga0307414_10047460 Ga0307414_100474603 333
726 3300032004 Ga0307414_10079892 Ga0307414_100798922 333
727 3300032004 Ga0307414_10114750 Ga0307414_101147502 333
728 3300032004 Ga0307414_10456842 Ga0307414_104568421 333
729 3300032005 Ga0307411_10018881 Ga0307411_100188812 333
730 3300032005 Ga0307411_10033515 Ga0307411_100335154 333
731 3300032005 Ga0307411_10076867 Ga0307411_100768672 333
732 3300032005 Ga0307411_10095807 Ga0307411_100958072 333
733 3300032005 Ga0307411_10150027 Ga0307411_101500272 333
734 3300032126 Ga0307415_100175145 Ga0307415_1001751452 333
735 3300033180 Ga0307510_10000038 Ga0307510_1000003815 333
736 3300033180 Ga0307510_10001244 Ga0307510_1000124419 333
737 3300036401 Ga0373937_0171774 Ga0373937_0171774_954_1955 333
738 3300037418 Ga0395900_0067817 Ga0395900_0067817_166_1209 333
739 3300037471 Ga0395905_0001404 Ga0395905_0001404_26168_27169 333
740 3300037471 Ga0395905_0142624 Ga0395905_0142624_128_1129 333
741 3300037471 Ga0395905_0200010 Ga0395905_0200010_679_1722 333
742 3300037471 Ga0395905_0350576 Ga0395905_0350576_79_1080 333
743 3300038443 Ga0395901_0497604 Ga0395901_0497604_20_1021 333
744 3300041405 Ga0439438_000156 Ga0439438_000156_2810_3811 333
745 3300041407 Ga0439447_000119 Ga0439447_000119_5123_6124 333
746 3300041407 Ga0439447_000835 Ga0439447_000835_4927_5928 333
747 3300041407 Ga0439447_003351 Ga0439447_003351_4124_5125 333
748 3300041411 Ga0439466_0004964 Ga0439466_0004964_3515_4516 333
749 3300041413 Ga0439465_0004512 Ga0439465_0004512_185_1204 333
750 3300041452 Ga0451793_0479790 Ga0451793_0479790_2213_3214 333
751 3300041456 Ga0451795_0032520 Ga0451795_0032520_1112_2113 333
752 3300041458 Ga0451798_0892919 Ga0451798_0892919_430_1431 333
753 3300041459 Ga0451800_0392314 Ga0451800_0392314_4699_5700 333
754 3300041512 Ga0451853_1117171 Ga0451853_1117171_17_1018 333
755 3300041997 Ga0439431_0042390 Ga0439431_0042390_111_1130 333
756 3300042006 Ga0439432_015862 Ga0439432_015862_1299_2315 333
757 3300042014 Ga0439457_000344 Ga0439457_000344_3586_4587 333
758 3300042014 Ga0439457_020551 Ga0439457_020551_38_1057 333
759 3300042128 Ga0450897_001337 Ga0450897_001337_627_1628 333
760 3300042876 Ga0451577_0002536 Ga0451577_0002536_13801_14802 333
761 3300042876 Ga0451577_0286976 Ga0451577_0286976_86_1087 333
762 3300044673 Ga0453683_0064422 Ga0453683_0064422_189_1190 333
763 3300044712 Ga0453684_0000353 Ga0453684_0000353_129633_130634 333
764 3300044712 Ga0453684_0006286 Ga0453684_0006286_6506_7507 333
765 3300044712 Ga0453684_0107062 Ga0453684_0107062_1635_2636 333
766 3300045051 Ga0451576_0029879 Ga0451576_0029879_3747_4748 333
767 3300045051 Ga0451576_0070120 Ga0451576_0070120_2527_3528 333
768 3300046453 Ga0495627_000331 Ga0495627_000331_25132_26214 333
769 3300046454 Ga0495592_0000365 Ga0495592_0000365_29926_30927 333
770 3300046458 Ga0495591_001338 Ga0495591_001338_2960_3961 333
771 3300046459 Ga0495629_0002327 Ga0495629_0002327_1118_2119 333
772 3300046460 Ga0495638_0011307 Ga0495638_0011307_4911_5912 333
773 3300046460 Ga0495638_0033665 Ga0495638_0033665_2168_3169 333
774 3300046460 Ga0495638_0074968 Ga0495638_0074968_963_1964 333
775 3300046460 Ga0495638_0082992 Ga0495638_0082992_820_1821 333
776 3300046460 Ga0495638_0109978 Ga0495638_0109978_344_1345 333
777 3300046462 Ga0495651_0031485 Ga0495651_0031485_849_1850 333
778 3300046463 Ga0495653_0044885 Ga0495653_0044885_1527_2528 333
779 3300046472 Ga0495580_0001754 Ga0495580_0001754_9206_10225 333
780 3300046472 Ga0495580_0050085 Ga0495580_0050085_1530_2531 333
781 3300046473 Ga0495582_0021696 Ga0495582_0021696_42_1061 333
782 3300046473 Ga0495582_0086888 Ga0495582_0086888_433_1434 333
783 3300046474 Ga0495605_0041917 Ga0495605_0041917_1006_2007 333
784 3300046474 Ga0495605_0090807 Ga0495605_0090807_376_1380 333
785 3300046476 Ga0495662_0093665 Ga0495662_0093665_47_1066 333
786 3300046477 Ga0495664_0015337 Ga0495664_0015337_2259_3260 333
787 3300046491 Ga0495584_0057005 Ga0495584_0057005_518_1522 333
788 3300046492 Ga0495585_0001312 Ga0495585_0001312_12784_13785 333
789 3300046492 Ga0495585_0028214 Ga0495585_0028214_1888_2892 333
790 3300046500 Ga0495596_0002121 Ga0495596_0002121_8815_9816 333
791 3300046500 Ga0495596_0007856 Ga0495596_0007856_1493_2494 333
792 3300046501 Ga0495607_0115014 Ga0495607_0115014_209_1210 333
793 3300046506 Ga0495583_0004366 Ga0495583_0004366_7103_8107 333
794 3300046507 Ga0495606_0014221 Ga0495606_0014221_1064_2080 333
795 3300046507 Ga0495606_0090702 Ga0495606_0090702_11_1012 333
796 3300046507 Ga0495606_0180150 Ga0495606_0180150_201_1202 333
797 3300046511 Ga0495608_0017253 Ga0495608_0017253_2449_3450 333
798 3300046512 Ga0495610_0005616 Ga0495610_0005616_3828_4829 333
799 3300046513 Ga0495616_0063544 Ga0495616_0063544_390_1394 333
800 3300046514 Ga0495618_0013317 Ga0495618_0013317_2523_3524 333
801 3300046515 Ga0495620_0012967 Ga0495620_0012967_1543_2547 333
802 3300046516 Ga0495628_0008078 Ga0495628_0008078_2191_3210 333
803 3300046516 Ga0495628_0025243 Ga0495628_0025243_2940_3941 333
804 3300046517 Ga0495630_0024065 Ga0495630_0024065_2577_3578 333
805 3300046518 Ga0495631_0003492 Ga0495631_0003492_3304_4305 333
806 3300046519 Ga0495632_0000615 Ga0495632_0000615_30288_31289 333
807 3300046522 Ga0495643_0022266 Ga0495643_0022266_1552_2553 333
808 3300046524 Ga0495648_0000650 Ga0495648_0000650_7759_8760 333
809 3300046524 Ga0495648_0003114 Ga0495648_0003114_12186_13187 333
810 3300046524 Ga0495648_0031744 Ga0495648_0031744_724_1743 333
811 3300046524 Ga0495648_0044815 Ga0495648_0044815_1294_2298 333
812 3300046524 Ga0495648_0095850 Ga0495648_0095850_341_1342 333
813 3300046526 Ga0495666_0011584 Ga0495666_0011584_2280_3281 333
814 3300046529 Ga0495652_0027497 Ga0495652_0027497_1339_2340 333
815 3300046530 Ga0495654_0008860 Ga0495654_0008860_968_2029 333
816 3300046531 Ga0495665_0015494 Ga0495665_0015494_2390_3391 333
817 3300046531 Ga0495665_0026698 Ga0495665_0026698_1825_2844 333
818 3300046533 Ga0495640_0026245 Ga0495640_0026245_2287_3288 333
819 3300046535 Ga0495586_0133825 Ga0495586_0133825_212_1213 333
820 3300046536 Ga0495587_0012329 Ga0495587_0012329_807_1808 333
821 3300046536 Ga0495587_0044837 Ga0495587_0044837_1235_2236 333
822 3300046538 Ga0495609_0029155 Ga0495609_0029155_1288_2289 333
823 3300046542 Ga0495597_0020551 Ga0495597_0020551_245_1246 333
824 3300046559 Ga0495667_0035781 Ga0495667_0035781_2060_3061 333
825 3300046616 Ga0495668_0005238 Ga0495668_0005238_3147_4148 333
826 3300046616 Ga0495668_0005998 Ga0495668_0005998_1856_2857 333
827 3300046616 Ga0495668_0006677 Ga0495668_0006677_594_1595 333
828 3300046616 Ga0495668_0129691 Ga0495668_0129691_224_1225 333
829 3300046642 Ga0495634_0034802 Ga0495634_0034802_1527_2528 333
830 3300046648 Ga0495611_0000338 Ga0495611_0000338_7542_8543 333
831 3300046648 Ga0495611_0043288 Ga0495611_0043288_42_1043 333
832 3300046660 Ga0495625_0000398 Ga0495625_0000398_36781_37782 333
833 3300046660 Ga0495625_0002639 Ga0495625_0002639_6422_7423 333
834 3300046660 Ga0495625_0005332 Ga0495625_0005332_5177_6178 333
835 3300046660 Ga0495625_0023964 Ga0495625_0023964_348_1349 333
836 3300046660 Ga0495625_0045187 Ga0495625_0045187_1028_2029 333
837 3300046660 Ga0495625_0055265 Ga0495625_0055265_128_1129 333
838 3300046663 Ga0495635_0004307 Ga0495635_0004307_6627_7628 333
839 3300046665 Ga0495661_0008892 Ga0495661_0008892_4991_5992 333
840 3300046665 Ga0495661_0022964 Ga0495661_0022964_2299_3300 333
841 3300046665 Ga0495661_0049329 Ga0495661_0049329_152_1156 333
842 3300046675 Ga0495657_0042048 Ga0495657_0042048_1226_2227 333
843 3300046678 Ga0495599_0028843 Ga0495599_0028843_219_1220 333
844 3300046680 Ga0495646_0019414 Ga0495646_0019414_926_1927 333
845 3300046684 Ga0495669_0057008 Ga0495669_0057008_650_1651 333
846 3300046689 Ga0495613_0003319 Ga0495613_0003319_8661_9662 333
847 3300046690 Ga0495624_0001210 Ga0495624_0001210_15034_16053 333
848 3300046690 Ga0495624_0010782 Ga0495624_0010782_3698_4699 333
849 3300046694 Ga0495649_0020224 Ga0495649_0020224_1602_2606 333
850 3300046794 Ga0495589_0012592 Ga0495589_0012592_926_1927 333
851 3300046809 Ga0495600_0018671 Ga0495600_0018671_2980_3981 333
852 3300046810 Ga0495660_0030605 Ga0495660_0030605_1471_2535 333
853 3300047317 Ga0495604_0004068 Ga0495604_0004068_326_1327 333
854 3300047317 Ga0495604_0015789 Ga0495604_0015789_2490_3491 333
855 3300047318 Ga0495636_0002305 Ga0495636_0002305_4013_5053 333
856 3300047318 Ga0495636_0044306 Ga0495636_0044306_403_1404 333
857 3300047318 Ga0495636_0077057 Ga0495636_0077057_64_1080 333
858 3300047319 Ga0495674_0002116 Ga0495674_0002116_3447_4466 333
859 3300047319 Ga0495674_0002272 Ga0495674_0002272_926_1927 333
860 3300047320 Ga0495672_0004957 Ga0495672_0004957_7490_8491 333
861 3300047321 Ga0495676_0016536 Ga0495676_0016536_3238_4257 333
862 3300047321 Ga0495676_0082230 Ga0495676_0082230_322_1323 333
863 3300047322 Ga0495680_0023678 Ga0495680_0023678_926_1927 333
864 3300047322 Ga0495680_0154093 Ga0495680_0154093_358_1452 333
865 3300047323 Ga0495683_0011094 Ga0495683_0011094_1463_2464 333
866 3300047443 Ga0495687_001236 Ga0495687_001236_15196_16197 333
867 3300047443 Ga0495687_027256 Ga0495687_027256_467_1468 333
868 3300047443 Ga0495687_050697 Ga0495687_050697_271_1272 333
869 3300047443 Ga0495687_058816 Ga0495687_058816_22_1026 333
870 3300047444 Ga0495675_0020835 Ga0495675_0020835_2287_3288 333
871 3300047446 Ga0495679_000183 Ga0495679_000183_12784_13788 333
872 3300047446 Ga0495679_008362 Ga0495679_008362_2287_3288 333
873 3300047469 Ga0495673_0014057 Ga0495673_0014057_2024_3025 333
874 3300047470 Ga0495681_0067650 Ga0495681_0067650_200_1201 333
875 3300047673 Ga0495593_0001368 Ga0495593_0001368_8475_9476 333
876 3300047673 Ga0495593_0001757 Ga0495593_0001757_5554_6573 333
877 3300048088 Ga0495602_0035786 Ga0495602_0035786_1339_2340 333
878 3300048089 Ga0495614_0011632 Ga0495614_0011632_420_1421 333
879 3300048091 Ga0495626_0011713 Ga0495626_0011713_1592_2593 333
880 3300048904 Ga0496101_0250648 Ga0496101_0250648_84_1088 333
881 3300048906 Ga0496103_0153161 Ga0496103_0153161_53_1057 333
882 3300048907 Ga0496104_0010697 Ga0496104_0010697_5855_6874 333
883 3300048908 Ga0496105_0043074 Ga0496105_0043074_1651_2670 333
884 3300048909 Ga0496106_0012180 Ga0496106_0012180_35_1078 333
885 3300048910 Ga0496107_0055487 Ga0496107_0055487_257_1258 333
886 3300048915 Ga0496112_0015518 Ga0496112_0015518_391_1392 333
887 3300048920 Ga0496117_0002431 Ga0496117_0002431_18972_19973 333
888 3300048920 Ga0496117_0009276 Ga0496117_0009276_552_1553 333
889 3300048920 Ga0496117_0047085 Ga0496117_0047085_704_1708 333
890 3300048921 Ga0496118_0005091 Ga0496118_0005091_5190_6191 333
891 3300048922 Ga0496119_0028863 Ga0496119_0028863_241_1242 333
892 3300048924 Ga0496121_0003338 Ga0496121_0003338_21644_22645 333
893 3300048924 Ga0496121_0017890 Ga0496121_0017890_5702_6745 333
894 3300048926 Ga0496123_0030984 Ga0496123_0030984_2188_3189 333
895 3300048927 Ga0496124_0023755 Ga0496124_0023755_681_1682 333
896 3300048928 Ga0496125_0009713 Ga0496125_0009713_509_1510 333
897 3300048928 Ga0496125_0068580 Ga0496125_0068580_730_1731 333
898 3300048929 Ga0496126_0069428 Ga0496126_0069428_359_1360 333
899 3300048929 Ga0496126_0173482 Ga0496126_0173482_487_1488 333
900 3300049460 Ga0495682_0006252 Ga0495682_0006252_3447_4451 333
901 3300049460 Ga0495682_0011202 Ga0495682_0011202_424_1425 333
902 3300049460 Ga0495682_0045654 Ga0495682_0045654_330_1331 333
903 3300049520 Ga0501297_009640 Ga0501297_009640_31_1032 333
904 3300049571 Ga0501034_0287285 Ga0501034_0287285_571_1572 333
905 3300049574 Ga0501038_0014418 Ga0501038_0014418_1971_2981 333
906 3300049679 Ga0501249_024246 Ga0501249_024246_51_1052 333
907 3300049759 Ga0501262_000019 Ga0501262_000019_12129_13130 333
908 3300049763 Ga0501266_000190 Ga0501266_000190_2765_3766 333
909 3300050489 nmdc:mga03683_13362_c1 nmdc:mga03683_13362_c1_999_2003 333
910 3300050490 nmdc:mga03n38_17482_c1 nmdc:mga03n38_17482_c1_921_1928 333
911 3300050491 nmdc:mga00v17_37146_c2 nmdc:mga00v17_37146_c2_1112_2113 333
912 3300050491 nmdc:mga00v17_4_c1 nmdc:mga00v17_4_c1_233300_234304 333
913 3300050493 nmdc:mga0k408_115892_c1 nmdc:mga0k408_115892_c1_467_1468 333
914 3300050493 nmdc:mga0k408_19195_c1 nmdc:mga0k408_19195_c1_2406_3407 333
915 3300050493 nmdc:mga0k408_3654_c1 nmdc:mga0k408_3654_c1_1283_2284 333
916 3300050493 nmdc:mga0k408_39926_c2 nmdc:mga0k408_39926_c2_62_1063 333
917 3300050493 nmdc:mga0k408_41120_c1 nmdc:mga0k408_41120_c1_1003_2004 333
918 3300050493 nmdc:mga0k408_9698_c1 nmdc:mga0k408_9698_c1_2935_3936 333
919 3300050494 nmdc:mga06z11_18457_c1 nmdc:mga06z11_18457_c1_1568_2569 333
920 3300050494 nmdc:mga06z11_22063_c1 nmdc:mga06z11_22063_c1_684_1685 333
921 3300050496 nmdc:mga07m45_4202_c1 nmdc:mga07m45_4202_c1_2370_3371 333
922 3300050511 nmdc:mga08y16_308720_c1 nmdc:mga08y16_308720_c1_38_1039 333
923 3300050512 nmdc:mga0n895_359_c1 nmdc:mga0n895_359_c1_4767_5768 333
924 3300050513 nmdc:mga0rr50_15494_c1 nmdc:mga0rr50_15494_c1_3757_4758 333
925 3300050515 nmdc:mga0a205_5241_c1 nmdc:mga0a205_5241_c1_6060_7061 333
926 3300050516 nmdc:mga0sz30_33157_c1 nmdc:mga0sz30_33157_c1_626_1627 333
927 3300050516 nmdc:mga0sz30_718_c1 nmdc:mga0sz30_718_c1_11183_12187 333
928 3300053079 Ga0500610_0000398 Ga0500610_0000398_5103_6104 333
929 3300053080 Ga0500635_0027882 Ga0500635_0027882_744_1745 333
930 3300053086 Ga0500578_0000002 Ga0500578_0000002_170795_171796 333
931 3300053086 Ga0500578_0059895 Ga0500578_0059895_14_1015 333
932 3300053087 Ga0500643_000023 Ga0500643_000023_235844_236884 333
933 3300053087 Ga0500643_000485 Ga0500643_000485_4050_5051 333
934 3300053088 Ga0500644_0000316 Ga0500644_0000316_185_1186 333
935 3300053090 Ga0500646_0005804 Ga0500646_0005804_344_1345 333
936 3300053090 Ga0500646_0012785 Ga0500646_0012785_608_1609 333
937 3300053090 Ga0500646_0017594 Ga0500646_0017594_337_1338 333
938 3300053090 Ga0500646_0031569 Ga0500646_0031569_364_1365 333
939 3300053090 Ga0500646_0032025 Ga0500646_0032025_148_1158 333
940 3300053092 Ga0500583_0000330 Ga0500583_0000330_3642_4643 333
941 3300053093 Ga0500651_0011141 Ga0500651_0011141_2554_3555 333
942 3300053093 Ga0500651_0036634 Ga0500651_0036634_1733_2734 333
943 3300053094 Ga0500566_0024737 Ga0500566_0024737_854_1855 333
944 3300053098 Ga0500650_0068764 Ga0500650_0068764_221_1222 333
945 3300053108 Ga0500562_000050 Ga0500562_000050_24851_25852 333
946 3300053119 Ga0500595_000113 Ga0500595_000113_32040_33041 333
947 3300053121 Ga0500607_022569 Ga0500607_022569_2061_3062 333
948 3300053130 Ga0500642_0008557 Ga0500642_0008557_544_1545 333
949 3300053131 Ga0500652_002040 Ga0500652_002040_831_1832 333
950 3300053131 Ga0500652_005790 Ga0500652_005790_2701_3702 333
951 3300053133 Ga0500655_011094 Ga0500655_011094_386_1387 333
952 3300053134 Ga0500658_0000009 Ga0500658_0000009_25794_26795 333
953 3300053134 Ga0500658_0009256 Ga0500658_0009256_2264_3265 333
954 3300053136 Ga0500559_0016915 Ga0500559_0016915_472_1473 333
955 3300053137 Ga0500561_0000073 Ga0500561_0000073_6035_7039 333
956 3300053139 Ga0500568_0000205 Ga0500568_0000205_14862_15863 333
957 3300053139 Ga0500568_0010186 Ga0500568_0010186_2708_3709 333
958 3300053142 Ga0500577_0010259 Ga0500577_0010259_750_1751 333
959 3300053151 Ga0500604_0000807 Ga0500604_0000807_1884_2885 333
960 3300053151 Ga0500604_0008000 Ga0500604_0008000_277_1278 333
961 3300053151 Ga0500604_0021103 Ga0500604_0021103_271_1272 333
962 3300053153 Ga0500616_0002510 Ga0500616_0002510_11138_12139 333
963 3300053155 Ga0500620_004905 Ga0500620_004905_2024_3025 333
964 3300053156 Ga0500622_0000227 Ga0500622_0000227_19583_20584 333
965 3300053156 Ga0500622_0000290 Ga0500622_0000290_16392_17393 333
966 3300053156 Ga0500622_0001746 Ga0500622_0001746_15464_16465 333
967 3300053156 Ga0500622_0002334 Ga0500622_0002334_6345_7391 333
968 3300053156 Ga0500622_0003764 Ga0500622_0003764_3743_4750 333
969 3300053156 Ga0500622_0019763 Ga0500622_0019763_347_1348 333
970 3300053158 Ga0500627_0036272 Ga0500627_0036272_113_1114 333
971 3300053177 Ga0500636_0014267 Ga0500636_0014267_2112_3113 333
972 3300053177 Ga0500636_0026685 Ga0500636_0026685_669_1670 333
973 3300053177 Ga0500636_0035954 Ga0500636_0035954_437_1438 333
974 3300053730 Ga0500645_001097 Ga0500645_001097_6012_7013 333
975 3300053730 Ga0500645_030402 Ga0500645_030402_605_1606 333
976 3300053739 Ga0500587_003299 Ga0500587_003299_11_1012 333
977 3300055283 Ga0500661_002854 Ga0500661_002854_2035_3036 333
978 3300055283 Ga0500661_003700 Ga0500661_003700_79_1080 333
979 iso_pu_bacteria 2582581280 2585150413 333
980 iso_pu_bacteria 2582581283 2585166089 333
981 iso_pu_bacteria 2582581293 2585198711 333
982 iso_pu_bacteria 2585427529 2585544483 333
983 iso_pu_bacteria 2585427633 2585994931 333
984 iso_pu_bacteria 2585427634 2585999473 333
985 iso_pu_bacteria 2841734538 2841738752 333
986 iso_pu_bacteria 2919408235 2919411485 333
987 iso_pu_bacteria 8005258706 8005264570 333
988 iso_pu_bacteria 8005321885 8005321997 333
989 iso_pu_bacteria 8018127388 8018127834 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

179

322

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

156

249

0.88

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

115

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9119 2 331
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9043 1 332
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8996 1 333
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8984 1 332
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8957 1 332
ID Description Score Start End Superfamily
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9465 2 126 3.90.180.10
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.945 1 93 3.90.180.10
af_Q54II4_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9409 2 122 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9404 1 123 3.90.180.10
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9388 2 118 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A536VTB4-F1-model_v4 NADP-dependent oxidoreductase 0.9956 55 333 GO:0008270
GO:0016491
AF-A0A536VTB4-F1-model_v4 NADP-dependent oxidoreductase 0.9921 55 333 GO:0008270
GO:0016491
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.992 1 333 GO:0008270
GO:0016491
AF-W9EF68-F1-model_v4 Zinc-containing alcohol dehydrogenase, quinone oxidoreductase 0.9909 1 333 GO:0016491
AF-A0A5B8TNI8-F1-model_v4 NADP-dependent oxidoreductase 0.9896 1 333 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.21 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map