F487585
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 989 | 669 | 691 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10000319|Ga0157378_1000031949 |
| Length | 335 |
| Sequence | VKAFIVDRYKKGGALRLGEMPEPAVRDHDVLVAVHAAALNPLDAKIRDGEFKLILPYRLPLILGNDVAGVVVRVGPKVRRFKPGDEVYARPSKDRIGTFAEYIAMDEADVALKPRNLSMEEAASVPLVALTAWQVLIERAELKQGQKVLIHAGSGGVGAFAIQLAKHLGATVATTTSTTNVDVVIDYKKENFARVLSGYDVVLNSLGKDTLEQSIDVLKPGGKLISISGPPDVAFAKENGLNWFLQQVMRLLSFGIRTKANRRGISYSFLFMRANGEQLGKITSLIEAGVIRQVVDRIFPFREFNEGMRYLETGRAVGKVVIRVGANENAHPGVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 13 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 14 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 15 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 16 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 17 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 18 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 19 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 20 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 21 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 22 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 23 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 24 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 25 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 26 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 27 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 28 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 29 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 30 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 31 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 32 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 33 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 34 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 35 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 36 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 37 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 38 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 39 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 40 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 41 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 42 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 43 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 44 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 45 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 46 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 47 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 48 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 49 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 50 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 51 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 52 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 53 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 54 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 55 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 56 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 57 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 58 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 59 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 60 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 61 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 62 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 63 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 64 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 65 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 66 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 67 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 68 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 69 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 70 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 71 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 72 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 73 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 74 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 75 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 76 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 77 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 78 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 79 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 80 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 81 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 82 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 83 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 84 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 85 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 86 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 87 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 88 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 89 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 90 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 91 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 92 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 93 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 94 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 95 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 96 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 97 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 98 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 99 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 100 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 101 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 102 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 103 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 104 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 105 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 106 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 107 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 108 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 109 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 110 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 111 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 112 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 113 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 114 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 115 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 116 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 117 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 118 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 119 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 120 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 121 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 122 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 123 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 124 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 125 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 126 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 127 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 128 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 129 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 130 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 131 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 132 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 133 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 134 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 135 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 136 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 137 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 138 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 139 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 140 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 141 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 142 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 143 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 144 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 145 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 146 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 147 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 148 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 149 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 150 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 151 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 152 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 153 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 154 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 155 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 156 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 157 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 158 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 159 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 160 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 161 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 162 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 163 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 164 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 165 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 166 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 167 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 168 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 169 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 170 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 171 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 172 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 173 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 174 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 175 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 176 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 177 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 178 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 179 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 180 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 181 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 182 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 183 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 184 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 185 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 186 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 187 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 188 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 189 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 190 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 191 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 192 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 193 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 194 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 195 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 196 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 197 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 198 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 199 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 200 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 201 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 202 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 203 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 204 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 205 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 206 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 207 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 208 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 209 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 210 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 211 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 212 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 213 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 214 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 215 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 216 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 217 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 218 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 219 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 220 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 221 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 222 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 223 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 224 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 225 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 226 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 227 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 228 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 229 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 230 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 231 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 232 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 233 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 234 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 235 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 236 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 237 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 238 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 239 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 240 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 241 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 242 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 243 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 244 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 245 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 246 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 247 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 248 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 249 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 250 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 251 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 252 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 253 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 254 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 255 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 256 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 257 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 258 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 259 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 260 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 261 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 262 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 263 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 264 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 265 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 266 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 267 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 268 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 269 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 270 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 271 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 272 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 273 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 274 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 275 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 276 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 277 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 278 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 279 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 280 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 281 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 282 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 283 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 284 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 285 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 286 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 287 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 288 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 289 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 290 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 291 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 292 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 293 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 294 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 295 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 296 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 299 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 301 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 312 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 315 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 316 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 317 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 318 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 320 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 321 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 322 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 323 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 324 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 326 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 327 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 328 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 329 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 330 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 331 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 332 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 333 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 334 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 335 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 336 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 337 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 338 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 340 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 341 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 342 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 343 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 344 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 345 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 346 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 347 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 348 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 349 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 350 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 351 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 352 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 353 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 354 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 355 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 356 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 358 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 361 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 363 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 364 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 366 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 367 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 368 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 369 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 370 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 371 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 372 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 375 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 376 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 379 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 381 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 382 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 383 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 384 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 385 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 386 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 388 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 389 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 392 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 393 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 394 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 396 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 397 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 399 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 401 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 403 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 404 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 454 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 458 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 459 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 460 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 461 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 462 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 463 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 464 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 465 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 466 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 467 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 468 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 469 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 470 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 471 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 472 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 473 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 474 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 475 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 476 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 477 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 478 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 479 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 480 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 481 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 482 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 483 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 484 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 485 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 486 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 487 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 488 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 489 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 490 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 491 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 492 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 493 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 494 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 495 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 496 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 497 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 498 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 499 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 500 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 501 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 502 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 503 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 504 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 505 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 506 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 578 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 579 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 580 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 581 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 582 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 583 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 584 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 585 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 586 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 587 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 588 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 589 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 590 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 591 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 592 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 593 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 595 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 598 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 599 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 600 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 601 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 602 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 603 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 604 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 605 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 606 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 607 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 613 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 614 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 615 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 616 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 617 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 618 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 619 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 620 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 621 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 622 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 623 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 624 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 625 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 626 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 627 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 628 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 629 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 630 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 631 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 632 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 633 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 634 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 635 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 636 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 637 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 638 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 639 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 640 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 641 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 642 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 643 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 644 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 645 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 646 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 647 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 648 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 649 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 650 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 651 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 652 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 653 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 654 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 655 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 656 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 657 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 658 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 659 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 660 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 661 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 662 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 663 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 664 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 665 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 666 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 667 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 668 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 669 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.87 |
| Metatranscriptomes | 0 |
| Isolates | 30.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.44 |
| Nodule | 17.8 |
| Rhizoplane | 1.82 |
| Rhizosphere | 56.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001788 | 3300001979 | Bacteria | 9857 |
| 2 | JGI24739J22299_10008123 | 3300001989 | Bacteria | 3918 |
| 3 | JGI24739J22299_10023597 | 3300001989 | Bacteria | 2173 |
| 4 | JGI24737J22298_10003380 | 3300001990 | Bacteria | 5642 |
| 5 | JGI24737J22298_10004822 | 3300001990 | Bacteria | 4683 |
| 6 | JGI24743J22301_10006797 | 3300001991 | Bacteria | 1963 |
| 7 | JGI24738J21930_10001816 | 3300002075 | Bacteria | 5787 |
| 8 | JGI24738J21930_10010554 | 3300002075 | Bacteria | 2054 |
| 9 | JGI25156J39149_1000873 | 3300002705 | Bacteria | 15026 |
| 10 | JGI25156J39149_1001284 | 3300002705 | Bacteria | 10895 |
| 11 | JGI25162J39368_1000642 | 3300002737 | Bacteria | 24772 |
| 12 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 13 | JGI25154J39366_1001801 | 3300002738 | Bacteria | 6715 |
| 14 | JGI25157J39369_1000851 | 3300002741 | Bacteria | 15031 |
| 15 | JGI25151J46595_10001575 | 3300003187 | Bacteria | 15220 |
| 16 | JGI25165J46597_1000999 | 3300003214 | Bacteria | 18766 |
| 17 | JGI25165J46597_1001072 | 3300003214 | Bacteria | 17563 |
| 18 | JGI25165J46597_1002307 | 3300003214 | Bacteria | 6506 |
| 19 | JGI25153J46596_10001714 | 3300003215 | Bacteria | 12988 |
| 20 | rootL2_10004516 | 3300003322 | Bacteria | 8575 |
| 21 | rootL2_10363542 | 3300003322 | Unclassified | 1741 |
| 22 | JGI25160J50197_1012841 | 3300003354 | Bacteria | 2885 |
| 23 | JGI25161J50226_1002832 | 3300003374 | Bacteria | 4250 |
| 24 | Ga0055539_1000513 | 3300003752 | Bacteria | 11908 |
| 25 | Ga0055524_1012206 | 3300003775 | Bacteria | 3312 |
| 26 | Ga0055531_10000965 | 3300003794 | Bacteria | 23016 |
| 27 | Ga0058692_1000035 | 3300003856 | Bacteria | 152983 |
| 28 | Ga0055543_1001188 | 3300004625 | Bacteria | 10960 |
| 29 | Ga0065165_1000241 | 3300005262 | Bacteria | 93644 |
| 30 | Ga0065165_1002670 | 3300005262 | Bacteria | 14404 |
| 31 | Ga0065715_10089106 | 3300005293 | Bacteria | 14278 |
| 32 | Ga0070658_10005121 | 3300005327 | Bacteria | 10670 |
| 33 | Ga0070658_10041562 | 3300005327 | Bacteria | 3710 |
| 34 | Ga0070670_100043399 | 3300005331 | Bacteria | 3865 |
| 35 | Ga0068869_100051298 | 3300005334 | Bacteria | 2993 |
| 36 | Ga0068869_100072738 | 3300005334 | Bacteria | 2548 |
| 37 | Ga0068869_100454803 | 3300005334 | Bacteria | 1062 |
| 38 | Ga0070666_10025670 | 3300005335 | Bacteria | 3843 |
| 39 | Ga0070666_10193979 | 3300005335 | Bacteria | 1428 |
| 40 | Ga0068868_100087708 | 3300005338 | Bacteria | 2503 |
| 41 | Ga0070660_100133936 | 3300005339 | Bacteria | 1985 |
| 42 | Ga0070660_100188043 | 3300005339 | Bacteria | 1672 |
| 43 | Ga0070660_100252382 | 3300005339 | Bacteria | 1439 |
| 44 | Ga0070668_100053824 | 3300005347 | Bacteria | 3103 |
| 45 | Ga0070668_100203068 | 3300005347 | Bacteria | 1628 |
| 46 | Ga0070669_100204096 | 3300005353 | Bacteria | 1557 |
| 47 | Ga0070675_100276405 | 3300005354 | Bacteria | 1475 |
| 48 | Ga0070675_100388678 | 3300005354 | Bacteria | 1243 |
| 49 | Ga0070671_100122939 | 3300005355 | Bacteria | 2184 |
| 50 | Ga0070671_100153126 | 3300005355 | Bacteria | 1947 |
| 51 | Ga0070674_100033790 | 3300005356 | Bacteria | 3408 |
| 52 | Ga0070674_100249814 | 3300005356 | Bacteria | 1393 |
| 53 | Ga0070673_100029907 | 3300005364 | Bacteria | 4068 |
| 54 | Ga0070673_100048494 | 3300005364 | Bacteria | 3311 |
| 55 | Ga0070659_100001718 | 3300005366 | Bacteria | 15751 |
| 56 | Ga0070659_100028187 | 3300005366 | Bacteria | 4334 |
| 57 | Ga0070659_100162400 | 3300005366 | Bacteria | 1827 |
| 58 | Ga0070667_100057349 | 3300005367 | Bacteria | 3292 |
| 59 | Ga0070667_100290157 | 3300005367 | Bacteria | 1471 |
| 60 | Ga0070705_100075763 | 3300005440 | Bacteria | 2049 |
| 61 | Ga0070700_100076132 | 3300005441 | Bacteria | 2154 |
| 62 | Ga0070708_100118089 | 3300005445 | Bacteria | 2443 |
| 63 | Ga0070708_100205401 | 3300005445 | Bacteria | 1845 |
| 64 | Ga0070662_100000167 | 3300005457 | Bacteria | 38204 |
| 65 | Ga0070662_100079420 | 3300005457 | Bacteria | 2440 |
| 66 | Ga0070662_100220601 | 3300005457 | Bacteria | 1513 |
| 67 | Ga0068867_100126997 | 3300005459 | Bacteria | 1977 |
| 68 | Ga0068867_100134289 | 3300005459 | Bacteria | 1927 |
| 69 | Ga0070706_100003698 | 3300005467 | Bacteria | 14968 |
| 70 | Ga0070706_100193872 | 3300005467 | Bacteria | 1898 |
| 71 | Ga0070707_100005425 | 3300005468 | Bacteria | 11927 |
| 72 | Ga0070707_100108298 | 3300005468 | Bacteria | 2695 |
| 73 | Ga0070698_100054281 | 3300005471 | Bacteria | 4069 |
| 74 | Ga0070698_100147290 | 3300005471 | Bacteria | 2303 |
| 75 | Ga0070698_100487148 | 3300005471 | Bacteria | 1170 |
| 76 | Ga0070699_100007692 | 3300005518 | Bacteria | 9368 |
| 77 | Ga0070699_100227605 | 3300005518 | Bacteria | 1662 |
| 78 | Ga0070679_100221311 | 3300005530 | Bacteria | 1854 |
| 79 | Ga0070684_100051678 | 3300005535 | Bacteria | 3571 |
| 80 | Ga0070697_100006095 | 3300005536 | Bacteria | 9327 |
| 81 | Ga0070697_100296960 | 3300005536 | Bacteria | 1388 |
| 82 | Ga0068853_100018261 | 3300005539 | Bacteria | 5803 |
| 83 | Ga0068853_100156821 | 3300005539 | Bacteria | 2051 |
| 84 | Ga0070672_100001960 | 3300005543 | Bacteria | 12906 |
| 85 | Ga0070672_100074753 | 3300005543 | Bacteria | 2704 |
| 86 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 87 | Ga0070665_100007151 | 3300005548 | Bacteria | 11349 |
| 88 | Ga0070665_100016065 | 3300005548 | Bacteria | 7512 |
| 89 | Ga0070665_100303727 | 3300005548 | Bacteria | 1599 |
| 90 | Ga0070704_100024496 | 3300005549 | Bacteria | 3960 |
| 91 | Ga0070704_100181522 | 3300005549 | Bacteria | 1684 |
| 92 | Ga0070704_100425153 | 3300005549 | Bacteria | 1138 |
| 93 | Ga0068855_100007578 | 3300005563 | Bacteria | 13132 |
| 94 | Ga0068855_100064015 | 3300005563 | Bacteria | 4289 |
| 95 | Ga0068855_100275068 | 3300005563 | Bacteria | 1871 |
| 96 | Ga0068855_100343998 | 3300005563 | Bacteria | 1644 |
| 97 | Ga0068857_100000489 | 3300005577 | Bacteria | 28341 |
| 98 | Ga0068857_100117345 | 3300005577 | Bacteria | 2395 |
| 99 | Ga0068857_100220463 | 3300005577 | Bacteria | 1732 |
| 100 | Ga0068854_100008799 | 3300005578 | Bacteria | 6497 |
| 101 | Ga0068854_100071479 | 3300005578 | Bacteria | 2538 |
| 102 | Ga0068856_100000991 | 3300005614 | Bacteria | 30324 |
| 103 | Ga0068856_100041460 | 3300005614 | Bacteria | 4524 |
| 104 | Ga0068856_100209029 | 3300005614 | Bacteria | 1967 |
| 105 | Ga0068852_100052049 | 3300005616 | Bacteria | 3518 |
| 106 | Ga0068852_100117952 | 3300005616 | Bacteria | 2424 |
| 107 | Ga0068852_100122678 | 3300005616 | Bacteria | 2382 |
| 108 | Ga0068859_100000151 | 3300005617 | Bacteria | 66183 |
| 109 | Ga0068859_100007089 | 3300005617 | Bacteria | 11377 |
| 110 | Ga0068861_100001690 | 3300005719 | Bacteria | 14160 |
| 111 | Ga0068851_10010112 | 3300005834 | Bacteria | 4396 |
| 112 | Ga0068851_10018502 | 3300005834 | Bacteria | 3356 |
| 113 | Ga0068851_10105116 | 3300005834 | Bacteria | 1502 |
| 114 | Ga0068863_100026949 | 3300005841 | Bacteria | 5480 |
| 115 | Ga0068863_100054170 | 3300005841 | Bacteria | 3801 |
| 116 | Ga0068863_100117728 | 3300005841 | Bacteria | 2532 |
| 117 | Ga0068863_100250274 | 3300005841 | Bacteria | 1711 |
| 118 | Ga0068863_100456958 | 3300005841 | Bacteria | 1254 |
| 119 | Ga0068858_100000273 | 3300005842 | Bacteria | 55482 |
| 120 | Ga0068858_100006378 | 3300005842 | Bacteria | 11490 |
| 121 | Ga0068858_100008996 | 3300005842 | Bacteria | 9552 |
| 122 | Ga0068858_100113852 | 3300005842 | Bacteria | 2526 |
| 123 | Ga0068858_100365369 | 3300005842 | Bacteria | 1383 |
| 124 | Ga0068860_100046091 | 3300005843 | Bacteria | 4157 |
| 125 | Ga0068860_100341009 | 3300005843 | Bacteria | 1473 |
| 126 | Ga0068862_100020999 | 3300005844 | Bacteria | 5456 |
| 127 | Ga0068862_100024533 | 3300005844 | Bacteria | 5061 |
| 128 | Ga0068862_100234316 | 3300005844 | Bacteria | 1666 |
| 129 | Ga0068862_100284396 | 3300005844 | Bacteria | 1517 |
| 130 | Ga0070717_10006422 | 3300006028 | Bacteria | 8647 |
| 131 | Ga0070717_10101276 | 3300006028 | Bacteria | 2446 |
| 132 | Ga0075365_10002167 | 3300006038 | Bacteria | 9449 |
| 133 | Ga0075365_10144624 | 3300006038 | Bacteria | 1652 |
| 134 | Ga0075368_10007659 | 3300006042 | Bacteria | 3817 |
| 135 | Ga0075368_10019634 | 3300006042 | Bacteria | 2552 |
| 136 | Ga0075364_10106867 | 3300006051 | Bacteria | 1865 |
| 137 | Ga0075432_10013171 | 3300006058 | Bacteria | 2809 |
| 138 | Ga0070715_10063920 | 3300006163 | Bacteria | 1624 |
| 139 | Ga0075362_10000508 | 3300006177 | Bacteria | 11381 |
| 140 | Ga0075367_10036200 | 3300006178 | Bacteria | 2861 |
| 141 | Ga0075367_10176970 | 3300006178 | Bacteria | 1329 |
| 142 | Ga0075369_10005799 | 3300006186 | Bacteria | 4637 |
| 143 | Ga0075369_10023666 | 3300006186 | Bacteria | 2540 |
| 144 | Ga0075366_10001556 | 3300006195 | Bacteria | 11484 |
| 145 | Ga0075366_10015983 | 3300006195 | Bacteria | 4309 |
| 146 | Ga0075366_10034597 | 3300006195 | Bacteria | 2976 |
| 147 | Ga0075366_10121530 | 3300006195 | Unclassified | 1574 |
| 148 | Ga0075370_10008118 | 3300006353 | Bacteria | 5390 |
| 149 | Ga0075370_10052305 | 3300006353 | Bacteria | 2317 |
| 150 | Ga0075370_10058171 | 3300006353 | Bacteria | 2198 |
| 151 | Ga0075428_100026574 | 3300006844 | Bacteria | 6408 |
| 152 | Ga0075428_100100604 | 3300006844 | Bacteria | 3152 |
| 153 | Ga0075430_100010209 | 3300006846 | Bacteria | 7952 |
| 154 | Ga0075430_100037469 | 3300006846 | Bacteria | 4110 |
| 155 | Ga0075430_100129903 | 3300006846 | Bacteria | 2100 |
| 156 | Ga0075431_100113557 | 3300006847 | Bacteria | 2796 |
| 157 | Ga0075434_100017992 | 3300006871 | Bacteria | 6820 |
| 158 | Ga0075429_100006117 | 3300006880 | Bacteria | 10402 |
| 159 | Ga0075429_100049552 | 3300006880 | Bacteria | 3652 |
| 160 | Ga0068865_100180466 | 3300006881 | Bacteria | 1625 |
| 161 | Ga0075436_100087478 | 3300006914 | Bacteria | 2164 |
| 162 | Ga0097620_100000151 | 3300006931 | Bacteria | 66183 |
| 163 | Ga0097620_100007089 | 3300006931 | Bacteria | 11377 |
| 164 | Ga0075435_100041263 | 3300007076 | Bacteria | 3688 |
| 165 | Ga0105251_10000837 | 3300009011 | Bacteria | 27603 |
| 166 | Ga0105244_10003082 | 3300009036 | Bacteria | 12199 |
| 167 | Ga0105244_10030578 | 3300009036 | Bacteria | 2864 |
| 168 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 169 | Ga0105240_10068267 | 3300009093 | Bacteria | 4403 |
| 170 | Ga0105240_10085783 | 3300009093 | Bacteria | 3857 |
| 171 | Ga0105240_10095230 | 3300009093 | Bacteria | 3630 |
| 172 | Ga0105240_10108637 | 3300009093 | Bacteria | 3360 |
| 173 | Ga0105240_10472789 | 3300009093 | Bacteria | 1399 |
| 174 | Ga0111539_10348399 | 3300009094 | Bacteria | 1724 |
| 175 | Ga0105245_10102479 | 3300009098 | Bacteria | 2651 |
| 176 | Ga0105247_10014016 | 3300009101 | Bacteria | 4807 |
| 177 | Ga0105247_10035380 | 3300009101 | Bacteria | 3044 |
| 178 | Ga0114129_10561688 | 3300009147 | Unclassified | 1483 |
| 179 | Ga0105243_10005104 | 3300009148 | Bacteria | 10305 |
| 180 | Ga0105243_10218194 | 3300009148 | Bacteria | 1684 |
| 181 | Ga0105241_10012545 | 3300009174 | Bacteria | 6216 |
| 182 | Ga0105241_10027870 | 3300009174 | Bacteria | 4207 |
| 183 | Ga0105241_10064139 | 3300009174 | Bacteria | 2836 |
| 184 | Ga0105248_10000764 | 3300009177 | Bacteria | 36109 |
| 185 | Ga0105248_10132844 | 3300009177 | Bacteria | 2808 |
| 186 | Ga0105248_10139030 | 3300009177 | Bacteria | 2740 |
| 187 | Ga0105248_10301610 | 3300009177 | Bacteria | 1804 |
| 188 | Ga0105237_10053876 | 3300009545 | Bacteria | 4033 |
| 189 | Ga0105237_10131081 | 3300009545 | Bacteria | 2501 |
| 190 | Ga0105237_10358871 | 3300009545 | Bacteria | 1462 |
| 191 | Ga0105238_10038755 | 3300009551 | Bacteria | 4839 |
| 192 | Ga0105238_10113596 | 3300009551 | Bacteria | 2688 |
| 193 | Ga0105238_10222572 | 3300009551 | Bacteria | 1863 |
| 194 | Ga0105249_10019476 | 3300009553 | Bacteria | 6055 |
| 195 | Ga0123342_1017216 | 3300009766 | Bacteria | 6065 |
| 196 | Ga0105239_10009037 | 3300010375 | Bacteria | 11282 |
| 197 | Ga0105239_10033221 | 3300010375 | Bacteria | 5666 |
| 198 | Ga0105239_10044778 | 3300010375 | Bacteria | 4850 |
| 199 | Ga0105239_10062150 | 3300010375 | Bacteria | 4099 |
| 200 | Ga0105239_10064171 | 3300010375 | Bacteria | 4032 |
| 201 | Ga0105239_10072703 | 3300010375 | Bacteria | 3781 |
| 202 | Ga0105239_10081086 | 3300010375 | Bacteria | 3571 |
| 203 | Ga0105239_10722216 | 3300010375 | Bacteria | 1140 |
| 204 | Ga0105246_10051609 | 3300011119 | Bacteria | 2825 |
| 205 | Ga0105246_10062221 | 3300011119 | Bacteria | 2599 |
| 206 | Ga0105246_10148420 | 3300011119 | Bacteria | 1772 |
| 207 | Ga0157373_10048454 | 3300013100 | Bacteria | 3029 |
| 208 | Ga0157373_10056285 | 3300013100 | Bacteria | 2793 |
| 209 | Ga0157373_10057525 | 3300013100 | Bacteria | 2758 |
| 210 | Ga0157370_10001666 | 3300013104 | Bacteria | 27356 |
| 211 | Ga0157370_10018690 | 3300013104 | Bacteria | 6969 |
| 212 | Ga0157370_10122823 | 3300013104 | Bacteria | 2425 |
| 213 | Ga0157369_10027598 | 3300013105 | Bacteria | 6290 |
| 214 | Ga0157369_10031335 | 3300013105 | Bacteria | 5855 |
| 215 | Ga0157369_10098085 | 3300013105 | Bacteria | 3126 |
| 216 | Ga0157369_10103270 | 3300013105 | Bacteria | 3036 |
| 217 | Ga0157374_10004368 | 3300013296 | Bacteria | 11900 |
| 218 | Ga0157374_10007769 | 3300013296 | Bacteria | 9154 |
| 219 | Ga0157374_10065564 | 3300013296 | Bacteria | 3411 |
| 220 | Ga0157374_10179313 | 3300013296 | Bacteria | 2069 |
| 221 | Ga0157374_10204448 | 3300013296 | Bacteria | 1935 |
| 222 | Ga0157378_10000319 | 3300013297 | Bacteria | 47265 |
| 223 | Ga0163162_10137842 | 3300013306 | Bacteria | 2551 |
| 224 | Ga0157372_10018994 | 3300013307 | Bacteria | 7397 |
| 225 | Ga0157372_10043036 | 3300013307 | Bacteria | 4998 |
| 226 | Ga0157375_10003013 | 3300013308 | Bacteria | 14623 |
| 227 | Ga0163163_10034598 | 3300014325 | Bacteria | 4895 |
| 228 | Ga0157380_10057383 | 3300014326 | Bacteria | 3100 |
| 229 | Ga0182008_10025740 | 3300014497 | Bacteria | 2988 |
| 230 | Ga0182008_10039458 | 3300014497 | Bacteria | 2359 |
| 231 | Ga0182008_10046900 | 3300014497 | Bacteria | 2147 |
| 232 | Ga0157379_10008013 | 3300014968 | Bacteria | 9166 |
| 233 | Ga0157379_10022204 | 3300014968 | Bacteria | 5622 |
| 234 | Ga0157376_10407585 | 3300014969 | Bacteria | 1316 |
| 235 | Ga0182006_1013342 | 3300015261 | Bacteria | 3567 |
| 236 | Ga0182006_1013820 | 3300015261 | Bacteria | 3492 |
| 237 | Ga0182006_1027109 | 3300015261 | Bacteria | 2341 |
| 238 | Ga0182006_1042021 | 3300015261 | Bacteria | 1793 |
| 239 | Ga0182007_10000445 | 3300015262 | Bacteria | 25030 |
| 240 | Ga0182007_10005878 | 3300015262 | Bacteria | 5332 |
| 241 | Ga0182007_10010414 | 3300015262 | Bacteria | 3675 |
| 242 | Ga0163161_10123495 | 3300017792 | Bacteria | 1947 |
| 243 | Ga0163161_10220475 | 3300017792 | Bacteria | 1469 |
| 244 | Ga0163161_10247922 | 3300017792 | Bacteria | 1387 |
| 245 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 246 | Ga0209437_102131 | 3300025233 | Bacteria | 3989 |
| 247 | Ga0207425_1003095 | 3300025245 | Bacteria | 5499 |
| 248 | Ga0209646_1000299 | 3300025246 | Bacteria | 40564 |
| 249 | Ga0209026_1000382 | 3300025250 | Bacteria | 40564 |
| 250 | Ga0209677_100222 | 3300025253 | Bacteria | 40564 |
| 251 | Ga0209677_101959 | 3300025253 | Bacteria | 8209 |
| 252 | Ga0209759_1000085 | 3300025256 | Bacteria | 168382 |
| 253 | Ga0209759_1000529 | 3300025256 | Bacteria | 40564 |
| 254 | Ga0209129_1000566 | 3300025258 | Bacteria | 25492 |
| 255 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 256 | Ga0209233_1000263 | 3300025261 | Bacteria | 79293 |
| 257 | Ga0209455_1005371 | 3300025272 | Bacteria | 3975 |
| 258 | Ga0209025_1000082 | 3300025294 | Bacteria | 265613 |
| 259 | Ga0209758_1000319 | 3300025297 | Bacteria | 92649 |
| 260 | Ga0209758_1003930 | 3300025297 | Bacteria | 12947 |
| 261 | Ga0209758_1049084 | 3300025297 | Bacteria | 1494 |
| 262 | Ga0209050_1000221 | 3300025298 | Bacteria | 126843 |
| 263 | Ga0209256_1000794 | 3300025299 | Bacteria | 40601 |
| 264 | Ga0207426_1000210 | 3300025302 | Bacteria | 138932 |
| 265 | Ga0209257_1000538 | 3300025304 | Bacteria | 65300 |
| 266 | Ga0207656_10057803 | 3300025321 | Bacteria | 1693 |
| 267 | Ga0207655_1004047 | 3300025728 | Bacteria | 10557 |
| 268 | Ga0207713_1000336 | 3300025735 | Bacteria | 52391 |
| 269 | Ga0207653_10045597 | 3300025885 | Bacteria | 1448 |
| 270 | Ga0207642_10072020 | 3300025899 | Bacteria | 1648 |
| 271 | Ga0207710_10004946 | 3300025900 | Bacteria | 5774 |
| 272 | Ga0207680_10090403 | 3300025903 | Bacteria | 1946 |
| 273 | Ga0207647_10000209 | 3300025904 | Bacteria | 47604 |
| 274 | Ga0207647_10000515 | 3300025904 | Bacteria | 30820 |
| 275 | Ga0207647_10101113 | 3300025904 | Bacteria | 1710 |
| 276 | Ga0207645_10042759 | 3300025907 | Bacteria | 2899 |
| 277 | Ga0207705_10000607 | 3300025909 | Bacteria | 30025 |
| 278 | Ga0207684_10009256 | 3300025910 | Bacteria | 8706 |
| 279 | Ga0207684_10071261 | 3300025910 | Bacteria | 2954 |
| 280 | Ga0207684_10081248 | 3300025910 | Bacteria | 2758 |
| 281 | Ga0207684_10235168 | 3300025910 | Bacteria | 1581 |
| 282 | Ga0207654_10042723 | 3300025911 | Bacteria | 2567 |
| 283 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 284 | Ga0207695_10076941 | 3300025913 | Bacteria | 3391 |
| 285 | Ga0207695_10251458 | 3300025913 | Bacteria | 1667 |
| 286 | Ga0207695_10305432 | 3300025913 | Bacteria | 1482 |
| 287 | Ga0207671_10000234 | 3300025914 | Bacteria | 83448 |
| 288 | Ga0207671_10059513 | 3300025914 | Bacteria | 2833 |
| 289 | Ga0207657_10002587 | 3300025919 | Bacteria | 19578 |
| 290 | Ga0207657_10074458 | 3300025919 | Bacteria | 2867 |
| 291 | Ga0207657_10185208 | 3300025919 | Bacteria | 1682 |
| 292 | Ga0207657_10329041 | 3300025919 | Bacteria | 1207 |
| 293 | Ga0207657_10342764 | 3300025919 | Bacteria | 1179 |
| 294 | Ga0207652_10087941 | 3300025921 | Bacteria | 2725 |
| 295 | Ga0207646_10003418 | 3300025922 | Bacteria | 17930 |
| 296 | Ga0207681_10115444 | 3300025923 | Bacteria | 1960 |
| 297 | Ga0207694_10013955 | 3300025924 | Bacteria | 6057 |
| 298 | Ga0207694_10083669 | 3300025924 | Bacteria | 2509 |
| 299 | Ga0207650_10038633 | 3300025925 | Bacteria | 3487 |
| 300 | Ga0207659_10351313 | 3300025926 | Unclassified | 1223 |
| 301 | Ga0207687_10042786 | 3300025927 | Bacteria | 3118 |
| 302 | Ga0207644_10042344 | 3300025931 | Bacteria | 3227 |
| 303 | Ga0207644_10140771 | 3300025931 | Bacteria | 1858 |
| 304 | Ga0207644_10168459 | 3300025931 | Bacteria | 1708 |
| 305 | Ga0207690_10004275 | 3300025932 | Bacteria | 8432 |
| 306 | Ga0207690_10013606 | 3300025932 | Bacteria | 4892 |
| 307 | Ga0207706_10000257 | 3300025933 | Bacteria | 57965 |
| 308 | Ga0207706_10019903 | 3300025933 | Bacteria | 6033 |
| 309 | Ga0207706_10098669 | 3300025933 | Bacteria | 2569 |
| 310 | Ga0207706_10115917 | 3300025933 | Bacteria | 2356 |
| 311 | Ga0207686_10176222 | 3300025934 | Bacteria | 1512 |
| 312 | Ga0207669_10022696 | 3300025937 | Bacteria | 3338 |
| 313 | Ga0207691_10099715 | 3300025940 | Bacteria | 2593 |
| 314 | Ga0207691_10101366 | 3300025940 | Bacteria | 2569 |
| 315 | Ga0207711_10005529 | 3300025941 | Bacteria | 10687 |
| 316 | Ga0207689_10050301 | 3300025942 | Bacteria | 3437 |
| 317 | Ga0207689_10061444 | 3300025942 | Bacteria | 3089 |
| 318 | Ga0207667_10003616 | 3300025949 | Bacteria | 19076 |
| 319 | Ga0207667_10011742 | 3300025949 | Bacteria | 10157 |
| 320 | Ga0207667_10070109 | 3300025949 | Bacteria | 3649 |
| 321 | Ga0207667_10267979 | 3300025949 | Bacteria | 1746 |
| 322 | Ga0207651_10009347 | 3300025960 | Bacteria | 5360 |
| 323 | Ga0207651_10014951 | 3300025960 | Bacteria | 4496 |
| 324 | Ga0207712_10101881 | 3300025961 | Bacteria | 2136 |
| 325 | Ga0207668_10045810 | 3300025972 | Bacteria | 2985 |
| 326 | Ga0207668_10132961 | 3300025972 | Bacteria | 1902 |
| 327 | Ga0207658_10095119 | 3300025986 | Bacteria | 2320 |
| 328 | Ga0207677_10132242 | 3300026023 | Bacteria | 1897 |
| 329 | Ga0207677_10165885 | 3300026023 | Bacteria | 1721 |
| 330 | Ga0207703_10000403 | 3300026035 | Bacteria | 46432 |
| 331 | Ga0207703_10005587 | 3300026035 | Bacteria | 10096 |
| 332 | Ga0207703_10006415 | 3300026035 | Bacteria | 9402 |
| 333 | Ga0207703_10161961 | 3300026035 | Bacteria | 1960 |
| 334 | Ga0207703_10177879 | 3300026035 | Bacteria | 1876 |
| 335 | Ga0207703_10421249 | 3300026035 | Bacteria | 1242 |
| 336 | Ga0207639_10034832 | 3300026041 | Bacteria | 3723 |
| 337 | Ga0207639_10165050 | 3300026041 | Bacteria | 1870 |
| 338 | Ga0207678_10046737 | 3300026067 | Bacteria | 3743 |
| 339 | Ga0207678_10157794 | 3300026067 | Bacteria | 1937 |
| 340 | Ga0207708_10015977 | 3300026075 | Bacteria | 5637 |
| 341 | Ga0207702_10000308 | 3300026078 | Bacteria | 55913 |
| 342 | Ga0207702_10096893 | 3300026078 | Bacteria | 2595 |
| 343 | Ga0207641_10315288 | 3300026088 | Bacteria | 1481 |
| 344 | Ga0207641_10321578 | 3300026088 | Bacteria | 1467 |
| 345 | Ga0207648_10012463 | 3300026089 | Bacteria | 7960 |
| 346 | Ga0207676_10490367 | 3300026095 | Bacteria | 1165 |
| 347 | Ga0207674_10006843 | 3300026116 | Bacteria | 13372 |
| 348 | Ga0207674_10012468 | 3300026116 | Bacteria | 9499 |
| 349 | Ga0207674_10161660 | 3300026116 | Bacteria | 2194 |
| 350 | Ga0207674_10179049 | 3300026116 | Bacteria | 2072 |
| 351 | Ga0207675_100000049 | 3300026118 | Bacteria | 84016 |
| 352 | Ga0207675_100215474 | 3300026118 | Bacteria | 1849 |
| 353 | Ga0207698_10063959 | 3300026142 | Bacteria | 2882 |
| 354 | Ga0207698_10134992 | 3300026142 | Bacteria | 2116 |
| 355 | Ga0207698_10266661 | 3300026142 | Bacteria | 1576 |
| 356 | Ga0207698_10580566 | 3300026142 | Bacteria | 1103 |
| 357 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 358 | Ga0209371_1000693 | 3300027312 | Bacteria | 28682 |
| 359 | Ga0207428_10203424 | 3300027907 | Bacteria | 1490 |
| 360 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 361 | Ga0268266_10022317 | 3300028379 | Bacteria | 5395 |
| 362 | Ga0268266_10044623 | 3300028379 | Bacteria | 3790 |
| 363 | Ga0268265_10000554 | 3300028380 | Bacteria | 38099 |
| 364 | Ga0268265_10120267 | 3300028380 | Bacteria | 2162 |
| 365 | Ga0268265_10276271 | 3300028380 | Bacteria | 1501 |
| 366 | Ga0268264_10034265 | 3300028381 | Bacteria | 4175 |
| 367 | Ga0268264_10127727 | 3300028381 | Bacteria | 2249 |
| 368 | Ga0307517_10006006 | 3300028786 | Bacteria | 18095 |
| 369 | Ga0307517_10195873 | 3300028786 | Bacteria | 1273 |
| 370 | Ga0307515_10023583 | 3300028794 | Bacteria | 10775 |
| 371 | Ga0307515_10104763 | 3300028794 | Bacteria | 3375 |
| 372 | Ga0307515_10213156 | 3300028794 | Bacteria | 1770 |
| 373 | Ga0307515_10320094 | 3300028794 | Bacteria | 1218 |
| 374 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 375 | Ga0268256_1003158 | 3300030500 | Bacteria | 7671 |
| 376 | Ga0307511_10005062 | 3300030521 | Bacteria | 13442 |
| 377 | Ga0316177_1027618 | 3300030731 | Bacteria | 2660 |
| 378 | Ga0316177_1054620 | 3300030731 | Bacteria | 3918 |
| 379 | Ga0314311_1034637 | 3300030733 | Bacteria | 15856 |
| 380 | Ga0316182_1382167 | 3300030745 | Bacteria | 2095 |
| 381 | Ga0265331_10006389 | 3300031250 | Bacteria | 6977 |
| 382 | Ga0265327_10000776 | 3300031251 | Bacteria | 49288 |
| 383 | Ga0307513_10031414 | 3300031456 | Bacteria | 6015 |
| 384 | Ga0307513_10223624 | 3300031456 | Bacteria | 1701 |
| 385 | Ga0307509_10251876 | 3300031507 | Bacteria | 1549 |
| 386 | Ga0307408_100045052 | 3300031548 | Bacteria | 3148 |
| 387 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 388 | Ga0307508_10166018 | 3300031616 | Bacteria | 1811 |
| 389 | Ga0307508_10197080 | 3300031616 | Bacteria | 1615 |
| 390 | Ga0307516_10029463 | 3300031730 | Bacteria | 5551 |
| 391 | Ga0307405_10074830 | 3300031731 | Bacteria | 2191 |
| 392 | Ga0307405_10082389 | 3300031731 | Bacteria | 2106 |
| 393 | Ga0307405_10112653 | 3300031731 | Bacteria | 1846 |
| 394 | Ga0307413_10015987 | 3300031824 | Bacteria | 3861 |
| 395 | Ga0307413_10040896 | 3300031824 | Bacteria | 2710 |
| 396 | Ga0307413_10083185 | 3300031824 | Bacteria | 2059 |
| 397 | Ga0307413_10201367 | 3300031824 | Bacteria | 1438 |
| 398 | Ga0307410_10059987 | 3300031852 | Bacteria | 2598 |
| 399 | Ga0307410_10203726 | 3300031852 | Bacteria | 1512 |
| 400 | Ga0307406_10000348 | 3300031901 | Bacteria | 26954 |
| 401 | Ga0307406_10018310 | 3300031901 | Bacteria | 4090 |
| 402 | Ga0307406_10105655 | 3300031901 | Bacteria | 1927 |
| 403 | Ga0307406_10192149 | 3300031901 | Bacteria | 1495 |
| 404 | Ga0307407_10018450 | 3300031903 | Bacteria | 3529 |
| 405 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 406 | Ga0307412_10012181 | 3300031911 | Bacteria | 5001 |
| 407 | Ga0307412_10064347 | 3300031911 | Bacteria | 2478 |
| 408 | Ga0307412_10130063 | 3300031911 | Bacteria | 1827 |
| 409 | Ga0307409_100046305 | 3300031995 | Bacteria | 3291 |
| 410 | Ga0307409_100434140 | 3300031995 | Bacteria | 1263 |
| 411 | Ga0307416_100007386 | 3300032002 | Bacteria | 6984 |
| 412 | Ga0307416_100044158 | 3300032002 | Bacteria | 3496 |
| 413 | Ga0307416_100087157 | 3300032002 | Bacteria | 2664 |
| 414 | Ga0307414_10000449 | 3300032004 | Bacteria | 21733 |
| 415 | Ga0307414_10006402 | 3300032004 | Bacteria | 6564 |
| 416 | Ga0307414_10030580 | 3300032004 | Bacteria | 3520 |
| 417 | Ga0307414_10047460 | 3300032004 | Bacteria | 2955 |
| 418 | Ga0307414_10079892 | 3300032004 | Bacteria | 2389 |
| 419 | Ga0307414_10114750 | 3300032004 | Bacteria | 2058 |
| 420 | Ga0307414_10456842 | 3300032004 | Bacteria | 1121 |
| 421 | Ga0307411_10018881 | 3300032005 | Bacteria | 3968 |
| 422 | Ga0307411_10033515 | 3300032005 | Bacteria | 3186 |
| 423 | Ga0307411_10076867 | 3300032005 | Bacteria | 2283 |
| 424 | Ga0307411_10095807 | 3300032005 | Bacteria | 2084 |
| 425 | Ga0307411_10121251 | 3300032005 | Bacteria | 1892 |
| 426 | Ga0307411_10150027 | 3300032005 | Bacteria | 1731 |
| 427 | Ga0307415_100002524 | 3300032126 | Bacteria | 9145 |
| 428 | Ga0307415_100060274 | 3300032126 | Bacteria | 2621 |
| 429 | Ga0307415_100175145 | 3300032126 | Bacteria | 1677 |
| 430 | Ga0307510_10000038 | 3300033180 | Bacteria | 106256 |
| 431 | Ga0307510_10001244 | 3300033180 | Bacteria | 27679 |
| 432 | Ga0307510_10021309 | 3300033180 | Bacteria | 7553 |
| 433 | Ga0373937_0171774 | 3300036401 | Bacteria | 2034 |
| 434 | Ga0395900_0067817 | 3300037418 | Bacteria | 3665 |
| 435 | Ga0395905_0001404 | 3300037471 | Bacteria | 29151 |
| 436 | Ga0395905_0142624 | 3300037471 | Bacteria | 2253 |
| 437 | Ga0395905_0200010 | 3300037471 | Bacteria | 1873 |
| 438 | Ga0395905_0350576 | 3300037471 | Bacteria | 1368 |
| 439 | Ga0395901_0497604 | 3300038443 | Bacteria | 1241 |
| 440 | Ga0436363_1258129 | 3300039450 | Bacteria | 2874 |
| 441 | Ga0439438_000156 | 3300041405 | Bacteria | 31119 |
| 442 | Ga0439447_000119 | 3300041407 | Bacteria | 26584 |
| 443 | Ga0439447_000835 | 3300041407 | Bacteria | 11291 |
| 444 | Ga0439447_003351 | 3300041407 | Bacteria | 5700 |
| 445 | Ga0439466_0004964 | 3300041411 | Bacteria | 5110 |
| 446 | Ga0439465_0004512 | 3300041413 | Bacteria | 4500 |
| 447 | Ga0451793_0479790 | 3300041452 | Bacteria | 3720 |
| 448 | Ga0451795_0032520 | 3300041456 | Bacteria | 2482 |
| 449 | Ga0451798_0892919 | 3300041458 | Bacteria | 1884 |
| 450 | Ga0451800_0392314 | 3300041459 | Bacteria | 6297 |
| 451 | Ga0451853_1117171 | 3300041512 | Bacteria | 1422 |
| 452 | Ga0439431_0042390 | 3300041997 | Bacteria | 1162 |
| 453 | Ga0439432_015862 | 3300042006 | Bacteria | 2537 |
| 454 | Ga0439450_033524 | 3300042008 | Bacteria | 1165 |
| 455 | Ga0439457_000344 | 3300042014 | Bacteria | 12945 |
| 456 | Ga0439457_020551 | 3300042014 | Bacteria | 1465 |
| 457 | Ga0450897_001337 | 3300042128 | Bacteria | 1663 |
| 458 | Ga0451577_0002536 | 3300042876 | Bacteria | 21608 |
| 459 | Ga0451577_0286976 | 3300042876 | Bacteria | 1491 |
| 460 | Ga0453683_0064422 | 3300044673 | Bacteria | 2291 |
| 461 | Ga0453684_0000353 | 3300044712 | Bacteria | 191059 |
| 462 | Ga0453684_0006286 | 3300044712 | Bacteria | 22724 |
| 463 | Ga0453684_0107062 | 3300044712 | Bacteria | 3405 |
| 464 | Ga0451576_0029879 | 3300045051 | Bacteria | 5829 |
| 465 | Ga0451576_0070120 | 3300045051 | Bacteria | 3648 |
| 466 | Ga0495627_000331 | 3300046453 | Bacteria | 45362 |
| 467 | Ga0495592_0000365 | 3300046454 | Bacteria | 35662 |
| 468 | Ga0495591_001338 | 3300046458 | Bacteria | 15489 |
| 469 | Ga0495629_0002327 | 3300046459 | Bacteria | 14641 |
| 470 | Ga0495638_0011307 | 3300046460 | Bacteria | 6151 |
| 471 | Ga0495638_0033665 | 3300046460 | Bacteria | 3276 |
| 472 | Ga0495638_0074968 | 3300046460 | Bacteria | 2063 |
| 473 | Ga0495638_0082992 | 3300046460 | Bacteria | 1942 |
| 474 | Ga0495638_0109978 | 3300046460 | Bacteria | 1638 |
| 475 | Ga0495651_0031485 | 3300046462 | Bacteria | 4136 |
| 476 | Ga0495653_0044885 | 3300046463 | Bacteria | 3428 |
| 477 | Ga0495580_0001754 | 3300046472 | Bacteria | 19061 |
| 478 | Ga0495580_0050085 | 3300046472 | Bacteria | 2953 |
| 479 | Ga0495582_0021696 | 3300046473 | Bacteria | 3514 |
| 480 | Ga0495582_0086888 | 3300046473 | Bacteria | 1740 |
| 481 | Ga0495605_0041917 | 3300046474 | Bacteria | 2278 |
| 482 | Ga0495605_0090807 | 3300046474 | Bacteria | 1416 |
| 483 | Ga0495662_0093665 | 3300046476 | Bacteria | 1466 |
| 484 | Ga0495664_0015337 | 3300046477 | Bacteria | 4355 |
| 485 | Ga0495584_0057005 | 3300046491 | Bacteria | 1966 |
| 486 | Ga0495585_0001312 | 3300046492 | Bacteria | 19806 |
| 487 | Ga0495585_0028214 | 3300046492 | Bacteria | 3202 |
| 488 | Ga0495596_0002121 | 3300046500 | Bacteria | 10856 |
| 489 | Ga0495596_0007856 | 3300046500 | Bacteria | 4780 |
| 490 | Ga0495607_0115014 | 3300046501 | Bacteria | 1421 |
| 491 | Ga0495583_0004366 | 3300046506 | Bacteria | 10181 |
| 492 | Ga0495606_0014221 | 3300046507 | Bacteria | 6227 |
| 493 | Ga0495606_0090702 | 3300046507 | Bacteria | 1880 |
| 494 | Ga0495606_0180150 | 3300046507 | Bacteria | 1219 |
| 495 | Ga0495608_0017253 | 3300046511 | Bacteria | 4996 |
| 496 | Ga0495610_0005616 | 3300046512 | Bacteria | 8854 |
| 497 | Ga0495616_0063544 | 3300046513 | Bacteria | 1804 |
| 498 | Ga0495618_0013317 | 3300046514 | Bacteria | 5005 |
| 499 | Ga0495620_0012967 | 3300046515 | Bacteria | 4283 |
| 500 | Ga0495620_0062069 | 3300046515 | Bacteria | 1553 |
| 501 | Ga0495628_0008078 | 3300046516 | Bacteria | 9052 |
| 502 | Ga0495628_0025243 | 3300046516 | Bacteria | 4855 |
| 503 | Ga0495630_0024065 | 3300046517 | Bacteria | 4503 |
| 504 | Ga0495631_0003492 | 3300046518 | Bacteria | 8591 |
| 505 | Ga0495632_0000615 | 3300046519 | Bacteria | 32915 |
| 506 | Ga0495643_0022266 | 3300046522 | Bacteria | 3618 |
| 507 | Ga0495648_0000650 | 3300046524 | Bacteria | 37082 |
| 508 | Ga0495648_0003114 | 3300046524 | Bacteria | 14787 |
| 509 | Ga0495648_0031744 | 3300046524 | Bacteria | 3475 |
| 510 | Ga0495648_0044815 | 3300046524 | Bacteria | 2757 |
| 511 | Ga0495648_0095850 | 3300046524 | Bacteria | 1650 |
| 512 | Ga0495666_0011584 | 3300046526 | Bacteria | 4395 |
| 513 | Ga0495652_0027497 | 3300046529 | Bacteria | 5009 |
| 514 | Ga0495654_0008860 | 3300046530 | Bacteria | 5532 |
| 515 | Ga0495665_0015494 | 3300046531 | Bacteria | 4105 |
| 516 | Ga0495665_0026698 | 3300046531 | Bacteria | 3101 |
| 517 | Ga0495640_0026245 | 3300046533 | Bacteria | 4212 |
| 518 | Ga0495586_0133825 | 3300046535 | Bacteria | 1389 |
| 519 | Ga0495587_0012329 | 3300046536 | Bacteria | 5385 |
| 520 | Ga0495587_0044837 | 3300046536 | Bacteria | 2630 |
| 521 | Ga0495609_0029155 | 3300046538 | Bacteria | 2514 |
| 522 | Ga0495597_0020551 | 3300046542 | Bacteria | 3074 |
| 523 | Ga0495667_0035781 | 3300046559 | Bacteria | 3317 |
| 524 | Ga0495668_0005238 | 3300046616 | Bacteria | 8884 |
| 525 | Ga0495668_0005998 | 3300046616 | Bacteria | 8065 |
| 526 | Ga0495668_0006677 | 3300046616 | Bacteria | 7512 |
| 527 | Ga0495668_0129691 | 3300046616 | Bacteria | 1380 |
| 528 | Ga0495634_0034802 | 3300046642 | Bacteria | 3453 |
| 529 | Ga0495611_0000338 | 3300046648 | Bacteria | 30531 |
| 530 | Ga0495611_0043288 | 3300046648 | Bacteria | 2013 |
| 531 | Ga0495625_0000398 | 3300046660 | Bacteria | 66474 |
| 532 | Ga0495625_0002639 | 3300046660 | Bacteria | 19152 |
| 533 | Ga0495625_0005332 | 3300046660 | Bacteria | 11778 |
| 534 | Ga0495625_0023964 | 3300046660 | Bacteria | 4654 |
| 535 | Ga0495625_0045187 | 3300046660 | Bacteria | 3185 |
| 536 | Ga0495625_0055265 | 3300046660 | Bacteria | 2831 |
| 537 | Ga0495635_0004307 | 3300046663 | Bacteria | 9857 |
| 538 | Ga0495661_0008892 | 3300046665 | Bacteria | 6917 |
| 539 | Ga0495661_0022964 | 3300046665 | Bacteria | 4054 |
| 540 | Ga0495661_0049329 | 3300046665 | Bacteria | 2553 |
| 541 | Ga0495657_0042048 | 3300046675 | Bacteria | 3123 |
| 542 | Ga0495599_0028843 | 3300046678 | Bacteria | 3478 |
| 543 | Ga0495646_0019414 | 3300046680 | Bacteria | 4304 |
| 544 | Ga0495669_0057008 | 3300046684 | Bacteria | 1762 |
| 545 | Ga0495613_0003319 | 3300046689 | Bacteria | 12051 |
| 546 | Ga0495624_0001210 | 3300046690 | Bacteria | 20399 |
| 547 | Ga0495624_0010782 | 3300046690 | Bacteria | 6299 |
| 548 | Ga0495649_0020224 | 3300046694 | Bacteria | 3734 |
| 549 | Ga0495589_0012592 | 3300046794 | Bacteria | 4375 |
| 550 | Ga0495600_0018671 | 3300046809 | Bacteria | 4421 |
| 551 | Ga0495660_0030605 | 3300046810 | Bacteria | 3031 |
| 552 | Ga0495604_0004068 | 3300047317 | Bacteria | 11623 |
| 553 | Ga0495604_0015789 | 3300047317 | Bacteria | 6027 |
| 554 | Ga0495636_0002305 | 3300047318 | Bacteria | 7330 |
| 555 | Ga0495636_0044306 | 3300047318 | Bacteria | 1852 |
| 556 | Ga0495636_0077057 | 3300047318 | Bacteria | 1431 |
| 557 | Ga0495674_0002116 | 3300047319 | Bacteria | 19499 |
| 558 | Ga0495674_0002272 | 3300047319 | Bacteria | 18868 |
| 559 | Ga0495672_0004957 | 3300047320 | Bacteria | 10693 |
| 560 | Ga0495676_0016536 | 3300047321 | Bacteria | 6543 |
| 561 | Ga0495676_0082230 | 3300047321 | Bacteria | 2438 |
| 562 | Ga0495680_0023678 | 3300047322 | Bacteria | 5102 |
| 563 | Ga0495680_0154093 | 3300047322 | Bacteria | 1673 |
| 564 | Ga0495683_0011094 | 3300047323 | Bacteria | 4749 |
| 565 | Ga0495687_001236 | 3300047443 | Bacteria | 24392 |
| 566 | Ga0495687_027256 | 3300047443 | Bacteria | 2676 |
| 567 | Ga0495687_050697 | 3300047443 | Bacteria | 1767 |
| 568 | Ga0495687_058816 | 3300047443 | Bacteria | 1593 |
| 569 | Ga0495675_0020835 | 3300047444 | Bacteria | 4172 |
| 570 | Ga0495679_000183 | 3300047446 | Bacteria | 56008 |
| 571 | Ga0495679_008362 | 3300047446 | Bacteria | 4213 |
| 572 | Ga0495673_0014057 | 3300047469 | Bacteria | 4176 |
| 573 | Ga0495681_0067650 | 3300047470 | Bacteria | 1627 |
| 574 | Ga0495593_0001368 | 3300047673 | Bacteria | 14246 |
| 575 | Ga0495593_0001757 | 3300047673 | Bacteria | 12828 |
| 576 | Ga0495602_0035786 | 3300048088 | Bacteria | 4626 |
| 577 | Ga0495614_0011632 | 3300048089 | Bacteria | 3869 |
| 578 | Ga0495626_0011713 | 3300048091 | Bacteria | 4626 |
| 579 | Ga0496101_0250648 | 3300048904 | Bacteria | 1379 |
| 580 | Ga0496103_0153161 | 3300048906 | Bacteria | 1477 |
| 581 | Ga0496104_0010697 | 3300048907 | Bacteria | 8204 |
| 582 | Ga0496105_0043074 | 3300048908 | Bacteria | 3723 |
| 583 | Ga0496106_0012180 | 3300048909 | Bacteria | 6347 |
| 584 | Ga0496107_0055487 | 3300048910 | Bacteria | 2862 |
| 585 | Ga0496112_0015518 | 3300048915 | Bacteria | 7114 |
| 586 | Ga0496116_0013736 | 3300048919 | Bacteria | 6510 |
| 587 | Ga0496117_0002431 | 3300048920 | Bacteria | 23546 |
| 588 | Ga0496117_0009276 | 3300048920 | Bacteria | 9193 |
| 589 | Ga0496117_0047085 | 3300048920 | Bacteria | 3096 |
| 590 | Ga0496117_0087514 | 3300048920 | Bacteria | 2019 |
| 591 | Ga0496118_0005091 | 3300048921 | Bacteria | 15118 |
| 592 | Ga0496119_0028863 | 3300048922 | Bacteria | 3775 |
| 593 | Ga0496121_0003338 | 3300048924 | Bacteria | 23036 |
| 594 | Ga0496121_0017890 | 3300048924 | Bacteria | 7192 |
| 595 | Ga0496123_0030984 | 3300048926 | Bacteria | 3902 |
| 596 | Ga0496124_0023755 | 3300048927 | Bacteria | 5588 |
| 597 | Ga0496125_0001021 | 3300048928 | Bacteria | 43477 |
| 598 | Ga0496125_0009713 | 3300048928 | Bacteria | 9824 |
| 599 | Ga0496125_0068580 | 3300048928 | Bacteria | 2789 |
| 600 | Ga0496126_0069428 | 3300048929 | Bacteria | 3143 |
| 601 | Ga0496126_0173482 | 3300048929 | Bacteria | 1835 |
| 602 | Ga0495682_0006252 | 3300049460 | Bacteria | 4839 |
| 603 | Ga0495682_0011202 | 3300049460 | Bacteria | 3455 |
| 604 | Ga0495682_0045654 | 3300049460 | Bacteria | 1600 |
| 605 | Ga0501297_009640 | 3300049520 | Bacteria | 1083 |
| 606 | Ga0501034_0287285 | 3300049571 | Bacteria | 1584 |
| 607 | Ga0501038_0014418 | 3300049574 | Bacteria | 7202 |
| 608 | Ga0501249_003383 | 3300049679 | Bacteria | 3199 |
| 609 | Ga0501249_024246 | 3300049679 | Bacteria | 1336 |
| 610 | Ga0501262_000019 | 3300049759 | Bacteria | 23083 |
| 611 | Ga0501266_000190 | 3300049763 | Bacteria | 7859 |
| 612 | Ga0501212_020169 | 3300049851 | Bacteria | 1026 |
| 613 | nmdc:mga03683_13362_c1 | 3300050489 | Bacteria | 3020 |
| 614 | nmdc:mga03n38_17482_c1 | 3300050490 | Bacteria | 2137 |
| 615 | nmdc:mga00v17_37146_c2 | 3300050491 | Bacteria | 2197 |
| 616 | nmdc:mga00v17_4_c1 | 3300050491 | Bacteria | 238758 |
| 617 | nmdc:mga0k408_115892_c1 | 3300050493 | Unclassified | 1585 |
| 618 | nmdc:mga0k408_19195_c1 | 3300050493 | Bacteria | 3818 |
| 619 | nmdc:mga0k408_3654_c1 | 3300050493 | Bacteria | 8141 |
| 620 | nmdc:mga0k408_39926_c2 | 3300050493 | Bacteria | 1246 |
| 621 | nmdc:mga0k408_41120_c1 | 3300050493 | Bacteria | 2661 |
| 622 | nmdc:mga0k408_9698_c1 | 3300050493 | Bacteria | 5199 |
| 623 | nmdc:mga06z11_18457_c1 | 3300050494 | Bacteria | 3186 |
| 624 | nmdc:mga06z11_22063_c1 | 3300050494 | Bacteria | 2967 |
| 625 | nmdc:mga07m45_4202_c1 | 3300050496 | Bacteria | 7040 |
| 626 | nmdc:mga05p37_250037_c1 | 3300050507 | Bacteria | 2127 |
| 627 | nmdc:mga08y16_308720_c1 | 3300050511 | Bacteria | 1629 |
| 628 | nmdc:mga0n895_359_c1 | 3300050512 | Bacteria | 30652 |
| 629 | nmdc:mga0rr50_15494_c1 | 3300050513 | Bacteria | 5034 |
| 630 | nmdc:mga0a205_5241_c1 | 3300050515 | Bacteria | 10392 |
| 631 | nmdc:mga0sz30_33157_c1 | 3300050516 | Bacteria | 2145 |
| 632 | nmdc:mga0sz30_718_c1 | 3300050516 | Bacteria | 12197 |
| 633 | Ga0500610_0000398 | 3300053079 | Bacteria | 13232 |
| 634 | Ga0500635_0027882 | 3300053080 | Bacteria | 1799 |
| 635 | Ga0500578_0000002 | 3300053086 | Bacteria | 293507 |
| 636 | Ga0500578_0059895 | 3300053086 | Bacteria | 2433 |
| 637 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 638 | Ga0500643_000023 | 3300053087 | Bacteria | 273090 |
| 639 | Ga0500643_000485 | 3300053087 | Bacteria | 28889 |
| 640 | Ga0500644_0000316 | 3300053088 | Bacteria | 25207 |
| 641 | Ga0500644_0001815 | 3300053088 | Bacteria | 5518 |
| 642 | Ga0500646_0005804 | 3300053090 | Bacteria | 3129 |
| 643 | Ga0500646_0012785 | 3300053090 | Bacteria | 2170 |
| 644 | Ga0500646_0017594 | 3300053090 | Bacteria | 1876 |
| 645 | Ga0500646_0031569 | 3300053090 | Bacteria | 1458 |
| 646 | Ga0500646_0032025 | 3300053090 | Bacteria | 1449 |
| 647 | Ga0500583_0000330 | 3300053092 | Bacteria | 15790 |
| 648 | Ga0500651_0011141 | 3300053093 | Bacteria | 5412 |
| 649 | Ga0500651_0036634 | 3300053093 | Bacteria | 3091 |
| 650 | Ga0500566_0024737 | 3300053094 | Bacteria | 3523 |
| 651 | Ga0500650_0068764 | 3300053098 | Bacteria | 1655 |
| 652 | Ga0500562_000050 | 3300053108 | Bacteria | 60058 |
| 653 | Ga0500594_0000743 | 3300053118 | Bacteria | 6936 |
| 654 | Ga0500595_000113 | 3300053119 | Bacteria | 53829 |
| 655 | Ga0500607_022569 | 3300053121 | Bacteria | 3537 |
| 656 | Ga0500642_0008557 | 3300053130 | Bacteria | 3511 |
| 657 | Ga0500652_002040 | 3300053131 | Bacteria | 6083 |
| 658 | Ga0500652_005790 | 3300053131 | Bacteria | 3926 |
| 659 | Ga0500655_011094 | 3300053133 | Bacteria | 1630 |
| 660 | Ga0500658_0000009 | 3300053134 | Bacteria | 270303 |
| 661 | Ga0500658_0001322 | 3300053134 | Bacteria | 10025 |
| 662 | Ga0500658_0009256 | 3300053134 | Bacteria | 3633 |
| 663 | Ga0500559_0000038 | 3300053136 | Bacteria | 109922 |
| 664 | Ga0500559_0016915 | 3300053136 | Bacteria | 3081 |
| 665 | Ga0500561_0000073 | 3300053137 | Bacteria | 19888 |
| 666 | Ga0500568_0000205 | 3300053139 | Bacteria | 51687 |
| 667 | Ga0500568_0010186 | 3300053139 | Bacteria | 4418 |
| 668 | Ga0500577_0010259 | 3300053142 | Bacteria | 2751 |
| 669 | Ga0500604_0000807 | 3300053151 | Bacteria | 8632 |
| 670 | Ga0500604_0008000 | 3300053151 | Bacteria | 2805 |
| 671 | Ga0500604_0021103 | 3300053151 | Bacteria | 1839 |
| 672 | Ga0500616_0002510 | 3300053153 | Bacteria | 15189 |
| 673 | Ga0500620_004905 | 3300053155 | Bacteria | 3041 |
| 674 | Ga0500622_0000227 | 3300053156 | Bacteria | 58653 |
| 675 | Ga0500622_0000290 | 3300053156 | Bacteria | 51286 |
| 676 | Ga0500622_0001746 | 3300053156 | Bacteria | 16757 |
| 677 | Ga0500622_0002334 | 3300053156 | Bacteria | 13843 |
| 678 | Ga0500622_0003764 | 3300053156 | Bacteria | 9907 |
| 679 | Ga0500622_0004702 | 3300053156 | Bacteria | 8445 |
| 680 | Ga0500622_0019763 | 3300053156 | Bacteria | 3576 |
| 681 | Ga0500627_0036272 | 3300053158 | Bacteria | 2098 |
| 682 | Ga0500633_0004460 | 3300053160 | Bacteria | 3213 |
| 683 | Ga0500636_0014267 | 3300053177 | Bacteria | 4672 |
| 684 | Ga0500636_0017930 | 3300053177 | Bacteria | 4185 |
| 685 | Ga0500636_0026685 | 3300053177 | Bacteria | 3411 |
| 686 | Ga0500636_0035954 | 3300053177 | Bacteria | 2931 |
| 687 | Ga0500645_001097 | 3300053730 | Bacteria | 14801 |
| 688 | Ga0500645_030402 | 3300053730 | Unclassified | 1625 |
| 689 | Ga0500587_003299 | 3300053739 | Bacteria | 2264 |
| 690 | Ga0500661_002854 | 3300055283 | Bacteria | 3257 |
| 691 | Ga0500661_003700 | 3300055283 | Unclassified | 2871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003354 | JGI25160J50197_1012841 | JGI25160J50197_10128412 | 317 |
| 2 | 3300003374 | JGI25161J50226_1002832 | JGI25161J50226_10028323 | 317 |
| 3 | 3300004625 | Ga0055543_1001188 | Ga0055543_10011886 | 317 |
| 4 | 3300025302 | Ga0207426_1000210 | Ga0207426_100021088 | 317 |
| 5 | 3300049851 | Ga0501212_020169 | Ga0501212_020169_13_966 | 317 |
| 6 | 3300050507 | nmdc:mga05p37_250037_c1 | nmdc:mga05p37_250037_c1_394_1395 | 318 |
| 7 | 3300005334 | Ga0068869_100454803 | Ga0068869_1004548031 | 319 |
| 8 | 3300005335 | Ga0070666_10193979 | Ga0070666_101939791 | 319 |
| 9 | 3300005364 | Ga0070673_100029907 | Ga0070673_1000299075 | 319 |
| 10 | 3300005543 | Ga0070672_100074753 | Ga0070672_1000747533 | 319 |
| 11 | 3300005841 | Ga0068863_100250274 | Ga0068863_1002502743 | 319 |
| 12 | 3300025940 | Ga0207691_10099715 | Ga0207691_100997153 | 319 |
| 13 | 3300025960 | Ga0207651_10009347 | Ga0207651_100093473 | 319 |
| 14 | 3300026088 | Ga0207641_10321578 | Ga0207641_103215782 | 319 |
| 15 | 3300053160 | Ga0500633_0004460 | Ga0500633_0004460_859_1860 | 321 |
| 16 | iso_pu_bacteria | 2906427513 | 2906434582 | 322 |
| 17 | iso_pu_bacteria | 2582581315 | 2585328027 | 323 |
| 18 | 3300025910 | Ga0207684_10071261 | Ga0207684_100712612 | 324 |
| 19 | 3300025919 | Ga0207657_10329041 | Ga0207657_103290411 | 324 |
| 20 | 3300028794 | Ga0307515_10213156 | Ga0307515_102131562 | 324 |
| 21 | 3300033180 | Ga0307510_10021309 | Ga0307510_100213094 | 324 |
| 22 | 3300046515 | Ga0495620_0062069 | Ga0495620_0062069_120_1121 | 324 |
| 23 | 3300049679 | Ga0501249_003383 | Ga0501249_003383_1290_2291 | 324 |
| 24 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_28299_29300 | 324 |
| 25 | 3300053088 | Ga0500644_0001815 | Ga0500644_0001815_3748_4749 | 324 |
| 26 | 3300053118 | Ga0500594_0000743 | Ga0500594_0000743_3960_4961 | 324 |
| 27 | 3300053136 | Ga0500559_0000038 | Ga0500559_0000038_101522_102523 | 324 |
| 28 | 3300053156 | Ga0500622_0004702 | Ga0500622_0004702_603_1604 | 324 |
| 29 | 3300053177 | Ga0500636_0017930 | Ga0500636_0017930_1728_2729 | 324 |
| 30 | 3300006353 | Ga0075370_10058171 | Ga0075370_100581713 | 325 |
| 31 | 3300013297 | Ga0157378_10000319 | Ga0157378_1000031949 | 325 |
| 32 | 3300030733 | Ga0314311_1034637 | Ga0314311_103463711 | 325 |
| 33 | 3300031911 | Ga0307412_10012181 | Ga0307412_100121815 | 325 |
| 34 | iso_pu_bacteria | 2885198086 | 2885204640 | 325 |
| 35 | iso_pu_bacteria | 2885211737 | 2885218293 | 325 |
| 36 | 3300005339 | Ga0070660_100188043 | Ga0070660_1001880431 | 326 |
| 37 | 3300005457 | Ga0070662_100000167 | Ga0070662_10000016721 | 326 |
| 38 | 3300005563 | Ga0068855_100275068 | Ga0068855_1002750682 | 326 |
| 39 | 3300005616 | Ga0068852_100052049 | Ga0068852_1000520492 | 326 |
| 40 | 3300009174 | Ga0105241_10012545 | Ga0105241_100125455 | 326 |
| 41 | 3300011119 | Ga0105246_10062221 | Ga0105246_100622213 | 326 |
| 42 | 3300013100 | Ga0157373_10057525 | Ga0157373_100575253 | 326 |
| 43 | 3300013296 | Ga0157374_10004368 | Ga0157374_100043685 | 326 |
| 44 | 3300025904 | Ga0207647_10000209 | Ga0207647_1000020947 | 326 |
| 45 | 3300025919 | Ga0207657_10185208 | Ga0207657_101852082 | 326 |
| 46 | 3300025933 | Ga0207706_10000257 | Ga0207706_1000025719 | 326 |
| 47 | 3300026035 | Ga0207703_10161961 | Ga0207703_101619612 | 326 |
| 48 | 3300026142 | Ga0207698_10266661 | Ga0207698_102666611 | 326 |
| 49 | iso_pu_bacteria | 8003314358 | 8003322940 | 327 |
| 50 | iso_pu_bacteria | 2818991450 | 2819621343 | 328 |
| 51 | 3300031901 | Ga0307406_10018310 | Ga0307406_100183103 | 329 |
| 52 | 3300031911 | Ga0307412_10130063 | Ga0307412_101300632 | 329 |
| 53 | 3300032005 | Ga0307411_10121251 | Ga0307411_101212512 | 329 |
| 54 | 3300032126 | Ga0307415_100002524 | Ga0307415_1000025247 | 329 |
| 55 | iso_pu_bacteria | 2508501050 | 2508731839 | 329 |
| 56 | iso_pu_bacteria | 2508501127 | 2509142552 | 329 |
| 57 | iso_pu_bacteria | 2510065019 | 2510136659 | 329 |
| 58 | iso_pu_bacteria | 2510917020 | 2511121787 | 329 |
| 59 | iso_pu_bacteria | 2510917022 | 2511134170 | 329 |
| 60 | iso_pu_bacteria | 2510917026 | 2511173894 | 329 |
| 61 | iso_pu_bacteria | 2510917030 | 2511198709 | 329 |
| 62 | iso_pu_bacteria | 2511231003 | 2511251464 | 329 |
| 63 | iso_pu_bacteria | 2512047030 | 2512346687 | 329 |
| 64 | iso_pu_bacteria | 2512875024 | 2512960015 | 329 |
| 65 | iso_pu_bacteria | 2513237084 | 2513569462 | 329 |
| 66 | iso_pu_bacteria | 2513237103 | 2513709928 | 329 |
| 67 | iso_pu_bacteria | 2513237138 | 2513866128 | 329 |
| 68 | iso_pu_bacteria | 2513237144 | 2513910854 | 329 |
| 69 | iso_pu_bacteria | 2513237159 | 2513996851 | 329 |
| 70 | iso_pu_bacteria | 2513237164 | 2514035964 | 329 |
| 71 | iso_pu_bacteria | 2516653077 | 2517041786 | 329 |
| 72 | iso_pu_bacteria | 2517093000 | 2517099227 | 329 |
| 73 | iso_pu_bacteria | 2524023250 | 2524613303 | 329 |
| 74 | iso_pu_bacteria | 2582581306 | 2585266601 | 329 |
| 75 | iso_pu_bacteria | 2582581307 | 2585273573 | 329 |
| 76 | iso_pu_bacteria | 2582581308 | 2585279601 | 329 |
| 77 | iso_pu_bacteria | 2582581316 | 2585334022 | 329 |
| 78 | iso_pu_bacteria | 2582581865 | 2585387616 | 329 |
| 79 | iso_pu_bacteria | 2582581866 | 2585393210 | 329 |
| 80 | iso_pu_bacteria | 2582581867 | 2585404758 | 329 |
| 81 | iso_pu_bacteria | 2585427526 | 2585524308 | 329 |
| 82 | iso_pu_bacteria | 2585427527 | 2585535680 | 329 |
| 83 | iso_pu_bacteria | 2585427530 | 2585551058 | 329 |
| 84 | iso_pu_bacteria | 2585427531 | 2585559746 | 329 |
| 85 | iso_pu_bacteria | 2585427590 | 2585823383 | 329 |
| 86 | iso_pu_bacteria | 2585427608 | 2585900434 | 329 |
| 87 | iso_pu_bacteria | 2585427609 | 2585906074 | 329 |
| 88 | iso_pu_bacteria | 2585428106 | 2587918729 | 329 |
| 89 | iso_pu_bacteria | 2585428125 | 2587978811 | 329 |
| 90 | iso_pu_bacteria | 2599185214 | 2599627698 | 329 |
| 91 | iso_pu_bacteria | 2599185226 | 2599677267 | 329 |
| 92 | iso_pu_bacteria | 2599185227 | 2599684712 | 329 |
| 93 | iso_pu_bacteria | 2599185229 | 2599696621 | 329 |
| 94 | iso_pu_bacteria | 2615840626 | 2616306388 | 329 |
| 95 | iso_pu_bacteria | 2617270742 | 2617382355 | 329 |
| 96 | iso_pu_bacteria | 2643221573 | 2643878321 | 329 |
| 97 | iso_pu_bacteria | 2643221592 | 2643969450 | 329 |
| 98 | iso_pu_bacteria | 2643221596 | 2643990690 | 329 |
| 99 | iso_pu_bacteria | 2643221609 | 2644060416 | 329 |
| 100 | iso_pu_bacteria | 2643221611 | 2644076155 | 329 |
| 101 | iso_pu_bacteria | 2643221625 | 2644143750 | 329 |
| 102 | iso_pu_bacteria | 2643221626 | 2644146178 | 329 |
| 103 | iso_pu_bacteria | 2643221640 | 2644225376 | 329 |
| 104 | iso_pu_bacteria | 2643221642 | 2644232684 | 329 |
| 105 | iso_pu_bacteria | 2643221648 | 2644276544 | 329 |
| 106 | iso_pu_bacteria | 2643221653 | 2644297026 | 329 |
| 107 | iso_pu_bacteria | 2643221659 | 2644332806 | 329 |
| 108 | iso_pu_bacteria | 2643221698 | 2644540286 | 329 |
| 109 | iso_pu_bacteria | 2643221715 | 2644639887 | 329 |
| 110 | iso_pu_bacteria | 2643221719 | 2644655279 | 329 |
| 111 | iso_pu_bacteria | 2643221720 | 2644659626 | 329 |
| 112 | iso_pu_bacteria | 2657244999 | 2657682111 | 329 |
| 113 | iso_pu_bacteria | 2667528174 | 2671115997 | 329 |
| 114 | iso_pu_bacteria | 2687453392 | 2688598029 | 329 |
| 115 | iso_pu_bacteria | 2690316117 | 2692319489 | 329 |
| 116 | iso_pu_bacteria | 2738541277 | 2738717890 | 329 |
| 117 | iso_pu_bacteria | 2738541283 | 2738755163 | 329 |
| 118 | iso_pu_bacteria | 2738541296 | 2738820538 | 329 |
| 119 | iso_pu_bacteria | 2738541298 | 2738833018 | 329 |
| 120 | iso_pu_bacteria | 2738541306 | 2738874545 | 329 |
| 121 | iso_pu_bacteria | 2738543002 | 2739186175 | 329 |
| 122 | iso_pu_bacteria | 2738543004 | 2739197190 | 329 |
| 123 | iso_pu_bacteria | 2738543008 | 2739221143 | 329 |
| 124 | iso_pu_bacteria | 2738543019 | 2739278576 | 329 |
| 125 | iso_pu_bacteria | 2738543028 | 2739332561 | 329 |
| 126 | iso_pu_bacteria | 2751185821 | 2753458321 | 329 |
| 127 | iso_pu_bacteria | 2751185897 | 2753763065 | 329 |
| 128 | iso_pu_bacteria | 2756170246 | 2756672088 | 329 |
| 129 | iso_pu_bacteria | 2765235802 | 2765465370 | 329 |
| 130 | iso_pu_bacteria | 2767802442 | 2770199203 | 329 |
| 131 | iso_pu_bacteria | 2775507266 | 2778179248 | 329 |
| 132 | iso_pu_bacteria | 2791355091 | 2792623284 | 329 |
| 133 | iso_pu_bacteria | 2791355263 | 2793344857 | 329 |
| 134 | iso_pu_bacteria | 2802429268 | 2804751129 | 329 |
| 135 | iso_pu_bacteria | 2802429633 | 2806045705 | 329 |
| 136 | iso_pu_bacteria | 2802429634 | 2806053275 | 329 |
| 137 | iso_pu_bacteria | 2802429635 | 2806062316 | 329 |
| 138 | iso_pu_bacteria | 2802429636 | 2806066356 | 329 |
| 139 | iso_pu_bacteria | 2802429637 | 2806073064 | 329 |
| 140 | iso_pu_bacteria | 2808606386 | 2808983711 | 329 |
| 141 | iso_pu_bacteria | 2808606415 | 2809129375 | 329 |
| 142 | iso_pu_bacteria | 2808606419 | 2809149570 | 329 |
| 143 | iso_pu_bacteria | 2818991435 | 2819539496 | 329 |
| 144 | iso_pu_bacteria | 2818991442 | 2819578065 | 329 |
| 145 | iso_pu_bacteria | 2818991453 | 2819638456 | 329 |
| 146 | iso_pu_bacteria | 2818991454 | 2819649278 | 329 |
| 147 | iso_pu_bacteria | 2838022645 | 2838026732 | 329 |
| 148 | iso_pu_bacteria | 2838029111 | 2838034151 | 329 |
| 149 | iso_pu_bacteria | 2838042994 | 2838045796 | 329 |
| 150 | iso_pu_bacteria | 2838680041 | 2838686216 | 329 |
| 151 | iso_pu_bacteria | 2838707686 | 2838713979 | 329 |
| 152 | iso_pu_bacteria | 2839993093 | 2839994979 | 329 |
| 153 | iso_pu_bacteria | 2840764183 | 2840769872 | 329 |
| 154 | iso_pu_bacteria | 2842077413 | 2842083377 | 329 |
| 155 | iso_pu_bacteria | 2842110456 | 2842115652 | 329 |
| 156 | iso_pu_bacteria | 2842118031 | 2842124324 | 329 |
| 157 | iso_pu_bacteria | 2842198810 | 2842202335 | 329 |
| 158 | iso_pu_bacteria | 2842217011 | 2842222107 | 329 |
| 159 | iso_pu_bacteria | 2842237096 | 2842243340 | 329 |
| 160 | iso_pu_bacteria | 2842291075 | 2842297522 | 329 |
| 161 | iso_pu_bacteria | 2842304105 | 2842308770 | 329 |
| 162 | iso_pu_bacteria | 2842370503 | 2842376607 | 329 |
| 163 | iso_pu_bacteria | 2842377471 | 2842383860 | 329 |
| 164 | iso_pu_bacteria | 2842384541 | 2842390947 | 329 |
| 165 | iso_pu_bacteria | 2842475841 | 2842480881 | 329 |
| 166 | iso_pu_bacteria | 2842502639 | 2842507508 | 329 |
| 167 | iso_pu_bacteria | 2842521101 | 2842522912 | 329 |
| 168 | iso_pu_bacteria | 2842718218 | 2842719704 | 329 |
| 169 | iso_pu_bacteria | 2844002411 | 2844007963 | 329 |
| 170 | iso_pu_bacteria | 2844009547 | 2844013253 | 329 |
| 171 | iso_pu_bacteria | 2844163670 | 2844167216 | 329 |
| 172 | iso_pu_bacteria | 2847417321 | 2847422009 | 329 |
| 173 | iso_pu_bacteria | 2851182111 | 2851186247 | 329 |
| 174 | iso_pu_bacteria | 2852618963 | 2852619722 | 329 |
| 175 | iso_pu_bacteria | 2856320880 | 2856326992 | 329 |
| 176 | iso_pu_bacteria | 2856334872 | 2856338128 | 329 |
| 177 | iso_pu_bacteria | 2856342000 | 2856344295 | 329 |
| 178 | iso_pu_bacteria | 2856349417 | 2856355949 | 329 |
| 179 | iso_pu_bacteria | 2856356410 | 2856363680 | 329 |
| 180 | iso_pu_bacteria | 2869169390 | 2869173354 | 329 |
| 181 | iso_pu_bacteria | 2869234852 | 2869239267 | 329 |
| 182 | iso_pu_bacteria | 2869242130 | 2869248345 | 329 |
| 183 | iso_pu_bacteria | 2869249662 | 2869256412 | 329 |
| 184 | iso_pu_bacteria | 2869256925 | 2869260758 | 329 |
| 185 | iso_pu_bacteria | 2869278585 | 2869283462 | 329 |
| 186 | iso_pu_bacteria | 2871435913 | 2871435994 | 329 |
| 187 | iso_pu_bacteria | 2871474448 | 2871476746 | 329 |
| 188 | iso_pu_bacteria | 2871481445 | 2871486757 | 329 |
| 189 | iso_pu_bacteria | 2871488783 | 2871492563 | 329 |
| 190 | iso_pu_bacteria | 2874131515 | 2874132663 | 329 |
| 191 | iso_pu_bacteria | 2874168670 | 2874169324 | 329 |
| 192 | iso_pu_bacteria | 2876386047 | 2876387505 | 329 |
| 193 | iso_pu_bacteria | 2876808645 | 2876815588 | 329 |
| 194 | iso_pu_bacteria | 2878730984 | 2878737842 | 329 |
| 195 | iso_pu_bacteria | 2878753008 | 2878758445 | 329 |
| 196 | iso_pu_bacteria | 2878788777 | 2878793235 | 329 |
| 197 | iso_pu_bacteria | 2879110137 | 2879116504 | 329 |
| 198 | iso_pu_bacteria | 2881155292 | 2881157992 | 329 |
| 199 | iso_pu_bacteria | 2881853255 | 2881859459 | 329 |
| 200 | iso_pu_bacteria | 2881861095 | 2881867363 | 329 |
| 201 | iso_pu_bacteria | 2882912400 | 2882913395 | 329 |
| 202 | iso_pu_bacteria | 2885318864 | 2885319924 | 329 |
| 203 | iso_pu_bacteria | 2885342637 | 2885348075 | 329 |
| 204 | iso_pu_bacteria | 2885350715 | 2885352933 | 329 |
| 205 | iso_pu_bacteria | 2886848708 | 2886849591 | 329 |
| 206 | iso_pu_bacteria | 2899845264 | 2899847450 | 329 |
| 207 | iso_pu_bacteria | 2903492973 | 2903496706 | 329 |
| 208 | iso_pu_bacteria | 2903513507 | 2903519944 | 329 |
| 209 | iso_pu_bacteria | 2904578770 | 2904581536 | 329 |
| 210 | iso_pu_bacteria | 2906363423 | 2906364103 | 329 |
| 211 | iso_pu_bacteria | 2906370794 | 2906375285 | 329 |
| 212 | iso_pu_bacteria | 2906393657 | 2906395027 | 329 |
| 213 | iso_pu_bacteria | 2906401398 | 2906405799 | 329 |
| 214 | iso_pu_bacteria | 2916028427 | 2916028659 | 329 |
| 215 | iso_pu_bacteria | 2916055098 | 2916056049 | 329 |
| 216 | iso_pu_bacteria | 2919100787 | 2919108204 | 329 |
| 217 | iso_pu_bacteria | 2919119836 | 2919122771 | 329 |
| 218 | iso_pu_bacteria | 2919130084 | 2919131303 | 329 |
| 219 | iso_pu_bacteria | 2921263974 | 2921264283 | 329 |
| 220 | iso_pu_bacteria | 2922151315 | 2922157868 | 329 |
| 221 | iso_pu_bacteria | 2923556063 | 2923562402 | 329 |
| 222 | iso_pu_bacteria | 2924172951 | 2924179476 | 329 |
| 223 | iso_pu_bacteria | 2924710171 | 2924716234 | 329 |
| 224 | iso_pu_bacteria | 2924733363 | 2924734938 | 329 |
| 225 | iso_pu_bacteria | 2924741084 | 2924741721 | 329 |
| 226 | iso_pu_bacteria | 2924784321 | 2924785027 | 329 |
| 227 | iso_pu_bacteria | 2928070936 | 2928078252 | 329 |
| 228 | iso_pu_bacteria | 2928503688 | 2928503850 | 329 |
| 229 | iso_pu_bacteria | 2928521798 | 2928525977 | 329 |
| 230 | iso_pu_bacteria | 2929177148 | 2929182041 | 329 |
| 231 | iso_pu_bacteria | 2929195423 | 2929196548 | 329 |
| 232 | iso_pu_bacteria | 2929921140 | 2929925906 | 329 |
| 233 | iso_pu_bacteria | 2932794094 | 2932795332 | 329 |
| 234 | iso_pu_bacteria | 2932801729 | 2932805862 | 329 |
| 235 | iso_pu_bacteria | 2933570622 | 2933575100 | 329 |
| 236 | iso_pu_bacteria | 2933586486 | 2933591619 | 329 |
| 237 | iso_pu_bacteria | 2935703347 | 2935708191 | 329 |
| 238 | iso_pu_bacteria | 2935883170 | 2935883775 | 329 |
| 239 | iso_pu_bacteria | 2935894831 | 2935900965 | 329 |
| 240 | iso_pu_bacteria | 2936002035 | 2936009427 | 329 |
| 241 | iso_pu_bacteria | 2936367885 | 2936370328 | 329 |
| 242 | iso_pu_bacteria | 2937016420 | 2937017998 | 329 |
| 243 | iso_pu_bacteria | 2937042894 | 2937047645 | 329 |
| 244 | iso_pu_bacteria | 2937071275 | 2937075848 | 329 |
| 245 | iso_pu_bacteria | 2937126314 | 2937126589 | 329 |
| 246 | iso_pu_bacteria | 2937861824 | 2937868949 | 329 |
| 247 | iso_pu_bacteria | 2937972304 | 2937979822 | 329 |
| 248 | iso_pu_bacteria | 2937980651 | 2937986880 | 329 |
| 249 | iso_pu_bacteria | 2945909444 | 2945912742 | 329 |
| 250 | iso_pu_bacteria | 2945934425 | 2945938681 | 329 |
| 251 | iso_pu_bacteria | 2945945610 | 2945947552 | 329 |
| 252 | iso_pu_bacteria | 2945977869 | 2945977982 | 329 |
| 253 | iso_pu_bacteria | 2945984333 | 2945984997 | 329 |
| 254 | iso_pu_bacteria | 2946013367 | 2946016165 | 329 |
| 255 | iso_pu_bacteria | 2954011201 | 2954011932 | 329 |
| 256 | iso_pu_bacteria | 2957478035 | 2957478262 | 329 |
| 257 | iso_pu_bacteria | 2958034702 | 2958039975 | 329 |
| 258 | iso_pu_bacteria | 2958041894 | 2958054319 | 329 |
| 259 | iso_pu_bacteria | 2958071322 | 2958071643 | 329 |
| 260 | iso_pu_bacteria | 2958092219 | 2958097982 | 329 |
| 261 | iso_pu_bacteria | 2958108152 | 2958111878 | 329 |
| 262 | iso_pu_bacteria | 2958122699 | 2958124145 | 329 |
| 263 | iso_pu_bacteria | 2961127735 | 2961133700 | 329 |
| 264 | iso_pu_bacteria | 2961170736 | 2961173362 | 329 |
| 265 | iso_pu_bacteria | 2961183825 | 2961184961 | 329 |
| 266 | iso_pu_bacteria | 2964705432 | 2964706873 | 329 |
| 267 | iso_pu_bacteria | 2965032056 | 2965036081 | 329 |
| 268 | iso_pu_bacteria | 2967742019 | 2967744211 | 329 |
| 269 | iso_pu_bacteria | 2967775926 | 2967780354 | 329 |
| 270 | iso_pu_bacteria | 2967996073 | 2967998532 | 329 |
| 271 | iso_pu_bacteria | 2968003550 | 2968006042 | 329 |
| 272 | iso_pu_bacteria | 2968138860 | 2968138867 | 329 |
| 273 | iso_pu_bacteria | 2970177841 | 2970178935 | 329 |
| 274 | iso_pu_bacteria | 2970503327 | 2970505955 | 329 |
| 275 | iso_pu_bacteria | 2970510686 | 2970515782 | 329 |
| 276 | iso_pu_bacteria | 2970524798 | 2970528194 | 329 |
| 277 | iso_pu_bacteria | 2970532167 | 2970535461 | 329 |
| 278 | iso_pu_bacteria | 2970593180 | 2970598112 | 329 |
| 279 | iso_pu_bacteria | 2970619444 | 2970619541 | 329 |
| 280 | iso_pu_bacteria | 2970627176 | 2970628152 | 329 |
| 281 | iso_pu_bacteria | 2977821940 | 2977826978 | 329 |
| 282 | iso_pu_bacteria | 2977828996 | 2977833747 | 329 |
| 283 | iso_pu_bacteria | 2977851361 | 2977854821 | 329 |
| 284 | iso_pu_bacteria | 2977872689 | 2977874883 | 329 |
| 285 | iso_pu_bacteria | 2977898635 | 2977905780 | 329 |
| 286 | iso_pu_bacteria | 2977915119 | 2977916529 | 329 |
| 287 | iso_pu_bacteria | 2977950692 | 2977957116 | 329 |
| 288 | iso_pu_bacteria | 2977957713 | 2977958069 | 329 |
| 289 | iso_pu_bacteria | 2979764755 | 2979768284 | 329 |
| 290 | iso_pu_bacteria | 2979793036 | 2979795753 | 329 |
| 291 | iso_pu_bacteria | 2979808191 | 2979810676 | 329 |
| 292 | iso_pu_bacteria | 2987673487 | 2987678707 | 329 |
| 293 | iso_pu_bacteria | 2990703756 | 2990708680 | 329 |
| 294 | iso_pu_bacteria | 2996310559 | 2996315093 | 329 |
| 295 | iso_pu_bacteria | 2996386984 | 2996388910 | 329 |
| 296 | iso_pu_bacteria | 3002141150 | 3002143022 | 329 |
| 297 | iso_pu_bacteria | 3004167301 | 3004168305 | 329 |
| 298 | iso_pu_bacteria | 3004195979 | 3004197796 | 329 |
| 299 | iso_pu_bacteria | 3004232784 | 3004233354 | 329 |
| 300 | iso_pu_bacteria | 3004239961 | 3004242157 | 329 |
| 301 | iso_pu_bacteria | 3004248173 | 3004250122 | 329 |
| 302 | iso_pu_bacteria | 3004268573 | 3004272950 | 329 |
| 303 | iso_pu_bacteria | 3004289098 | 3004293549 | 329 |
| 304 | iso_pu_bacteria | 3004334049 | 3004335091 | 329 |
| 305 | iso_pu_bacteria | 3005416602 | 3005416857 | 329 |
| 306 | iso_pu_bacteria | 3005506211 | 3005512795 | 329 |
| 307 | iso_pu_bacteria | 3005718088 | 3005719876 | 329 |
| 308 | iso_pu_bacteria | 639633055 | 639651857 | 329 |
| 309 | iso_pu_bacteria | 641736151 | 642426414 | 329 |
| 310 | iso_pu_bacteria | 642555113 | 642621616 | 329 |
| 311 | iso_pu_bacteria | 649633066 | 649872561 | 329 |
| 312 | iso_pu_bacteria | 8004361976 | 8004364851 | 329 |
| 313 | iso_pu_bacteria | 8004374579 | 8004379961 | 329 |
| 314 | iso_pu_bacteria | 8004633249 | 8004639763 | 329 |
| 315 | iso_pu_bacteria | 8004727605 | 8004732505 | 329 |
| 316 | iso_pu_bacteria | 8005314921 | 8005315939 | 329 |
| 317 | iso_pu_bacteria | 8005376324 | 8005382004 | 329 |
| 318 | iso_pu_bacteria | 8005556819 | 8005562240 | 329 |
| 319 | iso_pu_bacteria | 8005563573 | 8005566995 | 329 |
| 320 | iso_pu_bacteria | 8005570704 | 8005576633 | 329 |
| 321 | iso_pu_bacteria | 8018163183 | 8018166039 | 329 |
| 322 | iso_pu_bacteria | 8023680758 | 8023688199 | 329 |
| 323 | iso_pu_bacteria | 8024479707 | 8024483855 | 329 |
| 324 | iso_pu_bacteria | 8054285046 | 8054291378 | 329 |
| 325 | iso_pu_bacteria | 8055266321 | 8055269823 | 329 |
| 326 | iso_pu_bacteria | 8055617313 | 8055620325 | 329 |
| 327 | iso_pu_bacteria | 8057874678 | 8057878552 | 329 |
| 328 | 3300031456 | Ga0307513_10223624 | Ga0307513_102236242 | 330 |
| 329 | 3300053134 | Ga0500658_0001322 | Ga0500658_0001322_2552_3607 | 330 |
| 330 | iso_pu_bacteria | 2515154189 | 2516021016 | 330 |
| 331 | iso_pu_bacteria | 2643221622 | 2644128837 | 330 |
| 332 | iso_pu_bacteria | 2937848649 | 2937854009 | 330 |
| 333 | iso_pu_bacteria | 2977922695 | 2977928617 | 330 |
| 334 | iso_pu_bacteria | 3004211236 | 3004212015 | 330 |
| 335 | iso_pu_bacteria | 3004218560 | 3004224680 | 330 |
| 336 | 3300001991 | JGI24743J22301_10006797 | JGI24743J22301_100067971 | 331 |
| 337 | 3300005338 | Ga0068868_100087708 | Ga0068868_1000877083 | 331 |
| 338 | 3300005355 | Ga0070671_100122939 | Ga0070671_1001229392 | 331 |
| 339 | 3300005355 | Ga0070671_100153126 | Ga0070671_1001531262 | 331 |
| 340 | 3300005356 | Ga0070674_100249814 | Ga0070674_1002498141 | 331 |
| 341 | 3300005364 | Ga0070673_100048494 | Ga0070673_1000484943 | 331 |
| 342 | 3300005441 | Ga0070700_100076132 | Ga0070700_1000761321 | 331 |
| 343 | 3300005459 | Ga0068867_100126997 | Ga0068867_1001269972 | 331 |
| 344 | 3300005834 | Ga0068851_10105116 | Ga0068851_101051162 | 331 |
| 345 | 3300005844 | Ga0068862_100020999 | Ga0068862_1000209991 | 331 |
| 346 | 3300009148 | Ga0105243_10218194 | Ga0105243_102181942 | 331 |
| 347 | 3300010375 | Ga0105239_10062150 | Ga0105239_100621504 | 331 |
| 348 | 3300014326 | Ga0157380_10057383 | Ga0157380_100573832 | 331 |
| 349 | 3300025903 | Ga0207680_10090403 | Ga0207680_100904032 | 331 |
| 350 | 3300025907 | Ga0207645_10042759 | Ga0207645_100427592 | 331 |
| 351 | 3300025923 | Ga0207681_10115444 | Ga0207681_101154442 | 331 |
| 352 | 3300025931 | Ga0207644_10168459 | Ga0207644_101684592 | 331 |
| 353 | 3300025933 | Ga0207706_10019903 | Ga0207706_100199032 | 331 |
| 354 | 3300025960 | Ga0207651_10014951 | Ga0207651_100149514 | 331 |
| 355 | 3300026075 | Ga0207708_10015977 | Ga0207708_100159776 | 331 |
| 356 | 3300026089 | Ga0207648_10012463 | Ga0207648_100124633 | 331 |
| 357 | 3300026118 | Ga0207675_100215474 | Ga0207675_1002154741 | 331 |
| 358 | 3300031731 | Ga0307405_10082389 | Ga0307405_100823892 | 331 |
| 359 | 3300031901 | Ga0307406_10192149 | Ga0307406_101921492 | 331 |
| 360 | 3300031995 | Ga0307409_100046305 | Ga0307409_1000463053 | 331 |
| 361 | 3300031995 | Ga0307409_100434140 | Ga0307409_1004341401 | 331 |
| 362 | 3300032002 | Ga0307416_100007386 | Ga0307416_1000073864 | 331 |
| 363 | 3300032126 | Ga0307415_100060274 | Ga0307415_1000602742 | 331 |
| 364 | 3300039450 | Ga0436363_1258129 | Ga0436363_1258129_1238_2290 | 331 |
| 365 | 3300042008 | Ga0439450_033524 | Ga0439450_033524_124_1119 | 331 |
| 366 | iso_pu_bacteria | 8057575449 | 8057582319 | 331 |
| 367 | 3300001989 | JGI24739J22299_10008123 | JGI24739J22299_100081233 | 332 |
| 368 | 3300001990 | JGI24737J22298_10004822 | JGI24737J22298_100048224 | 332 |
| 369 | 3300002075 | JGI24738J21930_10010554 | JGI24738J21930_100105541 | 332 |
| 370 | 3300005467 | Ga0070706_100003698 | Ga0070706_10000369810 | 332 |
| 371 | 3300005468 | Ga0070707_100005425 | Ga0070707_10000542512 | 332 |
| 372 | 3300005518 | Ga0070699_100007692 | Ga0070699_1000076922 | 332 |
| 373 | 3300005536 | Ga0070697_100006095 | Ga0070697_10000609510 | 332 |
| 374 | 3300005842 | Ga0068858_100113852 | Ga0068858_1001138522 | 332 |
| 375 | 3300006028 | Ga0070717_10006422 | Ga0070717_100064222 | 332 |
| 376 | 3300006881 | Ga0068865_100180466 | Ga0068865_1001804662 | 332 |
| 377 | 3300009011 | Ga0105251_10000837 | Ga0105251_100008379 | 332 |
| 378 | 3300013105 | Ga0157369_10103270 | Ga0157369_101032703 | 332 |
| 379 | 3300014968 | Ga0157379_10022204 | Ga0157379_100222042 | 332 |
| 380 | 3300015262 | Ga0182007_10005878 | Ga0182007_100058784 | 332 |
| 381 | 3300025735 | Ga0207713_1000336 | Ga0207713_100033648 | 332 |
| 382 | 3300025899 | Ga0207642_10072020 | Ga0207642_100720202 | 332 |
| 383 | 3300025910 | Ga0207684_10009256 | Ga0207684_100092568 | 332 |
| 384 | 3300025922 | Ga0207646_10003418 | Ga0207646_100034183 | 332 |
| 385 | 3300025931 | Ga0207644_10042344 | Ga0207644_100423442 | 332 |
| 386 | 3300030731 | Ga0316177_1054620 | Ga0316177_10546201 | 332 |
| 387 | 3300031456 | Ga0307513_10031414 | Ga0307513_100314145 | 332 |
| 388 | 3300048919 | Ga0496116_0013736 | Ga0496116_0013736_2850_3848 | 332 |
| 389 | 3300048920 | Ga0496117_0087514 | Ga0496117_0087514_325_1323 | 332 |
| 390 | 3300048928 | Ga0496125_0001021 | Ga0496125_0001021_16819_17817 | 332 |
| 391 | iso_pu_bacteria | 2585428057 | 2587728480 | 332 |
| 392 | 3300001979 | JGI24740J21852_10001788 | JGI24740J21852_100017886 | 333 |
| 393 | 3300001989 | JGI24739J22299_10023597 | JGI24739J22299_100235972 | 333 |
| 394 | 3300001990 | JGI24737J22298_10003380 | JGI24737J22298_100033803 | 333 |
| 395 | 3300002075 | JGI24738J21930_10001816 | JGI24738J21930_100018162 | 333 |
| 396 | 3300002705 | JGI25156J39149_1000873 | JGI25156J39149_10008732 | 333 |
| 397 | 3300002705 | JGI25156J39149_1001284 | JGI25156J39149_10012842 | 333 |
| 398 | 3300002737 | JGI25162J39368_1000642 | JGI25162J39368_100064212 | 333 |
| 399 | 3300002738 | JGI25154J39366_1000069 | JGI25154J39366_100006918 | 333 |
| 400 | 3300002738 | JGI25154J39366_1001801 | JGI25154J39366_10018013 | 333 |
| 401 | 3300002741 | JGI25157J39369_1000851 | JGI25157J39369_10008512 | 333 |
| 402 | 3300003187 | JGI25151J46595_10001575 | JGI25151J46595_100015753 | 333 |
| 403 | 3300003214 | JGI25165J46597_1000999 | JGI25165J46597_10009998 | 333 |
| 404 | 3300003214 | JGI25165J46597_1001072 | JGI25165J46597_100107211 | 333 |
| 405 | 3300003214 | JGI25165J46597_1002307 | JGI25165J46597_10023078 | 333 |
| 406 | 3300003215 | JGI25153J46596_10001714 | JGI25153J46596_100017147 | 333 |
| 407 | 3300003322 | rootL2_10004516 | rootL2_100045163 | 333 |
| 408 | 3300003322 | rootL2_10363542 | rootL2_103635423 | 333 |
| 409 | 3300003752 | Ga0055539_1000513 | Ga0055539_10005132 | 333 |
| 410 | 3300003775 | Ga0055524_1012206 | Ga0055524_10122062 | 333 |
| 411 | 3300003794 | Ga0055531_10000965 | Ga0055531_1000096510 | 333 |
| 412 | 3300003856 | Ga0058692_1000035 | Ga0058692_100003561 | 333 |
| 413 | 3300005262 | Ga0065165_1000241 | Ga0065165_100024169 | 333 |
| 414 | 3300005262 | Ga0065165_1002670 | Ga0065165_10026701 | 333 |
| 415 | 3300005293 | Ga0065715_10089106 | Ga0065715_100891068 | 333 |
| 416 | 3300005327 | Ga0070658_10005121 | Ga0070658_100051214 | 333 |
| 417 | 3300005327 | Ga0070658_10041562 | Ga0070658_100415622 | 333 |
| 418 | 3300005331 | Ga0070670_100043399 | Ga0070670_1000433993 | 333 |
| 419 | 3300005334 | Ga0068869_100051298 | Ga0068869_1000512984 | 333 |
| 420 | 3300005334 | Ga0068869_100072738 | Ga0068869_1000727382 | 333 |
| 421 | 3300005335 | Ga0070666_10025670 | Ga0070666_100256704 | 333 |
| 422 | 3300005339 | Ga0070660_100133936 | Ga0070660_1001339362 | 333 |
| 423 | 3300005339 | Ga0070660_100252382 | Ga0070660_1002523821 | 333 |
| 424 | 3300005347 | Ga0070668_100053824 | Ga0070668_1000538242 | 333 |
| 425 | 3300005347 | Ga0070668_100203068 | Ga0070668_1002030681 | 333 |
| 426 | 3300005353 | Ga0070669_100204096 | Ga0070669_1002040962 | 333 |
| 427 | 3300005354 | Ga0070675_100276405 | Ga0070675_1002764052 | 333 |
| 428 | 3300005354 | Ga0070675_100388678 | Ga0070675_1003886782 | 333 |
| 429 | 3300005356 | Ga0070674_100033790 | Ga0070674_1000337902 | 333 |
| 430 | 3300005366 | Ga0070659_100001718 | Ga0070659_10000171810 | 333 |
| 431 | 3300005366 | Ga0070659_100028187 | Ga0070659_1000281873 | 333 |
| 432 | 3300005366 | Ga0070659_100162400 | Ga0070659_1001624001 | 333 |
| 433 | 3300005367 | Ga0070667_100057349 | Ga0070667_1000573495 | 333 |
| 434 | 3300005367 | Ga0070667_100290157 | Ga0070667_1002901572 | 333 |
| 435 | 3300005440 | Ga0070705_100075763 | Ga0070705_1000757632 | 333 |
| 436 | 3300005445 | Ga0070708_100118089 | Ga0070708_1001180892 | 333 |
| 437 | 3300005445 | Ga0070708_100205401 | Ga0070708_1002054012 | 333 |
| 438 | 3300005457 | Ga0070662_100079420 | Ga0070662_1000794202 | 333 |
| 439 | 3300005457 | Ga0070662_100220601 | Ga0070662_1002206011 | 333 |
| 440 | 3300005459 | Ga0068867_100134289 | Ga0068867_1001342891 | 333 |
| 441 | 3300005467 | Ga0070706_100193872 | Ga0070706_1001938721 | 333 |
| 442 | 3300005468 | Ga0070707_100108298 | Ga0070707_1001082983 | 333 |
| 443 | 3300005471 | Ga0070698_100054281 | Ga0070698_1000542812 | 333 |
| 444 | 3300005471 | Ga0070698_100147290 | Ga0070698_1001472902 | 333 |
| 445 | 3300005471 | Ga0070698_100487148 | Ga0070698_1004871481 | 333 |
| 446 | 3300005518 | Ga0070699_100227605 | Ga0070699_1002276051 | 333 |
| 447 | 3300005530 | Ga0070679_100221311 | Ga0070679_1002213112 | 333 |
| 448 | 3300005535 | Ga0070684_100051678 | Ga0070684_1000516783 | 333 |
| 449 | 3300005536 | Ga0070697_100296960 | Ga0070697_1002969602 | 333 |
| 450 | 3300005539 | Ga0068853_100018261 | Ga0068853_1000182612 | 333 |
| 451 | 3300005539 | Ga0068853_100156821 | Ga0068853_1001568212 | 333 |
| 452 | 3300005543 | Ga0070672_100001960 | Ga0070672_10000196012 | 333 |
| 453 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006427 | 333 |
| 454 | 3300005548 | Ga0070665_100007151 | Ga0070665_1000071514 | 333 |
| 455 | 3300005548 | Ga0070665_100016065 | Ga0070665_1000160655 | 333 |
| 456 | 3300005548 | Ga0070665_100303727 | Ga0070665_1003037272 | 333 |
| 457 | 3300005549 | Ga0070704_100024496 | Ga0070704_1000244962 | 333 |
| 458 | 3300005549 | Ga0070704_100181522 | Ga0070704_1001815222 | 333 |
| 459 | 3300005549 | Ga0070704_100425153 | Ga0070704_1004251531 | 333 |
| 460 | 3300005563 | Ga0068855_100007578 | Ga0068855_1000075786 | 333 |
| 461 | 3300005563 | Ga0068855_100064015 | Ga0068855_1000640153 | 333 |
| 462 | 3300005563 | Ga0068855_100343998 | Ga0068855_1003439982 | 333 |
| 463 | 3300005577 | Ga0068857_100000489 | Ga0068857_10000048925 | 333 |
| 464 | 3300005577 | Ga0068857_100117345 | Ga0068857_1001173452 | 333 |
| 465 | 3300005577 | Ga0068857_100220463 | Ga0068857_1002204632 | 333 |
| 466 | 3300005578 | Ga0068854_100008799 | Ga0068854_1000087991 | 333 |
| 467 | 3300005578 | Ga0068854_100071479 | Ga0068854_1000714792 | 333 |
| 468 | 3300005614 | Ga0068856_100000991 | Ga0068856_1000009912 | 333 |
| 469 | 3300005614 | Ga0068856_100041460 | Ga0068856_1000414606 | 333 |
| 470 | 3300005614 | Ga0068856_100209029 | Ga0068856_1002090292 | 333 |
| 471 | 3300005616 | Ga0068852_100117952 | Ga0068852_1001179524 | 333 |
| 472 | 3300005616 | Ga0068852_100122678 | Ga0068852_1001226781 | 333 |
| 473 | 3300005617 | Ga0068859_100000151 | Ga0068859_10000015134 | 333 |
| 474 | 3300005617 | Ga0068859_100007089 | Ga0068859_10000708914 | 333 |
| 475 | 3300005719 | Ga0068861_100001690 | Ga0068861_1000016907 | 333 |
| 476 | 3300005834 | Ga0068851_10010112 | Ga0068851_100101122 | 333 |
| 477 | 3300005834 | Ga0068851_10018502 | Ga0068851_100185023 | 333 |
| 478 | 3300005841 | Ga0068863_100026949 | Ga0068863_1000269492 | 333 |
| 479 | 3300005841 | Ga0068863_100054170 | Ga0068863_1000541705 | 333 |
| 480 | 3300005841 | Ga0068863_100117728 | Ga0068863_1001177282 | 333 |
| 481 | 3300005841 | Ga0068863_100456958 | Ga0068863_1004569582 | 333 |
| 482 | 3300005842 | Ga0068858_100000273 | Ga0068858_10000027334 | 333 |
| 483 | 3300005842 | Ga0068858_100006378 | Ga0068858_1000063782 | 333 |
| 484 | 3300005842 | Ga0068858_100008996 | Ga0068858_1000089962 | 333 |
| 485 | 3300005842 | Ga0068858_100365369 | Ga0068858_1003653692 | 333 |
| 486 | 3300005843 | Ga0068860_100046091 | Ga0068860_1000460912 | 333 |
| 487 | 3300005843 | Ga0068860_100341009 | Ga0068860_1003410092 | 333 |
| 488 | 3300005844 | Ga0068862_100024533 | Ga0068862_1000245334 | 333 |
| 489 | 3300005844 | Ga0068862_100234316 | Ga0068862_1002343162 | 333 |
| 490 | 3300005844 | Ga0068862_100284396 | Ga0068862_1002843962 | 333 |
| 491 | 3300006028 | Ga0070717_10101276 | Ga0070717_101012762 | 333 |
| 492 | 3300006038 | Ga0075365_10002167 | Ga0075365_100021671 | 333 |
| 493 | 3300006038 | Ga0075365_10144624 | Ga0075365_101446242 | 333 |
| 494 | 3300006042 | Ga0075368_10007659 | Ga0075368_100076592 | 333 |
| 495 | 3300006042 | Ga0075368_10019634 | Ga0075368_100196341 | 333 |
| 496 | 3300006051 | Ga0075364_10106867 | Ga0075364_101068671 | 333 |
| 497 | 3300006058 | Ga0075432_10013171 | Ga0075432_100131712 | 333 |
| 498 | 3300006163 | Ga0070715_10063920 | Ga0070715_100639202 | 333 |
| 499 | 3300006177 | Ga0075362_10000508 | Ga0075362_1000050811 | 333 |
| 500 | 3300006178 | Ga0075367_10036200 | Ga0075367_100362003 | 333 |
| 501 | 3300006178 | Ga0075367_10176970 | Ga0075367_101769701 | 333 |
| 502 | 3300006186 | Ga0075369_10005799 | Ga0075369_100057992 | 333 |
| 503 | 3300006186 | Ga0075369_10023666 | Ga0075369_100236661 | 333 |
| 504 | 3300006195 | Ga0075366_10001556 | Ga0075366_100015567 | 333 |
| 505 | 3300006195 | Ga0075366_10015983 | Ga0075366_100159833 | 333 |
| 506 | 3300006195 | Ga0075366_10034597 | Ga0075366_100345972 | 333 |
| 507 | 3300006195 | Ga0075366_10121530 | Ga0075366_101215301 | 333 |
| 508 | 3300006353 | Ga0075370_10008118 | Ga0075370_100081184 | 333 |
| 509 | 3300006353 | Ga0075370_10052305 | Ga0075370_100523052 | 333 |
| 510 | 3300006844 | Ga0075428_100026574 | Ga0075428_1000265743 | 333 |
| 511 | 3300006844 | Ga0075428_100100604 | Ga0075428_1001006043 | 333 |
| 512 | 3300006846 | Ga0075430_100010209 | Ga0075430_1000102092 | 333 |
| 513 | 3300006846 | Ga0075430_100037469 | Ga0075430_1000374696 | 333 |
| 514 | 3300006846 | Ga0075430_100129903 | Ga0075430_1001299033 | 333 |
| 515 | 3300006847 | Ga0075431_100113557 | Ga0075431_1001135573 | 333 |
| 516 | 3300006871 | Ga0075434_100017992 | Ga0075434_1000179924 | 333 |
| 517 | 3300006880 | Ga0075429_100006117 | Ga0075429_1000061178 | 333 |
| 518 | 3300006880 | Ga0075429_100049552 | Ga0075429_1000495524 | 333 |
| 519 | 3300006914 | Ga0075436_100087478 | Ga0075436_1000874782 | 333 |
| 520 | 3300006931 | Ga0097620_100000151 | Ga0097620_10000015134 | 333 |
| 521 | 3300006931 | Ga0097620_100007089 | Ga0097620_1000070895 | 333 |
| 522 | 3300007076 | Ga0075435_100041263 | Ga0075435_1000412635 | 333 |
| 523 | 3300009036 | Ga0105244_10003082 | Ga0105244_100030826 | 333 |
| 524 | 3300009036 | Ga0105244_10030578 | Ga0105244_100305783 | 333 |
| 525 | 3300009093 | Ga0105240_10000142 | Ga0105240_10000142100 | 333 |
| 526 | 3300009093 | Ga0105240_10068267 | Ga0105240_100682674 | 333 |
| 527 | 3300009093 | Ga0105240_10085783 | Ga0105240_100857834 | 333 |
| 528 | 3300009093 | Ga0105240_10095230 | Ga0105240_100952305 | 333 |
| 529 | 3300009093 | Ga0105240_10108637 | Ga0105240_101086375 | 333 |
| 530 | 3300009093 | Ga0105240_10472789 | Ga0105240_104727892 | 333 |
| 531 | 3300009094 | Ga0111539_10348399 | Ga0111539_103483992 | 333 |
| 532 | 3300009098 | Ga0105245_10102479 | Ga0105245_101024792 | 333 |
| 533 | 3300009101 | Ga0105247_10014016 | Ga0105247_100140165 | 333 |
| 534 | 3300009101 | Ga0105247_10035380 | Ga0105247_100353804 | 333 |
| 535 | 3300009147 | Ga0114129_10561688 | Ga0114129_105616882 | 333 |
| 536 | 3300009148 | Ga0105243_10005104 | Ga0105243_1000510412 | 333 |
| 537 | 3300009174 | Ga0105241_10027870 | Ga0105241_100278702 | 333 |
| 538 | 3300009174 | Ga0105241_10064139 | Ga0105241_100641393 | 333 |
| 539 | 3300009177 | Ga0105248_10000764 | Ga0105248_1000076426 | 333 |
| 540 | 3300009177 | Ga0105248_10132844 | Ga0105248_101328442 | 333 |
| 541 | 3300009177 | Ga0105248_10139030 | Ga0105248_101390303 | 333 |
| 542 | 3300009177 | Ga0105248_10301610 | Ga0105248_103016102 | 333 |
| 543 | 3300009545 | Ga0105237_10053876 | Ga0105237_100538763 | 333 |
| 544 | 3300009545 | Ga0105237_10131081 | Ga0105237_101310812 | 333 |
| 545 | 3300009545 | Ga0105237_10358871 | Ga0105237_103588712 | 333 |
| 546 | 3300009551 | Ga0105238_10038755 | Ga0105238_100387552 | 333 |
| 547 | 3300009551 | Ga0105238_10113596 | Ga0105238_101135962 | 333 |
| 548 | 3300009551 | Ga0105238_10222572 | Ga0105238_102225722 | 333 |
| 549 | 3300009553 | Ga0105249_10019476 | Ga0105249_100194763 | 333 |
| 550 | 3300009766 | Ga0123342_1017216 | Ga0123342_10172162 | 333 |
| 551 | 3300010375 | Ga0105239_10009037 | Ga0105239_100090378 | 333 |
| 552 | 3300010375 | Ga0105239_10033221 | Ga0105239_100332213 | 333 |
| 553 | 3300010375 | Ga0105239_10044778 | Ga0105239_100447784 | 333 |
| 554 | 3300010375 | Ga0105239_10064171 | Ga0105239_100641716 | 333 |
| 555 | 3300010375 | Ga0105239_10072703 | Ga0105239_100727031 | 333 |
| 556 | 3300010375 | Ga0105239_10081086 | Ga0105239_100810862 | 333 |
| 557 | 3300010375 | Ga0105239_10722216 | Ga0105239_107222162 | 333 |
| 558 | 3300011119 | Ga0105246_10051609 | Ga0105246_100516092 | 333 |
| 559 | 3300011119 | Ga0105246_10148420 | Ga0105246_101484202 | 333 |
| 560 | 3300013100 | Ga0157373_10048454 | Ga0157373_100484544 | 333 |
| 561 | 3300013100 | Ga0157373_10056285 | Ga0157373_100562853 | 333 |
| 562 | 3300013104 | Ga0157370_10001666 | Ga0157370_1000166621 | 333 |
| 563 | 3300013104 | Ga0157370_10018690 | Ga0157370_100186907 | 333 |
| 564 | 3300013104 | Ga0157370_10122823 | Ga0157370_101228232 | 333 |
| 565 | 3300013105 | Ga0157369_10027598 | Ga0157369_100275986 | 333 |
| 566 | 3300013105 | Ga0157369_10031335 | Ga0157369_100313355 | 333 |
| 567 | 3300013105 | Ga0157369_10098085 | Ga0157369_100980853 | 333 |
| 568 | 3300013296 | Ga0157374_10007769 | Ga0157374_100077692 | 333 |
| 569 | 3300013296 | Ga0157374_10065564 | Ga0157374_100655642 | 333 |
| 570 | 3300013296 | Ga0157374_10179313 | Ga0157374_101793132 | 333 |
| 571 | 3300013296 | Ga0157374_10204448 | Ga0157374_102044482 | 333 |
| 572 | 3300013306 | Ga0163162_10137842 | Ga0163162_101378423 | 333 |
| 573 | 3300013307 | Ga0157372_10018994 | Ga0157372_100189944 | 333 |
| 574 | 3300013307 | Ga0157372_10043036 | Ga0157372_100430369 | 333 |
| 575 | 3300013308 | Ga0157375_10003013 | Ga0157375_100030134 | 333 |
| 576 | 3300014325 | Ga0163163_10034598 | Ga0163163_100345985 | 333 |
| 577 | 3300014497 | Ga0182008_10025740 | Ga0182008_100257403 | 333 |
| 578 | 3300014497 | Ga0182008_10039458 | Ga0182008_100394581 | 333 |
| 579 | 3300014497 | Ga0182008_10046900 | Ga0182008_100469003 | 333 |
| 580 | 3300014968 | Ga0157379_10008013 | Ga0157379_100080133 | 333 |
| 581 | 3300014969 | Ga0157376_10407585 | Ga0157376_104075852 | 333 |
| 582 | 3300015261 | Ga0182006_1013342 | Ga0182006_10133422 | 333 |
| 583 | 3300015261 | Ga0182006_1013820 | Ga0182006_10138204 | 333 |
| 584 | 3300015261 | Ga0182006_1027109 | Ga0182006_10271092 | 333 |
| 585 | 3300015261 | Ga0182006_1042021 | Ga0182006_10420211 | 333 |
| 586 | 3300015262 | Ga0182007_10000445 | Ga0182007_1000044518 | 333 |
| 587 | 3300015262 | Ga0182007_10010414 | Ga0182007_100104143 | 333 |
| 588 | 3300017792 | Ga0163161_10123495 | Ga0163161_101234952 | 333 |
| 589 | 3300017792 | Ga0163161_10220475 | Ga0163161_102204752 | 333 |
| 590 | 3300017792 | Ga0163161_10247922 | Ga0163161_102479221 | 333 |
| 591 | 3300025233 | Ga0209437_100179 | Ga0209437_10017940 | 333 |
| 592 | 3300025233 | Ga0209437_102131 | Ga0209437_1021313 | 333 |
| 593 | 3300025245 | Ga0207425_1003095 | Ga0207425_10030951 | 333 |
| 594 | 3300025246 | Ga0209646_1000299 | Ga0209646_10002993 | 333 |
| 595 | 3300025250 | Ga0209026_1000382 | Ga0209026_10003823 | 333 |
| 596 | 3300025253 | Ga0209677_100222 | Ga0209677_1002223 | 333 |
| 597 | 3300025253 | Ga0209677_101959 | Ga0209677_1019594 | 333 |
| 598 | 3300025256 | Ga0209759_1000085 | Ga0209759_100008575 | 333 |
| 599 | 3300025256 | Ga0209759_1000529 | Ga0209759_10005293 | 333 |
| 600 | 3300025258 | Ga0209129_1000566 | Ga0209129_100056616 | 333 |
| 601 | 3300025261 | Ga0209233_1000185 | Ga0209233_100018539 | 333 |
| 602 | 3300025261 | Ga0209233_1000263 | Ga0209233_100026351 | 333 |
| 603 | 3300025272 | Ga0209455_1005371 | Ga0209455_10053715 | 333 |
| 604 | 3300025294 | Ga0209025_1000082 | Ga0209025_1000082141 | 333 |
| 605 | 3300025297 | Ga0209758_1000319 | Ga0209758_100031938 | 333 |
| 606 | 3300025297 | Ga0209758_1003930 | Ga0209758_100393011 | 333 |
| 607 | 3300025297 | Ga0209758_1049084 | Ga0209758_10490841 | 333 |
| 608 | 3300025298 | Ga0209050_1000221 | Ga0209050_100022150 | 333 |
| 609 | 3300025299 | Ga0209256_1000794 | Ga0209256_10007948 | 333 |
| 610 | 3300025304 | Ga0209257_1000538 | Ga0209257_100053856 | 333 |
| 611 | 3300025321 | Ga0207656_10057803 | Ga0207656_100578032 | 333 |
| 612 | 3300025728 | Ga0207655_1004047 | Ga0207655_100404716 | 333 |
| 613 | 3300025885 | Ga0207653_10045597 | Ga0207653_100455972 | 333 |
| 614 | 3300025900 | Ga0207710_10004946 | Ga0207710_100049464 | 333 |
| 615 | 3300025904 | Ga0207647_10000515 | Ga0207647_100005156 | 333 |
| 616 | 3300025904 | Ga0207647_10101113 | Ga0207647_101011132 | 333 |
| 617 | 3300025909 | Ga0207705_10000607 | Ga0207705_100006078 | 333 |
| 618 | 3300025910 | Ga0207684_10081248 | Ga0207684_100812484 | 333 |
| 619 | 3300025910 | Ga0207684_10235168 | Ga0207684_102351681 | 333 |
| 620 | 3300025911 | Ga0207654_10042723 | Ga0207654_100427232 | 333 |
| 621 | 3300025913 | Ga0207695_10000234 | Ga0207695_10000234101 | 333 |
| 622 | 3300025913 | Ga0207695_10076941 | Ga0207695_100769413 | 333 |
| 623 | 3300025913 | Ga0207695_10251458 | Ga0207695_102514582 | 333 |
| 624 | 3300025913 | Ga0207695_10305432 | Ga0207695_103054322 | 333 |
| 625 | 3300025914 | Ga0207671_10000234 | Ga0207671_1000023436 | 333 |
| 626 | 3300025914 | Ga0207671_10059513 | Ga0207671_100595133 | 333 |
| 627 | 3300025919 | Ga0207657_10002587 | Ga0207657_100025876 | 333 |
| 628 | 3300025919 | Ga0207657_10074458 | Ga0207657_100744583 | 333 |
| 629 | 3300025919 | Ga0207657_10342764 | Ga0207657_103427641 | 333 |
| 630 | 3300025921 | Ga0207652_10087941 | Ga0207652_100879412 | 333 |
| 631 | 3300025924 | Ga0207694_10013955 | Ga0207694_100139553 | 333 |
| 632 | 3300025924 | Ga0207694_10083669 | Ga0207694_100836692 | 333 |
| 633 | 3300025925 | Ga0207650_10038633 | Ga0207650_100386332 | 333 |
| 634 | 3300025926 | Ga0207659_10351313 | Ga0207659_103513132 | 333 |
| 635 | 3300025927 | Ga0207687_10042786 | Ga0207687_100427863 | 333 |
| 636 | 3300025931 | Ga0207644_10140771 | Ga0207644_101407712 | 333 |
| 637 | 3300025932 | Ga0207690_10004275 | Ga0207690_1000427511 | 333 |
| 638 | 3300025932 | Ga0207690_10013606 | Ga0207690_100136063 | 333 |
| 639 | 3300025933 | Ga0207706_10098669 | Ga0207706_100986692 | 333 |
| 640 | 3300025933 | Ga0207706_10115917 | Ga0207706_101159173 | 333 |
| 641 | 3300025934 | Ga0207686_10176222 | Ga0207686_101762222 | 333 |
| 642 | 3300025937 | Ga0207669_10022696 | Ga0207669_100226962 | 333 |
| 643 | 3300025940 | Ga0207691_10101366 | Ga0207691_101013662 | 333 |
| 644 | 3300025941 | Ga0207711_10005529 | Ga0207711_100055293 | 333 |
| 645 | 3300025942 | Ga0207689_10050301 | Ga0207689_100503014 | 333 |
| 646 | 3300025942 | Ga0207689_10061444 | Ga0207689_100614443 | 333 |
| 647 | 3300025949 | Ga0207667_10003616 | Ga0207667_1000361619 | 333 |
| 648 | 3300025949 | Ga0207667_10011742 | Ga0207667_100117426 | 333 |
| 649 | 3300025949 | Ga0207667_10070109 | Ga0207667_100701092 | 333 |
| 650 | 3300025949 | Ga0207667_10267979 | Ga0207667_102679791 | 333 |
| 651 | 3300025961 | Ga0207712_10101881 | Ga0207712_101018813 | 333 |
| 652 | 3300025972 | Ga0207668_10045810 | Ga0207668_100458102 | 333 |
| 653 | 3300025972 | Ga0207668_10132961 | Ga0207668_101329612 | 333 |
| 654 | 3300025986 | Ga0207658_10095119 | Ga0207658_100951191 | 333 |
| 655 | 3300026023 | Ga0207677_10132242 | Ga0207677_101322422 | 333 |
| 656 | 3300026023 | Ga0207677_10165885 | Ga0207677_101658851 | 333 |
| 657 | 3300026035 | Ga0207703_10000403 | Ga0207703_1000040316 | 333 |
| 658 | 3300026035 | Ga0207703_10005587 | Ga0207703_1000558712 | 333 |
| 659 | 3300026035 | Ga0207703_10006415 | Ga0207703_100064157 | 333 |
| 660 | 3300026035 | Ga0207703_10177879 | Ga0207703_101778792 | 333 |
| 661 | 3300026035 | Ga0207703_10421249 | Ga0207703_104212492 | 333 |
| 662 | 3300026041 | Ga0207639_10034832 | Ga0207639_100348323 | 333 |
| 663 | 3300026041 | Ga0207639_10165050 | Ga0207639_101650502 | 333 |
| 664 | 3300026067 | Ga0207678_10046737 | Ga0207678_100467373 | 333 |
| 665 | 3300026067 | Ga0207678_10157794 | Ga0207678_101577942 | 333 |
| 666 | 3300026078 | Ga0207702_10000308 | Ga0207702_1000030826 | 333 |
| 667 | 3300026078 | Ga0207702_10096893 | Ga0207702_100968932 | 333 |
| 668 | 3300026088 | Ga0207641_10315288 | Ga0207641_103152882 | 333 |
| 669 | 3300026095 | Ga0207676_10490367 | Ga0207676_104903671 | 333 |
| 670 | 3300026116 | Ga0207674_10006843 | Ga0207674_1000684313 | 333 |
| 671 | 3300026116 | Ga0207674_10012468 | Ga0207674_100124687 | 333 |
| 672 | 3300026116 | Ga0207674_10161660 | Ga0207674_101616601 | 333 |
| 673 | 3300026116 | Ga0207674_10179049 | Ga0207674_101790492 | 333 |
| 674 | 3300026118 | Ga0207675_100000049 | Ga0207675_10000004988 | 333 |
| 675 | 3300026142 | Ga0207698_10063959 | Ga0207698_100639593 | 333 |
| 676 | 3300026142 | Ga0207698_10134992 | Ga0207698_101349922 | 333 |
| 677 | 3300026142 | Ga0207698_10580566 | Ga0207698_105805661 | 333 |
| 678 | 3300027312 | Ga0209371_1000043 | Ga0209371_100004374 | 333 |
| 679 | 3300027312 | Ga0209371_1000693 | Ga0209371_100069318 | 333 |
| 680 | 3300027907 | Ga0207428_10203424 | Ga0207428_102034241 | 333 |
| 681 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010507 | 333 |
| 682 | 3300028379 | Ga0268266_10022317 | Ga0268266_100223173 | 333 |
| 683 | 3300028379 | Ga0268266_10044623 | Ga0268266_100446232 | 333 |
| 684 | 3300028380 | Ga0268265_10000554 | Ga0268265_1000055424 | 333 |
| 685 | 3300028380 | Ga0268265_10120267 | Ga0268265_101202672 | 333 |
| 686 | 3300028380 | Ga0268265_10276271 | Ga0268265_102762712 | 333 |
| 687 | 3300028381 | Ga0268264_10034265 | Ga0268264_100342656 | 333 |
| 688 | 3300028381 | Ga0268264_10127727 | Ga0268264_101277272 | 333 |
| 689 | 3300028786 | Ga0307517_10006006 | Ga0307517_1000600621 | 333 |
| 690 | 3300028786 | Ga0307517_10195873 | Ga0307517_101958731 | 333 |
| 691 | 3300028794 | Ga0307515_10023583 | Ga0307515_100235834 | 333 |
| 692 | 3300028794 | Ga0307515_10104763 | Ga0307515_101047634 | 333 |
| 693 | 3300028794 | Ga0307515_10320094 | Ga0307515_103200941 | 333 |
| 694 | 3300030500 | Ga0268256_1000044 | Ga0268256_100004474 | 333 |
| 695 | 3300030500 | Ga0268256_1003158 | Ga0268256_10031584 | 333 |
| 696 | 3300030521 | Ga0307511_10005062 | Ga0307511_100050624 | 333 |
| 697 | 3300030731 | Ga0316177_1027618 | Ga0316177_10276183 | 333 |
| 698 | 3300030745 | Ga0316182_1382167 | Ga0316182_13821672 | 333 |
| 699 | 3300031250 | Ga0265331_10006389 | Ga0265331_100063899 | 333 |
| 700 | 3300031251 | Ga0265327_10000776 | Ga0265327_100007769 | 333 |
| 701 | 3300031507 | Ga0307509_10251876 | Ga0307509_102518762 | 333 |
| 702 | 3300031548 | Ga0307408_100045052 | Ga0307408_1000450522 | 333 |
| 703 | 3300031616 | Ga0307508_10000011 | Ga0307508_10000011181 | 333 |
| 704 | 3300031616 | Ga0307508_10166018 | Ga0307508_101660182 | 333 |
| 705 | 3300031616 | Ga0307508_10197080 | Ga0307508_101970802 | 333 |
| 706 | 3300031730 | Ga0307516_10029463 | Ga0307516_100294635 | 333 |
| 707 | 3300031731 | Ga0307405_10074830 | Ga0307405_100748301 | 333 |
| 708 | 3300031731 | Ga0307405_10112653 | Ga0307405_101126531 | 333 |
| 709 | 3300031824 | Ga0307413_10015987 | Ga0307413_100159872 | 333 |
| 710 | 3300031824 | Ga0307413_10040896 | Ga0307413_100408962 | 333 |
| 711 | 3300031824 | Ga0307413_10083185 | Ga0307413_100831852 | 333 |
| 712 | 3300031824 | Ga0307413_10201367 | Ga0307413_102013672 | 333 |
| 713 | 3300031852 | Ga0307410_10059987 | Ga0307410_100599871 | 333 |
| 714 | 3300031852 | Ga0307410_10203726 | Ga0307410_102037261 | 333 |
| 715 | 3300031901 | Ga0307406_10000348 | Ga0307406_1000034820 | 333 |
| 716 | 3300031901 | Ga0307406_10105655 | Ga0307406_101056552 | 333 |
| 717 | 3300031903 | Ga0307407_10018450 | Ga0307407_100184504 | 333 |
| 718 | 3300031911 | Ga0307412_10000002 | Ga0307412_10000002244 | 333 |
| 719 | 3300031911 | Ga0307412_10064347 | Ga0307412_100643472 | 333 |
| 720 | 3300032002 | Ga0307416_100044158 | Ga0307416_1000441584 | 333 |
| 721 | 3300032002 | Ga0307416_100087157 | Ga0307416_1000871571 | 333 |
| 722 | 3300032004 | Ga0307414_10000449 | Ga0307414_1000044910 | 333 |
| 723 | 3300032004 | Ga0307414_10006402 | Ga0307414_100064021 | 333 |
| 724 | 3300032004 | Ga0307414_10030580 | Ga0307414_100305802 | 333 |
| 725 | 3300032004 | Ga0307414_10047460 | Ga0307414_100474603 | 333 |
| 726 | 3300032004 | Ga0307414_10079892 | Ga0307414_100798922 | 333 |
| 727 | 3300032004 | Ga0307414_10114750 | Ga0307414_101147502 | 333 |
| 728 | 3300032004 | Ga0307414_10456842 | Ga0307414_104568421 | 333 |
| 729 | 3300032005 | Ga0307411_10018881 | Ga0307411_100188812 | 333 |
| 730 | 3300032005 | Ga0307411_10033515 | Ga0307411_100335154 | 333 |
| 731 | 3300032005 | Ga0307411_10076867 | Ga0307411_100768672 | 333 |
| 732 | 3300032005 | Ga0307411_10095807 | Ga0307411_100958072 | 333 |
| 733 | 3300032005 | Ga0307411_10150027 | Ga0307411_101500272 | 333 |
| 734 | 3300032126 | Ga0307415_100175145 | Ga0307415_1001751452 | 333 |
| 735 | 3300033180 | Ga0307510_10000038 | Ga0307510_1000003815 | 333 |
| 736 | 3300033180 | Ga0307510_10001244 | Ga0307510_1000124419 | 333 |
| 737 | 3300036401 | Ga0373937_0171774 | Ga0373937_0171774_954_1955 | 333 |
| 738 | 3300037418 | Ga0395900_0067817 | Ga0395900_0067817_166_1209 | 333 |
| 739 | 3300037471 | Ga0395905_0001404 | Ga0395905_0001404_26168_27169 | 333 |
| 740 | 3300037471 | Ga0395905_0142624 | Ga0395905_0142624_128_1129 | 333 |
| 741 | 3300037471 | Ga0395905_0200010 | Ga0395905_0200010_679_1722 | 333 |
| 742 | 3300037471 | Ga0395905_0350576 | Ga0395905_0350576_79_1080 | 333 |
| 743 | 3300038443 | Ga0395901_0497604 | Ga0395901_0497604_20_1021 | 333 |
| 744 | 3300041405 | Ga0439438_000156 | Ga0439438_000156_2810_3811 | 333 |
| 745 | 3300041407 | Ga0439447_000119 | Ga0439447_000119_5123_6124 | 333 |
| 746 | 3300041407 | Ga0439447_000835 | Ga0439447_000835_4927_5928 | 333 |
| 747 | 3300041407 | Ga0439447_003351 | Ga0439447_003351_4124_5125 | 333 |
| 748 | 3300041411 | Ga0439466_0004964 | Ga0439466_0004964_3515_4516 | 333 |
| 749 | 3300041413 | Ga0439465_0004512 | Ga0439465_0004512_185_1204 | 333 |
| 750 | 3300041452 | Ga0451793_0479790 | Ga0451793_0479790_2213_3214 | 333 |
| 751 | 3300041456 | Ga0451795_0032520 | Ga0451795_0032520_1112_2113 | 333 |
| 752 | 3300041458 | Ga0451798_0892919 | Ga0451798_0892919_430_1431 | 333 |
| 753 | 3300041459 | Ga0451800_0392314 | Ga0451800_0392314_4699_5700 | 333 |
| 754 | 3300041512 | Ga0451853_1117171 | Ga0451853_1117171_17_1018 | 333 |
| 755 | 3300041997 | Ga0439431_0042390 | Ga0439431_0042390_111_1130 | 333 |
| 756 | 3300042006 | Ga0439432_015862 | Ga0439432_015862_1299_2315 | 333 |
| 757 | 3300042014 | Ga0439457_000344 | Ga0439457_000344_3586_4587 | 333 |
| 758 | 3300042014 | Ga0439457_020551 | Ga0439457_020551_38_1057 | 333 |
| 759 | 3300042128 | Ga0450897_001337 | Ga0450897_001337_627_1628 | 333 |
| 760 | 3300042876 | Ga0451577_0002536 | Ga0451577_0002536_13801_14802 | 333 |
| 761 | 3300042876 | Ga0451577_0286976 | Ga0451577_0286976_86_1087 | 333 |
| 762 | 3300044673 | Ga0453683_0064422 | Ga0453683_0064422_189_1190 | 333 |
| 763 | 3300044712 | Ga0453684_0000353 | Ga0453684_0000353_129633_130634 | 333 |
| 764 | 3300044712 | Ga0453684_0006286 | Ga0453684_0006286_6506_7507 | 333 |
| 765 | 3300044712 | Ga0453684_0107062 | Ga0453684_0107062_1635_2636 | 333 |
| 766 | 3300045051 | Ga0451576_0029879 | Ga0451576_0029879_3747_4748 | 333 |
| 767 | 3300045051 | Ga0451576_0070120 | Ga0451576_0070120_2527_3528 | 333 |
| 768 | 3300046453 | Ga0495627_000331 | Ga0495627_000331_25132_26214 | 333 |
| 769 | 3300046454 | Ga0495592_0000365 | Ga0495592_0000365_29926_30927 | 333 |
| 770 | 3300046458 | Ga0495591_001338 | Ga0495591_001338_2960_3961 | 333 |
| 771 | 3300046459 | Ga0495629_0002327 | Ga0495629_0002327_1118_2119 | 333 |
| 772 | 3300046460 | Ga0495638_0011307 | Ga0495638_0011307_4911_5912 | 333 |
| 773 | 3300046460 | Ga0495638_0033665 | Ga0495638_0033665_2168_3169 | 333 |
| 774 | 3300046460 | Ga0495638_0074968 | Ga0495638_0074968_963_1964 | 333 |
| 775 | 3300046460 | Ga0495638_0082992 | Ga0495638_0082992_820_1821 | 333 |
| 776 | 3300046460 | Ga0495638_0109978 | Ga0495638_0109978_344_1345 | 333 |
| 777 | 3300046462 | Ga0495651_0031485 | Ga0495651_0031485_849_1850 | 333 |
| 778 | 3300046463 | Ga0495653_0044885 | Ga0495653_0044885_1527_2528 | 333 |
| 779 | 3300046472 | Ga0495580_0001754 | Ga0495580_0001754_9206_10225 | 333 |
| 780 | 3300046472 | Ga0495580_0050085 | Ga0495580_0050085_1530_2531 | 333 |
| 781 | 3300046473 | Ga0495582_0021696 | Ga0495582_0021696_42_1061 | 333 |
| 782 | 3300046473 | Ga0495582_0086888 | Ga0495582_0086888_433_1434 | 333 |
| 783 | 3300046474 | Ga0495605_0041917 | Ga0495605_0041917_1006_2007 | 333 |
| 784 | 3300046474 | Ga0495605_0090807 | Ga0495605_0090807_376_1380 | 333 |
| 785 | 3300046476 | Ga0495662_0093665 | Ga0495662_0093665_47_1066 | 333 |
| 786 | 3300046477 | Ga0495664_0015337 | Ga0495664_0015337_2259_3260 | 333 |
| 787 | 3300046491 | Ga0495584_0057005 | Ga0495584_0057005_518_1522 | 333 |
| 788 | 3300046492 | Ga0495585_0001312 | Ga0495585_0001312_12784_13785 | 333 |
| 789 | 3300046492 | Ga0495585_0028214 | Ga0495585_0028214_1888_2892 | 333 |
| 790 | 3300046500 | Ga0495596_0002121 | Ga0495596_0002121_8815_9816 | 333 |
| 791 | 3300046500 | Ga0495596_0007856 | Ga0495596_0007856_1493_2494 | 333 |
| 792 | 3300046501 | Ga0495607_0115014 | Ga0495607_0115014_209_1210 | 333 |
| 793 | 3300046506 | Ga0495583_0004366 | Ga0495583_0004366_7103_8107 | 333 |
| 794 | 3300046507 | Ga0495606_0014221 | Ga0495606_0014221_1064_2080 | 333 |
| 795 | 3300046507 | Ga0495606_0090702 | Ga0495606_0090702_11_1012 | 333 |
| 796 | 3300046507 | Ga0495606_0180150 | Ga0495606_0180150_201_1202 | 333 |
| 797 | 3300046511 | Ga0495608_0017253 | Ga0495608_0017253_2449_3450 | 333 |
| 798 | 3300046512 | Ga0495610_0005616 | Ga0495610_0005616_3828_4829 | 333 |
| 799 | 3300046513 | Ga0495616_0063544 | Ga0495616_0063544_390_1394 | 333 |
| 800 | 3300046514 | Ga0495618_0013317 | Ga0495618_0013317_2523_3524 | 333 |
| 801 | 3300046515 | Ga0495620_0012967 | Ga0495620_0012967_1543_2547 | 333 |
| 802 | 3300046516 | Ga0495628_0008078 | Ga0495628_0008078_2191_3210 | 333 |
| 803 | 3300046516 | Ga0495628_0025243 | Ga0495628_0025243_2940_3941 | 333 |
| 804 | 3300046517 | Ga0495630_0024065 | Ga0495630_0024065_2577_3578 | 333 |
| 805 | 3300046518 | Ga0495631_0003492 | Ga0495631_0003492_3304_4305 | 333 |
| 806 | 3300046519 | Ga0495632_0000615 | Ga0495632_0000615_30288_31289 | 333 |
| 807 | 3300046522 | Ga0495643_0022266 | Ga0495643_0022266_1552_2553 | 333 |
| 808 | 3300046524 | Ga0495648_0000650 | Ga0495648_0000650_7759_8760 | 333 |
| 809 | 3300046524 | Ga0495648_0003114 | Ga0495648_0003114_12186_13187 | 333 |
| 810 | 3300046524 | Ga0495648_0031744 | Ga0495648_0031744_724_1743 | 333 |
| 811 | 3300046524 | Ga0495648_0044815 | Ga0495648_0044815_1294_2298 | 333 |
| 812 | 3300046524 | Ga0495648_0095850 | Ga0495648_0095850_341_1342 | 333 |
| 813 | 3300046526 | Ga0495666_0011584 | Ga0495666_0011584_2280_3281 | 333 |
| 814 | 3300046529 | Ga0495652_0027497 | Ga0495652_0027497_1339_2340 | 333 |
| 815 | 3300046530 | Ga0495654_0008860 | Ga0495654_0008860_968_2029 | 333 |
| 816 | 3300046531 | Ga0495665_0015494 | Ga0495665_0015494_2390_3391 | 333 |
| 817 | 3300046531 | Ga0495665_0026698 | Ga0495665_0026698_1825_2844 | 333 |
| 818 | 3300046533 | Ga0495640_0026245 | Ga0495640_0026245_2287_3288 | 333 |
| 819 | 3300046535 | Ga0495586_0133825 | Ga0495586_0133825_212_1213 | 333 |
| 820 | 3300046536 | Ga0495587_0012329 | Ga0495587_0012329_807_1808 | 333 |
| 821 | 3300046536 | Ga0495587_0044837 | Ga0495587_0044837_1235_2236 | 333 |
| 822 | 3300046538 | Ga0495609_0029155 | Ga0495609_0029155_1288_2289 | 333 |
| 823 | 3300046542 | Ga0495597_0020551 | Ga0495597_0020551_245_1246 | 333 |
| 824 | 3300046559 | Ga0495667_0035781 | Ga0495667_0035781_2060_3061 | 333 |
| 825 | 3300046616 | Ga0495668_0005238 | Ga0495668_0005238_3147_4148 | 333 |
| 826 | 3300046616 | Ga0495668_0005998 | Ga0495668_0005998_1856_2857 | 333 |
| 827 | 3300046616 | Ga0495668_0006677 | Ga0495668_0006677_594_1595 | 333 |
| 828 | 3300046616 | Ga0495668_0129691 | Ga0495668_0129691_224_1225 | 333 |
| 829 | 3300046642 | Ga0495634_0034802 | Ga0495634_0034802_1527_2528 | 333 |
| 830 | 3300046648 | Ga0495611_0000338 | Ga0495611_0000338_7542_8543 | 333 |
| 831 | 3300046648 | Ga0495611_0043288 | Ga0495611_0043288_42_1043 | 333 |
| 832 | 3300046660 | Ga0495625_0000398 | Ga0495625_0000398_36781_37782 | 333 |
| 833 | 3300046660 | Ga0495625_0002639 | Ga0495625_0002639_6422_7423 | 333 |
| 834 | 3300046660 | Ga0495625_0005332 | Ga0495625_0005332_5177_6178 | 333 |
| 835 | 3300046660 | Ga0495625_0023964 | Ga0495625_0023964_348_1349 | 333 |
| 836 | 3300046660 | Ga0495625_0045187 | Ga0495625_0045187_1028_2029 | 333 |
| 837 | 3300046660 | Ga0495625_0055265 | Ga0495625_0055265_128_1129 | 333 |
| 838 | 3300046663 | Ga0495635_0004307 | Ga0495635_0004307_6627_7628 | 333 |
| 839 | 3300046665 | Ga0495661_0008892 | Ga0495661_0008892_4991_5992 | 333 |
| 840 | 3300046665 | Ga0495661_0022964 | Ga0495661_0022964_2299_3300 | 333 |
| 841 | 3300046665 | Ga0495661_0049329 | Ga0495661_0049329_152_1156 | 333 |
| 842 | 3300046675 | Ga0495657_0042048 | Ga0495657_0042048_1226_2227 | 333 |
| 843 | 3300046678 | Ga0495599_0028843 | Ga0495599_0028843_219_1220 | 333 |
| 844 | 3300046680 | Ga0495646_0019414 | Ga0495646_0019414_926_1927 | 333 |
| 845 | 3300046684 | Ga0495669_0057008 | Ga0495669_0057008_650_1651 | 333 |
| 846 | 3300046689 | Ga0495613_0003319 | Ga0495613_0003319_8661_9662 | 333 |
| 847 | 3300046690 | Ga0495624_0001210 | Ga0495624_0001210_15034_16053 | 333 |
| 848 | 3300046690 | Ga0495624_0010782 | Ga0495624_0010782_3698_4699 | 333 |
| 849 | 3300046694 | Ga0495649_0020224 | Ga0495649_0020224_1602_2606 | 333 |
| 850 | 3300046794 | Ga0495589_0012592 | Ga0495589_0012592_926_1927 | 333 |
| 851 | 3300046809 | Ga0495600_0018671 | Ga0495600_0018671_2980_3981 | 333 |
| 852 | 3300046810 | Ga0495660_0030605 | Ga0495660_0030605_1471_2535 | 333 |
| 853 | 3300047317 | Ga0495604_0004068 | Ga0495604_0004068_326_1327 | 333 |
| 854 | 3300047317 | Ga0495604_0015789 | Ga0495604_0015789_2490_3491 | 333 |
| 855 | 3300047318 | Ga0495636_0002305 | Ga0495636_0002305_4013_5053 | 333 |
| 856 | 3300047318 | Ga0495636_0044306 | Ga0495636_0044306_403_1404 | 333 |
| 857 | 3300047318 | Ga0495636_0077057 | Ga0495636_0077057_64_1080 | 333 |
| 858 | 3300047319 | Ga0495674_0002116 | Ga0495674_0002116_3447_4466 | 333 |
| 859 | 3300047319 | Ga0495674_0002272 | Ga0495674_0002272_926_1927 | 333 |
| 860 | 3300047320 | Ga0495672_0004957 | Ga0495672_0004957_7490_8491 | 333 |
| 861 | 3300047321 | Ga0495676_0016536 | Ga0495676_0016536_3238_4257 | 333 |
| 862 | 3300047321 | Ga0495676_0082230 | Ga0495676_0082230_322_1323 | 333 |
| 863 | 3300047322 | Ga0495680_0023678 | Ga0495680_0023678_926_1927 | 333 |
| 864 | 3300047322 | Ga0495680_0154093 | Ga0495680_0154093_358_1452 | 333 |
| 865 | 3300047323 | Ga0495683_0011094 | Ga0495683_0011094_1463_2464 | 333 |
| 866 | 3300047443 | Ga0495687_001236 | Ga0495687_001236_15196_16197 | 333 |
| 867 | 3300047443 | Ga0495687_027256 | Ga0495687_027256_467_1468 | 333 |
| 868 | 3300047443 | Ga0495687_050697 | Ga0495687_050697_271_1272 | 333 |
| 869 | 3300047443 | Ga0495687_058816 | Ga0495687_058816_22_1026 | 333 |
| 870 | 3300047444 | Ga0495675_0020835 | Ga0495675_0020835_2287_3288 | 333 |
| 871 | 3300047446 | Ga0495679_000183 | Ga0495679_000183_12784_13788 | 333 |
| 872 | 3300047446 | Ga0495679_008362 | Ga0495679_008362_2287_3288 | 333 |
| 873 | 3300047469 | Ga0495673_0014057 | Ga0495673_0014057_2024_3025 | 333 |
| 874 | 3300047470 | Ga0495681_0067650 | Ga0495681_0067650_200_1201 | 333 |
| 875 | 3300047673 | Ga0495593_0001368 | Ga0495593_0001368_8475_9476 | 333 |
| 876 | 3300047673 | Ga0495593_0001757 | Ga0495593_0001757_5554_6573 | 333 |
| 877 | 3300048088 | Ga0495602_0035786 | Ga0495602_0035786_1339_2340 | 333 |
| 878 | 3300048089 | Ga0495614_0011632 | Ga0495614_0011632_420_1421 | 333 |
| 879 | 3300048091 | Ga0495626_0011713 | Ga0495626_0011713_1592_2593 | 333 |
| 880 | 3300048904 | Ga0496101_0250648 | Ga0496101_0250648_84_1088 | 333 |
| 881 | 3300048906 | Ga0496103_0153161 | Ga0496103_0153161_53_1057 | 333 |
| 882 | 3300048907 | Ga0496104_0010697 | Ga0496104_0010697_5855_6874 | 333 |
| 883 | 3300048908 | Ga0496105_0043074 | Ga0496105_0043074_1651_2670 | 333 |
| 884 | 3300048909 | Ga0496106_0012180 | Ga0496106_0012180_35_1078 | 333 |
| 885 | 3300048910 | Ga0496107_0055487 | Ga0496107_0055487_257_1258 | 333 |
| 886 | 3300048915 | Ga0496112_0015518 | Ga0496112_0015518_391_1392 | 333 |
| 887 | 3300048920 | Ga0496117_0002431 | Ga0496117_0002431_18972_19973 | 333 |
| 888 | 3300048920 | Ga0496117_0009276 | Ga0496117_0009276_552_1553 | 333 |
| 889 | 3300048920 | Ga0496117_0047085 | Ga0496117_0047085_704_1708 | 333 |
| 890 | 3300048921 | Ga0496118_0005091 | Ga0496118_0005091_5190_6191 | 333 |
| 891 | 3300048922 | Ga0496119_0028863 | Ga0496119_0028863_241_1242 | 333 |
| 892 | 3300048924 | Ga0496121_0003338 | Ga0496121_0003338_21644_22645 | 333 |
| 893 | 3300048924 | Ga0496121_0017890 | Ga0496121_0017890_5702_6745 | 333 |
| 894 | 3300048926 | Ga0496123_0030984 | Ga0496123_0030984_2188_3189 | 333 |
| 895 | 3300048927 | Ga0496124_0023755 | Ga0496124_0023755_681_1682 | 333 |
| 896 | 3300048928 | Ga0496125_0009713 | Ga0496125_0009713_509_1510 | 333 |
| 897 | 3300048928 | Ga0496125_0068580 | Ga0496125_0068580_730_1731 | 333 |
| 898 | 3300048929 | Ga0496126_0069428 | Ga0496126_0069428_359_1360 | 333 |
| 899 | 3300048929 | Ga0496126_0173482 | Ga0496126_0173482_487_1488 | 333 |
| 900 | 3300049460 | Ga0495682_0006252 | Ga0495682_0006252_3447_4451 | 333 |
| 901 | 3300049460 | Ga0495682_0011202 | Ga0495682_0011202_424_1425 | 333 |
| 902 | 3300049460 | Ga0495682_0045654 | Ga0495682_0045654_330_1331 | 333 |
| 903 | 3300049520 | Ga0501297_009640 | Ga0501297_009640_31_1032 | 333 |
| 904 | 3300049571 | Ga0501034_0287285 | Ga0501034_0287285_571_1572 | 333 |
| 905 | 3300049574 | Ga0501038_0014418 | Ga0501038_0014418_1971_2981 | 333 |
| 906 | 3300049679 | Ga0501249_024246 | Ga0501249_024246_51_1052 | 333 |
| 907 | 3300049759 | Ga0501262_000019 | Ga0501262_000019_12129_13130 | 333 |
| 908 | 3300049763 | Ga0501266_000190 | Ga0501266_000190_2765_3766 | 333 |
| 909 | 3300050489 | nmdc:mga03683_13362_c1 | nmdc:mga03683_13362_c1_999_2003 | 333 |
| 910 | 3300050490 | nmdc:mga03n38_17482_c1 | nmdc:mga03n38_17482_c1_921_1928 | 333 |
| 911 | 3300050491 | nmdc:mga00v17_37146_c2 | nmdc:mga00v17_37146_c2_1112_2113 | 333 |
| 912 | 3300050491 | nmdc:mga00v17_4_c1 | nmdc:mga00v17_4_c1_233300_234304 | 333 |
| 913 | 3300050493 | nmdc:mga0k408_115892_c1 | nmdc:mga0k408_115892_c1_467_1468 | 333 |
| 914 | 3300050493 | nmdc:mga0k408_19195_c1 | nmdc:mga0k408_19195_c1_2406_3407 | 333 |
| 915 | 3300050493 | nmdc:mga0k408_3654_c1 | nmdc:mga0k408_3654_c1_1283_2284 | 333 |
| 916 | 3300050493 | nmdc:mga0k408_39926_c2 | nmdc:mga0k408_39926_c2_62_1063 | 333 |
| 917 | 3300050493 | nmdc:mga0k408_41120_c1 | nmdc:mga0k408_41120_c1_1003_2004 | 333 |
| 918 | 3300050493 | nmdc:mga0k408_9698_c1 | nmdc:mga0k408_9698_c1_2935_3936 | 333 |
| 919 | 3300050494 | nmdc:mga06z11_18457_c1 | nmdc:mga06z11_18457_c1_1568_2569 | 333 |
| 920 | 3300050494 | nmdc:mga06z11_22063_c1 | nmdc:mga06z11_22063_c1_684_1685 | 333 |
| 921 | 3300050496 | nmdc:mga07m45_4202_c1 | nmdc:mga07m45_4202_c1_2370_3371 | 333 |
| 922 | 3300050511 | nmdc:mga08y16_308720_c1 | nmdc:mga08y16_308720_c1_38_1039 | 333 |
| 923 | 3300050512 | nmdc:mga0n895_359_c1 | nmdc:mga0n895_359_c1_4767_5768 | 333 |
| 924 | 3300050513 | nmdc:mga0rr50_15494_c1 | nmdc:mga0rr50_15494_c1_3757_4758 | 333 |
| 925 | 3300050515 | nmdc:mga0a205_5241_c1 | nmdc:mga0a205_5241_c1_6060_7061 | 333 |
| 926 | 3300050516 | nmdc:mga0sz30_33157_c1 | nmdc:mga0sz30_33157_c1_626_1627 | 333 |
| 927 | 3300050516 | nmdc:mga0sz30_718_c1 | nmdc:mga0sz30_718_c1_11183_12187 | 333 |
| 928 | 3300053079 | Ga0500610_0000398 | Ga0500610_0000398_5103_6104 | 333 |
| 929 | 3300053080 | Ga0500635_0027882 | Ga0500635_0027882_744_1745 | 333 |
| 930 | 3300053086 | Ga0500578_0000002 | Ga0500578_0000002_170795_171796 | 333 |
| 931 | 3300053086 | Ga0500578_0059895 | Ga0500578_0059895_14_1015 | 333 |
| 932 | 3300053087 | Ga0500643_000023 | Ga0500643_000023_235844_236884 | 333 |
| 933 | 3300053087 | Ga0500643_000485 | Ga0500643_000485_4050_5051 | 333 |
| 934 | 3300053088 | Ga0500644_0000316 | Ga0500644_0000316_185_1186 | 333 |
| 935 | 3300053090 | Ga0500646_0005804 | Ga0500646_0005804_344_1345 | 333 |
| 936 | 3300053090 | Ga0500646_0012785 | Ga0500646_0012785_608_1609 | 333 |
| 937 | 3300053090 | Ga0500646_0017594 | Ga0500646_0017594_337_1338 | 333 |
| 938 | 3300053090 | Ga0500646_0031569 | Ga0500646_0031569_364_1365 | 333 |
| 939 | 3300053090 | Ga0500646_0032025 | Ga0500646_0032025_148_1158 | 333 |
| 940 | 3300053092 | Ga0500583_0000330 | Ga0500583_0000330_3642_4643 | 333 |
| 941 | 3300053093 | Ga0500651_0011141 | Ga0500651_0011141_2554_3555 | 333 |
| 942 | 3300053093 | Ga0500651_0036634 | Ga0500651_0036634_1733_2734 | 333 |
| 943 | 3300053094 | Ga0500566_0024737 | Ga0500566_0024737_854_1855 | 333 |
| 944 | 3300053098 | Ga0500650_0068764 | Ga0500650_0068764_221_1222 | 333 |
| 945 | 3300053108 | Ga0500562_000050 | Ga0500562_000050_24851_25852 | 333 |
| 946 | 3300053119 | Ga0500595_000113 | Ga0500595_000113_32040_33041 | 333 |
| 947 | 3300053121 | Ga0500607_022569 | Ga0500607_022569_2061_3062 | 333 |
| 948 | 3300053130 | Ga0500642_0008557 | Ga0500642_0008557_544_1545 | 333 |
| 949 | 3300053131 | Ga0500652_002040 | Ga0500652_002040_831_1832 | 333 |
| 950 | 3300053131 | Ga0500652_005790 | Ga0500652_005790_2701_3702 | 333 |
| 951 | 3300053133 | Ga0500655_011094 | Ga0500655_011094_386_1387 | 333 |
| 952 | 3300053134 | Ga0500658_0000009 | Ga0500658_0000009_25794_26795 | 333 |
| 953 | 3300053134 | Ga0500658_0009256 | Ga0500658_0009256_2264_3265 | 333 |
| 954 | 3300053136 | Ga0500559_0016915 | Ga0500559_0016915_472_1473 | 333 |
| 955 | 3300053137 | Ga0500561_0000073 | Ga0500561_0000073_6035_7039 | 333 |
| 956 | 3300053139 | Ga0500568_0000205 | Ga0500568_0000205_14862_15863 | 333 |
| 957 | 3300053139 | Ga0500568_0010186 | Ga0500568_0010186_2708_3709 | 333 |
| 958 | 3300053142 | Ga0500577_0010259 | Ga0500577_0010259_750_1751 | 333 |
| 959 | 3300053151 | Ga0500604_0000807 | Ga0500604_0000807_1884_2885 | 333 |
| 960 | 3300053151 | Ga0500604_0008000 | Ga0500604_0008000_277_1278 | 333 |
| 961 | 3300053151 | Ga0500604_0021103 | Ga0500604_0021103_271_1272 | 333 |
| 962 | 3300053153 | Ga0500616_0002510 | Ga0500616_0002510_11138_12139 | 333 |
| 963 | 3300053155 | Ga0500620_004905 | Ga0500620_004905_2024_3025 | 333 |
| 964 | 3300053156 | Ga0500622_0000227 | Ga0500622_0000227_19583_20584 | 333 |
| 965 | 3300053156 | Ga0500622_0000290 | Ga0500622_0000290_16392_17393 | 333 |
| 966 | 3300053156 | Ga0500622_0001746 | Ga0500622_0001746_15464_16465 | 333 |
| 967 | 3300053156 | Ga0500622_0002334 | Ga0500622_0002334_6345_7391 | 333 |
| 968 | 3300053156 | Ga0500622_0003764 | Ga0500622_0003764_3743_4750 | 333 |
| 969 | 3300053156 | Ga0500622_0019763 | Ga0500622_0019763_347_1348 | 333 |
| 970 | 3300053158 | Ga0500627_0036272 | Ga0500627_0036272_113_1114 | 333 |
| 971 | 3300053177 | Ga0500636_0014267 | Ga0500636_0014267_2112_3113 | 333 |
| 972 | 3300053177 | Ga0500636_0026685 | Ga0500636_0026685_669_1670 | 333 |
| 973 | 3300053177 | Ga0500636_0035954 | Ga0500636_0035954_437_1438 | 333 |
| 974 | 3300053730 | Ga0500645_001097 | Ga0500645_001097_6012_7013 | 333 |
| 975 | 3300053730 | Ga0500645_030402 | Ga0500645_030402_605_1606 | 333 |
| 976 | 3300053739 | Ga0500587_003299 | Ga0500587_003299_11_1012 | 333 |
| 977 | 3300055283 | Ga0500661_002854 | Ga0500661_002854_2035_3036 | 333 |
| 978 | 3300055283 | Ga0500661_003700 | Ga0500661_003700_79_1080 | 333 |
| 979 | iso_pu_bacteria | 2582581280 | 2585150413 | 333 |
| 980 | iso_pu_bacteria | 2582581283 | 2585166089 | 333 |
| 981 | iso_pu_bacteria | 2582581293 | 2585198711 | 333 |
| 982 | iso_pu_bacteria | 2585427529 | 2585544483 | 333 |
| 983 | iso_pu_bacteria | 2585427633 | 2585994931 | 333 |
| 984 | iso_pu_bacteria | 2585427634 | 2585999473 | 333 |
| 985 | iso_pu_bacteria | 2841734538 | 2841738752 | 333 |
| 986 | iso_pu_bacteria | 2919408235 | 2919411485 | 333 |
| 987 | iso_pu_bacteria | 8005258706 | 8005264570 | 333 |
| 988 | iso_pu_bacteria | 8005321885 | 8005321997 | 333 |
| 989 | iso_pu_bacteria | 8018127388 | 8018127834 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ide-assembly1.cif.gz_A | structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf | 0.9119 | 2 | 331 |
| 5a3j-assembly8.cif.gz_H | crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. | 0.9043 | 1 | 332 |
| 3tqh-assembly1.cif.gz_A | structure of the quinone oxidoreductase from coxiella burnetii | 0.8996 | 1 | 333 |
| 5a4d-assembly5.cif.gz_E | crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp | 0.8984 | 1 | 332 |
| 5a4d-assembly5.cif.gz_E | crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp | 0.8957 | 1 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q3UNZ8_26_154_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9465 | 2 | 126 | 3.90.180.10 |
| af_Q0JDV3_9_115_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.945 | 1 | 93 | 3.90.180.10 |
| af_Q54II4_2_127_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9409 | 2 | 122 | 3.90.180.10 |
| af_O45496_9_126_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9404 | 1 | 123 | 3.90.180.10 |
| af_B0BNC9_25_138_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9388 | 2 | 118 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536VTB4-F1-model_v4 | NADP-dependent oxidoreductase | 0.9956 | 55 | 333 |
GO:0008270
GO:0016491 |
| AF-A0A536VTB4-F1-model_v4 | NADP-dependent oxidoreductase | 0.9921 | 55 | 333 |
GO:0008270
GO:0016491 |
| AF-A0A2V7NA27-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.992 | 1 | 333 |
GO:0008270
GO:0016491 |
| AF-W9EF68-F1-model_v4 | Zinc-containing alcohol dehydrogenase, quinone oxidoreductase | 0.9909 | 1 | 333 |
GO:0016491
|
| AF-A0A5B8TNI8-F1-model_v4 | NADP-dependent oxidoreductase | 0.9896 | 1 | 333 |
GO:0008270
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar