F487568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 988 | 462 | 1976 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0113510|Ga0373936_0113510_382_936 |
| Length | 184 |
| Sequence | MTKGYALFDTAIGRCGIAWTSRGIVATCLPEADERRARVRLARRCPGGEEQTPPPAIQLVIDRVVALLRGAPDDLADVVLDMEAVPEFNARIYAIIRTIPPGETITYGEIAKRLGAVDARDVGQAMGQNPFPPIVPCHRVVAAGSKTGGFSARGGVATKLRMLAIEGAQVDGTLPLFEGPARQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 81 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 112 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 188 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 249 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 393 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 396 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 406 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 412 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 413 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 415 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 417 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 418 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 424 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 425 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 426 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 427 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 428 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 429 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 430 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 431 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 432 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 433 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 434 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 435 | 2791355199 | |||
| 436 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 437 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 438 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 439 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 440 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 441 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 442 | 2904699407 | |||
| 443 | 2906610324 | |||
| 444 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 445 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 446 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 447 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 448 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 449 | 2922425934 | |||
| 450 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 451 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 452 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 453 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 454 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 455 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 456 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 457 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 458 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 459 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 460 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 461 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 462 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.22 |
| Metatranscriptomes | 1.12 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.81 |
| Nodule | 3.44 |
| Rhizoplane | 6.28 |
| Rhizosphere | 75.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373936_0113510 | 3300035113 | Bacteria | 1152 |
| 2 | JGI25406J46586_10014265 | 3300003203 | Bacteria | 3383 |
| 3 | JGI25165J46597_1008272 | 3300003214 | Bacteria | 1644 |
| 4 | JGI25165J46597_1008905 | 3300003214 | Bacteria | 1541 |
| 5 | JGI25153J46596_10001699 | 3300003215 | Bacteria | 13066 |
| 6 | JGI25404J52841_10003242 | 3300003659 | Bacteria | 3191 |
| 7 | JGI25404J52841_10007484 | 3300003659 | Bacteria | 2310 |
| 8 | JGI25404J52841_10014463 | 3300003659 | Bacteria | 1713 |
| 9 | JGI25404J52841_10049818 | 3300003659 | Bacteria | 881 |
| 10 | Ga0070658_11094795 | 3300005327 | Bacteria | 693 |
| 11 | Ga0070683_100008883 | 3300005329 | Bacteria | 8559 |
| 12 | Ga0070683_100054636 | 3300005329 | Bacteria | 3703 |
| 13 | Ga0070683_100067497 | 3300005329 | Bacteria | 3331 |
| 14 | Ga0070677_10193451 | 3300005333 | Bacteria | 977 |
| 15 | Ga0068869_100084996 | 3300005334 | Bacteria | 2369 |
| 16 | Ga0070680_100003569 | 3300005336 | Bacteria | 11609 |
| 17 | Ga0070680_100162622 | 3300005336 | Bacteria | 1876 |
| 18 | Ga0070680_100239691 | 3300005336 | Bacteria | 1533 |
| 19 | Ga0070682_100289771 | 3300005337 | Bacteria | 1197 |
| 20 | Ga0070682_100290793 | 3300005337 | Bacteria | 1195 |
| 21 | Ga0070660_100028691 | 3300005339 | Bacteria | 4165 |
| 22 | Ga0070660_100068615 | 3300005339 | Bacteria | 2764 |
| 23 | Ga0070660_100233401 | 3300005339 | Bacteria | 1497 |
| 24 | Ga0070660_100484862 | 3300005339 | Bacteria | 1027 |
| 25 | Ga0070689_100440846 | 3300005340 | Bacteria | 1107 |
| 26 | Ga0070691_10122660 | 3300005341 | Bacteria | 1310 |
| 27 | Ga0070661_100292591 | 3300005344 | Bacteria | 1266 |
| 28 | Ga0070661_100391975 | 3300005344 | Bacteria | 1097 |
| 29 | Ga0070661_100418671 | 3300005344 | Bacteria | 1062 |
| 30 | Ga0070661_100954356 | 3300005344 | Bacteria | 710 |
| 31 | Ga0070692_10298644 | 3300005345 | Bacteria | 983 |
| 32 | Ga0070668_100047596 | 3300005347 | Bacteria | 3297 |
| 33 | Ga0070675_100585633 | 3300005354 | Bacteria | 1011 |
| 34 | Ga0070671_100053820 | 3300005355 | Bacteria | 3346 |
| 35 | Ga0070671_100423394 | 3300005355 | Bacteria | 1140 |
| 36 | Ga0070674_100100148 | 3300005356 | Bacteria | 2109 |
| 37 | Ga0070674_100192112 | 3300005356 | Bacteria | 1571 |
| 38 | Ga0070674_100224862 | 3300005356 | Bacteria | 1462 |
| 39 | Ga0070673_100160820 | 3300005364 | Bacteria | 1910 |
| 40 | Ga0070673_100226975 | 3300005364 | Bacteria | 1619 |
| 41 | Ga0070688_100630186 | 3300005365 | Bacteria | 824 |
| 42 | Ga0070688_100638242 | 3300005365 | Bacteria | 819 |
| 43 | Ga0070703_10299701 | 3300005406 | Bacteria | 670 |
| 44 | Ga0070709_10001461 | 3300005434 | Bacteria | 12746 |
| 45 | Ga0070709_10113928 | 3300005434 | Bacteria | 1821 |
| 46 | Ga0070714_100003988 | 3300005435 | Bacteria | 11098 |
| 47 | Ga0070714_100614141 | 3300005435 | Bacteria | 1045 |
| 48 | Ga0070714_100620482 | 3300005435 | Bacteria | 1039 |
| 49 | Ga0070714_101262634 | 3300005435 | Bacteria | 721 |
| 50 | Ga0070713_100009716 | 3300005436 | Bacteria | 6909 |
| 51 | Ga0070713_100045353 | 3300005436 | Bacteria | 3602 |
| 52 | Ga0070713_100130018 | 3300005436 | Bacteria | 2219 |
| 53 | Ga0070713_100193726 | 3300005436 | Bacteria | 1833 |
| 54 | Ga0070713_100700968 | 3300005436 | Bacteria | 966 |
| 55 | Ga0070710_10001981 | 3300005437 | Bacteria | 9708 |
| 56 | Ga0070710_10003702 | 3300005437 | Bacteria | 7230 |
| 57 | Ga0070710_10013111 | 3300005437 | Bacteria | 4139 |
| 58 | Ga0070710_10362886 | 3300005437 | Bacteria | 962 |
| 59 | Ga0070701_10162548 | 3300005438 | Bacteria | 1294 |
| 60 | Ga0070711_100010613 | 3300005439 | Bacteria | 5706 |
| 61 | Ga0070711_100054947 | 3300005439 | Bacteria | 2749 |
| 62 | Ga0070711_100071985 | 3300005439 | Bacteria | 2438 |
| 63 | Ga0070708_100183380 | 3300005445 | Bacteria | 1957 |
| 64 | Ga0070663_100016725 | 3300005455 | Bacteria | 4772 |
| 65 | Ga0070663_100059739 | 3300005455 | Bacteria | 2740 |
| 66 | Ga0070663_100124898 | 3300005455 | Bacteria | 1948 |
| 67 | Ga0070663_100188644 | 3300005455 | Bacteria | 1603 |
| 68 | Ga0070678_100046387 | 3300005456 | Bacteria | 3116 |
| 69 | Ga0070678_100090590 | 3300005456 | Bacteria | 2345 |
| 70 | Ga0070678_100506523 | 3300005456 | Bacteria | 1066 |
| 71 | Ga0070662_100076746 | 3300005457 | Bacteria | 2477 |
| 72 | Ga0070662_100968567 | 3300005457 | Bacteria | 728 |
| 73 | Ga0070681_10015034 | 3300005458 | Bacteria | 7699 |
| 74 | Ga0070681_10265153 | 3300005458 | Bacteria | 1629 |
| 75 | Ga0070681_10304690 | 3300005458 | Bacteria | 1503 |
| 76 | Ga0070681_10683269 | 3300005458 | Bacteria | 942 |
| 77 | Ga0070681_10800358 | 3300005458 | Bacteria | 860 |
| 78 | Ga0068867_100298380 | 3300005459 | Bacteria | 1327 |
| 79 | Ga0068867_100655299 | 3300005459 | Bacteria | 922 |
| 80 | Ga0070706_100406781 | 3300005467 | Bacteria | 1267 |
| 81 | Ga0070707_100939000 | 3300005468 | Bacteria | 830 |
| 82 | Ga0070698_100133500 | 3300005471 | Bacteria | 2437 |
| 83 | Ga0070698_100377666 | 3300005471 | Bacteria | 1350 |
| 84 | Ga0070698_101071959 | 3300005471 | Bacteria | 754 |
| 85 | Ga0070699_101123042 | 3300005518 | Bacteria | 721 |
| 86 | Ga0070679_100074282 | 3300005530 | Bacteria | 3390 |
| 87 | Ga0070679_100094119 | 3300005530 | Bacteria | 2983 |
| 88 | Ga0070679_100132475 | 3300005530 | Bacteria | 2474 |
| 89 | Ga0070679_100340493 | 3300005530 | Bacteria | 1448 |
| 90 | Ga0070679_100416144 | 3300005530 | Bacteria | 1290 |
| 91 | Ga0070679_100963696 | 3300005530 | Bacteria | 797 |
| 92 | Ga0070679_101120527 | 3300005530 | Bacteria | 732 |
| 93 | Ga0070684_100016526 | 3300005535 | Bacteria | 6032 |
| 94 | Ga0070684_100048824 | 3300005535 | Bacteria | 3672 |
| 95 | Ga0070684_100376489 | 3300005535 | Bacteria | 1307 |
| 96 | Ga0070684_100481690 | 3300005535 | Bacteria | 1148 |
| 97 | Ga0070684_101056561 | 3300005535 | Bacteria | 763 |
| 98 | Ga0070697_100071083 | 3300005536 | Bacteria | 2854 |
| 99 | Ga0070697_100103553 | 3300005536 | Bacteria | 2366 |
| 100 | Ga0070697_100986080 | 3300005536 | Bacteria | 749 |
| 101 | Ga0068853_100214433 | 3300005539 | Bacteria | 1756 |
| 102 | Ga0068853_100256064 | 3300005539 | Bacteria | 1608 |
| 103 | Ga0068853_100416327 | 3300005539 | Bacteria | 1260 |
| 104 | Ga0068853_100594557 | 3300005539 | Bacteria | 1050 |
| 105 | Ga0068853_100654930 | 3300005539 | Bacteria | 1000 |
| 106 | Ga0068853_101777931 | 3300005539 | Bacteria | 598 |
| 107 | Ga0070672_100297365 | 3300005543 | Bacteria | 1368 |
| 108 | Ga0070672_100600368 | 3300005543 | Bacteria | 959 |
| 109 | Ga0070686_100145822 | 3300005544 | Bacteria | 1653 |
| 110 | Ga0070686_100788786 | 3300005544 | Bacteria | 765 |
| 111 | Ga0070693_100121665 | 3300005547 | Bacteria | 1619 |
| 112 | Ga0070665_100009458 | 3300005548 | Bacteria | 9864 |
| 113 | Ga0070665_100020723 | 3300005548 | Bacteria | 6606 |
| 114 | Ga0070665_100046666 | 3300005548 | Bacteria | 4350 |
| 115 | Ga0070665_100133651 | 3300005548 | Bacteria | 2483 |
| 116 | Ga0070665_100156385 | 3300005548 | Bacteria | 2281 |
| 117 | Ga0070665_100241352 | 3300005548 | Bacteria | 1807 |
| 118 | Ga0070665_100620169 | 3300005548 | Bacteria | 1095 |
| 119 | Ga0070704_101023742 | 3300005549 | Bacteria | 748 |
| 120 | Ga0068855_100029909 | 3300005563 | Bacteria | 6513 |
| 121 | Ga0068855_100065359 | 3300005563 | Bacteria | 4241 |
| 122 | Ga0068855_100130860 | 3300005563 | Bacteria | 2866 |
| 123 | Ga0068855_100136170 | 3300005563 | Bacteria | 2802 |
| 124 | Ga0068855_100504877 | 3300005563 | Bacteria | 1314 |
| 125 | Ga0068855_100633138 | 3300005563 | Bacteria | 1150 |
| 126 | Ga0070664_100231912 | 3300005564 | Bacteria | 1655 |
| 127 | Ga0068857_100005639 | 3300005577 | Bacteria | 10702 |
| 128 | Ga0068857_100641834 | 3300005577 | Bacteria | 1006 |
| 129 | Ga0068854_100005923 | 3300005578 | Bacteria | 7744 |
| 130 | Ga0068854_101185061 | 3300005578 | Bacteria | 684 |
| 131 | Ga0068856_100000476 | 3300005614 | Bacteria | 44310 |
| 132 | Ga0068856_100416911 | 3300005614 | Bacteria | 1363 |
| 133 | Ga0068856_100427182 | 3300005614 | Bacteria | 1345 |
| 134 | Ga0068852_100276425 | 3300005616 | Bacteria | 1618 |
| 135 | Ga0068864_100305057 | 3300005618 | Bacteria | 1491 |
| 136 | Ga0068864_100536784 | 3300005618 | Bacteria | 1129 |
| 137 | Ga0068866_11015432 | 3300005718 | Bacteria | 590 |
| 138 | Ga0068861_100063011 | 3300005719 | Bacteria | 2849 |
| 139 | Ga0068861_100434442 | 3300005719 | Bacteria | 1173 |
| 140 | Ga0068870_10081819 | 3300005840 | Bacteria | 1787 |
| 141 | Ga0068870_10086555 | 3300005840 | Bacteria | 1744 |
| 142 | Ga0068858_100179452 | 3300005842 | Bacteria | 1999 |
| 143 | Ga0068858_100201984 | 3300005842 | Bacteria | 1880 |
| 144 | Ga0068858_100219487 | 3300005842 | Bacteria | 1800 |
| 145 | Ga0068858_100857524 | 3300005842 | Bacteria | 887 |
| 146 | Ga0081455_10008457 | 3300005937 | Bacteria | 10700 |
| 147 | Ga0081455_10011371 | 3300005937 | Bacteria | 8946 |
| 148 | Ga0081455_10071946 | 3300005937 | Bacteria | 2865 |
| 149 | Ga0081455_10116310 | 3300005937 | Bacteria | 2115 |
| 150 | Ga0081540_1005329 | 3300005983 | Bacteria | 9623 |
| 151 | Ga0081540_1007078 | 3300005983 | Bacteria | 8062 |
| 152 | Ga0081540_1007475 | 3300005983 | Bacteria | 7780 |
| 153 | Ga0081540_1010016 | 3300005983 | Bacteria | 6451 |
| 154 | Ga0081540_1016353 | 3300005983 | Bacteria | 4646 |
| 155 | Ga0081540_1018434 | 3300005983 | Bacteria | 4281 |
| 156 | Ga0081540_1027051 | 3300005983 | Bacteria | 3259 |
| 157 | Ga0081540_1048885 | 3300005983 | Bacteria | 2115 |
| 158 | Ga0081540_1053004 | 3300005983 | Bacteria | 1993 |
| 159 | Ga0081540_1053054 | 3300005983 | Bacteria | 1991 |
| 160 | Ga0081540_1069721 | 3300005983 | Bacteria | 1632 |
| 161 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 162 | Ga0081539_10037181 | 3300005985 | Bacteria | 2903 |
| 163 | Ga0070717_10001915 | 3300006028 | Bacteria | 14544 |
| 164 | Ga0075365_10037480 | 3300006038 | Bacteria | 3148 |
| 165 | Ga0075365_10058983 | 3300006038 | Bacteria | 2556 |
| 166 | Ga0075365_10096611 | 3300006038 | Bacteria | 2019 |
| 167 | Ga0075365_10367306 | 3300006038 | Bacteria | 1015 |
| 168 | Ga0075365_10399644 | 3300006038 | Bacteria | 970 |
| 169 | Ga0075368_10034050 | 3300006042 | Bacteria | 1984 |
| 170 | Ga0075368_10097895 | 3300006042 | Bacteria | 1203 |
| 171 | Ga0075363_100000795 | 3300006048 | Bacteria | 10907 |
| 172 | Ga0075363_100029297 | 3300006048 | Bacteria | 2840 |
| 173 | Ga0075363_100072106 | 3300006048 | Bacteria | 1878 |
| 174 | Ga0075364_10378811 | 3300006051 | Bacteria | 965 |
| 175 | Ga0070715_10002928 | 3300006163 | Bacteria | 5333 |
| 176 | Ga0070716_100017312 | 3300006173 | Bacteria | 3733 |
| 177 | Ga0070716_100286211 | 3300006173 | Bacteria | 1140 |
| 178 | Ga0070716_100525524 | 3300006173 | Bacteria | 877 |
| 179 | Ga0070716_100820800 | 3300006173 | Bacteria | 722 |
| 180 | Ga0070712_100254170 | 3300006175 | Bacteria | 1406 |
| 181 | Ga0070712_100347031 | 3300006175 | Bacteria | 1214 |
| 182 | Ga0070712_100388111 | 3300006175 | Bacteria | 1151 |
| 183 | Ga0070712_100423449 | 3300006175 | Bacteria | 1104 |
| 184 | Ga0070712_100980028 | 3300006175 | Bacteria | 731 |
| 185 | Ga0075362_10102482 | 3300006177 | Bacteria | 1340 |
| 186 | Ga0075367_10009759 | 3300006178 | Bacteria | 5027 |
| 187 | Ga0075367_10026192 | 3300006178 | Bacteria | 3304 |
| 188 | Ga0075367_10485489 | 3300006178 | Bacteria | 783 |
| 189 | Ga0075369_10023467 | 3300006186 | Bacteria | 2550 |
| 190 | Ga0075369_10467989 | 3300006186 | Bacteria | 598 |
| 191 | Ga0075366_10186109 | 3300006195 | Bacteria | 1262 |
| 192 | Ga0075370_10096836 | 3300006353 | Bacteria | 1706 |
| 193 | Ga0075370_10714073 | 3300006353 | Bacteria | 610 |
| 194 | Ga0068871_100158458 | 3300006358 | Bacteria | 1934 |
| 195 | Ga0075428_100128792 | 3300006844 | Bacteria | 2753 |
| 196 | Ga0075433_10781196 | 3300006852 | Bacteria | 835 |
| 197 | Ga0068865_100100401 | 3300006881 | Bacteria | 2117 |
| 198 | Ga0068865_100220495 | 3300006881 | Bacteria | 1482 |
| 199 | Ga0068865_100245917 | 3300006881 | Bacteria | 1409 |
| 200 | Ga0099825_1022556 | 3300006941 | Bacteria | 4040 |
| 201 | Ga0099822_1024573 | 3300006943 | Bacteria | 5376 |
| 202 | Ga0099794_10013122 | 3300007265 | Bacteria | 3598 |
| 203 | Ga0099795_10144911 | 3300007788 | Bacteria | 969 |
| 204 | Ga0105251_10300235 | 3300009011 | Bacteria | 728 |
| 205 | Ga0105240_10031535 | 3300009093 | Bacteria | 6872 |
| 206 | Ga0105240_10031799 | 3300009093 | Bacteria | 6838 |
| 207 | Ga0105240_10581974 | 3300009093 | Bacteria | 1235 |
| 208 | Ga0105245_10680866 | 3300009098 | Bacteria | 1060 |
| 209 | Ga0105245_10755680 | 3300009098 | Bacteria | 1008 |
| 210 | Ga0105245_10857082 | 3300009098 | Bacteria | 949 |
| 211 | Ga0105247_10277217 | 3300009101 | Bacteria | 1155 |
| 212 | Ga0114129_10043623 | 3300009147 | Bacteria | 6310 |
| 213 | Ga0105241_10112909 | 3300009174 | Bacteria | 2177 |
| 214 | Ga0105241_10578625 | 3300009174 | Bacteria | 1012 |
| 215 | Ga0105242_10139169 | 3300009176 | Bacteria | 2104 |
| 216 | Ga0105248_10329581 | 3300009177 | Bacteria | 1719 |
| 217 | Ga0105237_10641939 | 3300009545 | Bacteria | 1068 |
| 218 | Ga0105238_10007773 | 3300009551 | Bacteria | 10722 |
| 219 | Ga0105238_10042015 | 3300009551 | Bacteria | 4630 |
| 220 | Ga0105238_10334610 | 3300009551 | Bacteria | 1501 |
| 221 | Ga0105238_10757486 | 3300009551 | Bacteria | 985 |
| 222 | Ga0105249_10156611 | 3300009553 | Bacteria | 2197 |
| 223 | Ga0105249_11010209 | 3300009553 | Bacteria | 901 |
| 224 | Ga0105239_10013308 | 3300010375 | Bacteria | 9143 |
| 225 | Ga0105239_10429826 | 3300010375 | Bacteria | 1497 |
| 226 | Ga0105239_10971086 | 3300010375 | Bacteria | 976 |
| 227 | Ga0105246_10316965 | 3300011119 | Bacteria | 1265 |
| 228 | Ga0157373_10614708 | 3300013100 | Bacteria | 792 |
| 229 | Ga0157370_10061297 | 3300013104 | Bacteria | 3570 |
| 230 | Ga0157370_10079869 | 3300013104 | Bacteria | 3080 |
| 231 | Ga0157370_10148369 | 3300013104 | Bacteria | 2183 |
| 232 | Ga0157369_10012327 | 3300013105 | Bacteria | 9710 |
| 233 | Ga0157369_10013199 | 3300013105 | Bacteria | 9350 |
| 234 | Ga0157369_10113235 | 3300013105 | Bacteria | 2882 |
| 235 | Ga0157369_10330348 | 3300013105 | Bacteria | 1584 |
| 236 | Ga0157369_11026646 | 3300013105 | Bacteria | 844 |
| 237 | Ga0157369_11154996 | 3300013105 | Bacteria | 791 |
| 238 | Ga0157374_10513632 | 3300013296 | Bacteria | 1203 |
| 239 | Ga0157374_10747123 | 3300013296 | Bacteria | 993 |
| 240 | Ga0157374_10774577 | 3300013296 | Bacteria | 975 |
| 241 | Ga0157378_11219616 | 3300013297 | Bacteria | 792 |
| 242 | Ga0163162_10230968 | 3300013306 | Bacteria | 1981 |
| 243 | Ga0163162_11868690 | 3300013306 | Bacteria | 687 |
| 244 | Ga0157372_10452965 | 3300013307 | Bacteria | 1495 |
| 245 | Ga0157372_10472819 | 3300013307 | Bacteria | 1461 |
| 246 | Ga0157372_10556992 | 3300013307 | Bacteria | 1336 |
| 247 | Ga0157375_11563882 | 3300013308 | Bacteria | 779 |
| 248 | Ga0163163_10051682 | 3300014325 | Bacteria | 4051 |
| 249 | Ga0163163_10066420 | 3300014325 | Bacteria | 3582 |
| 250 | Ga0163163_11457722 | 3300014325 | Bacteria | 746 |
| 251 | Ga0157380_10227116 | 3300014326 | Bacteria | 1674 |
| 252 | Ga0157376_10443554 | 3300014969 | Bacteria | 1264 |
| 253 | Ga0157376_11040123 | 3300014969 | Bacteria | 843 |
| 254 | Ga0163161_10142698 | 3300017792 | Bacteria | 1814 |
| 255 | Ga0197907_10482238 | 3300020069 | Bacteria | 873 |
| 256 | Ga0197907_11225397 | 3300020069 | Bacteria | 706 |
| 257 | Ga0206356_11267106 | 3300020070 | Bacteria | 767 |
| 258 | Ga0206355_1215798 | 3300020076 | Bacteria | 706 |
| 259 | Ga0206352_10436581 | 3300020078 | Bacteria | 755 |
| 260 | Ga0206352_11357989 | 3300020078 | Bacteria | 661 |
| 261 | Ga0206350_10949899 | 3300020080 | Bacteria | 703 |
| 262 | Ga0206354_10068295 | 3300020081 | Bacteria | 721 |
| 263 | Ga0206353_11967255 | 3300020082 | Bacteria | 1301 |
| 264 | Ga0213873_10004591 | 3300021358 | Bacteria | 2591 |
| 265 | Ga0213873_10009335 | 3300021358 | Bacteria | 2034 |
| 266 | Ga0213876_10002064 | 3300021384 | Bacteria | 11899 |
| 267 | Ga0213876_10031000 | 3300021384 | Bacteria | 2822 |
| 268 | Ga0213875_10090152 | 3300021388 | Bacteria | 1430 |
| 269 | Ga0213871_10000490 | 3300021441 | Bacteria | 5411 |
| 270 | Ga0224712_10242241 | 3300022467 | Bacteria | 831 |
| 271 | Ga0209233_1002779 | 3300025261 | Bacteria | 6291 |
| 272 | Ga0209455_1011932 | 3300025272 | Bacteria | 2109 |
| 273 | Ga0209758_1010528 | 3300025297 | Bacteria | 5516 |
| 274 | Ga0209758_1025853 | 3300025297 | Bacteria | 2562 |
| 275 | Ga0207653_10043757 | 3300025885 | Bacteria | 1475 |
| 276 | Ga0207692_10002972 | 3300025898 | Bacteria | 6568 |
| 277 | Ga0207692_10008204 | 3300025898 | Bacteria | 4317 |
| 278 | Ga0207692_10030002 | 3300025898 | Bacteria | 2589 |
| 279 | Ga0207642_10311043 | 3300025899 | Bacteria | 917 |
| 280 | Ga0207688_10470209 | 3300025901 | Bacteria | 785 |
| 281 | Ga0207680_10274615 | 3300025903 | Bacteria | 1170 |
| 282 | Ga0207647_10076385 | 3300025904 | Bacteria | 2015 |
| 283 | Ga0207647_10348943 | 3300025904 | Bacteria | 838 |
| 284 | Ga0207685_10110293 | 3300025905 | Bacteria | 1192 |
| 285 | Ga0207685_10451964 | 3300025905 | Bacteria | 668 |
| 286 | Ga0207699_10005733 | 3300025906 | Bacteria | 5973 |
| 287 | Ga0207699_10094679 | 3300025906 | Bacteria | 1882 |
| 288 | Ga0207699_10527185 | 3300025906 | Bacteria | 855 |
| 289 | Ga0207699_10794527 | 3300025906 | Bacteria | 695 |
| 290 | Ga0207645_10111875 | 3300025907 | Bacteria | 1768 |
| 291 | Ga0207645_10336235 | 3300025907 | Bacteria | 1009 |
| 292 | Ga0207705_10134297 | 3300025909 | Bacteria | 1844 |
| 293 | Ga0207705_11212792 | 3300025909 | Bacteria | 578 |
| 294 | Ga0207654_10024224 | 3300025911 | Bacteria | 3261 |
| 295 | Ga0207707_10002162 | 3300025912 | Bacteria | 17780 |
| 296 | Ga0207707_10005294 | 3300025912 | Bacteria | 11286 |
| 297 | Ga0207707_10404715 | 3300025912 | Bacteria | 1171 |
| 298 | Ga0207707_10437690 | 3300025912 | Bacteria | 1119 |
| 299 | Ga0207707_10661325 | 3300025912 | Bacteria | 880 |
| 300 | Ga0207695_10027026 | 3300025913 | Bacteria | 6394 |
| 301 | Ga0207695_10054704 | 3300025913 | Bacteria | 4165 |
| 302 | Ga0207695_10085563 | 3300025913 | Bacteria | 3181 |
| 303 | Ga0207695_10240938 | 3300025913 | Bacteria | 1710 |
| 304 | Ga0207671_10012964 | 3300025914 | Bacteria | 6670 |
| 305 | Ga0207671_10703067 | 3300025914 | Bacteria | 804 |
| 306 | Ga0207671_11076284 | 3300025914 | Bacteria | 632 |
| 307 | Ga0207693_10004007 | 3300025915 | Bacteria | 12519 |
| 308 | Ga0207693_10009468 | 3300025915 | Bacteria | 7934 |
| 309 | Ga0207693_10009993 | 3300025915 | Bacteria | 7715 |
| 310 | Ga0207693_10063412 | 3300025915 | Bacteria | 2895 |
| 311 | Ga0207693_10242502 | 3300025915 | Bacteria | 1415 |
| 312 | Ga0207693_10344250 | 3300025915 | Bacteria | 1167 |
| 313 | Ga0207663_10010172 | 3300025916 | Bacteria | 4995 |
| 314 | Ga0207663_10056128 | 3300025916 | Bacteria | 2475 |
| 315 | Ga0207663_10156346 | 3300025916 | Bacteria | 1604 |
| 316 | Ga0207660_10161258 | 3300025917 | Bacteria | 1730 |
| 317 | Ga0207660_10185538 | 3300025917 | Bacteria | 1617 |
| 318 | Ga0207660_10286300 | 3300025917 | Bacteria | 1309 |
| 319 | Ga0207660_10502286 | 3300025917 | Bacteria | 984 |
| 320 | Ga0207657_10008647 | 3300025919 | Bacteria | 10306 |
| 321 | Ga0207657_10228648 | 3300025919 | Bacteria | 1488 |
| 322 | Ga0207657_10445895 | 3300025919 | Bacteria | 1016 |
| 323 | Ga0207649_10176590 | 3300025920 | Bacteria | 1492 |
| 324 | Ga0207649_10467497 | 3300025920 | Bacteria | 954 |
| 325 | Ga0207649_10761871 | 3300025920 | Bacteria | 754 |
| 326 | Ga0207652_10013564 | 3300025921 | Bacteria | 6591 |
| 327 | Ga0207652_10039725 | 3300025921 | Bacteria | 3994 |
| 328 | Ga0207652_10106404 | 3300025921 | Bacteria | 2483 |
| 329 | Ga0207652_10177471 | 3300025921 | Bacteria | 1913 |
| 330 | Ga0207652_10350452 | 3300025921 | Bacteria | 1332 |
| 331 | Ga0207681_10273572 | 3300025923 | Bacteria | 1327 |
| 332 | Ga0207694_10031537 | 3300025924 | Bacteria | 4049 |
| 333 | Ga0207694_10048565 | 3300025924 | Bacteria | 3284 |
| 334 | Ga0207694_10119947 | 3300025924 | Bacteria | 2099 |
| 335 | Ga0207694_10234551 | 3300025924 | Bacteria | 1499 |
| 336 | Ga0207694_10321344 | 3300025924 | Bacteria | 1277 |
| 337 | Ga0207659_10551777 | 3300025926 | Bacteria | 979 |
| 338 | Ga0207659_10675924 | 3300025926 | Bacteria | 883 |
| 339 | Ga0207687_10013836 | 3300025927 | Bacteria | 5270 |
| 340 | Ga0207687_10052637 | 3300025927 | Bacteria | 2842 |
| 341 | Ga0207687_10286140 | 3300025927 | Bacteria | 1323 |
| 342 | Ga0207700_10008050 | 3300025928 | Bacteria | 6500 |
| 343 | Ga0207700_10078205 | 3300025928 | Bacteria | 2572 |
| 344 | Ga0207700_10165094 | 3300025928 | Bacteria | 1842 |
| 345 | Ga0207700_10392223 | 3300025928 | Bacteria | 1215 |
| 346 | Ga0207700_10419375 | 3300025928 | Bacteria | 1175 |
| 347 | Ga0207700_11304046 | 3300025928 | Bacteria | 647 |
| 348 | Ga0207664_10010392 | 3300025929 | Bacteria | 6574 |
| 349 | Ga0207664_11375967 | 3300025929 | Bacteria | 626 |
| 350 | Ga0207690_10378503 | 3300025932 | Bacteria | 1124 |
| 351 | Ga0207706_10317750 | 3300025933 | Bacteria | 1355 |
| 352 | Ga0207686_10124640 | 3300025934 | Bacteria | 1759 |
| 353 | Ga0207709_10022329 | 3300025935 | Bacteria | 3589 |
| 354 | Ga0207709_10085086 | 3300025935 | Bacteria | 2049 |
| 355 | Ga0207709_10291770 | 3300025935 | Bacteria | 1209 |
| 356 | Ga0207709_10338661 | 3300025935 | Bacteria | 1131 |
| 357 | Ga0207670_10407696 | 3300025936 | Bacteria | 1088 |
| 358 | Ga0207669_10117923 | 3300025937 | Bacteria | 1795 |
| 359 | Ga0207669_10491398 | 3300025937 | Bacteria | 980 |
| 360 | Ga0207704_10123604 | 3300025938 | Bacteria | 1777 |
| 361 | Ga0207704_10270825 | 3300025938 | Bacteria | 1286 |
| 362 | Ga0207665_10002028 | 3300025939 | Bacteria | 13631 |
| 363 | Ga0207665_10115974 | 3300025939 | Bacteria | 1887 |
| 364 | Ga0207665_10205865 | 3300025939 | Bacteria | 1435 |
| 365 | Ga0207665_10253265 | 3300025939 | Bacteria | 1302 |
| 366 | Ga0207665_10558601 | 3300025939 | Bacteria | 890 |
| 367 | Ga0207665_10590132 | 3300025939 | Bacteria | 867 |
| 368 | Ga0207691_10482785 | 3300025940 | Bacteria | 1053 |
| 369 | Ga0207711_10310988 | 3300025941 | Bacteria | 1455 |
| 370 | Ga0207711_10611101 | 3300025941 | Bacteria | 1017 |
| 371 | Ga0207689_10081964 | 3300025942 | Bacteria | 2652 |
| 372 | Ga0207689_10593662 | 3300025942 | Bacteria | 931 |
| 373 | Ga0207661_10004540 | 3300025944 | Bacteria | 9726 |
| 374 | Ga0207661_10006444 | 3300025944 | Bacteria | 8298 |
| 375 | Ga0207661_10501990 | 3300025944 | Bacteria | 1108 |
| 376 | Ga0207661_10752271 | 3300025944 | Bacteria | 897 |
| 377 | Ga0207667_10013617 | 3300025949 | Bacteria | 9297 |
| 378 | Ga0207667_10029690 | 3300025949 | Bacteria | 5925 |
| 379 | Ga0207667_10076087 | 3300025949 | Bacteria | 3484 |
| 380 | Ga0207667_10496673 | 3300025949 | Bacteria | 1238 |
| 381 | Ga0207667_10865519 | 3300025949 | Bacteria | 897 |
| 382 | Ga0207712_10042423 | 3300025961 | Bacteria | 3132 |
| 383 | Ga0207712_11173602 | 3300025961 | Bacteria | 685 |
| 384 | Ga0207668_10062725 | 3300025972 | Bacteria | 2618 |
| 385 | Ga0207668_10117798 | 3300025972 | Bacteria | 2005 |
| 386 | Ga0207668_10487738 | 3300025972 | Bacteria | 1058 |
| 387 | Ga0207640_10016570 | 3300025981 | Bacteria | 4290 |
| 388 | Ga0207640_11113810 | 3300025981 | Bacteria | 699 |
| 389 | Ga0207658_10329549 | 3300025986 | Bacteria | 1324 |
| 390 | Ga0207658_11477781 | 3300025986 | Bacteria | 622 |
| 391 | Ga0207677_10067541 | 3300026023 | Bacteria | 2505 |
| 392 | Ga0207677_10378830 | 3300026023 | Bacteria | 1194 |
| 393 | Ga0207703_10162751 | 3300026035 | Bacteria | 1956 |
| 394 | Ga0207703_10656164 | 3300026035 | Bacteria | 996 |
| 395 | Ga0207703_10746145 | 3300026035 | Bacteria | 933 |
| 396 | Ga0207639_10031167 | 3300026041 | Bacteria | 3917 |
| 397 | Ga0207639_10126624 | 3300026041 | Bacteria | 2108 |
| 398 | Ga0207639_10271183 | 3300026041 | Bacteria | 1488 |
| 399 | Ga0207639_10333333 | 3300026041 | Bacteria | 1351 |
| 400 | Ga0207639_10391767 | 3300026041 | Bacteria | 1250 |
| 401 | Ga0207678_10010954 | 3300026067 | Bacteria | 7969 |
| 402 | Ga0207678_10045772 | 3300026067 | Bacteria | 3783 |
| 403 | Ga0207678_10053837 | 3300026067 | Bacteria | 3467 |
| 404 | Ga0207678_10066420 | 3300026067 | Bacteria | 3097 |
| 405 | Ga0207678_10693967 | 3300026067 | Bacteria | 896 |
| 406 | Ga0207702_10000514 | 3300026078 | Bacteria | 43618 |
| 407 | Ga0207702_10624719 | 3300026078 | Bacteria | 1058 |
| 408 | Ga0207648_10049340 | 3300026089 | Bacteria | 3683 |
| 409 | Ga0207648_10525823 | 3300026089 | Bacteria | 1084 |
| 410 | Ga0207676_10019625 | 3300026095 | Bacteria | 4934 |
| 411 | Ga0207676_10512021 | 3300026095 | Bacteria | 1141 |
| 412 | Ga0207674_10048184 | 3300026116 | Bacteria | 4362 |
| 413 | Ga0207674_10521377 | 3300026116 | Bacteria | 1148 |
| 414 | Ga0207675_100037613 | 3300026118 | Bacteria | 4513 |
| 415 | Ga0207675_100070222 | 3300026118 | Bacteria | 3273 |
| 416 | Ga0207683_10021505 | 3300026121 | Bacteria | 5525 |
| 417 | Ga0207683_10128052 | 3300026121 | Bacteria | 2283 |
| 418 | Ga0207683_10700350 | 3300026121 | Bacteria | 939 |
| 419 | Ga0207683_11003797 | 3300026121 | Bacteria | 775 |
| 420 | Ga0207698_10057798 | 3300026142 | Bacteria | 3003 |
| 421 | Ga0207698_10469412 | 3300026142 | Bacteria | 1218 |
| 422 | Ga0207698_10703187 | 3300026142 | Bacteria | 1006 |
| 423 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 424 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 425 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 426 | Ga0209179_1000570 | 3300027512 | Bacteria | 3866 |
| 427 | Ga0209588_1046767 | 3300027671 | Bacteria | 1400 |
| 428 | Ga0268266_10005838 | 3300028379 | Bacteria | 11389 |
| 429 | Ga0268266_10156331 | 3300028379 | Bacteria | 2060 |
| 430 | Ga0268266_10192118 | 3300028379 | Bacteria | 1864 |
| 431 | Ga0268266_11375680 | 3300028379 | Bacteria | 681 |
| 432 | Ga0268266_11655517 | 3300028379 | Bacteria | 615 |
| 433 | Ga0268265_10268494 | 3300028380 | Bacteria | 1520 |
| 434 | Ga0268265_10719307 | 3300028380 | Bacteria | 966 |
| 435 | Ga0265334_10016514 | 3300028573 | Bacteria | 3053 |
| 436 | Ga0307515_10054329 | 3300028794 | Bacteria | 5883 |
| 437 | Ga0307515_10204476 | 3300028794 | Bacteria | 1840 |
| 438 | Ga0307515_10763341 | 3300028794 | Bacteria | 587 |
| 439 | Ga0307512_10301481 | 3300030522 | Bacteria | 746 |
| 440 | Ga0265760_10084633 | 3300031090 | Bacteria | 986 |
| 441 | Ga0265332_10008158 | 3300031238 | Bacteria | 4710 |
| 442 | Ga0265328_10031392 | 3300031239 | Bacteria | 1974 |
| 443 | Ga0265340_10018482 | 3300031247 | Bacteria | 3594 |
| 444 | Ga0265339_10040049 | 3300031249 | Bacteria | 2606 |
| 445 | Ga0265331_10101405 | 3300031250 | Bacteria | 1324 |
| 446 | Ga0265316_10107714 | 3300031344 | Bacteria | 2113 |
| 447 | Ga0265316_10271313 | 3300031344 | Bacteria | 1241 |
| 448 | Ga0307513_10105798 | 3300031456 | Bacteria | 2821 |
| 449 | Ga0307408_100853722 | 3300031548 | Bacteria | 830 |
| 450 | Ga0307508_10045726 | 3300031616 | Bacteria | 3910 |
| 451 | Ga0265314_10015497 | 3300031711 | Bacteria | 6048 |
| 452 | Ga0265314_10061194 | 3300031711 | Bacteria | 2565 |
| 453 | Ga0265314_10113147 | 3300031711 | Bacteria | 1721 |
| 454 | Ga0265314_10124452 | 3300031711 | Bacteria | 1617 |
| 455 | Ga0265342_10010500 | 3300031712 | Bacteria | 6417 |
| 456 | Ga0265342_10036461 | 3300031712 | Bacteria | 3004 |
| 457 | Ga0307516_10072595 | 3300031730 | Bacteria | 3300 |
| 458 | Ga0307516_10075437 | 3300031730 | Bacteria | 3226 |
| 459 | Ga0307516_10427281 | 3300031730 | Bacteria | 982 |
| 460 | Ga0307413_10328219 | 3300031824 | Bacteria | 1172 |
| 461 | Ga0307413_11040531 | 3300031824 | Bacteria | 704 |
| 462 | Ga0307410_10783535 | 3300031852 | Bacteria | 810 |
| 463 | Ga0307406_10443469 | 3300031901 | Bacteria | 1040 |
| 464 | Ga0307406_10528755 | 3300031901 | Bacteria | 961 |
| 465 | Ga0307406_10641596 | 3300031901 | Bacteria | 880 |
| 466 | Ga0307412_10211313 | 3300031911 | Bacteria | 1481 |
| 467 | Ga0307412_10508815 | 3300031911 | Bacteria | 1004 |
| 468 | Ga0307416_100205834 | 3300032002 | Bacteria | 1872 |
| 469 | Ga0307411_10305237 | 3300032005 | Bacteria | 1278 |
| 470 | Ga0307415_100077941 | 3300032126 | Bacteria | 2355 |
| 471 | Ga0307415_100258870 | 3300032126 | Bacteria | 1418 |
| 472 | Ga0307415_100289060 | 3300032126 | Bacteria | 1352 |
| 473 | Ga0307510_10005379 | 3300033180 | Bacteria | 15241 |
| 474 | Ga0307510_10083698 | 3300033180 | Bacteria | 3078 |
| 475 | Ga0307510_10315969 | 3300033180 | Bacteria | 1020 |
| 476 | Ga0315911_1000015 | 3300033442 | Bacteria | 185247 |
| 477 | Ga0373930_0102633 | 3300034816 | Bacteria | 681 |
| 478 | Ga0373938_0059947 | 3300034957 | Bacteria | 888 |
| 479 | Ga0373926_0127308 | 3300035083 | Bacteria | 963 |
| 480 | Ga0373934_0008069 | 3300035086 | Bacteria | 3919 |
| 481 | Ga0373934_0120402 | 3300035086 | Bacteria | 1067 |
| 482 | Ga0373934_0171130 | 3300035086 | Bacteria | 892 |
| 483 | Ga0373944_0176156 | 3300035089 | Bacteria | 765 |
| 484 | Ga0373952_0105271 | 3300035092 | Bacteria | 749 |
| 485 | Ga0373923_0010770 | 3300035111 | Bacteria | 3337 |
| 486 | Ga0373923_0157577 | 3300035111 | Bacteria | 1034 |
| 487 | Ga0373932_0068821 | 3300035112 | Bacteria | 1093 |
| 488 | Ga0373936_0025118 | 3300035113 | Bacteria | 2328 |
| 489 | Ga0373936_0044108 | 3300035113 | Bacteria | 1794 |
| 490 | Ga0373936_0085085 | 3300035113 | Bacteria | 1320 |
| 491 | Ga0373941_0050835 | 3300035115 | Bacteria | 1317 |
| 492 | Ga0373945_0015999 | 3300035116 | Bacteria | 2528 |
| 493 | Ga0373953_0081691 | 3300035117 | Bacteria | 1344 |
| 494 | Ga0373953_0128586 | 3300035117 | Bacteria | 1079 |
| 495 | Ga0373953_0421904 | 3300035117 | Bacteria | 588 |
| 496 | Ga0373954_0003254 | 3300035118 | Bacteria | 6857 |
| 497 | Ga0373954_0013871 | 3300035118 | Bacteria | 3592 |
| 498 | Ga0373954_0050144 | 3300035118 | Bacteria | 1958 |
| 499 | Ga0373956_0244077 | 3300035119 | Bacteria | 854 |
| 500 | Ga0373957_0161379 | 3300035120 | Bacteria | 923 |
| 501 | Ga0373943_0077832 | 3300035170 | Bacteria | 1694 |
| 502 | Ga0373943_0192461 | 3300035170 | Bacteria | 1125 |
| 503 | Ga0373946_0055424 | 3300035171 | Bacteria | 1671 |
| 504 | Ga0373946_0061132 | 3300035171 | Bacteria | 1603 |
| 505 | Ga0373946_0192923 | 3300035171 | Bacteria | 972 |
| 506 | Ga0373946_0193549 | 3300035171 | Bacteria | 971 |
| 507 | Ga0373955_0019007 | 3300035172 | Bacteria | 3427 |
| 508 | Ga0373955_0034453 | 3300035172 | Bacteria | 2674 |
| 509 | Ga0373942_0136365 | 3300035207 | Bacteria | 778 |
| 510 | Ga0373962_0060838 | 3300035242 | Bacteria | 1109 |
| 511 | Ga0373924_0020154 | 3300035410 | Bacteria | 2589 |
| 512 | Ga0373924_0071056 | 3300035410 | Bacteria | 1468 |
| 513 | Ga0373931_0002294 | 3300035691 | Bacteria | 8454 |
| 514 | Ga0373935_0012074 | 3300035692 | Bacteria | 5192 |
| 515 | Ga0373935_0047436 | 3300035692 | Bacteria | 2716 |
| 516 | Ga0373935_0107938 | 3300035692 | Bacteria | 1844 |
| 517 | Ga0373935_0144774 | 3300035692 | Bacteria | 1608 |
| 518 | Ga0373927_0012034 | 3300035695 | Bacteria | 5755 |
| 519 | Ga0373927_0033415 | 3300035695 | Bacteria | 3349 |
| 520 | Ga0373927_0187178 | 3300035695 | Bacteria | 1358 |
| 521 | Ga0373927_0287620 | 3300035695 | Bacteria | 1082 |
| 522 | Ga0373933_0000784 | 3300035724 | Bacteria | 19397 |
| 523 | Ga0373933_0002702 | 3300035724 | Bacteria | 9936 |
| 524 | Ga0373933_0024423 | 3300035724 | Bacteria | 3460 |
| 525 | Ga0373933_0391771 | 3300035724 | Bacteria | 905 |
| 526 | Ga0373933_0625609 | 3300035724 | Bacteria | 707 |
| 527 | Ga0373933_0792884 | 3300035724 | Bacteria | 623 |
| 528 | Ga0373947_0006075 | 3300035725 | Bacteria | 7038 |
| 529 | Ga0373947_0018523 | 3300035725 | Bacteria | 4008 |
| 530 | Ga0373947_0100020 | 3300035725 | Bacteria | 1821 |
| 531 | Ga0373937_0013724 | 3300036401 | Bacteria | 7139 |
| 532 | Ga0373937_0629745 | 3300036401 | Bacteria | 1018 |
| 533 | Ga0373937_0678128 | 3300036401 | Bacteria | 977 |
| 534 | Ga0373937_0915674 | 3300036401 | Bacteria | 825 |
| 535 | Ga0373925_0028352 | 3300037068 | Bacteria | 4102 |
| 536 | Ga0373925_0031318 | 3300037068 | Bacteria | 3908 |
| 537 | Ga0373925_0062447 | 3300037068 | Bacteria | 2801 |
| 538 | Ga0395899_0138645 | 3300037312 | Bacteria | 1732 |
| 539 | Ga0395900_0049784 | 3300037418 | Bacteria | 4317 |
| 540 | Ga0395900_0311332 | 3300037418 | Bacteria | 1558 |
| 541 | Ga0395898_0055824 | 3300037466 | Bacteria | 3852 |
| 542 | Ga0395898_0103771 | 3300037466 | Bacteria | 2727 |
| 543 | Ga0395905_0069858 | 3300037471 | Bacteria | 3290 |
| 544 | Ga0436364_0881658 | 3300037853 | Bacteria | 1656 |
| 545 | Ga0436364_1111914 | 3300037853 | Bacteria | 2129 |
| 546 | Ga0395901_0387541 | 3300038443 | Bacteria | 1437 |
| 547 | Ga0436365_0564143 | 3300039437 | Bacteria | 2450 |
| 548 | Ga0436365_0972944 | 3300039437 | Bacteria | 3362 |
| 549 | Ga0436365_1342005 | 3300039437 | Bacteria | 11459 |
| 550 | Ga0436365_1493072 | 3300039437 | Bacteria | 8985 |
| 551 | Ga0436365_1883175 | 3300039437 | Bacteria | 1493 |
| 552 | Ga0436360_0879024 | 3300039438 | Bacteria | 977 |
| 553 | Ga0436361_0964292 | 3300039447 | Bacteria | 1654 |
| 554 | Ga0436363_0039534 | 3300039450 | Bacteria | 3177 |
| 555 | Ga0436363_0296726 | 3300039450 | Bacteria | 920 |
| 556 | Ga0436363_0557724 | 3300039450 | Bacteria | 1048 |
| 557 | Ga0436362_0009437 | 3300039453 | Bacteria | 1971 |
| 558 | Ga0436362_0953067 | 3300039453 | Bacteria | 5962 |
| 559 | Ga0439465_0020470 | 3300041413 | Bacteria | 2073 |
| 560 | Ga0451833_0686916 | 3300041491 | Bacteria | 606 |
| 561 | Ga0451839_0697962 | 3300041496 | Bacteria | 590 |
| 562 | Ga0439459_0022873 | 3300042438 | Bacteria | 1213 |
| 563 | Ga0466970_0255650 | 3300044765 | Bacteria | 982 |
| 564 | Ga0466957_0059062 | 3300044842 | Bacteria | 2350 |
| 565 | Ga0466957_0392866 | 3300044842 | Bacteria | 948 |
| 566 | Ga0466959_0044336 | 3300045049 | Bacteria | 3278 |
| 567 | Ga0466967_0101592 | 3300045976 | Bacteria | 2629 |
| 568 | Ga0466967_0357537 | 3300045976 | Bacteria | 1414 |
| 569 | Ga0466967_0432291 | 3300045976 | Bacteria | 1284 |
| 570 | Ga0466967_0589444 | 3300045976 | Bacteria | 1096 |
| 571 | Ga0466967_1495507 | 3300045976 | Bacteria | 673 |
| 572 | Ga0495617_020141 | 3300046452 | Bacteria | 2254 |
| 573 | Ga0495592_0057714 | 3300046454 | Bacteria | 2865 |
| 574 | Ga0495592_0420691 | 3300046454 | Bacteria | 843 |
| 575 | Ga0495603_0008752 | 3300046455 | Bacteria | 6120 |
| 576 | Ga0495603_0049995 | 3300046455 | Bacteria | 2487 |
| 577 | Ga0495603_0159059 | 3300046455 | Bacteria | 1310 |
| 578 | Ga0495629_0002984 | 3300046459 | Bacteria | 12864 |
| 579 | Ga0495629_0035847 | 3300046459 | Bacteria | 3504 |
| 580 | Ga0495641_0018784 | 3300046461 | Bacteria | 3558 |
| 581 | Ga0495651_0036567 | 3300046462 | Bacteria | 3823 |
| 582 | Ga0495651_0060367 | 3300046462 | Bacteria | 2904 |
| 583 | Ga0495653_0028021 | 3300046463 | Bacteria | 4508 |
| 584 | Ga0495653_0232128 | 3300046463 | Bacteria | 1234 |
| 585 | Ga0495653_0537577 | 3300046463 | Bacteria | 724 |
| 586 | Ga0495650_0096464 | 3300046471 | Bacteria | 1116 |
| 587 | Ga0495580_0098534 | 3300046472 | Bacteria | 2033 |
| 588 | Ga0495582_0080477 | 3300046473 | Bacteria | 1809 |
| 589 | Ga0495582_0282995 | 3300046473 | Bacteria | 952 |
| 590 | Ga0495639_0003042 | 3300046475 | Bacteria | 7301 |
| 591 | Ga0495639_0007837 | 3300046475 | Bacteria | 4591 |
| 592 | Ga0495639_0042858 | 3300046475 | Bacteria | 2043 |
| 593 | Ga0495639_0103382 | 3300046475 | Bacteria | 1347 |
| 594 | Ga0495662_0034440 | 3300046476 | Bacteria | 2444 |
| 595 | Ga0495662_0103228 | 3300046476 | Bacteria | 1395 |
| 596 | Ga0495662_0114892 | 3300046476 | Bacteria | 1320 |
| 597 | Ga0495664_0129187 | 3300046477 | Bacteria | 1529 |
| 598 | Ga0495664_0156356 | 3300046477 | Bacteria | 1383 |
| 599 | Ga0495594_0020690 | 3300046499 | Bacteria | 3506 |
| 600 | Ga0495594_0096208 | 3300046499 | Bacteria | 1663 |
| 601 | Ga0495594_0398184 | 3300046499 | Bacteria | 783 |
| 602 | Ga0495594_0414886 | 3300046499 | Bacteria | 766 |
| 603 | Ga0495596_0022344 | 3300046500 | Bacteria | 2576 |
| 604 | Ga0495583_0112530 | 3300046506 | Bacteria | 1152 |
| 605 | Ga0495606_0003350 | 3300046507 | Bacteria | 17079 |
| 606 | Ga0495608_0183608 | 3300046511 | Bacteria | 1323 |
| 607 | Ga0495608_0189832 | 3300046511 | Bacteria | 1297 |
| 608 | Ga0495618_0054775 | 3300046514 | Bacteria | 2525 |
| 609 | Ga0495618_0166821 | 3300046514 | Bacteria | 1402 |
| 610 | Ga0495618_0253407 | 3300046514 | Bacteria | 1104 |
| 611 | Ga0495620_0068670 | 3300046515 | Bacteria | 1455 |
| 612 | Ga0495628_0018851 | 3300046516 | Bacteria | 5712 |
| 613 | Ga0495628_0037867 | 3300046516 | Bacteria | 3864 |
| 614 | Ga0495628_0076373 | 3300046516 | Bacteria | 2607 |
| 615 | Ga0495628_0577615 | 3300046516 | Bacteria | 805 |
| 616 | Ga0495630_0059721 | 3300046517 | Bacteria | 2861 |
| 617 | Ga0495630_0098848 | 3300046517 | Bacteria | 2208 |
| 618 | Ga0495630_0430695 | 3300046517 | Bacteria | 1011 |
| 619 | Ga0495630_0762626 | 3300046517 | Bacteria | 739 |
| 620 | Ga0495632_0158599 | 3300046519 | Bacteria | 1043 |
| 621 | Ga0495632_0192772 | 3300046519 | Bacteria | 930 |
| 622 | Ga0495632_0274205 | 3300046519 | Bacteria | 752 |
| 623 | Ga0495644_0043821 | 3300046523 | Bacteria | 1683 |
| 624 | Ga0495648_0005396 | 3300046524 | Bacteria | 10629 |
| 625 | Ga0495666_0090625 | 3300046526 | Bacteria | 1443 |
| 626 | Ga0495642_0041301 | 3300046528 | Bacteria | 1876 |
| 627 | Ga0495652_0141008 | 3300046529 | Bacteria | 1895 |
| 628 | Ga0495652_0273775 | 3300046529 | Bacteria | 1239 |
| 629 | Ga0495652_0314817 | 3300046529 | Bacteria | 1133 |
| 630 | Ga0495665_0048993 | 3300046531 | Bacteria | 2240 |
| 631 | Ga0495665_0072348 | 3300046531 | Bacteria | 1816 |
| 632 | Ga0495665_0260691 | 3300046531 | Bacteria | 891 |
| 633 | Ga0495665_0289521 | 3300046531 | Bacteria | 840 |
| 634 | Ga0495640_0031105 | 3300046533 | Bacteria | 3813 |
| 635 | Ga0495640_0043124 | 3300046533 | Bacteria | 3143 |
| 636 | Ga0495640_0197990 | 3300046533 | Bacteria | 1274 |
| 637 | Ga0495640_0501708 | 3300046533 | Bacteria | 738 |
| 638 | Ga0495586_0084345 | 3300046535 | Bacteria | 1749 |
| 639 | Ga0495587_0070229 | 3300046536 | Bacteria | 2038 |
| 640 | Ga0495609_0127835 | 3300046538 | Bacteria | 1090 |
| 641 | Ga0495609_0128949 | 3300046538 | Bacteria | 1084 |
| 642 | Ga0495645_0024397 | 3300046543 | Bacteria | 4388 |
| 643 | Ga0495645_0187646 | 3300046543 | Bacteria | 1411 |
| 644 | Ga0495622_0015653 | 3300046557 | Bacteria | 3526 |
| 645 | Ga0495622_0035408 | 3300046557 | Bacteria | 2328 |
| 646 | Ga0495667_0035702 | 3300046559 | Bacteria | 3321 |
| 647 | Ga0495667_0122295 | 3300046559 | Bacteria | 1680 |
| 648 | Ga0495667_0146376 | 3300046559 | Bacteria | 1521 |
| 649 | Ga0495667_0785906 | 3300046559 | Bacteria | 587 |
| 650 | Ga0495656_0137787 | 3300046615 | Bacteria | 1167 |
| 651 | Ga0495656_0189032 | 3300046615 | Bacteria | 1016 |
| 652 | Ga0495668_0464903 | 3300046616 | Bacteria | 696 |
| 653 | Ga0495634_0005863 | 3300046642 | Bacteria | 9385 |
| 654 | Ga0495634_0038694 | 3300046642 | Bacteria | 3251 |
| 655 | Ga0495634_0096854 | 3300046642 | Bacteria | 1910 |
| 656 | Ga0495634_0164285 | 3300046642 | Bacteria | 1398 |
| 657 | Ga0495625_0621482 | 3300046660 | Bacteria | 646 |
| 658 | Ga0495635_0004233 | 3300046663 | Bacteria | 9950 |
| 659 | Ga0495635_0058430 | 3300046663 | Bacteria | 2653 |
| 660 | Ga0495659_0008839 | 3300046664 | Bacteria | 3208 |
| 661 | Ga0495659_0104801 | 3300046664 | Bacteria | 1099 |
| 662 | Ga0495659_0250466 | 3300046664 | Bacteria | 738 |
| 663 | Ga0495661_0195600 | 3300046665 | Bacteria | 1062 |
| 664 | Ga0495588_0020627 | 3300046674 | Bacteria | 3242 |
| 665 | Ga0495657_0025879 | 3300046675 | Bacteria | 4162 |
| 666 | Ga0495657_0063786 | 3300046675 | Bacteria | 2429 |
| 667 | Ga0495657_0327290 | 3300046675 | Bacteria | 910 |
| 668 | Ga0495599_0018837 | 3300046678 | Bacteria | 4302 |
| 669 | Ga0495599_0080476 | 3300046678 | Bacteria | 2034 |
| 670 | Ga0495599_0145712 | 3300046678 | Bacteria | 1468 |
| 671 | Ga0495623_0006324 | 3300046679 | Bacteria | 7698 |
| 672 | Ga0495623_0238414 | 3300046679 | Bacteria | 1028 |
| 673 | Ga0495646_0017450 | 3300046680 | Bacteria | 4553 |
| 674 | Ga0495646_0046764 | 3300046680 | Bacteria | 2636 |
| 675 | Ga0495646_0118960 | 3300046680 | Bacteria | 1496 |
| 676 | Ga0495647_0013604 | 3300046681 | Bacteria | 2823 |
| 677 | Ga0495647_0120523 | 3300046681 | Bacteria | 1103 |
| 678 | Ga0495658_0087659 | 3300046683 | Bacteria | 1838 |
| 679 | Ga0495658_0300810 | 3300046683 | Bacteria | 1015 |
| 680 | Ga0495658_0348775 | 3300046683 | Bacteria | 941 |
| 681 | Ga0495669_0006974 | 3300046684 | Bacteria | 4731 |
| 682 | Ga0495669_0049594 | 3300046684 | Bacteria | 1880 |
| 683 | Ga0495669_0118974 | 3300046684 | Bacteria | 1237 |
| 684 | Ga0495613_0106646 | 3300046689 | Bacteria | 2021 |
| 685 | Ga0495613_0213921 | 3300046689 | Bacteria | 1355 |
| 686 | Ga0495613_0880490 | 3300046689 | Bacteria | 580 |
| 687 | Ga0495624_0039316 | 3300046690 | Bacteria | 3033 |
| 688 | Ga0495624_0130355 | 3300046690 | Bacteria | 1542 |
| 689 | Ga0495624_0373061 | 3300046690 | Bacteria | 858 |
| 690 | Ga0495670_0088380 | 3300046691 | Bacteria | 1584 |
| 691 | Ga0495670_0112902 | 3300046691 | Bacteria | 1407 |
| 692 | Ga0495589_0212256 | 3300046794 | Bacteria | 911 |
| 693 | Ga0495600_0100555 | 3300046809 | Bacteria | 1885 |
| 694 | Ga0495600_0240484 | 3300046809 | Bacteria | 1154 |
| 695 | Ga0495600_0246640 | 3300046809 | Bacteria | 1137 |
| 696 | Ga0495600_0777507 | 3300046809 | Bacteria | 572 |
| 697 | Ga0495660_0233494 | 3300046810 | Bacteria | 861 |
| 698 | Ga0495581_0022509 | 3300047315 | Bacteria | 3652 |
| 699 | Ga0495581_0039231 | 3300047315 | Bacteria | 2741 |
| 700 | Ga0495581_0056334 | 3300047315 | Bacteria | 2269 |
| 701 | Ga0495581_0133443 | 3300047315 | Bacteria | 1447 |
| 702 | Ga0495604_0093644 | 3300047317 | Bacteria | 2222 |
| 703 | Ga0495604_0098991 | 3300047317 | Bacteria | 2147 |
| 704 | Ga0495604_0103732 | 3300047317 | Bacteria | 2085 |
| 705 | Ga0495604_0282157 | 3300047317 | Bacteria | 1122 |
| 706 | Ga0495604_0417447 | 3300047317 | Bacteria | 881 |
| 707 | Ga0495604_0430065 | 3300047317 | Bacteria | 865 |
| 708 | Ga0495604_0459204 | 3300047317 | Bacteria | 831 |
| 709 | Ga0495636_0050243 | 3300047318 | Bacteria | 1745 |
| 710 | Ga0495674_0066189 | 3300047319 | Bacteria | 3136 |
| 711 | Ga0495674_0087507 | 3300047319 | Bacteria | 2666 |
| 712 | Ga0495674_0119336 | 3300047319 | Bacteria | 2229 |
| 713 | Ga0495674_1008512 | 3300047319 | Bacteria | 638 |
| 714 | Ga0495672_0053768 | 3300047320 | Bacteria | 2357 |
| 715 | Ga0495672_0206616 | 3300047320 | Bacteria | 978 |
| 716 | Ga0495676_0050003 | 3300047321 | Bacteria | 3356 |
| 717 | Ga0495680_0152660 | 3300047322 | Bacteria | 1682 |
| 718 | Ga0495680_0406147 | 3300047322 | Bacteria | 939 |
| 719 | Ga0495675_0037487 | 3300047444 | Bacteria | 3087 |
| 720 | Ga0495675_0039044 | 3300047444 | Bacteria | 3023 |
| 721 | Ga0495675_0377973 | 3300047444 | Bacteria | 829 |
| 722 | Ga0495679_063429 | 3300047446 | Bacteria | 1079 |
| 723 | Ga0495673_0121565 | 3300047469 | Bacteria | 1034 |
| 724 | Ga0495684_0008094 | 3300047471 | Bacteria | 8129 |
| 725 | Ga0495684_0019268 | 3300047471 | Bacteria | 5253 |
| 726 | Ga0495684_0079279 | 3300047471 | Bacteria | 2493 |
| 727 | Ga0495684_0252110 | 3300047471 | Bacteria | 1284 |
| 728 | Ga0495686_0122443 | 3300047472 | Bacteria | 1548 |
| 729 | Ga0495686_0134394 | 3300047472 | Bacteria | 1464 |
| 730 | Ga0495593_0032879 | 3300047673 | Bacteria | 2826 |
| 731 | Ga0495593_0040757 | 3300047673 | Bacteria | 2499 |
| 732 | Ga0495593_0049421 | 3300047673 | Bacteria | 2231 |
| 733 | Ga0495593_0170222 | 3300047673 | Bacteria | 1098 |
| 734 | Ga0495593_0283985 | 3300047673 | Bacteria | 828 |
| 735 | Ga0495602_0061833 | 3300048088 | Bacteria | 3252 |
| 736 | Ga0495602_0197811 | 3300048088 | Bacteria | 1536 |
| 737 | Ga0495602_0288857 | 3300048088 | Bacteria | 1205 |
| 738 | Ga0495614_0183994 | 3300048089 | Bacteria | 941 |
| 739 | Ga0495614_0273504 | 3300048089 | Bacteria | 776 |
| 740 | Ga0495615_0039676 | 3300048090 | Bacteria | 1169 |
| 741 | Ga0495626_0218940 | 3300048091 | Bacteria | 774 |
| 742 | Ga0496100_0241413 | 3300048903 | Bacteria | 1333 |
| 743 | Ga0496101_0077541 | 3300048904 | Bacteria | 2449 |
| 744 | Ga0496101_0181632 | 3300048904 | Bacteria | 1620 |
| 745 | Ga0496101_0210619 | 3300048904 | Bacteria | 1506 |
| 746 | Ga0496101_0642682 | 3300048904 | Bacteria | 838 |
| 747 | Ga0496101_0975022 | 3300048904 | Bacteria | 667 |
| 748 | Ga0496101_1009162 | 3300048904 | Bacteria | 654 |
| 749 | Ga0496102_0084967 | 3300048905 | Bacteria | 2922 |
| 750 | Ga0496102_0094275 | 3300048905 | Bacteria | 2774 |
| 751 | Ga0496102_0129276 | 3300048905 | Bacteria | 2363 |
| 752 | Ga0496102_0201988 | 3300048905 | Bacteria | 1874 |
| 753 | Ga0496102_0481573 | 3300048905 | Bacteria | 1162 |
| 754 | Ga0496102_0520590 | 3300048905 | Bacteria | 1112 |
| 755 | Ga0496103_0107579 | 3300048906 | Bacteria | 1769 |
| 756 | Ga0496104_0007678 | 3300048907 | Bacteria | 9549 |
| 757 | Ga0496104_0140577 | 3300048907 | Bacteria | 2319 |
| 758 | Ga0496104_0580447 | 3300048907 | Bacteria | 1031 |
| 759 | Ga0496104_0622867 | 3300048907 | Bacteria | 989 |
| 760 | Ga0496104_0687146 | 3300048907 | Bacteria | 931 |
| 761 | Ga0496105_0097372 | 3300048908 | Bacteria | 2430 |
| 762 | Ga0496105_0274728 | 3300048908 | Bacteria | 1360 |
| 763 | Ga0496105_0439275 | 3300048908 | Bacteria | 1031 |
| 764 | Ga0496105_0471756 | 3300048908 | Bacteria | 988 |
| 765 | Ga0496106_0008768 | 3300048909 | Bacteria | 7473 |
| 766 | Ga0496106_0057561 | 3300048909 | Bacteria | 2940 |
| 767 | Ga0496106_0073480 | 3300048909 | Bacteria | 2616 |
| 768 | Ga0496106_0090660 | 3300048909 | Bacteria | 2359 |
| 769 | Ga0496107_0032726 | 3300048910 | Bacteria | 3717 |
| 770 | Ga0496107_0222751 | 3300048910 | Bacteria | 1403 |
| 771 | Ga0496107_0476306 | 3300048910 | Bacteria | 926 |
| 772 | Ga0496108_0204509 | 3300048911 | Bacteria | 1713 |
| 773 | Ga0496108_0223181 | 3300048911 | Bacteria | 1637 |
| 774 | Ga0496109_0000469 | 3300048912 | Bacteria | 34339 |
| 775 | Ga0496109_0944410 | 3300048912 | Bacteria | 800 |
| 776 | Ga0496110_0011658 | 3300048913 | Bacteria | 7207 |
| 777 | Ga0496110_0065763 | 3300048913 | Bacteria | 3206 |
| 778 | Ga0496110_0284284 | 3300048913 | Bacteria | 1506 |
| 779 | Ga0496110_0674586 | 3300048913 | Bacteria | 934 |
| 780 | Ga0496110_0739849 | 3300048913 | Bacteria | 886 |
| 781 | Ga0496111_0035057 | 3300048914 | Bacteria | 3585 |
| 782 | Ga0496111_0084785 | 3300048914 | Bacteria | 2316 |
| 783 | Ga0496111_0155210 | 3300048914 | Bacteria | 1698 |
| 784 | Ga0496111_0873852 | 3300048914 | Bacteria | 648 |
| 785 | Ga0496111_0979587 | 3300048914 | Bacteria | 606 |
| 786 | Ga0496112_0000096 | 3300048915 | Bacteria | 57298 |
| 787 | Ga0496112_0017876 | 3300048915 | Bacteria | 6673 |
| 788 | Ga0496112_0111037 | 3300048915 | Bacteria | 2712 |
| 789 | Ga0496112_0119746 | 3300048915 | Bacteria | 2602 |
| 790 | Ga0496112_0119972 | 3300048915 | Bacteria | 2600 |
| 791 | Ga0496112_0287859 | 3300048915 | Bacteria | 1589 |
| 792 | Ga0496113_0119862 | 3300048916 | Bacteria | 2056 |
| 793 | Ga0496113_0171286 | 3300048916 | Bacteria | 1719 |
| 794 | Ga0496113_0244651 | 3300048916 | Bacteria | 1431 |
| 795 | Ga0496114_0005276 | 3300048917 | Bacteria | 10097 |
| 796 | Ga0496114_0326765 | 3300048917 | Bacteria | 1356 |
| 797 | Ga0496114_0363577 | 3300048917 | Bacteria | 1280 |
| 798 | Ga0496115_0019167 | 3300048918 | Bacteria | 5263 |
| 799 | Ga0496115_0019415 | 3300048918 | Bacteria | 5230 |
| 800 | Ga0496115_0044802 | 3300048918 | Bacteria | 3531 |
| 801 | Ga0496115_0130697 | 3300048918 | Bacteria | 2069 |
| 802 | Ga0496115_0583505 | 3300048918 | Bacteria | 890 |
| 803 | Ga0496118_0136657 | 3300048921 | Bacteria | 1563 |
| 804 | Ga0496118_0264262 | 3300048921 | Bacteria | 969 |
| 805 | Ga0496119_0070230 | 3300048922 | Bacteria | 2055 |
| 806 | Ga0496119_0123615 | 3300048922 | Bacteria | 1419 |
| 807 | Ga0496119_0231188 | 3300048922 | Bacteria | 941 |
| 808 | Ga0496121_0002453 | 3300048924 | Bacteria | 28353 |
| 809 | Ga0496121_0084289 | 3300048924 | Bacteria | 2506 |
| 810 | Ga0496121_0169347 | 3300048924 | Bacteria | 1589 |
| 811 | Ga0496121_0448430 | 3300048924 | Bacteria | 832 |
| 812 | Ga0496121_0568859 | 3300048924 | Bacteria | 706 |
| 813 | Ga0496124_0160713 | 3300048927 | Bacteria | 1751 |
| 814 | Ga0496125_0226979 | 3300048928 | Bacteria | 1198 |
| 815 | Ga0496126_0056340 | 3300048929 | Bacteria | 3553 |
| 816 | Ga0496126_0067172 | 3300048929 | Bacteria | 3204 |
| 817 | Ga0496126_0111934 | 3300048929 | Bacteria | 2377 |
| 818 | Ga0496126_0390298 | 3300048929 | Bacteria | 1131 |
| 819 | Ga0496126_0509483 | 3300048929 | Bacteria | 960 |
| 820 | Ga0495682_0150622 | 3300049460 | Bacteria | 830 |
| 821 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 822 | Ga0501032_0096066 | 3300049569 | Bacteria | 1964 |
| 823 | Ga0501033_0003209 | 3300049570 | Bacteria | 13536 |
| 824 | Ga0501033_0018168 | 3300049570 | Bacteria | 5313 |
| 825 | Ga0501034_0001151 | 3300049571 | Bacteria | 36663 |
| 826 | Ga0501034_0504125 | 3300049571 | Bacteria | 1124 |
| 827 | Ga0501036_0000323 | 3300049572 | Bacteria | 33256 |
| 828 | Ga0501036_0083448 | 3300049572 | Bacteria | 2701 |
| 829 | Ga0501036_0607310 | 3300049572 | Bacteria | 907 |
| 830 | Ga0501037_0001377 | 3300049573 | Bacteria | 17808 |
| 831 | Ga0501037_0001630 | 3300049573 | Bacteria | 16306 |
| 832 | Ga0501038_0001622 | 3300049574 | Bacteria | 20925 |
| 833 | Ga0501039_0001302 | 3300049575 | Bacteria | 18240 |
| 834 | Ga0501039_0258956 | 3300049575 | Bacteria | 1367 |
| 835 | Ga0501039_0578651 | 3300049575 | Bacteria | 881 |
| 836 | Ga0501042_0046374 | 3300049578 | Bacteria | 3098 |
| 837 | Ga0501042_0137635 | 3300049578 | Bacteria | 1760 |
| 838 | Ga0501043_0000409 | 3300049579 | Bacteria | 38657 |
| 839 | Ga0501043_0017728 | 3300049579 | Bacteria | 5582 |
| 840 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 841 | Ga0501046_0060008 | 3300049580 | Bacteria | 2977 |
| 842 | Ga0501047_0002426 | 3300049581 | Bacteria | 17808 |
| 843 | Ga0501047_0062965 | 3300049581 | Bacteria | 3578 |
| 844 | Ga0501047_0352826 | 3300049581 | Bacteria | 1307 |
| 845 | Ga0501048_0003595 | 3300049582 | Bacteria | 11806 |
| 846 | Ga0501067_0000145 | 3300049583 | Bacteria | 39277 |
| 847 | Ga0501067_0023101 | 3300049583 | Bacteria | 3445 |
| 848 | Ga0501067_0050454 | 3300049583 | Bacteria | 2306 |
| 849 | Ga0501068_0002577 | 3300049584 | Bacteria | 9611 |
| 850 | Ga0501069_0116733 | 3300049585 | Bacteria | 1522 |
| 851 | Ga0501070_0003510 | 3300049586 | Bacteria | 13565 |
| 852 | Ga0501070_0605189 | 3300049586 | Bacteria | 873 |
| 853 | Ga0501071_0274480 | 3300049587 | Bacteria | 1275 |
| 854 | Ga0501072_0017020 | 3300049588 | Bacteria | 5585 |
| 855 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 856 | Ga0501073_0039562 | 3300049589 | Bacteria | 3340 |
| 857 | Ga0501074_0001347 | 3300049590 | Bacteria | 16291 |
| 858 | Ga0501074_0146411 | 3300049590 | Bacteria | 1689 |
| 859 | Ga0501079_0048138 | 3300049741 | Bacteria | 3290 |
| 860 | Ga0501079_0751275 | 3300049741 | Bacteria | 768 |
| 861 | Ga0501080_0002621 | 3300049742 | Bacteria | 15752 |
| 862 | Ga0501080_0052129 | 3300049742 | Bacteria | 3808 |
| 863 | Ga0501083_0002123 | 3300049744 | Bacteria | 13604 |
| 864 | Ga0501035_0001852 | 3300049822 | Bacteria | 21281 |
| 865 | Ga0501035_0005411 | 3300049822 | Bacteria | 12069 |
| 866 | Ga0501044_0003498 | 3300049823 | Bacteria | 17680 |
| 867 | Ga0501044_0035674 | 3300049823 | Bacteria | 5207 |
| 868 | Ga0501044_0453947 | 3300049823 | Bacteria | 1188 |
| 869 | Ga0501045_1042880 | 3300049824 | Bacteria | 599 |
| 870 | nmdc:mga03683_147542_c1 | 3300050489 | Bacteria | 1060 |
| 871 | nmdc:mga03683_266469_c1 | 3300050489 | Bacteria | 798 |
| 872 | nmdc:mga03n38_415174_c1 | 3300050490 | Bacteria | 743 |
| 873 | nmdc:mga03n38_98_c1 | 3300050490 | Bacteria | 19203 |
| 874 | nmdc:mga00v17_134015_c1 | 3300050491 | Bacteria | 1585 |
| 875 | nmdc:mga00v17_360989_c1 | 3300050491 | Bacteria | 944 |
| 876 | nmdc:mga00v17_825617_c1 | 3300050491 | Bacteria | 590 |
| 877 | nmdc:mga0yw44_134681_c1 | 3300050492 | Bacteria | 1602 |
| 878 | nmdc:mga0yw44_375205_c1 | 3300050492 | Bacteria | 960 |
| 879 | nmdc:mga0yw44_459536_c1 | 3300050492 | Bacteria | 863 |
| 880 | nmdc:mga0yw44_6672_c1 | 3300050492 | Bacteria | 5602 |
| 881 | nmdc:mga0k408_135893_c1 | 3300050493 | Bacteria | 1461 |
| 882 | nmdc:mga0k408_219045_c1 | 3300050493 | Bacteria | 1136 |
| 883 | nmdc:mga0k408_67583_c1 | 3300050493 | Bacteria | 2083 |
| 884 | nmdc:mga06z11_114027_c1 | 3300050494 | Bacteria | 1500 |
| 885 | nmdc:mga06z11_32996_c1 | 3300050494 | Bacteria | 2529 |
| 886 | nmdc:mga06z11_342728_c1 | 3300050494 | Bacteria | 894 |
| 887 | nmdc:mga06z11_37963_c1 | 3300050494 | Bacteria | 2389 |
| 888 | nmdc:mga06z11_656518_c1 | 3300050494 | Bacteria | 639 |
| 889 | nmdc:mga07m45_144674_c1 | 3300050496 | Bacteria | 1378 |
| 890 | nmdc:mga07m45_9952_c2 | 3300050496 | Bacteria | 4350 |
| 891 | nmdc:mga08y16_1190555_c1 | 3300050511 | Bacteria | 733 |
| 892 | nmdc:mga0n895_1673395_c1 | 3300050512 | Bacteria | 599 |
| 893 | nmdc:mga0n895_179818_c1 | 3300050512 | Bacteria | 2146 |
| 894 | nmdc:mga0rr50_287390_c1 | 3300050513 | Bacteria | 1373 |
| 895 | nmdc:mga08x19_815980_c1 | 3300050514 | Bacteria | 662 |
| 896 | Ga0495601_0018892 | 3300053077 | Bacteria | 4199 |
| 897 | Ga0495601_0023042 | 3300053077 | Bacteria | 3826 |
| 898 | Ga0495601_0045290 | 3300053077 | Bacteria | 2766 |
| 899 | Ga0495612_0050427 | 3300053078 | Bacteria | 1709 |
| 900 | Ga0495612_0141603 | 3300053078 | Bacteria | 1043 |
| 901 | Ga0495612_0266615 | 3300053078 | Bacteria | 764 |
| 902 | Ga0500635_0003192 | 3300053080 | Bacteria | 4104 |
| 903 | Ga0500635_0008969 | 3300053080 | Bacteria | 2760 |
| 904 | Ga0495595_0051790 | 3300053084 | Bacteria | 1903 |
| 905 | Ga0495619_0008712 | 3300053085 | Bacteria | 6416 |
| 906 | Ga0495619_0052867 | 3300053085 | Bacteria | 2685 |
| 907 | Ga0495619_0620895 | 3300053085 | Bacteria | 739 |
| 908 | Ga0495619_0639291 | 3300053085 | Bacteria | 726 |
| 909 | Ga0500578_0459676 | 3300053086 | Bacteria | 723 |
| 910 | Ga0500566_0000207 | 3300053094 | Bacteria | 31105 |
| 911 | Ga0500641_0001497 | 3300053096 | Bacteria | 8343 |
| 912 | Ga0500641_0170350 | 3300053096 | Bacteria | 937 |
| 913 | Ga0500654_137610 | 3300053099 | Bacteria | 902 |
| 914 | Ga0500554_000856 | 3300053102 | Bacteria | 5978 |
| 915 | Ga0500554_001256 | 3300053102 | Bacteria | 4908 |
| 916 | Ga0500556_0017680 | 3300053104 | Bacteria | 2238 |
| 917 | Ga0500572_000676 | 3300053111 | Bacteria | 11214 |
| 918 | Ga0500595_000299 | 3300053119 | Bacteria | 32634 |
| 919 | Ga0500595_003982 | 3300053119 | Bacteria | 6751 |
| 920 | Ga0500595_004108 | 3300053119 | Bacteria | 6601 |
| 921 | Ga0500595_015612 | 3300053119 | Bacteria | 2847 |
| 922 | Ga0500608_051325 | 3300053122 | Bacteria | 1981 |
| 923 | Ga0500614_005280 | 3300053123 | Bacteria | 2713 |
| 924 | Ga0500642_0009622 | 3300053130 | Bacteria | 3365 |
| 925 | Ga0500559_0107274 | 3300053136 | Bacteria | 1292 |
| 926 | Ga0500568_0008381 | 3300053139 | Bacteria | 4985 |
| 927 | Ga0500603_000313 | 3300053150 | Bacteria | 12755 |
| 928 | Ga0500603_016677 | 3300053150 | Bacteria | 1746 |
| 929 | Ga0500619_187121 | 3300053154 | Bacteria | 698 |
| 930 | Ga0500627_0208447 | 3300053158 | Bacteria | 875 |
| 931 | Ga0500630_001066 | 3300053159 | Bacteria | 12827 |
| 932 | Ga0500633_0209680 | 3300053160 | Bacteria | 729 |
| 933 | Ga0500638_002777 | 3300053162 | Bacteria | 6250 |
| 934 | Ga0500638_003145 | 3300053162 | Bacteria | 6024 |
| 935 | Ga0500639_000072 | 3300053163 | Bacteria | 46512 |
| 936 | Ga0500639_104704 | 3300053163 | Bacteria | 1386 |
| 937 | Ga0500636_0039800 | 3300053177 | Bacteria | 2781 |
| 938 | Ga0500637_0000065 | 3300053178 | Bacteria | 37771 |
| 939 | Ga0500637_0002631 | 3300053178 | Bacteria | 8033 |
| 940 | Ga0500637_0059800 | 3300053178 | Bacteria | 2182 |
| 941 | Ga0500637_0199894 | 3300053178 | Bacteria | 1139 |
| 942 | Ga0500570_033718 | 3300053724 | Bacteria | 2745 |
| 943 | Ga0500609_025955 | 3300053731 | Bacteria | 803 |
| 944 | Ga0500596_036886 | 3300053735 | Bacteria | 771 |
| 945 | Ga0501084_0003235 | 3300054114 | Bacteria | 13188 |
| 946 | Ga0501084_0661451 | 3300054114 | Bacteria | 882 |
| 947 | Ga0500661_001927 | 3300055283 | Bacteria | 3916 |
| 948 | Ga0501082_0005376 | 3300060353 | Bacteria | 11113 |
| 949 | 2509146428 | 2508501128 | Bacteria | 8613869 |
| 950 | 2513656190 | 2513237096 | Bacteria | 8722461 |
| 951 | 2513679750 | 2513237098 | Bacteria | 9902361 |
| 952 | 2513694665 | 2513237101 | Bacteria | 7952346 |
| 953 | 2513860707 | 2513237137 | Bacteria | 9558895 |
| 954 | 2513917630 | 2513237145 | Bacteria | 8979722 |
| 955 | 2517887710 | 2517572143 | Bacteria | 9484767 |
| 956 | 2524535376 | 2524023228 | Bacteria | 10118060 |
| 957 | 2671120778 | 2667528175 | Bacteria | 7532676 |
| 958 | 2723842483 | 2721755755 | Bacteria | 8322773 |
| 959 | 2728748279 | 2728368998 | Bacteria | 8720350 |
| 960 | 2793072902 | 2791355197 | Bacteria | 8420563 |
| 961 | 2793078665 | |||
| 962 | 2874606830 | 2874604998 | Bacteria | 7834745 |
| 963 | 2876818017 | 2876808645 | Bacteria | 8824342 |
| 964 | 2879112257 | 2879110137 | Bacteria | 8907982 |
| 965 | 2885382551 | 2885374607 | Bacteria | 8927485 |
| 966 | 2889034245 | 2889033259 | Bacteria | 9099371 |
| 967 | 2903753645 | 2903748898 | Bacteria | 9972761 |
| 968 | 2904709570 | |||
| 969 | 2906612720 | |||
| 970 | 2906640552 | 2906635258 | Bacteria | 8601019 |
| 971 | 2906663224 | 2906660503 | Bacteria | 8595048 |
| 972 | 2908745916 | 2908739725 | Bacteria | 8628932 |
| 973 | 2922367631 | 2922361189 | Bacteria | 7436256 |
| 974 | 2922391606 | 2922386360 | Bacteria | 7017218 |
| 975 | 2922433200 | |||
| 976 | 2935630603 | 2935630451 | Bacteria | 8169952 |
| 977 | 2941507255 | 2941507105 | Bacteria | 8166816 |
| 978 | 2941515682 | 2941515067 | Bacteria | 8166720 |
| 979 | 2941523610 | 2941523033 | Bacteria | 8169134 |
| 980 | 3005482797 | 3005474847 | Bacteria | 9259049 |
| 981 | 8006935101 | 8006933436 | Bacteria | 10410654 |
| 982 | 8006965372 | 8006964411 | Bacteria | 8966052 |
| 983 | 8006975069 | 8006973647 | Bacteria | 10679141 |
| 984 | 8006986084 | 8006984368 | Bacteria | 9651211 |
| 985 | 8019563603 | 8019555841 | Bacteria | 9642137 |
| 986 | 8019573672 | 8019565922 | Bacteria | 9639779 |
| 987 | 8056678963 | 8056673599 | Bacteria | 7871253 |
| 988 | 8056685530 | 8056681323 | Bacteria | 8472857 |
| 989 | Ga0373936_0113510 | |||
| 990 | JGI25406J46586_10014265 | |||
| 991 | JGI25165J46597_1008272 | |||
| 992 | JGI25165J46597_1008905 | |||
| 993 | JGI25153J46596_10001699 | |||
| 994 | JGI25404J52841_10003242 | |||
| 995 | JGI25404J52841_10007484 | |||
| 996 | JGI25404J52841_10014463 | |||
| 997 | JGI25404J52841_10049818 | |||
| 998 | Ga0070658_11094795 | |||
| 999 | Ga0070683_100008883 | |||
| 1000 | Ga0070683_100054636 | |||
| 1001 | Ga0070683_100067497 | |||
| 1002 | Ga0070677_10193451 | |||
| 1003 | Ga0068869_100084996 | |||
| 1004 | Ga0070680_100003569 | |||
| 1005 | Ga0070680_100162622 | |||
| 1006 | Ga0070680_100239691 | |||
| 1007 | Ga0070682_100289771 | |||
| 1008 | Ga0070682_100290793 | |||
| 1009 | Ga0070660_100028691 | |||
| 1010 | Ga0070660_100068615 | |||
| 1011 | Ga0070660_100233401 | |||
| 1012 | Ga0070660_100484862 | |||
| 1013 | Ga0070689_100440846 | |||
| 1014 | Ga0070691_10122660 | |||
| 1015 | Ga0070661_100292591 | |||
| 1016 | Ga0070661_100391975 | |||
| 1017 | Ga0070661_100418671 | |||
| 1018 | Ga0070661_100954356 | |||
| 1019 | Ga0070692_10298644 | |||
| 1020 | Ga0070668_100047596 | |||
| 1021 | Ga0070675_100585633 | |||
| 1022 | Ga0070671_100053820 | |||
| 1023 | Ga0070671_100423394 | |||
| 1024 | Ga0070674_100100148 | |||
| 1025 | Ga0070674_100192112 | |||
| 1026 | Ga0070674_100224862 | |||
| 1027 | Ga0070673_100160820 | |||
| 1028 | Ga0070673_100226975 | |||
| 1029 | Ga0070688_100630186 | |||
| 1030 | Ga0070688_100638242 | |||
| 1031 | Ga0070703_10299701 | |||
| 1032 | Ga0070709_10001461 | |||
| 1033 | Ga0070709_10113928 | |||
| 1034 | Ga0070714_100003988 | |||
| 1035 | Ga0070714_100614141 | |||
| 1036 | Ga0070714_100620482 | |||
| 1037 | Ga0070714_101262634 | |||
| 1038 | Ga0070713_100009716 | |||
| 1039 | Ga0070713_100045353 | |||
| 1040 | Ga0070713_100130018 | |||
| 1041 | Ga0070713_100193726 | |||
| 1042 | Ga0070713_100700968 | |||
| 1043 | Ga0070710_10001981 | |||
| 1044 | Ga0070710_10003702 | |||
| 1045 | Ga0070710_10013111 | |||
| 1046 | Ga0070710_10362886 | |||
| 1047 | Ga0070701_10162548 | |||
| 1048 | Ga0070711_100010613 | |||
| 1049 | Ga0070711_100054947 | |||
| 1050 | Ga0070711_100071985 | |||
| 1051 | Ga0070708_100183380 | |||
| 1052 | Ga0070663_100016725 | |||
| 1053 | Ga0070663_100059739 | |||
| 1054 | Ga0070663_100124898 | |||
| 1055 | Ga0070663_100188644 | |||
| 1056 | Ga0070678_100046387 | |||
| 1057 | Ga0070678_100090590 | |||
| 1058 | Ga0070678_100506523 | |||
| 1059 | Ga0070662_100076746 | |||
| 1060 | Ga0070662_100968567 | |||
| 1061 | Ga0070681_10015034 | |||
| 1062 | Ga0070681_10265153 | |||
| 1063 | Ga0070681_10304690 | |||
| 1064 | Ga0070681_10683269 | |||
| 1065 | Ga0070681_10800358 | |||
| 1066 | Ga0068867_100298380 | |||
| 1067 | Ga0068867_100655299 | |||
| 1068 | Ga0070706_100406781 | |||
| 1069 | Ga0070707_100939000 | |||
| 1070 | Ga0070698_100133500 | |||
| 1071 | Ga0070698_100377666 | |||
| 1072 | Ga0070698_101071959 | |||
| 1073 | Ga0070699_101123042 | |||
| 1074 | Ga0070679_100074282 | |||
| 1075 | Ga0070679_100094119 | |||
| 1076 | Ga0070679_100132475 | |||
| 1077 | Ga0070679_100340493 | |||
| 1078 | Ga0070679_100416144 | |||
| 1079 | Ga0070679_100963696 | |||
| 1080 | Ga0070679_101120527 | |||
| 1081 | Ga0070684_100016526 | |||
| 1082 | Ga0070684_100048824 | |||
| 1083 | Ga0070684_100376489 | |||
| 1084 | Ga0070684_100481690 | |||
| 1085 | Ga0070684_101056561 | |||
| 1086 | Ga0070697_100071083 | |||
| 1087 | Ga0070697_100103553 | |||
| 1088 | Ga0070697_100986080 | |||
| 1089 | Ga0068853_100214433 | |||
| 1090 | Ga0068853_100256064 | |||
| 1091 | Ga0068853_100416327 | |||
| 1092 | Ga0068853_100594557 | |||
| 1093 | Ga0068853_100654930 | |||
| 1094 | Ga0068853_101777931 | |||
| 1095 | Ga0070672_100297365 | |||
| 1096 | Ga0070672_100600368 | |||
| 1097 | Ga0070686_100145822 | |||
| 1098 | Ga0070686_100788786 | |||
| 1099 | Ga0070693_100121665 | |||
| 1100 | Ga0070665_100009458 | |||
| 1101 | Ga0070665_100020723 | |||
| 1102 | Ga0070665_100046666 | |||
| 1103 | Ga0070665_100133651 | |||
| 1104 | Ga0070665_100156385 | |||
| 1105 | Ga0070665_100241352 | |||
| 1106 | Ga0070665_100620169 | |||
| 1107 | Ga0070704_101023742 | |||
| 1108 | Ga0068855_100029909 | |||
| 1109 | Ga0068855_100065359 | |||
| 1110 | Ga0068855_100130860 | |||
| 1111 | Ga0068855_100136170 | |||
| 1112 | Ga0068855_100504877 | |||
| 1113 | Ga0068855_100633138 | |||
| 1114 | Ga0070664_100231912 | |||
| 1115 | Ga0068857_100005639 | |||
| 1116 | Ga0068857_100641834 | |||
| 1117 | Ga0068854_100005923 | |||
| 1118 | Ga0068854_101185061 | |||
| 1119 | Ga0068856_100000476 | |||
| 1120 | Ga0068856_100416911 | |||
| 1121 | Ga0068856_100427182 | |||
| 1122 | Ga0068852_100276425 | |||
| 1123 | Ga0068864_100305057 | |||
| 1124 | Ga0068864_100536784 | |||
| 1125 | Ga0068866_11015432 | |||
| 1126 | Ga0068861_100063011 | |||
| 1127 | Ga0068861_100434442 | |||
| 1128 | Ga0068870_10081819 | |||
| 1129 | Ga0068870_10086555 | |||
| 1130 | Ga0068858_100179452 | |||
| 1131 | Ga0068858_100201984 | |||
| 1132 | Ga0068858_100219487 | |||
| 1133 | Ga0068858_100857524 | |||
| 1134 | Ga0081455_10008457 | |||
| 1135 | Ga0081455_10011371 | |||
| 1136 | Ga0081455_10071946 | |||
| 1137 | Ga0081455_10116310 | |||
| 1138 | Ga0081540_1005329 | |||
| 1139 | Ga0081540_1007078 | |||
| 1140 | Ga0081540_1007475 | |||
| 1141 | Ga0081540_1010016 | |||
| 1142 | Ga0081540_1016353 | |||
| 1143 | Ga0081540_1018434 | |||
| 1144 | Ga0081540_1027051 | |||
| 1145 | Ga0081540_1048885 | |||
| 1146 | Ga0081540_1053004 | |||
| 1147 | Ga0081540_1053054 | |||
| 1148 | Ga0081540_1069721 | |||
| 1149 | Ga0081539_10000425 | |||
| 1150 | Ga0081539_10037181 | |||
| 1151 | Ga0070717_10001915 | |||
| 1152 | Ga0075365_10037480 | |||
| 1153 | Ga0075365_10058983 | |||
| 1154 | Ga0075365_10096611 | |||
| 1155 | Ga0075365_10367306 | |||
| 1156 | Ga0075365_10399644 | |||
| 1157 | Ga0075368_10034050 | |||
| 1158 | Ga0075368_10097895 | |||
| 1159 | Ga0075363_100000795 | |||
| 1160 | Ga0075363_100029297 | |||
| 1161 | Ga0075363_100072106 | |||
| 1162 | Ga0075364_10378811 | |||
| 1163 | Ga0070715_10002928 | |||
| 1164 | Ga0070716_100017312 | |||
| 1165 | Ga0070716_100286211 | |||
| 1166 | Ga0070716_100525524 | |||
| 1167 | Ga0070716_100820800 | |||
| 1168 | Ga0070712_100254170 | |||
| 1169 | Ga0070712_100347031 | |||
| 1170 | Ga0070712_100388111 | |||
| 1171 | Ga0070712_100423449 | |||
| 1172 | Ga0070712_100980028 | |||
| 1173 | Ga0075362_10102482 | |||
| 1174 | Ga0075367_10009759 | |||
| 1175 | Ga0075367_10026192 | |||
| 1176 | Ga0075367_10485489 | |||
| 1177 | Ga0075369_10023467 | |||
| 1178 | Ga0075369_10467989 | |||
| 1179 | Ga0075366_10186109 | |||
| 1180 | Ga0075370_10096836 | |||
| 1181 | Ga0075370_10714073 | |||
| 1182 | Ga0068871_100158458 | |||
| 1183 | Ga0075428_100128792 | |||
| 1184 | Ga0075433_10781196 | |||
| 1185 | Ga0068865_100100401 | |||
| 1186 | Ga0068865_100220495 | |||
| 1187 | Ga0068865_100245917 | |||
| 1188 | Ga0099825_1022556 | |||
| 1189 | Ga0099822_1024573 | |||
| 1190 | Ga0099794_10013122 | |||
| 1191 | Ga0099795_10144911 | |||
| 1192 | Ga0105251_10300235 | |||
| 1193 | Ga0105240_10031535 | |||
| 1194 | Ga0105240_10031799 | |||
| 1195 | Ga0105240_10581974 | |||
| 1196 | Ga0105245_10680866 | |||
| 1197 | Ga0105245_10755680 | |||
| 1198 | Ga0105245_10857082 | |||
| 1199 | Ga0105247_10277217 | |||
| 1200 | Ga0114129_10043623 | |||
| 1201 | Ga0105241_10112909 | |||
| 1202 | Ga0105241_10578625 | |||
| 1203 | Ga0105242_10139169 | |||
| 1204 | Ga0105248_10329581 | |||
| 1205 | Ga0105237_10641939 | |||
| 1206 | Ga0105238_10007773 | |||
| 1207 | Ga0105238_10042015 | |||
| 1208 | Ga0105238_10334610 | |||
| 1209 | Ga0105238_10757486 | |||
| 1210 | Ga0105249_10156611 | |||
| 1211 | Ga0105249_11010209 | |||
| 1212 | Ga0105239_10013308 | |||
| 1213 | Ga0105239_10429826 | |||
| 1214 | Ga0105239_10971086 | |||
| 1215 | Ga0105246_10316965 | |||
| 1216 | Ga0157373_10614708 | |||
| 1217 | Ga0157370_10061297 | |||
| 1218 | Ga0157370_10079869 | |||
| 1219 | Ga0157370_10148369 | |||
| 1220 | Ga0157369_10012327 | |||
| 1221 | Ga0157369_10013199 | |||
| 1222 | Ga0157369_10113235 | |||
| 1223 | Ga0157369_10330348 | |||
| 1224 | Ga0157369_11026646 | |||
| 1225 | Ga0157369_11154996 | |||
| 1226 | Ga0157374_10513632 | |||
| 1227 | Ga0157374_10747123 | |||
| 1228 | Ga0157374_10774577 | |||
| 1229 | Ga0157378_11219616 | |||
| 1230 | Ga0163162_10230968 | |||
| 1231 | Ga0163162_11868690 | |||
| 1232 | Ga0157372_10452965 | |||
| 1233 | Ga0157372_10472819 | |||
| 1234 | Ga0157372_10556992 | |||
| 1235 | Ga0157375_11563882 | |||
| 1236 | Ga0163163_10051682 | |||
| 1237 | Ga0163163_10066420 | |||
| 1238 | Ga0163163_11457722 | |||
| 1239 | Ga0157380_10227116 | |||
| 1240 | Ga0157376_10443554 | |||
| 1241 | Ga0157376_11040123 | |||
| 1242 | Ga0163161_10142698 | |||
| 1243 | Ga0197907_10482238 | |||
| 1244 | Ga0197907_11225397 | |||
| 1245 | Ga0206356_11267106 | |||
| 1246 | Ga0206355_1215798 | |||
| 1247 | Ga0206352_10436581 | |||
| 1248 | Ga0206352_11357989 | |||
| 1249 | Ga0206350_10949899 | |||
| 1250 | Ga0206354_10068295 | |||
| 1251 | Ga0206353_11967255 | |||
| 1252 | Ga0213873_10004591 | |||
| 1253 | Ga0213873_10009335 | |||
| 1254 | Ga0213876_10002064 | |||
| 1255 | Ga0213876_10031000 | |||
| 1256 | Ga0213875_10090152 | |||
| 1257 | Ga0213871_10000490 | |||
| 1258 | Ga0224712_10242241 | |||
| 1259 | Ga0209233_1002779 | |||
| 1260 | Ga0209455_1011932 | |||
| 1261 | Ga0209758_1010528 | |||
| 1262 | Ga0209758_1025853 | |||
| 1263 | Ga0207653_10043757 | |||
| 1264 | Ga0207692_10002972 | |||
| 1265 | Ga0207692_10008204 | |||
| 1266 | Ga0207692_10030002 | |||
| 1267 | Ga0207642_10311043 | |||
| 1268 | Ga0207688_10470209 | |||
| 1269 | Ga0207680_10274615 | |||
| 1270 | Ga0207647_10076385 | |||
| 1271 | Ga0207647_10348943 | |||
| 1272 | Ga0207685_10110293 | |||
| 1273 | Ga0207685_10451964 | |||
| 1274 | Ga0207699_10005733 | |||
| 1275 | Ga0207699_10094679 | |||
| 1276 | Ga0207699_10527185 | |||
| 1277 | Ga0207699_10794527 | |||
| 1278 | Ga0207645_10111875 | |||
| 1279 | Ga0207645_10336235 | |||
| 1280 | Ga0207705_10134297 | |||
| 1281 | Ga0207705_11212792 | |||
| 1282 | Ga0207654_10024224 | |||
| 1283 | Ga0207707_10002162 | |||
| 1284 | Ga0207707_10005294 | |||
| 1285 | Ga0207707_10404715 | |||
| 1286 | Ga0207707_10437690 | |||
| 1287 | Ga0207707_10661325 | |||
| 1288 | Ga0207695_10027026 | |||
| 1289 | Ga0207695_10054704 | |||
| 1290 | Ga0207695_10085563 | |||
| 1291 | Ga0207695_10240938 | |||
| 1292 | Ga0207671_10012964 | |||
| 1293 | Ga0207671_10703067 | |||
| 1294 | Ga0207671_11076284 | |||
| 1295 | Ga0207693_10004007 | |||
| 1296 | Ga0207693_10009468 | |||
| 1297 | Ga0207693_10009993 | |||
| 1298 | Ga0207693_10063412 | |||
| 1299 | Ga0207693_10242502 | |||
| 1300 | Ga0207693_10344250 | |||
| 1301 | Ga0207663_10010172 | |||
| 1302 | Ga0207663_10056128 | |||
| 1303 | Ga0207663_10156346 | |||
| 1304 | Ga0207660_10161258 | |||
| 1305 | Ga0207660_10185538 | |||
| 1306 | Ga0207660_10286300 | |||
| 1307 | Ga0207660_10502286 | |||
| 1308 | Ga0207657_10008647 | |||
| 1309 | Ga0207657_10228648 | |||
| 1310 | Ga0207657_10445895 | |||
| 1311 | Ga0207649_10176590 | |||
| 1312 | Ga0207649_10467497 | |||
| 1313 | Ga0207649_10761871 | |||
| 1314 | Ga0207652_10013564 | |||
| 1315 | Ga0207652_10039725 | |||
| 1316 | Ga0207652_10106404 | |||
| 1317 | Ga0207652_10177471 | |||
| 1318 | Ga0207652_10350452 | |||
| 1319 | Ga0207681_10273572 | |||
| 1320 | Ga0207694_10031537 | |||
| 1321 | Ga0207694_10048565 | |||
| 1322 | Ga0207694_10119947 | |||
| 1323 | Ga0207694_10234551 | |||
| 1324 | Ga0207694_10321344 | |||
| 1325 | Ga0207659_10551777 | |||
| 1326 | Ga0207659_10675924 | |||
| 1327 | Ga0207687_10013836 | |||
| 1328 | Ga0207687_10052637 | |||
| 1329 | Ga0207687_10286140 | |||
| 1330 | Ga0207700_10008050 | |||
| 1331 | Ga0207700_10078205 | |||
| 1332 | Ga0207700_10165094 | |||
| 1333 | Ga0207700_10392223 | |||
| 1334 | Ga0207700_10419375 | |||
| 1335 | Ga0207700_11304046 | |||
| 1336 | Ga0207664_10010392 | |||
| 1337 | Ga0207664_11375967 | |||
| 1338 | Ga0207690_10378503 | |||
| 1339 | Ga0207706_10317750 | |||
| 1340 | Ga0207686_10124640 | |||
| 1341 | Ga0207709_10022329 | |||
| 1342 | Ga0207709_10085086 | |||
| 1343 | Ga0207709_10291770 | |||
| 1344 | Ga0207709_10338661 | |||
| 1345 | Ga0207670_10407696 | |||
| 1346 | Ga0207669_10117923 | |||
| 1347 | Ga0207669_10491398 | |||
| 1348 | Ga0207704_10123604 | |||
| 1349 | Ga0207704_10270825 | |||
| 1350 | Ga0207665_10002028 | |||
| 1351 | Ga0207665_10115974 | |||
| 1352 | Ga0207665_10205865 | |||
| 1353 | Ga0207665_10253265 | |||
| 1354 | Ga0207665_10558601 | |||
| 1355 | Ga0207665_10590132 | |||
| 1356 | Ga0207691_10482785 | |||
| 1357 | Ga0207711_10310988 | |||
| 1358 | Ga0207711_10611101 | |||
| 1359 | Ga0207689_10081964 | |||
| 1360 | Ga0207689_10593662 | |||
| 1361 | Ga0207661_10004540 | |||
| 1362 | Ga0207661_10006444 | |||
| 1363 | Ga0207661_10501990 | |||
| 1364 | Ga0207661_10752271 | |||
| 1365 | Ga0207667_10013617 | |||
| 1366 | Ga0207667_10029690 | |||
| 1367 | Ga0207667_10076087 | |||
| 1368 | Ga0207667_10496673 | |||
| 1369 | Ga0207667_10865519 | |||
| 1370 | Ga0207712_10042423 | |||
| 1371 | Ga0207712_11173602 | |||
| 1372 | Ga0207668_10062725 | |||
| 1373 | Ga0207668_10117798 | |||
| 1374 | Ga0207668_10487738 | |||
| 1375 | Ga0207640_10016570 | |||
| 1376 | Ga0207640_11113810 | |||
| 1377 | Ga0207658_10329549 | |||
| 1378 | Ga0207658_11477781 | |||
| 1379 | Ga0207677_10067541 | |||
| 1380 | Ga0207677_10378830 | |||
| 1381 | Ga0207703_10162751 | |||
| 1382 | Ga0207703_10656164 | |||
| 1383 | Ga0207703_10746145 | |||
| 1384 | Ga0207639_10031167 | |||
| 1385 | Ga0207639_10126624 | |||
| 1386 | Ga0207639_10271183 | |||
| 1387 | Ga0207639_10333333 | |||
| 1388 | Ga0207639_10391767 | |||
| 1389 | Ga0207678_10010954 | |||
| 1390 | Ga0207678_10045772 | |||
| 1391 | Ga0207678_10053837 | |||
| 1392 | Ga0207678_10066420 | |||
| 1393 | Ga0207678_10693967 | |||
| 1394 | Ga0207702_10000514 | |||
| 1395 | Ga0207702_10624719 | |||
| 1396 | Ga0207648_10049340 | |||
| 1397 | Ga0207648_10525823 | |||
| 1398 | Ga0207676_10019625 | |||
| 1399 | Ga0207676_10512021 | |||
| 1400 | Ga0207674_10048184 | |||
| 1401 | Ga0207674_10521377 | |||
| 1402 | Ga0207675_100037613 | |||
| 1403 | Ga0207675_100070222 | |||
| 1404 | Ga0207683_10021505 | |||
| 1405 | Ga0207683_10128052 | |||
| 1406 | Ga0207683_10700350 | |||
| 1407 | Ga0207683_11003797 | |||
| 1408 | Ga0207698_10057798 | |||
| 1409 | Ga0207698_10469412 | |||
| 1410 | Ga0207698_10703187 | |||
| 1411 | Ga0209589_1000005 | |||
| 1412 | Ga0209489_100005 | |||
| 1413 | Ga0209700_100006 | |||
| 1414 | Ga0209179_1000570 | |||
| 1415 | Ga0209588_1046767 | |||
| 1416 | Ga0268266_10005838 | |||
| 1417 | Ga0268266_10156331 | |||
| 1418 | Ga0268266_10192118 | |||
| 1419 | Ga0268266_11375680 | |||
| 1420 | Ga0268266_11655517 | |||
| 1421 | Ga0268265_10268494 | |||
| 1422 | Ga0268265_10719307 | |||
| 1423 | Ga0265334_10016514 | |||
| 1424 | Ga0307515_10054329 | |||
| 1425 | Ga0307515_10204476 | |||
| 1426 | Ga0307515_10763341 | |||
| 1427 | Ga0307512_10301481 | |||
| 1428 | Ga0265760_10084633 | |||
| 1429 | Ga0265332_10008158 | |||
| 1430 | Ga0265328_10031392 | |||
| 1431 | Ga0265340_10018482 | |||
| 1432 | Ga0265339_10040049 | |||
| 1433 | Ga0265331_10101405 | |||
| 1434 | Ga0265316_10107714 | |||
| 1435 | Ga0265316_10271313 | |||
| 1436 | Ga0307513_10105798 | |||
| 1437 | Ga0307408_100853722 | |||
| 1438 | Ga0307508_10045726 | |||
| 1439 | Ga0265314_10015497 | |||
| 1440 | Ga0265314_10061194 | |||
| 1441 | Ga0265314_10113147 | |||
| 1442 | Ga0265314_10124452 | |||
| 1443 | Ga0265342_10010500 | |||
| 1444 | Ga0265342_10036461 | |||
| 1445 | Ga0307516_10072595 | |||
| 1446 | Ga0307516_10075437 | |||
| 1447 | Ga0307516_10427281 | |||
| 1448 | Ga0307413_10328219 | |||
| 1449 | Ga0307413_11040531 | |||
| 1450 | Ga0307410_10783535 | |||
| 1451 | Ga0307406_10443469 | |||
| 1452 | Ga0307406_10528755 | |||
| 1453 | Ga0307406_10641596 | |||
| 1454 | Ga0307412_10211313 | |||
| 1455 | Ga0307412_10508815 | |||
| 1456 | Ga0307416_100205834 | |||
| 1457 | Ga0307411_10305237 | |||
| 1458 | Ga0307415_100077941 | |||
| 1459 | Ga0307415_100258870 | |||
| 1460 | Ga0307415_100289060 | |||
| 1461 | Ga0307510_10005379 | |||
| 1462 | Ga0307510_10083698 | |||
| 1463 | Ga0307510_10315969 | |||
| 1464 | Ga0315911_1000015 | |||
| 1465 | Ga0373930_0102633 | |||
| 1466 | Ga0373938_0059947 | |||
| 1467 | Ga0373926_0127308 | |||
| 1468 | Ga0373934_0008069 | |||
| 1469 | Ga0373934_0120402 | |||
| 1470 | Ga0373934_0171130 | |||
| 1471 | Ga0373944_0176156 | |||
| 1472 | Ga0373952_0105271 | |||
| 1473 | Ga0373923_0010770 | |||
| 1474 | Ga0373923_0157577 | |||
| 1475 | Ga0373932_0068821 | |||
| 1476 | Ga0373936_0025118 | |||
| 1477 | Ga0373936_0044108 | |||
| 1478 | Ga0373936_0085085 | |||
| 1479 | Ga0373941_0050835 | |||
| 1480 | Ga0373945_0015999 | |||
| 1481 | Ga0373953_0081691 | |||
| 1482 | Ga0373953_0128586 | |||
| 1483 | Ga0373953_0421904 | |||
| 1484 | Ga0373954_0003254 | |||
| 1485 | Ga0373954_0013871 | |||
| 1486 | Ga0373954_0050144 | |||
| 1487 | Ga0373956_0244077 | |||
| 1488 | Ga0373957_0161379 | |||
| 1489 | Ga0373943_0077832 | |||
| 1490 | Ga0373943_0192461 | |||
| 1491 | Ga0373946_0055424 | |||
| 1492 | Ga0373946_0061132 | |||
| 1493 | Ga0373946_0192923 | |||
| 1494 | Ga0373946_0193549 | |||
| 1495 | Ga0373955_0019007 | |||
| 1496 | Ga0373955_0034453 | |||
| 1497 | Ga0373942_0136365 | |||
| 1498 | Ga0373962_0060838 | |||
| 1499 | Ga0373924_0020154 | |||
| 1500 | Ga0373924_0071056 | |||
| 1501 | Ga0373931_0002294 | |||
| 1502 | Ga0373935_0012074 | |||
| 1503 | Ga0373935_0047436 | |||
| 1504 | Ga0373935_0107938 | |||
| 1505 | Ga0373935_0144774 | |||
| 1506 | Ga0373927_0012034 | |||
| 1507 | Ga0373927_0033415 | |||
| 1508 | Ga0373927_0187178 | |||
| 1509 | Ga0373927_0287620 | |||
| 1510 | Ga0373933_0000784 | |||
| 1511 | Ga0373933_0002702 | |||
| 1512 | Ga0373933_0024423 | |||
| 1513 | Ga0373933_0391771 | |||
| 1514 | Ga0373933_0625609 | |||
| 1515 | Ga0373933_0792884 | |||
| 1516 | Ga0373947_0006075 | |||
| 1517 | Ga0373947_0018523 | |||
| 1518 | Ga0373947_0100020 | |||
| 1519 | Ga0373937_0013724 | |||
| 1520 | Ga0373937_0629745 | |||
| 1521 | Ga0373937_0678128 | |||
| 1522 | Ga0373937_0915674 | |||
| 1523 | Ga0373925_0028352 | |||
| 1524 | Ga0373925_0031318 | |||
| 1525 | Ga0373925_0062447 | |||
| 1526 | Ga0395899_0138645 | |||
| 1527 | Ga0395900_0049784 | |||
| 1528 | Ga0395900_0311332 | |||
| 1529 | Ga0395898_0055824 | |||
| 1530 | Ga0395898_0103771 | |||
| 1531 | Ga0395905_0069858 | |||
| 1532 | Ga0436364_0881658 | |||
| 1533 | Ga0436364_1111914 | |||
| 1534 | Ga0395901_0387541 | |||
| 1535 | Ga0436365_0564143 | |||
| 1536 | Ga0436365_0972944 | |||
| 1537 | Ga0436365_1342005 | |||
| 1538 | Ga0436365_1493072 | |||
| 1539 | Ga0436365_1883175 | |||
| 1540 | Ga0436360_0879024 | |||
| 1541 | Ga0436361_0964292 | |||
| 1542 | Ga0436363_0039534 | |||
| 1543 | Ga0436363_0296726 | |||
| 1544 | Ga0436363_0557724 | |||
| 1545 | Ga0436362_0009437 | |||
| 1546 | Ga0436362_0953067 | |||
| 1547 | Ga0439465_0020470 | |||
| 1548 | Ga0451833_0686916 | |||
| 1549 | Ga0451839_0697962 | |||
| 1550 | Ga0439459_0022873 | |||
| 1551 | Ga0466970_0255650 | |||
| 1552 | Ga0466957_0059062 | |||
| 1553 | Ga0466957_0392866 | |||
| 1554 | Ga0466959_0044336 | |||
| 1555 | Ga0466967_0101592 | |||
| 1556 | Ga0466967_0357537 | |||
| 1557 | Ga0466967_0432291 | |||
| 1558 | Ga0466967_0589444 | |||
| 1559 | Ga0466967_1495507 | |||
| 1560 | Ga0495617_020141 | |||
| 1561 | Ga0495592_0057714 | |||
| 1562 | Ga0495592_0420691 | |||
| 1563 | Ga0495603_0008752 | |||
| 1564 | Ga0495603_0049995 | |||
| 1565 | Ga0495603_0159059 | |||
| 1566 | Ga0495629_0002984 | |||
| 1567 | Ga0495629_0035847 | |||
| 1568 | Ga0495641_0018784 | |||
| 1569 | Ga0495651_0036567 | |||
| 1570 | Ga0495651_0060367 | |||
| 1571 | Ga0495653_0028021 | |||
| 1572 | Ga0495653_0232128 | |||
| 1573 | Ga0495653_0537577 | |||
| 1574 | Ga0495650_0096464 | |||
| 1575 | Ga0495580_0098534 | |||
| 1576 | Ga0495582_0080477 | |||
| 1577 | Ga0495582_0282995 | |||
| 1578 | Ga0495639_0003042 | |||
| 1579 | Ga0495639_0007837 | |||
| 1580 | Ga0495639_0042858 | |||
| 1581 | Ga0495639_0103382 | |||
| 1582 | Ga0495662_0034440 | |||
| 1583 | Ga0495662_0103228 | |||
| 1584 | Ga0495662_0114892 | |||
| 1585 | Ga0495664_0129187 | |||
| 1586 | Ga0495664_0156356 | |||
| 1587 | Ga0495594_0020690 | |||
| 1588 | Ga0495594_0096208 | |||
| 1589 | Ga0495594_0398184 | |||
| 1590 | Ga0495594_0414886 | |||
| 1591 | Ga0495596_0022344 | |||
| 1592 | Ga0495583_0112530 | |||
| 1593 | Ga0495606_0003350 | |||
| 1594 | Ga0495608_0183608 | |||
| 1595 | Ga0495608_0189832 | |||
| 1596 | Ga0495618_0054775 | |||
| 1597 | Ga0495618_0166821 | |||
| 1598 | Ga0495618_0253407 | |||
| 1599 | Ga0495620_0068670 | |||
| 1600 | Ga0495628_0018851 | |||
| 1601 | Ga0495628_0037867 | |||
| 1602 | Ga0495628_0076373 | |||
| 1603 | Ga0495628_0577615 | |||
| 1604 | Ga0495630_0059721 | |||
| 1605 | Ga0495630_0098848 | |||
| 1606 | Ga0495630_0430695 | |||
| 1607 | Ga0495630_0762626 | |||
| 1608 | Ga0495632_0158599 | |||
| 1609 | Ga0495632_0192772 | |||
| 1610 | Ga0495632_0274205 | |||
| 1611 | Ga0495644_0043821 | |||
| 1612 | Ga0495648_0005396 | |||
| 1613 | Ga0495666_0090625 | |||
| 1614 | Ga0495642_0041301 | |||
| 1615 | Ga0495652_0141008 | |||
| 1616 | Ga0495652_0273775 | |||
| 1617 | Ga0495652_0314817 | |||
| 1618 | Ga0495665_0048993 | |||
| 1619 | Ga0495665_0072348 | |||
| 1620 | Ga0495665_0260691 | |||
| 1621 | Ga0495665_0289521 | |||
| 1622 | Ga0495640_0031105 | |||
| 1623 | Ga0495640_0043124 | |||
| 1624 | Ga0495640_0197990 | |||
| 1625 | Ga0495640_0501708 | |||
| 1626 | Ga0495586_0084345 | |||
| 1627 | Ga0495587_0070229 | |||
| 1628 | Ga0495609_0127835 | |||
| 1629 | Ga0495609_0128949 | |||
| 1630 | Ga0495645_0024397 | |||
| 1631 | Ga0495645_0187646 | |||
| 1632 | Ga0495622_0015653 | |||
| 1633 | Ga0495622_0035408 | |||
| 1634 | Ga0495667_0035702 | |||
| 1635 | Ga0495667_0122295 | |||
| 1636 | Ga0495667_0146376 | |||
| 1637 | Ga0495667_0785906 | |||
| 1638 | Ga0495656_0137787 | |||
| 1639 | Ga0495656_0189032 | |||
| 1640 | Ga0495668_0464903 | |||
| 1641 | Ga0495634_0005863 | |||
| 1642 | Ga0495634_0038694 | |||
| 1643 | Ga0495634_0096854 | |||
| 1644 | Ga0495634_0164285 | |||
| 1645 | Ga0495625_0621482 | |||
| 1646 | Ga0495635_0004233 | |||
| 1647 | Ga0495635_0058430 | |||
| 1648 | Ga0495659_0008839 | |||
| 1649 | Ga0495659_0104801 | |||
| 1650 | Ga0495659_0250466 | |||
| 1651 | Ga0495661_0195600 | |||
| 1652 | Ga0495588_0020627 | |||
| 1653 | Ga0495657_0025879 | |||
| 1654 | Ga0495657_0063786 | |||
| 1655 | Ga0495657_0327290 | |||
| 1656 | Ga0495599_0018837 | |||
| 1657 | Ga0495599_0080476 | |||
| 1658 | Ga0495599_0145712 | |||
| 1659 | Ga0495623_0006324 | |||
| 1660 | Ga0495623_0238414 | |||
| 1661 | Ga0495646_0017450 | |||
| 1662 | Ga0495646_0046764 | |||
| 1663 | Ga0495646_0118960 | |||
| 1664 | Ga0495647_0013604 | |||
| 1665 | Ga0495647_0120523 | |||
| 1666 | Ga0495658_0087659 | |||
| 1667 | Ga0495658_0300810 | |||
| 1668 | Ga0495658_0348775 | |||
| 1669 | Ga0495669_0006974 | |||
| 1670 | Ga0495669_0049594 | |||
| 1671 | Ga0495669_0118974 | |||
| 1672 | Ga0495613_0106646 | |||
| 1673 | Ga0495613_0213921 | |||
| 1674 | Ga0495613_0880490 | |||
| 1675 | Ga0495624_0039316 | |||
| 1676 | Ga0495624_0130355 | |||
| 1677 | Ga0495624_0373061 | |||
| 1678 | Ga0495670_0088380 | |||
| 1679 | Ga0495670_0112902 | |||
| 1680 | Ga0495589_0212256 | |||
| 1681 | Ga0495600_0100555 | |||
| 1682 | Ga0495600_0240484 | |||
| 1683 | Ga0495600_0246640 | |||
| 1684 | Ga0495600_0777507 | |||
| 1685 | Ga0495660_0233494 | |||
| 1686 | Ga0495581_0022509 | |||
| 1687 | Ga0495581_0039231 | |||
| 1688 | Ga0495581_0056334 | |||
| 1689 | Ga0495581_0133443 | |||
| 1690 | Ga0495604_0093644 | |||
| 1691 | Ga0495604_0098991 | |||
| 1692 | Ga0495604_0103732 | |||
| 1693 | Ga0495604_0282157 | |||
| 1694 | Ga0495604_0417447 | |||
| 1695 | Ga0495604_0430065 | |||
| 1696 | Ga0495604_0459204 | |||
| 1697 | Ga0495636_0050243 | |||
| 1698 | Ga0495674_0066189 | |||
| 1699 | Ga0495674_0087507 | |||
| 1700 | Ga0495674_0119336 | |||
| 1701 | Ga0495674_1008512 | |||
| 1702 | Ga0495672_0053768 | |||
| 1703 | Ga0495672_0206616 | |||
| 1704 | Ga0495676_0050003 | |||
| 1705 | Ga0495680_0152660 | |||
| 1706 | Ga0495680_0406147 | |||
| 1707 | Ga0495675_0037487 | |||
| 1708 | Ga0495675_0039044 | |||
| 1709 | Ga0495675_0377973 | |||
| 1710 | Ga0495679_063429 | |||
| 1711 | Ga0495673_0121565 | |||
| 1712 | Ga0495684_0008094 | |||
| 1713 | Ga0495684_0019268 | |||
| 1714 | Ga0495684_0079279 | |||
| 1715 | Ga0495684_0252110 | |||
| 1716 | Ga0495686_0122443 | |||
| 1717 | Ga0495686_0134394 | |||
| 1718 | Ga0495593_0032879 | |||
| 1719 | Ga0495593_0040757 | |||
| 1720 | Ga0495593_0049421 | |||
| 1721 | Ga0495593_0170222 | |||
| 1722 | Ga0495593_0283985 | |||
| 1723 | Ga0495602_0061833 | |||
| 1724 | Ga0495602_0197811 | |||
| 1725 | Ga0495602_0288857 | |||
| 1726 | Ga0495614_0183994 | |||
| 1727 | Ga0495614_0273504 | |||
| 1728 | Ga0495615_0039676 | |||
| 1729 | Ga0495626_0218940 | |||
| 1730 | Ga0496100_0241413 | |||
| 1731 | Ga0496101_0077541 | |||
| 1732 | Ga0496101_0181632 | |||
| 1733 | Ga0496101_0210619 | |||
| 1734 | Ga0496101_0642682 | |||
| 1735 | Ga0496101_0975022 | |||
| 1736 | Ga0496101_1009162 | |||
| 1737 | Ga0496102_0084967 | |||
| 1738 | Ga0496102_0094275 | |||
| 1739 | Ga0496102_0129276 | |||
| 1740 | Ga0496102_0201988 | |||
| 1741 | Ga0496102_0481573 | |||
| 1742 | Ga0496102_0520590 | |||
| 1743 | Ga0496103_0107579 | |||
| 1744 | Ga0496104_0007678 | |||
| 1745 | Ga0496104_0140577 | |||
| 1746 | Ga0496104_0580447 | |||
| 1747 | Ga0496104_0622867 | |||
| 1748 | Ga0496104_0687146 | |||
| 1749 | Ga0496105_0097372 | |||
| 1750 | Ga0496105_0274728 | |||
| 1751 | Ga0496105_0439275 | |||
| 1752 | Ga0496105_0471756 | |||
| 1753 | Ga0496106_0008768 | |||
| 1754 | Ga0496106_0057561 | |||
| 1755 | Ga0496106_0073480 | |||
| 1756 | Ga0496106_0090660 | |||
| 1757 | Ga0496107_0032726 | |||
| 1758 | Ga0496107_0222751 | |||
| 1759 | Ga0496107_0476306 | |||
| 1760 | Ga0496108_0204509 | |||
| 1761 | Ga0496108_0223181 | |||
| 1762 | Ga0496109_0000469 | |||
| 1763 | Ga0496109_0944410 | |||
| 1764 | Ga0496110_0011658 | |||
| 1765 | Ga0496110_0065763 | |||
| 1766 | Ga0496110_0284284 | |||
| 1767 | Ga0496110_0674586 | |||
| 1768 | Ga0496110_0739849 | |||
| 1769 | Ga0496111_0035057 | |||
| 1770 | Ga0496111_0084785 | |||
| 1771 | Ga0496111_0155210 | |||
| 1772 | Ga0496111_0873852 | |||
| 1773 | Ga0496111_0979587 | |||
| 1774 | Ga0496112_0000096 | |||
| 1775 | Ga0496112_0017876 | |||
| 1776 | Ga0496112_0111037 | |||
| 1777 | Ga0496112_0119746 | |||
| 1778 | Ga0496112_0119972 | |||
| 1779 | Ga0496112_0287859 | |||
| 1780 | Ga0496113_0119862 | |||
| 1781 | Ga0496113_0171286 | |||
| 1782 | Ga0496113_0244651 | |||
| 1783 | Ga0496114_0005276 | |||
| 1784 | Ga0496114_0326765 | |||
| 1785 | Ga0496114_0363577 | |||
| 1786 | Ga0496115_0019167 | |||
| 1787 | Ga0496115_0019415 | |||
| 1788 | Ga0496115_0044802 | |||
| 1789 | Ga0496115_0130697 | |||
| 1790 | Ga0496115_0583505 | |||
| 1791 | Ga0496118_0136657 | |||
| 1792 | Ga0496118_0264262 | |||
| 1793 | Ga0496119_0070230 | |||
| 1794 | Ga0496119_0123615 | |||
| 1795 | Ga0496119_0231188 | |||
| 1796 | Ga0496121_0002453 | |||
| 1797 | Ga0496121_0084289 | |||
| 1798 | Ga0496121_0169347 | |||
| 1799 | Ga0496121_0448430 | |||
| 1800 | Ga0496121_0568859 | |||
| 1801 | Ga0496124_0160713 | |||
| 1802 | Ga0496125_0226979 | |||
| 1803 | Ga0496126_0056340 | |||
| 1804 | Ga0496126_0067172 | |||
| 1805 | Ga0496126_0111934 | |||
| 1806 | Ga0496126_0390298 | |||
| 1807 | Ga0496126_0509483 | |||
| 1808 | Ga0495682_0150622 | |||
| 1809 | Ga0501032_0000196 | |||
| 1810 | Ga0501032_0096066 | |||
| 1811 | Ga0501033_0003209 | |||
| 1812 | Ga0501033_0018168 | |||
| 1813 | Ga0501034_0001151 | |||
| 1814 | Ga0501034_0504125 | |||
| 1815 | Ga0501036_0000323 | |||
| 1816 | Ga0501036_0083448 | |||
| 1817 | Ga0501036_0607310 | |||
| 1818 | Ga0501037_0001377 | |||
| 1819 | Ga0501037_0001630 | |||
| 1820 | Ga0501038_0001622 | |||
| 1821 | Ga0501039_0001302 | |||
| 1822 | Ga0501039_0258956 | |||
| 1823 | Ga0501039_0578651 | |||
| 1824 | Ga0501042_0046374 | |||
| 1825 | Ga0501042_0137635 | |||
| 1826 | Ga0501043_0000409 | |||
| 1827 | Ga0501043_0017728 | |||
| 1828 | Ga0501046_0000181 | |||
| 1829 | Ga0501046_0060008 | |||
| 1830 | Ga0501047_0002426 | |||
| 1831 | Ga0501047_0062965 | |||
| 1832 | Ga0501047_0352826 | |||
| 1833 | Ga0501048_0003595 | |||
| 1834 | Ga0501067_0000145 | |||
| 1835 | Ga0501067_0023101 | |||
| 1836 | Ga0501067_0050454 | |||
| 1837 | Ga0501068_0002577 | |||
| 1838 | Ga0501069_0116733 | |||
| 1839 | Ga0501070_0003510 | |||
| 1840 | Ga0501070_0605189 | |||
| 1841 | Ga0501071_0274480 | |||
| 1842 | Ga0501072_0017020 | |||
| 1843 | Ga0501073_0000027 | |||
| 1844 | Ga0501073_0039562 | |||
| 1845 | Ga0501074_0001347 | |||
| 1846 | Ga0501074_0146411 | |||
| 1847 | Ga0501079_0048138 | |||
| 1848 | Ga0501079_0751275 | |||
| 1849 | Ga0501080_0002621 | |||
| 1850 | Ga0501080_0052129 | |||
| 1851 | Ga0501083_0002123 | |||
| 1852 | Ga0501035_0001852 | |||
| 1853 | Ga0501035_0005411 | |||
| 1854 | Ga0501044_0003498 | |||
| 1855 | Ga0501044_0035674 | |||
| 1856 | Ga0501044_0453947 | |||
| 1857 | Ga0501045_1042880 | |||
| 1858 | nmdc:mga03683_147542_c1 | |||
| 1859 | nmdc:mga03683_266469_c1 | |||
| 1860 | nmdc:mga03n38_415174_c1 | |||
| 1861 | nmdc:mga03n38_98_c1 | |||
| 1862 | nmdc:mga00v17_134015_c1 | |||
| 1863 | nmdc:mga00v17_360989_c1 | |||
| 1864 | nmdc:mga00v17_825617_c1 | |||
| 1865 | nmdc:mga0yw44_134681_c1 | |||
| 1866 | nmdc:mga0yw44_375205_c1 | |||
| 1867 | nmdc:mga0yw44_459536_c1 | |||
| 1868 | nmdc:mga0yw44_6672_c1 | |||
| 1869 | nmdc:mga0k408_135893_c1 | |||
| 1870 | nmdc:mga0k408_219045_c1 | |||
| 1871 | nmdc:mga0k408_67583_c1 | |||
| 1872 | nmdc:mga06z11_114027_c1 | |||
| 1873 | nmdc:mga06z11_32996_c1 | |||
| 1874 | nmdc:mga06z11_342728_c1 | |||
| 1875 | nmdc:mga06z11_37963_c1 | |||
| 1876 | nmdc:mga06z11_656518_c1 | |||
| 1877 | nmdc:mga07m45_144674_c1 | |||
| 1878 | nmdc:mga07m45_9952_c2 | |||
| 1879 | nmdc:mga08y16_1190555_c1 | |||
| 1880 | nmdc:mga0n895_1673395_c1 | |||
| 1881 | nmdc:mga0n895_179818_c1 | |||
| 1882 | nmdc:mga0rr50_287390_c1 | |||
| 1883 | nmdc:mga08x19_815980_c1 | |||
| 1884 | Ga0495601_0018892 | |||
| 1885 | Ga0495601_0023042 | |||
| 1886 | Ga0495601_0045290 | |||
| 1887 | Ga0495612_0050427 | |||
| 1888 | Ga0495612_0141603 | |||
| 1889 | Ga0495612_0266615 | |||
| 1890 | Ga0500635_0003192 | |||
| 1891 | Ga0500635_0008969 | |||
| 1892 | Ga0495595_0051790 | |||
| 1893 | Ga0495619_0008712 | |||
| 1894 | Ga0495619_0052867 | |||
| 1895 | Ga0495619_0620895 | |||
| 1896 | Ga0495619_0639291 | |||
| 1897 | Ga0500578_0459676 | |||
| 1898 | Ga0500566_0000207 | |||
| 1899 | Ga0500641_0001497 | |||
| 1900 | Ga0500641_0170350 | |||
| 1901 | Ga0500654_137610 | |||
| 1902 | Ga0500554_000856 | |||
| 1903 | Ga0500554_001256 | |||
| 1904 | Ga0500556_0017680 | |||
| 1905 | Ga0500572_000676 | |||
| 1906 | Ga0500595_000299 | |||
| 1907 | Ga0500595_003982 | |||
| 1908 | Ga0500595_004108 | |||
| 1909 | Ga0500595_015612 | |||
| 1910 | Ga0500608_051325 | |||
| 1911 | Ga0500614_005280 | |||
| 1912 | Ga0500642_0009622 | |||
| 1913 | Ga0500559_0107274 | |||
| 1914 | Ga0500568_0008381 | |||
| 1915 | Ga0500603_000313 | |||
| 1916 | Ga0500603_016677 | |||
| 1917 | Ga0500619_187121 | |||
| 1918 | Ga0500627_0208447 | |||
| 1919 | Ga0500630_001066 | |||
| 1920 | Ga0500633_0209680 | |||
| 1921 | Ga0500638_002777 | |||
| 1922 | Ga0500638_003145 | |||
| 1923 | Ga0500639_000072 | |||
| 1924 | Ga0500639_104704 | |||
| 1925 | Ga0500636_0039800 | |||
| 1926 | Ga0500637_0000065 | |||
| 1927 | Ga0500637_0002631 | |||
| 1928 | Ga0500637_0059800 | |||
| 1929 | Ga0500637_0199894 | |||
| 1930 | Ga0500570_033718 | |||
| 1931 | Ga0500609_025955 | |||
| 1932 | Ga0500596_036886 | |||
| 1933 | Ga0501084_0003235 | |||
| 1934 | Ga0501084_0661451 | |||
| 1935 | Ga0500661_001927 | |||
| 1936 | Ga0501082_0005376 | |||
| 1937 | 2509146428 | |||
| 1938 | 2513656190 | |||
| 1939 | 2513679750 | |||
| 1940 | 2513694665 | |||
| 1941 | 2513860707 | |||
| 1942 | 2513917630 | |||
| 1943 | 2517887710 | |||
| 1944 | 2524535376 | |||
| 1945 | 2671120778 | |||
| 1946 | 2723842483 | |||
| 1947 | 2728748279 | |||
| 1948 | 2793072902 | |||
| 1949 | 2793078665 | |||
| 1950 | 2874606830 | |||
| 1951 | 2876818017 | |||
| 1952 | 2879112257 | |||
| 1953 | 2885382551 | |||
| 1954 | 2889034245 | |||
| 1955 | 2903753645 | |||
| 1956 | 2904709570 | |||
| 1957 | 2906612720 | |||
| 1958 | 2906640552 | |||
| 1959 | 2906663224 | |||
| 1960 | 2908745916 | |||
| 1961 | 2922367631 | |||
| 1962 | 2922391606 | |||
| 1963 | 2922433200 | |||
| 1964 | 2935630603 | |||
| 1965 | 2941507255 | |||
| 1966 | 2941515682 | |||
| 1967 | 2941523610 | |||
| 1968 | 3005482797 | |||
| 1969 | 8006935101 | |||
| 1970 | 8006965372 | |||
| 1971 | 8006975069 | |||
| 1972 | 8006986084 | |||
| 1973 | 8019563603 | |||
| 1974 | 8019573672 | |||
| 1975 | 8056678963 | |||
| 1976 | 8056685530 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8754 | 1 | 170 |
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8706 | 1 | 170 |
| 4zyd-assembly2.cif.gz_A-3 | crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna | 0.8589 | 4 | 171 |
| 7dqt-assembly1.cif.gz_A | crystal structure of o6-methylguanine methyltransferase y91f variant | 0.853 | 3 | 171 |
| 7e1p-assembly1.cif.gz_A | crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine | 0.8517 | 3 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DAC5_49_134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.945 | 86 | 170 | 1.10.10.10 |
| 5llqB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9231 | 85 | 170 | 1.10.10.10 |
| 5llqB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9125 | 85 | 170 | 1.10.10.10 |
| af_Q4DAC5_49_134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9034 | 86 | 170 | 1.10.10.10 |
| 1t39B01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain | 0.8983 | 5 | 28 | 3.30.160.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431RJJ5-F1-model_v4 | deleted | 0.9872 | 2 | 133 |
|
| AF-A0A431RJJ5-F1-model_v4 | deleted | 0.9655 | 2 | 133 |
|
| AF-A0A2R7NXB5-F1-model_v4 | Cysteine methyltransferase | 0.9618 | 2 | 150 |
GO:0003908
GO:0006281 GO:0032259 |
| AF-K2CBI1-F1-model_v4 | Uncharacterized protein | 0.9558 | 2 | 121 |
GO:0003908
GO:0006281 |
| AF-A0A355UNV3-F1-model_v4 | Cysteine methyltransferase | 0.9542 | 2 | 168 |
GO:0003908
GO:0006281 GO:0032259 |