F487537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 591 | 765 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300053730|Ga0500645_024708|Ga0500645_024708_190_1209 |
| Length | 314 |
| Sequence | MIPLSVLDLSVVTTGTKPAQSLRNSIDLAKHADQLGYTRYWLAEHHSLLSVASPAPEIMIGQIAAATQRIRVGSGGVMLPNHAPLMVAERFKMLEALFPGRIDLGLGRAPGTDQTTMHALRQRFDPRGGDDFIERLIELTLWETREFPEGHPYNKVVAMPDDTPLPPIWLLGSSDYSMIHYRAHFKPSRWRENPHAILAIAVIMAETDEEADKLASSADLNRLLRDRGQYRPLPSVEEAQAYPYTDAERASIARNRSRLFVGSKQTVMEKVTPLIETSKPDEVMVITATYDHDARKRSYSLLADAFGIGRQAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 67 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 68 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 69 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 70 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 82 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 83 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 84 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 85 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 88 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 89 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 90 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 91 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 92 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 93 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 94 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 95 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 96 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 97 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 98 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 99 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 100 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 101 | 2904699407 | |||
| 102 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 103 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 104 | 2906610324 | |||
| 105 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 106 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 107 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 108 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 109 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 110 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 111 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 112 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 113 | 2922368715 | |||
| 114 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 115 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 116 | 2922425934 | |||
| 117 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 118 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 119 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 120 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 121 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 122 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 123 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 124 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 125 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 126 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 127 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 128 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 129 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 130 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 131 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 132 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 133 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 134 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 135 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 136 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 137 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 138 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 139 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 140 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 141 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 142 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 143 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 144 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 145 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 146 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 147 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 148 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 149 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 150 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 151 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 152 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 153 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 154 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 155 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 156 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 157 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 158 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 159 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 160 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 161 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 162 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 163 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 164 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 165 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 166 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 167 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 168 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 169 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 170 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 171 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 172 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 173 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 174 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 175 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 176 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 177 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 178 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 179 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 180 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 181 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 182 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 183 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 184 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 185 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 186 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 187 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 188 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 189 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 190 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 191 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 192 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 193 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 194 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 195 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 197 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 199 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 205 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 219 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 220 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 222 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 224 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 225 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 226 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 227 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 228 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 229 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 230 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 231 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 232 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 233 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 234 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 235 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 237 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 238 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 239 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 240 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 242 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 243 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 244 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 245 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 254 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 266 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 267 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 268 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 269 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 270 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 275 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 325 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 326 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 333 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 334 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 335 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 337 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 338 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 340 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 341 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 342 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 343 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 344 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 345 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 346 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 347 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 348 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 349 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 350 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 352 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 353 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 354 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 355 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 356 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 357 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 358 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 359 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 360 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 361 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 362 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 363 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 364 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 365 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 366 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 368 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 369 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 370 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 371 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 372 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 373 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 374 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 375 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 376 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 377 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 378 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 379 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 380 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 381 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 382 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 383 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 384 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 385 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 457 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 458 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 459 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 460 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 461 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 462 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 465 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 466 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 467 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 468 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 469 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 470 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 471 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 472 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 473 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 474 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 475 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 476 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 477 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 478 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 508 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 509 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 510 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 511 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 512 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 514 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 518 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 521 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 523 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 524 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 525 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 527 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 528 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 531 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 532 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 533 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 534 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 535 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 536 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 537 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 538 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 539 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 540 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 541 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 542 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 543 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 545 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 547 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 550 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 551 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 552 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 553 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 555 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 557 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 558 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 559 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 560 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 561 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 562 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 563 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 564 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 565 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 566 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 567 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 568 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 569 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 570 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 571 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 572 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 573 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 574 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 575 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 576 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 577 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 578 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 579 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 580 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 581 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 582 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 583 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 584 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 585 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 586 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 587 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 588 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 589 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 590 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 591 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.78 |
| Metatranscriptomes | 0.2 |
| Isolates | 22.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.46 |
| Nodule | 16.94 |
| Rhizoplane | 4.67 |
| Rhizosphere | 54.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005937 | 3300001979 | Bacteria | 5113 |
| 2 | JGI25406J46586_10000012 | 3300003203 | Bacteria | 102438 |
| 3 | JGI25406J46586_10038146 | 3300003203 | Bacteria | 1725 |
| 4 | JGI25153J46596_10008046 | 3300003215 | Bacteria | 5094 |
| 5 | JGI25153J46596_10019332 | 3300003215 | Bacteria | 2615 |
| 6 | JGI25160J50197_1005561 | 3300003354 | Bacteria | 5227 |
| 7 | JGI25160J50197_1007198 | 3300003354 | Bacteria | 4383 |
| 8 | JGI25160J50197_1015110 | 3300003354 | Bacteria | 2548 |
| 9 | JGI25404J52841_10006703 | 3300003659 | Bacteria | 2417 |
| 10 | JGI25404J52841_10010612 | 3300003659 | Bacteria | 1979 |
| 11 | Ga0055539_1002997 | 3300003752 | Bacteria | 2435 |
| 12 | Ga0055543_1005993 | 3300004625 | Bacteria | 3016 |
| 13 | Ga0065165_1000982 | 3300005262 | Bacteria | 35331 |
| 14 | Ga0065165_1007672 | 3300005262 | Bacteria | 5235 |
| 15 | Ga0065165_1008445 | 3300005262 | Bacteria | 4816 |
| 16 | Ga0070670_100068271 | 3300005331 | Bacteria | 3051 |
| 17 | Ga0068869_100023869 | 3300005334 | Bacteria | 4232 |
| 18 | Ga0070680_100016577 | 3300005336 | Bacteria | 5798 |
| 19 | Ga0070680_100064099 | 3300005336 | Bacteria | 3011 |
| 20 | Ga0070680_100367073 | 3300005336 | Bacteria | 1225 |
| 21 | Ga0068868_100071269 | 3300005338 | Bacteria | 2771 |
| 22 | Ga0070660_100238356 | 3300005339 | Bacteria | 1481 |
| 23 | Ga0070660_100280343 | 3300005339 | Bacteria | 1364 |
| 24 | Ga0070661_100310121 | 3300005344 | Bacteria | 1230 |
| 25 | Ga0070668_100041152 | 3300005347 | Bacteria | 3540 |
| 26 | Ga0070668_100087155 | 3300005347 | Bacteria | 2456 |
| 27 | Ga0070668_100137630 | 3300005347 | Bacteria | 1965 |
| 28 | Ga0070671_100044664 | 3300005355 | Bacteria | 3682 |
| 29 | Ga0070674_100096396 | 3300005356 | Bacteria | 2146 |
| 30 | Ga0070688_100166279 | 3300005365 | Bacteria | 1519 |
| 31 | Ga0070709_10002283 | 3300005434 | Bacteria | 10401 |
| 32 | Ga0070714_100022105 | 3300005435 | Bacteria | 5212 |
| 33 | Ga0070714_100039738 | 3300005435 | Bacteria | 3962 |
| 34 | Ga0070713_100022749 | 3300005436 | Bacteria | 4849 |
| 35 | Ga0070713_100060987 | 3300005436 | Bacteria | 3155 |
| 36 | Ga0070713_100129624 | 3300005436 | Bacteria | 2223 |
| 37 | Ga0070713_100162662 | 3300005436 | Bacteria | 1993 |
| 38 | Ga0070710_10018697 | 3300005437 | Bacteria | 3569 |
| 39 | Ga0070708_100387090 | 3300005445 | Bacteria | 1319 |
| 40 | Ga0070663_100028428 | 3300005455 | Bacteria | 3806 |
| 41 | Ga0070663_100169745 | 3300005455 | Bacteria | 1685 |
| 42 | Ga0070678_100178156 | 3300005456 | Bacteria | 1738 |
| 43 | Ga0070678_100279634 | 3300005456 | Bacteria | 1411 |
| 44 | Ga0070662_100185930 | 3300005457 | Bacteria | 1640 |
| 45 | Ga0070662_100367923 | 3300005457 | Bacteria | 1181 |
| 46 | Ga0070681_10187131 | 3300005458 | Bacteria | 1991 |
| 47 | Ga0070681_10419787 | 3300005458 | Bacteria | 1250 |
| 48 | Ga0070706_100133515 | 3300005467 | Bacteria | 2317 |
| 49 | Ga0070707_100054763 | 3300005468 | Bacteria | 3825 |
| 50 | Ga0070707_100433063 | 3300005468 | Bacteria | 1275 |
| 51 | Ga0070698_100047957 | 3300005471 | Bacteria | 4366 |
| 52 | Ga0070679_100270231 | 3300005530 | Bacteria | 1654 |
| 53 | Ga0070684_100065197 | 3300005535 | Bacteria | 3196 |
| 54 | Ga0070684_100115278 | 3300005535 | Bacteria | 2413 |
| 55 | Ga0070684_100213839 | 3300005535 | Bacteria | 1757 |
| 56 | Ga0068853_100032830 | 3300005539 | Bacteria | 4400 |
| 57 | Ga0068853_100040910 | 3300005539 | Bacteria | 3957 |
| 58 | Ga0068853_100109745 | 3300005539 | Bacteria | 2449 |
| 59 | Ga0070672_100185134 | 3300005543 | Bacteria | 1736 |
| 60 | Ga0070686_100183444 | 3300005544 | Bacteria | 1488 |
| 61 | Ga0070665_100012864 | 3300005548 | Bacteria | 8426 |
| 62 | Ga0070665_100058353 | 3300005548 | Bacteria | 3870 |
| 63 | Ga0068855_100080478 | 3300005563 | Bacteria | 3777 |
| 64 | Ga0068855_100117639 | 3300005563 | Bacteria | 3044 |
| 65 | Ga0068855_100154127 | 3300005563 | Bacteria | 2611 |
| 66 | Ga0068855_100218105 | 3300005563 | Bacteria | 2141 |
| 67 | Ga0068855_100358675 | 3300005563 | Bacteria | 1604 |
| 68 | Ga0068857_100023618 | 3300005577 | Bacteria | 5413 |
| 69 | Ga0068854_100072638 | 3300005578 | Bacteria | 2519 |
| 70 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 71 | Ga0068856_100063543 | 3300005614 | Bacteria | 3647 |
| 72 | Ga0068856_100118565 | 3300005614 | Bacteria | 2647 |
| 73 | Ga0068856_100540575 | 3300005614 | Bacteria | 1186 |
| 74 | Ga0068852_100006606 | 3300005616 | Bacteria | 8399 |
| 75 | Ga0068852_100010212 | 3300005616 | Bacteria | 6998 |
| 76 | Ga0068852_100448392 | 3300005616 | Bacteria | 1277 |
| 77 | Ga0068851_10003838 | 3300005834 | Bacteria | 6727 |
| 78 | Ga0068851_10061017 | 3300005834 | Bacteria | 1932 |
| 79 | Ga0068860_100000837 | 3300005843 | Bacteria | 34452 |
| 80 | Ga0068860_100274052 | 3300005843 | Bacteria | 1647 |
| 81 | Ga0068860_100468621 | 3300005843 | Bacteria | 1254 |
| 82 | Ga0068862_100137583 | 3300005844 | Bacteria | 2166 |
| 83 | Ga0068862_100249676 | 3300005844 | Bacteria | 1616 |
| 84 | Ga0068862_100315305 | 3300005844 | Bacteria | 1442 |
| 85 | Ga0081455_10008940 | 3300005937 | Bacteria | 10353 |
| 86 | Ga0081455_10011276 | 3300005937 | Bacteria | 8994 |
| 87 | Ga0081455_10013423 | 3300005937 | Bacteria | 8097 |
| 88 | Ga0081455_10032605 | 3300005937 | Bacteria | 4692 |
| 89 | Ga0081538_10037995 | 3300005981 | Bacteria | 3113 |
| 90 | Ga0081540_1002034 | 3300005983 | Bacteria | 16870 |
| 91 | Ga0081540_1007800 | 3300005983 | Bacteria | 7574 |
| 92 | Ga0081540_1008423 | 3300005983 | Bacteria | 7210 |
| 93 | Ga0081540_1012078 | 3300005983 | Bacteria | 5714 |
| 94 | Ga0081540_1020975 | 3300005983 | Bacteria | 3910 |
| 95 | Ga0081540_1023647 | 3300005983 | Bacteria | 3588 |
| 96 | Ga0081540_1051055 | 3300005983 | Bacteria | 2048 |
| 97 | Ga0081540_1065713 | 3300005983 | Bacteria | 1704 |
| 98 | Ga0081540_1068142 | 3300005983 | Bacteria | 1659 |
| 99 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 100 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 101 | Ga0081539_10006006 | 3300005985 | Bacteria | 11928 |
| 102 | Ga0081539_10063904 | 3300005985 | Bacteria | 2006 |
| 103 | Ga0081539_10105346 | 3300005985 | Bacteria | 1430 |
| 104 | Ga0070717_10017655 | 3300006028 | Bacteria | 5555 |
| 105 | Ga0075365_10043977 | 3300006038 | Bacteria | 2925 |
| 106 | Ga0075365_10110776 | 3300006038 | Bacteria | 1886 |
| 107 | Ga0075368_10016127 | 3300006042 | Bacteria | 2781 |
| 108 | Ga0075363_100115619 | 3300006048 | Bacteria | 1494 |
| 109 | Ga0075363_100125154 | 3300006048 | Bacteria | 1438 |
| 110 | Ga0070716_100014843 | 3300006173 | Bacteria | 3996 |
| 111 | Ga0070716_100021483 | 3300006173 | Bacteria | 3402 |
| 112 | Ga0070716_100114369 | 3300006173 | Bacteria | 1678 |
| 113 | Ga0070712_100152298 | 3300006175 | Bacteria | 1777 |
| 114 | Ga0075367_10061551 | 3300006178 | Bacteria | 2240 |
| 115 | Ga0075367_10121060 | 3300006178 | Bacteria | 1612 |
| 116 | Ga0075369_10010149 | 3300006186 | Bacteria | 3680 |
| 117 | Ga0075369_10132724 | 3300006186 | Bacteria | 1132 |
| 118 | Ga0075366_10023825 | 3300006195 | Bacteria | 3567 |
| 119 | Ga0099794_10005590 | 3300007265 | Bacteria | 5052 |
| 120 | Ga0105240_10012243 | 3300009093 | Bacteria | 11853 |
| 121 | Ga0105240_10015437 | 3300009093 | Bacteria | 10386 |
| 122 | Ga0105240_10069358 | 3300009093 | Bacteria | 4364 |
| 123 | Ga0105240_10135717 | 3300009093 | Bacteria | 2947 |
| 124 | Ga0111539_10347138 | 3300009094 | Bacteria | 1727 |
| 125 | Ga0111539_10351823 | 3300009094 | Bacteria | 1714 |
| 126 | Ga0105245_10148468 | 3300009098 | Bacteria | 2214 |
| 127 | Ga0105243_10224948 | 3300009148 | Bacteria | 1661 |
| 128 | Ga0105241_10001280 | 3300009174 | Bacteria | 19200 |
| 129 | Ga0105241_10043926 | 3300009174 | Bacteria | 3385 |
| 130 | Ga0105241_10070526 | 3300009174 | Bacteria | 2711 |
| 131 | Ga0105241_10081915 | 3300009174 | Bacteria | 2529 |
| 132 | Ga0105248_10036476 | 3300009177 | Bacteria | 5498 |
| 133 | Ga0105248_10497588 | 3300009177 | Bacteria | 1374 |
| 134 | Ga0105237_10044776 | 3300009545 | Bacteria | 4455 |
| 135 | Ga0105237_10140850 | 3300009545 | Bacteria | 2406 |
| 136 | Ga0105238_10044002 | 3300009551 | Bacteria | 4517 |
| 137 | Ga0105238_10079710 | 3300009551 | Bacteria | 3264 |
| 138 | Ga0099796_10019249 | 3300010159 | Bacteria | 2067 |
| 139 | Ga0105239_10054114 | 3300010375 | Bacteria | 4401 |
| 140 | Ga0105239_10187359 | 3300010375 | Bacteria | 2316 |
| 141 | Ga0105239_10211117 | 3300010375 | Bacteria | 2176 |
| 142 | Ga0105239_10267778 | 3300010375 | Bacteria | 1921 |
| 143 | Ga0105246_10111990 | 3300011119 | Bacteria | 2006 |
| 144 | Ga0157370_10040880 | 3300013104 | Bacteria | 4475 |
| 145 | Ga0157370_10532625 | 3300013104 | Bacteria | 1077 |
| 146 | Ga0157369_10151451 | 3300013105 | Bacteria | 2451 |
| 147 | Ga0157374_10134006 | 3300013296 | Bacteria | 2400 |
| 148 | Ga0157378_10074226 | 3300013297 | Bacteria | 3060 |
| 149 | Ga0157378_10078348 | 3300013297 | Bacteria | 2981 |
| 150 | Ga0157378_10544548 | 3300013297 | Bacteria | 1165 |
| 151 | Ga0163162_10654083 | 3300013306 | Bacteria | 1174 |
| 152 | Ga0157372_10100045 | 3300013307 | Bacteria | 3308 |
| 153 | Ga0157375_10055890 | 3300013308 | Bacteria | 3893 |
| 154 | Ga0157375_10190888 | 3300013308 | Bacteria | 2203 |
| 155 | Ga0163163_10150156 | 3300014325 | Bacteria | 2374 |
| 156 | Ga0163163_10222436 | 3300014325 | Bacteria | 1936 |
| 157 | Ga0163163_10268407 | 3300014325 | Bacteria | 1757 |
| 158 | Ga0157376_10022471 | 3300014969 | Bacteria | 4919 |
| 159 | Ga0157376_10240448 | 3300014969 | Bacteria | 1687 |
| 160 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 161 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 162 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 163 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 164 | Ga0213871_10033779 | 3300021441 | Bacteria | 1346 |
| 165 | Ga0209677_102183 | 3300025253 | Bacteria | 7623 |
| 166 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 167 | Ga0209233_1004336 | 3300025261 | Bacteria | 4843 |
| 168 | Ga0209233_1008907 | 3300025261 | Bacteria | 3075 |
| 169 | Ga0209455_1000807 | 3300025272 | Bacteria | 17148 |
| 170 | Ga0209455_1023034 | 3300025272 | Bacteria | 1176 |
| 171 | Ga0209564_1000477 | 3300025295 | Bacteria | 66843 |
| 172 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 173 | Ga0209758_1000536 | 3300025297 | Bacteria | 60374 |
| 174 | Ga0209758_1001539 | 3300025297 | Bacteria | 26507 |
| 175 | Ga0209758_1001550 | 3300025297 | Bacteria | 26398 |
| 176 | Ga0209758_1002309 | 3300025297 | Bacteria | 19718 |
| 177 | Ga0209758_1004564 | 3300025297 | Bacteria | 11423 |
| 178 | Ga0209256_1011364 | 3300025299 | Bacteria | 3571 |
| 179 | Ga0207426_1000773 | 3300025302 | Bacteria | 35199 |
| 180 | Ga0207426_1000990 | 3300025302 | Bacteria | 27830 |
| 181 | Ga0207426_1003444 | 3300025302 | Bacteria | 8596 |
| 182 | Ga0209051_1048370 | 3300025303 | Bacteria | 1442 |
| 183 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 184 | Ga0209257_1011695 | 3300025304 | Bacteria | 4183 |
| 185 | Ga0209257_1034598 | 3300025304 | Bacteria | 1573 |
| 186 | Ga0207656_10005846 | 3300025321 | Bacteria | 4382 |
| 187 | Ga0207692_10000138 | 3300025898 | Bacteria | 22336 |
| 188 | Ga0207692_10008172 | 3300025898 | Bacteria | 4323 |
| 189 | Ga0207692_10010497 | 3300025898 | Bacteria | 3906 |
| 190 | Ga0207710_10035205 | 3300025900 | Bacteria | 2202 |
| 191 | Ga0207647_10005671 | 3300025904 | Bacteria | 9117 |
| 192 | Ga0207699_10000122 | 3300025906 | Bacteria | 55116 |
| 193 | Ga0207699_10003146 | 3300025906 | Bacteria | 7851 |
| 194 | Ga0207699_10221479 | 3300025906 | Bacteria | 1292 |
| 195 | Ga0207643_10008642 | 3300025908 | Bacteria | 5462 |
| 196 | Ga0207705_10124422 | 3300025909 | Bacteria | 1915 |
| 197 | Ga0207684_10037662 | 3300025910 | Bacteria | 4104 |
| 198 | Ga0207654_10000153 | 3300025911 | Bacteria | 43627 |
| 199 | Ga0207654_10039326 | 3300025911 | Bacteria | 2660 |
| 200 | Ga0207654_10048569 | 3300025911 | Bacteria | 2429 |
| 201 | Ga0207707_10002207 | 3300025912 | Bacteria | 17632 |
| 202 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 203 | Ga0207695_10000506 | 3300025913 | Bacteria | 82904 |
| 204 | Ga0207695_10051564 | 3300025913 | Bacteria | 4318 |
| 205 | Ga0207695_10402539 | 3300025913 | Bacteria | 1253 |
| 206 | Ga0207671_10021063 | 3300025914 | Bacteria | 4952 |
| 207 | Ga0207671_10110521 | 3300025914 | Bacteria | 2091 |
| 208 | Ga0207671_10313295 | 3300025914 | Bacteria | 1241 |
| 209 | Ga0207693_10004906 | 3300025915 | Bacteria | 11244 |
| 210 | Ga0207693_10009351 | 3300025915 | Bacteria | 7991 |
| 211 | Ga0207693_10068086 | 3300025915 | Bacteria | 2787 |
| 212 | Ga0207663_10000161 | 3300025916 | Bacteria | 30665 |
| 213 | Ga0207663_10000623 | 3300025916 | Bacteria | 15689 |
| 214 | Ga0207663_10209013 | 3300025916 | Bacteria | 1413 |
| 215 | Ga0207660_10227703 | 3300025917 | Bacteria | 1465 |
| 216 | Ga0207660_10243940 | 3300025917 | Bacteria | 1416 |
| 217 | Ga0207662_10099985 | 3300025918 | Bacteria | 1796 |
| 218 | Ga0207657_10033356 | 3300025919 | Bacteria | 4642 |
| 219 | Ga0207657_10242711 | 3300025919 | Bacteria | 1438 |
| 220 | Ga0207652_10047975 | 3300025921 | Bacteria | 3649 |
| 221 | Ga0207652_10373220 | 3300025921 | Bacteria | 1288 |
| 222 | Ga0207646_10050177 | 3300025922 | Bacteria | 3735 |
| 223 | Ga0207681_10275586 | 3300025923 | Bacteria | 1322 |
| 224 | Ga0207694_10003910 | 3300025924 | Bacteria | 11770 |
| 225 | Ga0207694_10034184 | 3300025924 | Bacteria | 3898 |
| 226 | Ga0207694_10038204 | 3300025924 | Bacteria | 3691 |
| 227 | Ga0207694_10081906 | 3300025924 | Bacteria | 2536 |
| 228 | Ga0207694_10219491 | 3300025924 | Bacteria | 1550 |
| 229 | Ga0207687_10009895 | 3300025927 | Bacteria | 6243 |
| 230 | Ga0207687_10029818 | 3300025927 | Bacteria | 3672 |
| 231 | Ga0207687_10274318 | 3300025927 | Bacteria | 1349 |
| 232 | Ga0207700_10045317 | 3300025928 | Bacteria | 3244 |
| 233 | Ga0207700_10053147 | 3300025928 | Bacteria | 3033 |
| 234 | Ga0207700_10057556 | 3300025928 | Bacteria | 2932 |
| 235 | Ga0207664_10021734 | 3300025929 | Bacteria | 4779 |
| 236 | Ga0207664_10120275 | 3300025929 | Bacteria | 2196 |
| 237 | Ga0207706_10065562 | 3300025933 | Bacteria | 3198 |
| 238 | Ga0207706_10312768 | 3300025933 | Bacteria | 1367 |
| 239 | Ga0207669_10029132 | 3300025937 | Bacteria | 3048 |
| 240 | Ga0207665_10000183 | 3300025939 | Bacteria | 41938 |
| 241 | Ga0207665_10171674 | 3300025939 | Bacteria | 1566 |
| 242 | Ga0207665_10175312 | 3300025939 | Bacteria | 1550 |
| 243 | Ga0207691_10049861 | 3300025940 | Bacteria | 3835 |
| 244 | Ga0207691_10274416 | 3300025940 | Bacteria | 1451 |
| 245 | Ga0207711_10033479 | 3300025941 | Bacteria | 4348 |
| 246 | Ga0207689_10046436 | 3300025942 | Bacteria | 3589 |
| 247 | Ga0207689_10093199 | 3300025942 | Bacteria | 2474 |
| 248 | Ga0207689_10104918 | 3300025942 | Bacteria | 2322 |
| 249 | Ga0207661_10000828 | 3300025944 | Bacteria | 20288 |
| 250 | Ga0207667_10072942 | 3300025949 | Bacteria | 3568 |
| 251 | Ga0207667_10087422 | 3300025949 | Bacteria | 3224 |
| 252 | Ga0207667_10114421 | 3300025949 | Bacteria | 2781 |
| 253 | Ga0207667_10119463 | 3300025949 | Bacteria | 2716 |
| 254 | Ga0207667_10244025 | 3300025949 | Bacteria | 1838 |
| 255 | Ga0207667_10271534 | 3300025949 | Bacteria | 1733 |
| 256 | Ga0207712_10128647 | 3300025961 | Bacteria | 1927 |
| 257 | Ga0207668_10104398 | 3300025972 | Bacteria | 2112 |
| 258 | Ga0207668_10118457 | 3300025972 | Bacteria | 2000 |
| 259 | Ga0207668_10366631 | 3300025972 | Bacteria | 1208 |
| 260 | Ga0207677_10175196 | 3300026023 | Bacteria | 1682 |
| 261 | Ga0207639_10007981 | 3300026041 | Bacteria | 7230 |
| 262 | Ga0207639_10042056 | 3300026041 | Bacteria | 3423 |
| 263 | Ga0207639_10346164 | 3300026041 | Bacteria | 1326 |
| 264 | Ga0207678_10038686 | 3300026067 | Bacteria | 4143 |
| 265 | Ga0207678_10065333 | 3300026067 | Bacteria | 3124 |
| 266 | Ga0207678_10086765 | 3300026067 | Bacteria | 2674 |
| 267 | Ga0207678_10174584 | 3300026067 | Bacteria | 1835 |
| 268 | Ga0207678_10426764 | 3300026067 | Bacteria | 1150 |
| 269 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 270 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 271 | Ga0207702_10063018 | 3300026078 | Bacteria | 3169 |
| 272 | Ga0207702_10610005 | 3300026078 | Bacteria | 1071 |
| 273 | Ga0207648_10285701 | 3300026089 | Bacteria | 1476 |
| 274 | Ga0207676_10089134 | 3300026095 | Bacteria | 2527 |
| 275 | Ga0207674_10048571 | 3300026116 | Bacteria | 4343 |
| 276 | Ga0207674_10048718 | 3300026116 | Bacteria | 4336 |
| 277 | Ga0207674_10130837 | 3300026116 | Bacteria | 2473 |
| 278 | Ga0207675_100236199 | 3300026118 | Bacteria | 1765 |
| 279 | Ga0207683_10121878 | 3300026121 | Bacteria | 2342 |
| 280 | Ga0207683_10174513 | 3300026121 | Bacteria | 1947 |
| 281 | Ga0207683_10308371 | 3300026121 | Bacteria | 1448 |
| 282 | Ga0207683_10375902 | 3300026121 | Bacteria | 1306 |
| 283 | Ga0207698_10045959 | 3300026142 | Bacteria | 3293 |
| 284 | Ga0207698_10057730 | 3300026142 | Bacteria | 3004 |
| 285 | Ga0207698_10420215 | 3300026142 | Bacteria | 1283 |
| 286 | Ga0207698_10427495 | 3300026142 | Bacteria | 1273 |
| 287 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 288 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 289 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 290 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 291 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 292 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 293 | Ga0209588_1005208 | 3300027671 | Bacteria | 3711 |
| 294 | Ga0268266_10034894 | 3300028379 | Bacteria | 4278 |
| 295 | Ga0268266_10053634 | 3300028379 | Bacteria | 3464 |
| 296 | Ga0268266_10163006 | 3300028379 | Bacteria | 2018 |
| 297 | Ga0268266_10187728 | 3300028379 | Bacteria | 1886 |
| 298 | Ga0268266_10497615 | 3300028379 | Bacteria | 1163 |
| 299 | Ga0268265_10277711 | 3300028380 | Bacteria | 1497 |
| 300 | Ga0268265_10461022 | 3300028380 | Bacteria | 1189 |
| 301 | Ga0268264_10000537 | 3300028381 | Bacteria | 48029 |
| 302 | Ga0268264_10066486 | 3300028381 | Bacteria | 3040 |
| 303 | Ga0307517_10050575 | 3300028786 | Bacteria | 4220 |
| 304 | Ga0307515_10046793 | 3300028794 | Bacteria | 6600 |
| 305 | Ga0307515_10063600 | 3300028794 | Bacteria | 5178 |
| 306 | Ga0265338_10063970 | 3300028800 | Bacteria | 3203 |
| 307 | Ga0265763_1002954 | 3300030763 | Bacteria | 1326 |
| 308 | Ga0265330_10072948 | 3300031235 | Bacteria | 1484 |
| 309 | Ga0265340_10052128 | 3300031247 | Bacteria | 1979 |
| 310 | Ga0265339_10000281 | 3300031249 | Bacteria | 41044 |
| 311 | Ga0265339_10026845 | 3300031249 | Bacteria | 3294 |
| 312 | Ga0307513_10139543 | 3300031456 | Bacteria | 2353 |
| 313 | Ga0307509_10053131 | 3300031507 | Bacteria | 4322 |
| 314 | Ga0307509_10106470 | 3300031507 | Bacteria | 2823 |
| 315 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 316 | Ga0307508_10033210 | 3300031616 | Bacteria | 4657 |
| 317 | Ga0307508_10078988 | 3300031616 | Bacteria | 2871 |
| 318 | Ga0307508_10210862 | 3300031616 | Bacteria | 1543 |
| 319 | Ga0307508_10217175 | 3300031616 | Bacteria | 1512 |
| 320 | Ga0265314_10011033 | 3300031711 | Bacteria | 7493 |
| 321 | Ga0265314_10063614 | 3300031711 | Bacteria | 2502 |
| 322 | Ga0265342_10014904 | 3300031712 | Bacteria | 5138 |
| 323 | Ga0265342_10049510 | 3300031712 | Bacteria | 2514 |
| 324 | Ga0307516_10014001 | 3300031730 | Bacteria | 8506 |
| 325 | Ga0307516_10068943 | 3300031730 | Bacteria | 3403 |
| 326 | Ga0307516_10290305 | 3300031730 | Bacteria | 1314 |
| 327 | Ga0307405_10223239 | 3300031731 | Bacteria | 1384 |
| 328 | Ga0307412_10029996 | 3300031911 | Bacteria | 3419 |
| 329 | Ga0307411_10210904 | 3300032005 | Bacteria | 1500 |
| 330 | Ga0307510_10022874 | 3300033180 | Bacteria | 7250 |
| 331 | Ga0307510_10037361 | 3300033180 | Bacteria | 5388 |
| 332 | Ga0373944_0021553 | 3300035089 | Bacteria | 1866 |
| 333 | Ga0373944_0026026 | 3300035089 | Bacteria | 1726 |
| 334 | Ga0373923_0065718 | 3300035111 | Bacteria | 1549 |
| 335 | Ga0373936_0114188 | 3300035113 | Bacteria | 1149 |
| 336 | Ga0373953_0001704 | 3300035117 | Bacteria | 6467 |
| 337 | Ga0373953_0002691 | 3300035117 | Bacteria | 5390 |
| 338 | Ga0373954_0007407 | 3300035118 | Bacteria | 4802 |
| 339 | Ga0373954_0037173 | 3300035118 | Bacteria | 2262 |
| 340 | Ga0373956_0012937 | 3300035119 | Bacteria | 3467 |
| 341 | Ga0373957_0012302 | 3300035120 | Bacteria | 2878 |
| 342 | Ga0373957_0013220 | 3300035120 | Bacteria | 2796 |
| 343 | Ga0373943_0002235 | 3300035170 | Bacteria | 8797 |
| 344 | Ga0373946_0126793 | 3300035171 | Bacteria | 1170 |
| 345 | Ga0373955_0027684 | 3300035172 | Bacteria | 2933 |
| 346 | Ga0373955_0154980 | 3300035172 | Bacteria | 1349 |
| 347 | Ga0373924_0069573 | 3300035410 | Bacteria | 1483 |
| 348 | Ga0373935_0003730 | 3300035692 | Bacteria | 8891 |
| 349 | Ga0373935_0048374 | 3300035692 | Bacteria | 2692 |
| 350 | Ga0373927_0001492 | 3300035695 | Bacteria | 17635 |
| 351 | Ga0373927_0001793 | 3300035695 | Bacteria | 16018 |
| 352 | Ga0373927_0033848 | 3300035695 | Bacteria | 3325 |
| 353 | Ga0373927_0140989 | 3300035695 | Bacteria | 1577 |
| 354 | Ga0373933_0000267 | 3300035724 | Bacteria | 34008 |
| 355 | Ga0373947_0001861 | 3300035725 | Bacteria | 12857 |
| 356 | Ga0373947_0133714 | 3300035725 | Bacteria | 1585 |
| 357 | Ga0373937_0034261 | 3300036401 | Bacteria | 4618 |
| 358 | Ga0373937_0051137 | 3300036401 | Bacteria | 3787 |
| 359 | Ga0373937_0057297 | 3300036401 | Bacteria | 3579 |
| 360 | Ga0372808_013234 | 3300036459 | Bacteria | 1175 |
| 361 | Ga0373925_0013546 | 3300037068 | Bacteria | 5904 |
| 362 | Ga0373925_0058364 | 3300037068 | Bacteria | 2894 |
| 363 | Ga0373925_0114613 | 3300037068 | Bacteria | 2086 |
| 364 | Ga0395900_0001496 | 3300037418 | Bacteria | 27775 |
| 365 | Ga0395898_0019947 | 3300037466 | Bacteria | 6816 |
| 366 | Ga0395898_0070389 | 3300037466 | Bacteria | 3382 |
| 367 | Ga0395905_0004165 | 3300037471 | Bacteria | 15125 |
| 368 | Ga0395905_0032236 | 3300037471 | Bacteria | 4928 |
| 369 | Ga0395905_0083368 | 3300037471 | Bacteria | 2995 |
| 370 | Ga0395905_0124402 | 3300037471 | Bacteria | 2425 |
| 371 | Ga0395901_0064055 | 3300038443 | Bacteria | 3826 |
| 372 | Ga0395901_0231437 | 3300038443 | Bacteria | 1929 |
| 373 | Ga0436365_0344664 | 3300039437 | Bacteria | 1367 |
| 374 | Ga0436365_0389593 | 3300039437 | Bacteria | 1415 |
| 375 | Ga0436360_0441680 | 3300039438 | Bacteria | 2202 |
| 376 | Ga0436360_0560055 | 3300039438 | Bacteria | 1418 |
| 377 | Ga0436360_0600621 | 3300039438 | Bacteria | 4286 |
| 378 | Ga0436361_0686082 | 3300039447 | Bacteria | 8872 |
| 379 | Ga0436361_1065603 | 3300039447 | Bacteria | 2482 |
| 380 | Ga0436363_0135082 | 3300039450 | Bacteria | 2969 |
| 381 | Ga0436363_0460586 | 3300039450 | Bacteria | 3703 |
| 382 | Ga0436362_1080726 | 3300039453 | Bacteria | 1041 |
| 383 | Ga0466965_0022945 | 3300044683 | Bacteria | 3011 |
| 384 | Ga0466966_0003788 | 3300044684 | Bacteria | 9975 |
| 385 | Ga0466961_0000227 | 3300044693 | Bacteria | 38175 |
| 386 | Ga0466961_0059356 | 3300044693 | Bacteria | 2433 |
| 387 | Ga0466963_0018798 | 3300044694 | Bacteria | 4326 |
| 388 | Ga0466970_0169879 | 3300044765 | Bacteria | 1208 |
| 389 | Ga0466957_0148709 | 3300044842 | Bacteria | 1513 |
| 390 | Ga0466960_0009796 | 3300044901 | Bacteria | 3961 |
| 391 | Ga0466960_0041081 | 3300044901 | Bacteria | 2190 |
| 392 | Ga0466960_0113129 | 3300044901 | Bacteria | 1413 |
| 393 | Ga0466959_0000605 | 3300045049 | Bacteria | 20930 |
| 394 | Ga0466959_0024944 | 3300045049 | Bacteria | 4429 |
| 395 | Ga0466959_0061469 | 3300045049 | Bacteria | 2731 |
| 396 | Ga0466959_0181687 | 3300045049 | Bacteria | 1471 |
| 397 | Ga0466967_0157884 | 3300045976 | Bacteria | 2126 |
| 398 | Ga0495617_013424 | 3300046452 | Bacteria | 2788 |
| 399 | Ga0495592_0002227 | 3300046454 | Bacteria | 13684 |
| 400 | Ga0495592_0041547 | 3300046454 | Bacteria | 3446 |
| 401 | Ga0495592_0060638 | 3300046454 | Bacteria | 2782 |
| 402 | Ga0495603_0000036 | 3300046455 | Bacteria | 57443 |
| 403 | Ga0495603_0008447 | 3300046455 | Bacteria | 6220 |
| 404 | Ga0495603_0015690 | 3300046455 | Bacteria | 4583 |
| 405 | Ga0495629_0000148 | 3300046459 | Bacteria | 61440 |
| 406 | Ga0495629_0000331 | 3300046459 | Bacteria | 40528 |
| 407 | Ga0495629_0049085 | 3300046459 | Bacteria | 2959 |
| 408 | Ga0495629_0242116 | 3300046459 | Bacteria | 1242 |
| 409 | Ga0495638_0022001 | 3300046460 | Bacteria | 4191 |
| 410 | Ga0495638_0032248 | 3300046460 | Bacteria | 3360 |
| 411 | Ga0495638_0033836 | 3300046460 | Bacteria | 3265 |
| 412 | Ga0495641_0008477 | 3300046461 | Bacteria | 6258 |
| 413 | Ga0495641_0121183 | 3300046461 | Bacteria | 1167 |
| 414 | Ga0495651_0015094 | 3300046462 | Bacteria | 5970 |
| 415 | Ga0495651_0016761 | 3300046462 | Bacteria | 5675 |
| 416 | Ga0495651_0032670 | 3300046462 | Bacteria | 4058 |
| 417 | Ga0495653_0000697 | 3300046463 | Bacteria | 25621 |
| 418 | Ga0495653_0033411 | 3300046463 | Bacteria | 4076 |
| 419 | Ga0495653_0080356 | 3300046463 | Bacteria | 2412 |
| 420 | Ga0495653_0228582 | 3300046463 | Bacteria | 1246 |
| 421 | Ga0495580_0000705 | 3300046472 | Bacteria | 28569 |
| 422 | Ga0495582_0002450 | 3300046473 | Bacteria | 10340 |
| 423 | Ga0495639_0000135 | 3300046475 | Bacteria | 38122 |
| 424 | Ga0495639_0004541 | 3300046475 | Bacteria | 5951 |
| 425 | Ga0495639_0055478 | 3300046475 | Bacteria | 1807 |
| 426 | Ga0495662_0000811 | 3300046476 | Bacteria | 15187 |
| 427 | Ga0495664_0015540 | 3300046477 | Bacteria | 4328 |
| 428 | Ga0495584_0137167 | 3300046491 | Bacteria | 1242 |
| 429 | Ga0495585_0049604 | 3300046492 | Bacteria | 2330 |
| 430 | Ga0495594_0001252 | 3300046499 | Bacteria | 13306 |
| 431 | Ga0495594_0016885 | 3300046499 | Bacteria | 3851 |
| 432 | Ga0495607_0035604 | 3300046501 | Bacteria | 3009 |
| 433 | Ga0495606_0001350 | 3300046507 | Bacteria | 33317 |
| 434 | Ga0495608_0038216 | 3300046511 | Bacteria | 3224 |
| 435 | Ga0495608_0130635 | 3300046511 | Bacteria | 1607 |
| 436 | Ga0495608_0139318 | 3300046511 | Bacteria | 1549 |
| 437 | Ga0495608_0183184 | 3300046511 | Bacteria | 1324 |
| 438 | Ga0495610_0039906 | 3300046512 | Bacteria | 2370 |
| 439 | Ga0495616_0132872 | 3300046513 | Bacteria | 1139 |
| 440 | Ga0495618_0081584 | 3300046514 | Bacteria | 2065 |
| 441 | Ga0495618_0149881 | 3300046514 | Bacteria | 1490 |
| 442 | Ga0495618_0184896 | 3300046514 | Bacteria | 1323 |
| 443 | Ga0495620_0013412 | 3300046515 | Bacteria | 4195 |
| 444 | Ga0495628_0028014 | 3300046516 | Bacteria | 4582 |
| 445 | Ga0495628_0032806 | 3300046516 | Bacteria | 4189 |
| 446 | Ga0495628_0037061 | 3300046516 | Bacteria | 3910 |
| 447 | Ga0495628_0211900 | 3300046516 | Bacteria | 1457 |
| 448 | Ga0495631_0070222 | 3300046518 | Bacteria | 1514 |
| 449 | Ga0495643_0037685 | 3300046522 | Bacteria | 2650 |
| 450 | Ga0495643_0121212 | 3300046522 | Bacteria | 1321 |
| 451 | Ga0495648_0000310 | 3300046524 | Bacteria | 53884 |
| 452 | Ga0495648_0004337 | 3300046524 | Bacteria | 12150 |
| 453 | Ga0495648_0130331 | 3300046524 | Bacteria | 1338 |
| 454 | Ga0495666_0118010 | 3300046526 | Bacteria | 1243 |
| 455 | Ga0495652_0025648 | 3300046529 | Bacteria | 5210 |
| 456 | Ga0495652_0033885 | 3300046529 | Bacteria | 4454 |
| 457 | Ga0495652_0076325 | 3300046529 | Bacteria | 2780 |
| 458 | Ga0495652_0103067 | 3300046529 | Bacteria | 2310 |
| 459 | Ga0495652_0174301 | 3300046529 | Bacteria | 1657 |
| 460 | Ga0495665_0000118 | 3300046531 | Bacteria | 37731 |
| 461 | Ga0495640_0032839 | 3300046533 | Bacteria | 3693 |
| 462 | Ga0495640_0045231 | 3300046533 | Bacteria | 3056 |
| 463 | Ga0495640_0058195 | 3300046533 | Bacteria | 2636 |
| 464 | Ga0495587_0021863 | 3300046536 | Bacteria | 3945 |
| 465 | Ga0495587_0028742 | 3300046536 | Bacteria | 3379 |
| 466 | Ga0495609_0026332 | 3300046538 | Bacteria | 2663 |
| 467 | Ga0495597_0028026 | 3300046542 | Bacteria | 2580 |
| 468 | Ga0495645_0018632 | 3300046543 | Bacteria | 4988 |
| 469 | Ga0495645_0162202 | 3300046543 | Bacteria | 1545 |
| 470 | Ga0495622_0002977 | 3300046557 | Bacteria | 8052 |
| 471 | Ga0495667_0000379 | 3300046559 | Bacteria | 28161 |
| 472 | Ga0495667_0092297 | 3300046559 | Bacteria | 1960 |
| 473 | Ga0495667_0281418 | 3300046559 | Bacteria | 1056 |
| 474 | Ga0495656_0021970 | 3300046615 | Bacteria | 2492 |
| 475 | Ga0495634_0000969 | 3300046642 | Bacteria | 27075 |
| 476 | Ga0495634_0015671 | 3300046642 | Bacteria | 5438 |
| 477 | Ga0495634_0018562 | 3300046642 | Bacteria | 4949 |
| 478 | Ga0495634_0044526 | 3300046642 | Bacteria | 3003 |
| 479 | Ga0495625_0053068 | 3300046660 | Bacteria | 2901 |
| 480 | Ga0495625_0283918 | 3300046660 | Bacteria | 1064 |
| 481 | Ga0495635_0000434 | 3300046663 | Bacteria | 26421 |
| 482 | Ga0495635_0025444 | 3300046663 | Bacteria | 4122 |
| 483 | Ga0495635_0059745 | 3300046663 | Bacteria | 2621 |
| 484 | Ga0495635_0059871 | 3300046663 | Bacteria | 2619 |
| 485 | Ga0495661_0016991 | 3300046665 | Bacteria | 4808 |
| 486 | Ga0495588_0063025 | 3300046674 | Bacteria | 1922 |
| 487 | Ga0495588_0073316 | 3300046674 | Bacteria | 1782 |
| 488 | Ga0495657_0005912 | 3300046675 | Bacteria | 9612 |
| 489 | Ga0495657_0007977 | 3300046675 | Bacteria | 8117 |
| 490 | Ga0495657_0022986 | 3300046675 | Bacteria | 4460 |
| 491 | Ga0495599_0002117 | 3300046678 | Bacteria | 11526 |
| 492 | Ga0495599_0062858 | 3300046678 | Bacteria | 2319 |
| 493 | Ga0495599_0129549 | 3300046678 | Bacteria | 1567 |
| 494 | Ga0495623_0022452 | 3300046679 | Bacteria | 4076 |
| 495 | Ga0495623_0064649 | 3300046679 | Bacteria | 2289 |
| 496 | Ga0495646_0014985 | 3300046680 | Bacteria | 4925 |
| 497 | Ga0495646_0021600 | 3300046680 | Bacteria | 4066 |
| 498 | Ga0495646_0027263 | 3300046680 | Bacteria | 3584 |
| 499 | Ga0495646_0141558 | 3300046680 | Bacteria | 1344 |
| 500 | Ga0495647_0000360 | 3300046681 | Bacteria | 12869 |
| 501 | Ga0495658_0009177 | 3300046683 | Bacteria | 4918 |
| 502 | Ga0495658_0020094 | 3300046683 | Bacteria | 3498 |
| 503 | Ga0495658_0109479 | 3300046683 | Bacteria | 1659 |
| 504 | Ga0495613_0030595 | 3300046689 | Bacteria | 3999 |
| 505 | Ga0495613_0031204 | 3300046689 | Bacteria | 3957 |
| 506 | Ga0495624_0000445 | 3300046690 | Bacteria | 32525 |
| 507 | Ga0495624_0105050 | 3300046690 | Bacteria | 1738 |
| 508 | Ga0495670_0041658 | 3300046691 | Bacteria | 2291 |
| 509 | Ga0495671_0156236 | 3300046692 | Bacteria | 1110 |
| 510 | Ga0495600_0003883 | 3300046809 | Bacteria | 8870 |
| 511 | Ga0495600_0015470 | 3300046809 | Bacteria | 4822 |
| 512 | Ga0495600_0227209 | 3300046809 | Bacteria | 1192 |
| 513 | Ga0495581_0001178 | 3300047315 | Bacteria | 14344 |
| 514 | Ga0495581_0039724 | 3300047315 | Bacteria | 2724 |
| 515 | Ga0495581_0164853 | 3300047315 | Bacteria | 1296 |
| 516 | Ga0495604_0012567 | 3300047317 | Bacteria | 6733 |
| 517 | Ga0495604_0043465 | 3300047317 | Bacteria | 3517 |
| 518 | Ga0495604_0100106 | 3300047317 | Bacteria | 2131 |
| 519 | Ga0495604_0175565 | 3300047317 | Bacteria | 1503 |
| 520 | Ga0495674_0000443 | 3300047319 | Bacteria | 37259 |
| 521 | Ga0495674_0010317 | 3300047319 | Bacteria | 8845 |
| 522 | Ga0495674_0036232 | 3300047319 | Bacteria | 4443 |
| 523 | Ga0495674_0038574 | 3300047319 | Bacteria | 4287 |
| 524 | Ga0495674_0106388 | 3300047319 | Bacteria | 2383 |
| 525 | Ga0495674_0171479 | 3300047319 | Bacteria | 1810 |
| 526 | Ga0495672_0005199 | 3300047320 | Bacteria | 10374 |
| 527 | Ga0495672_0006462 | 3300047320 | Bacteria | 9068 |
| 528 | Ga0495672_0081743 | 3300047320 | Bacteria | 1798 |
| 529 | Ga0495676_0066520 | 3300047321 | Bacteria | 2792 |
| 530 | Ga0495676_0144347 | 3300047321 | Bacteria | 1702 |
| 531 | Ga0495680_0001308 | 3300047322 | Bacteria | 27152 |
| 532 | Ga0495680_0042578 | 3300047322 | Bacteria | 3601 |
| 533 | Ga0495680_0076152 | 3300047322 | Bacteria | 2544 |
| 534 | Ga0495683_0074363 | 3300047323 | Bacteria | 1665 |
| 535 | Ga0495687_046825 | 3300047443 | Bacteria | 1864 |
| 536 | Ga0495675_0068237 | 3300047444 | Bacteria | 2246 |
| 537 | Ga0495685_063973 | 3300047447 | Bacteria | 1238 |
| 538 | Ga0495673_0013330 | 3300047469 | Bacteria | 4323 |
| 539 | Ga0495684_0002730 | 3300047471 | Bacteria | 13961 |
| 540 | Ga0495684_0054251 | 3300047471 | Bacteria | 3057 |
| 541 | Ga0495684_0105859 | 3300047471 | Bacteria | 2125 |
| 542 | Ga0495684_0127653 | 3300047471 | Bacteria | 1912 |
| 543 | Ga0495686_0126470 | 3300047472 | Bacteria | 1519 |
| 544 | Ga0495593_0000495 | 3300047673 | Bacteria | 22212 |
| 545 | Ga0495593_0001203 | 3300047673 | Bacteria | 15131 |
| 546 | Ga0495593_0022477 | 3300047673 | Bacteria | 3513 |
| 547 | Ga0495593_0124049 | 3300047673 | Bacteria | 1313 |
| 548 | Ga0495602_0028623 | 3300048088 | Bacteria | 5327 |
| 549 | Ga0495602_0049654 | 3300048088 | Bacteria | 3755 |
| 550 | Ga0495602_0055132 | 3300048088 | Bacteria | 3502 |
| 551 | Ga0495602_0146601 | 3300048088 | Bacteria | 1861 |
| 552 | Ga0496100_0011667 | 3300048903 | Bacteria | 5008 |
| 553 | Ga0496101_0003579 | 3300048904 | Bacteria | 9698 |
| 554 | Ga0496101_0052485 | 3300048904 | Bacteria | 2940 |
| 555 | Ga0496101_0146965 | 3300048904 | Bacteria | 1801 |
| 556 | Ga0496101_0183960 | 3300048904 | Bacteria | 1610 |
| 557 | Ga0496102_0007923 | 3300048905 | Bacteria | 9080 |
| 558 | Ga0496102_0139950 | 3300048905 | Bacteria | 2269 |
| 559 | Ga0496103_0121183 | 3300048906 | Bacteria | 1666 |
| 560 | Ga0496103_0161673 | 3300048906 | Bacteria | 1436 |
| 561 | Ga0496104_0069177 | 3300048907 | Bacteria | 3355 |
| 562 | Ga0496104_0168040 | 3300048907 | Bacteria | 2103 |
| 563 | Ga0496104_0237482 | 3300048907 | Bacteria | 1734 |
| 564 | Ga0496105_0016857 | 3300048908 | Bacteria | 5843 |
| 565 | Ga0496105_0026827 | 3300048908 | Bacteria | 4701 |
| 566 | Ga0496105_0258754 | 3300048908 | Bacteria | 1408 |
| 567 | Ga0496105_0322725 | 3300048908 | Bacteria | 1237 |
| 568 | Ga0496106_0043115 | 3300048909 | Bacteria | 3385 |
| 569 | Ga0496106_0104052 | 3300048909 | Bacteria | 2204 |
| 570 | Ga0496107_0033299 | 3300048910 | Bacteria | 3686 |
| 571 | Ga0496107_0066411 | 3300048910 | Bacteria | 2615 |
| 572 | Ga0496107_0096532 | 3300048910 | Bacteria | 2163 |
| 573 | Ga0496107_0140661 | 3300048910 | Bacteria | 1784 |
| 574 | Ga0496107_0230720 | 3300048910 | Bacteria | 1377 |
| 575 | Ga0496108_0074802 | 3300048911 | Bacteria | 2861 |
| 576 | Ga0496109_0017997 | 3300048912 | Bacteria | 6203 |
| 577 | Ga0496109_0116893 | 3300048912 | Bacteria | 2482 |
| 578 | Ga0496110_0067181 | 3300048913 | Bacteria | 3172 |
| 579 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 580 | Ga0496112_0042235 | 3300048915 | Bacteria | 4460 |
| 581 | Ga0496112_0074363 | 3300048915 | Bacteria | 3359 |
| 582 | Ga0496112_0173866 | 3300048915 | Bacteria | 2119 |
| 583 | Ga0496112_0197092 | 3300048915 | Bacteria | 1974 |
| 584 | Ga0496112_0218968 | 3300048915 | Bacteria | 1860 |
| 585 | Ga0496112_0396022 | 3300048915 | Bacteria | 1321 |
| 586 | Ga0496113_0061050 | 3300048916 | Bacteria | 2843 |
| 587 | Ga0496113_0182878 | 3300048916 | Bacteria | 1662 |
| 588 | Ga0496113_0207468 | 3300048916 | Bacteria | 1559 |
| 589 | Ga0496114_0011325 | 3300048917 | Bacteria | 7124 |
| 590 | Ga0496114_0056814 | 3300048917 | Bacteria | 3266 |
| 591 | Ga0496115_0000295 | 3300048918 | Bacteria | 42998 |
| 592 | Ga0496115_0018198 | 3300048918 | Bacteria | 5389 |
| 593 | Ga0496115_0076474 | 3300048918 | Bacteria | 2721 |
| 594 | Ga0496115_0079903 | 3300048918 | Bacteria | 2662 |
| 595 | Ga0496115_0142236 | 3300048918 | Bacteria | 1979 |
| 596 | Ga0496116_0002462 | 3300048919 | Bacteria | 19411 |
| 597 | Ga0496116_0040127 | 3300048919 | Bacteria | 3227 |
| 598 | Ga0496117_0086744 | 3300048920 | Bacteria | 2032 |
| 599 | Ga0496117_0153103 | 3300048920 | Bacteria | 1362 |
| 600 | Ga0496118_0015057 | 3300048921 | Bacteria | 7190 |
| 601 | Ga0496118_0037848 | 3300048921 | Bacteria | 3875 |
| 602 | Ga0496118_0093022 | 3300048921 | Bacteria | 2067 |
| 603 | Ga0496118_0100783 | 3300048921 | Bacteria | 1952 |
| 604 | Ga0496118_0101437 | 3300048921 | Bacteria | 1943 |
| 605 | Ga0496118_0128456 | 3300048921 | Bacteria | 1633 |
| 606 | Ga0496119_0007315 | 3300048922 | Bacteria | 9989 |
| 607 | Ga0496120_0002476 | 3300048923 | Bacteria | 18594 |
| 608 | Ga0496120_0018821 | 3300048923 | Bacteria | 4437 |
| 609 | Ga0496120_0126979 | 3300048923 | Bacteria | 1311 |
| 610 | Ga0496121_0001687 | 3300048924 | Bacteria | 36333 |
| 611 | Ga0496121_0022584 | 3300048924 | Bacteria | 6095 |
| 612 | Ga0496121_0024664 | 3300048924 | Bacteria | 5741 |
| 613 | Ga0496121_0036588 | 3300048924 | Bacteria | 4372 |
| 614 | Ga0496121_0041193 | 3300048924 | Bacteria | 4041 |
| 615 | Ga0496121_0050936 | 3300048924 | Bacteria | 3492 |
| 616 | Ga0496121_0055607 | 3300048924 | Bacteria | 3295 |
| 617 | Ga0496121_0063679 | 3300048924 | Bacteria | 3011 |
| 618 | Ga0496121_0155941 | 3300048924 | Bacteria | 1675 |
| 619 | Ga0496121_0158418 | 3300048924 | Bacteria | 1658 |
| 620 | Ga0496121_0292411 | 3300048924 | Bacteria | 1109 |
| 621 | Ga0496124_0134256 | 3300048927 | Bacteria | 1962 |
| 622 | Ga0496124_0165185 | 3300048927 | Bacteria | 1721 |
| 623 | Ga0496124_0212595 | 3300048927 | Bacteria | 1462 |
| 624 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 625 | Ga0496125_0004393 | 3300048928 | Bacteria | 16325 |
| 626 | Ga0496125_0056873 | 3300048928 | Bacteria | 3173 |
| 627 | Ga0496125_0074537 | 3300048928 | Bacteria | 2631 |
| 628 | Ga0496126_0005939 | 3300048929 | Bacteria | 13755 |
| 629 | Ga0496126_0007864 | 3300048929 | Bacteria | 11610 |
| 630 | Ga0496126_0007926 | 3300048929 | Bacteria | 11546 |
| 631 | Ga0496126_0010008 | 3300048929 | Bacteria | 10006 |
| 632 | Ga0496126_0032301 | 3300048929 | Bacteria | 4932 |
| 633 | Ga0496126_0035603 | 3300048929 | Bacteria | 4664 |
| 634 | Ga0496126_0038680 | 3300048929 | Bacteria | 4435 |
| 635 | Ga0496126_0082697 | 3300048929 | Bacteria | 2836 |
| 636 | Ga0496126_0093307 | 3300048929 | Bacteria | 2643 |
| 637 | Ga0496126_0258306 | 3300048929 | Bacteria | 1449 |
| 638 | Ga0496126_0285803 | 3300048929 | Bacteria | 1365 |
| 639 | Ga0496126_0290432 | 3300048929 | Bacteria | 1352 |
| 640 | Ga0496126_0292181 | 3300048929 | Bacteria | 1347 |
| 641 | Ga0495682_0051142 | 3300049460 | Bacteria | 1503 |
| 642 | Ga0501031_0003990 | 3300049568 | Bacteria | 9517 |
| 643 | Ga0501032_0000073 | 3300049569 | Bacteria | 85584 |
| 644 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 645 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 646 | Ga0501034_0116531 | 3300049571 | Bacteria | 2659 |
| 647 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 648 | Ga0501036_0202301 | 3300049572 | Bacteria | 1670 |
| 649 | Ga0501037_0000040 | 3300049573 | Bacteria | 119364 |
| 650 | Ga0501038_0000150 | 3300049574 | Bacteria | 59508 |
| 651 | Ga0501038_0368549 | 3300049574 | Bacteria | 1116 |
| 652 | Ga0501039_0003418 | 3300049575 | Bacteria | 11852 |
| 653 | Ga0501040_0300295 | 3300049576 | Bacteria | 1148 |
| 654 | Ga0501042_0008136 | 3300049578 | Bacteria | 6907 |
| 655 | Ga0501043_0000464 | 3300049579 | Bacteria | 36232 |
| 656 | Ga0501043_0191031 | 3300049579 | Bacteria | 1592 |
| 657 | Ga0501046_0000398 | 3300049580 | Bacteria | 43497 |
| 658 | Ga0501046_0223674 | 3300049580 | Bacteria | 1392 |
| 659 | Ga0501047_0000656 | 3300049581 | Bacteria | 36126 |
| 660 | Ga0501047_0294580 | 3300049581 | Bacteria | 1466 |
| 661 | Ga0501048_0000906 | 3300049582 | Bacteria | 21866 |
| 662 | Ga0501067_0000192 | 3300049583 | Bacteria | 34520 |
| 663 | Ga0501067_0035211 | 3300049583 | Bacteria | 2780 |
| 664 | Ga0501068_0002765 | 3300049584 | Bacteria | 9319 |
| 665 | Ga0501069_0014897 | 3300049585 | Bacteria | 4163 |
| 666 | Ga0501070_0037271 | 3300049586 | Bacteria | 4060 |
| 667 | Ga0501070_0076207 | 3300049586 | Bacteria | 2776 |
| 668 | Ga0501070_0179220 | 3300049586 | Bacteria | 1744 |
| 669 | Ga0501070_0203936 | 3300049586 | Bacteria | 1624 |
| 670 | Ga0501071_0053825 | 3300049587 | Bacteria | 2903 |
| 671 | Ga0501072_0002128 | 3300049588 | Bacteria | 14764 |
| 672 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 673 | Ga0501074_0000133 | 3300049590 | Bacteria | 38342 |
| 674 | Ga0501079_0024353 | 3300049741 | Bacteria | 4643 |
| 675 | Ga0501080_0000054 | 3300049742 | Bacteria | 74316 |
| 676 | Ga0501080_0005201 | 3300049742 | Bacteria | 11597 |
| 677 | Ga0501083_0001153 | 3300049744 | Bacteria | 17779 |
| 678 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 679 | Ga0501035_0278135 | 3300049822 | Bacteria | 1415 |
| 680 | Ga0501044_0000985 | 3300049823 | Bacteria | 34233 |
| 681 | Ga0501044_0102936 | 3300049823 | Bacteria | 2870 |
| 682 | Ga0501045_0019721 | 3300049824 | Bacteria | 4811 |
| 683 | nmdc:mga03683_17647_c1 | 3300050489 | Bacteria | 2704 |
| 684 | nmdc:mga00v17_20486_c1 | 3300050491 | Bacteria | 3789 |
| 685 | nmdc:mga00v17_215349_c1 | 3300050491 | Bacteria | 1243 |
| 686 | nmdc:mga0yw44_91521_c1 | 3300050492 | Bacteria | 1923 |
| 687 | nmdc:mga0yw44_942_c1 | 3300050492 | Bacteria | 11041 |
| 688 | nmdc:mga06z11_14027_c1 | 3300050494 | Bacteria | 3536 |
| 689 | nmdc:mga06z11_30068_c1 | 3300050494 | Bacteria | 2625 |
| 690 | nmdc:mga07m45_69423_c1 | 3300050496 | Bacteria | 1110 |
| 691 | nmdc:mga07m45_6998_c1 | 3300050496 | Bacteria | 5738 |
| 692 | nmdc:mga0n895_115792_c1 | 3300050512 | Bacteria | 2699 |
| 693 | nmdc:mga0n895_30146_c1 | 3300050512 | Bacteria | 5181 |
| 694 | nmdc:mga0sz30_9846_c1 | 3300050516 | Bacteria | 3646 |
| 695 | Ga0495601_0013434 | 3300053077 | Bacteria | 4926 |
| 696 | Ga0495601_0083775 | 3300053077 | Bacteria | 2048 |
| 697 | Ga0495612_0062530 | 3300053078 | Bacteria | 1543 |
| 698 | Ga0500610_0097521 | 3300053079 | Bacteria | 1524 |
| 699 | Ga0500635_0044597 | 3300053080 | Bacteria | 1497 |
| 700 | Ga0495595_0000758 | 3300053084 | Bacteria | 12258 |
| 701 | Ga0495619_0000617 | 3300053085 | Bacteria | 23526 |
| 702 | Ga0495619_0217529 | 3300053085 | Bacteria | 1323 |
| 703 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 704 | Ga0500581_052116 | 3300053089 | Bacteria | 2085 |
| 705 | Ga0500646_0035013 | 3300053090 | Bacteria | 1394 |
| 706 | Ga0500583_0012288 | 3300053092 | Bacteria | 3260 |
| 707 | Ga0500651_0026339 | 3300053093 | Bacteria | 3654 |
| 708 | Ga0500651_0098104 | 3300053093 | Bacteria | 1799 |
| 709 | Ga0500651_0127566 | 3300053093 | Bacteria | 1540 |
| 710 | Ga0500566_0000822 | 3300053094 | Bacteria | 17706 |
| 711 | Ga0500566_0003799 | 3300053094 | Bacteria | 9002 |
| 712 | Ga0500566_0015378 | 3300053094 | Bacteria | 4489 |
| 713 | Ga0500641_0016085 | 3300053096 | Bacteria | 2783 |
| 714 | Ga0500641_0039404 | 3300053096 | Bacteria | 1903 |
| 715 | Ga0500650_0006577 | 3300053098 | Bacteria | 4451 |
| 716 | Ga0500555_003167 | 3300053103 | Bacteria | 4691 |
| 717 | Ga0500556_0000047 | 3300053104 | Bacteria | 126199 |
| 718 | Ga0500595_003841 | 3300053119 | Bacteria | 6904 |
| 719 | Ga0500595_015941 | 3300053119 | Bacteria | 2808 |
| 720 | Ga0500595_023858 | 3300053119 | Bacteria | 2143 |
| 721 | Ga0500608_015167 | 3300053122 | Bacteria | 3456 |
| 722 | Ga0500618_011635 | 3300053125 | Bacteria | 2328 |
| 723 | Ga0500642_0000142 | 3300053130 | Bacteria | 32016 |
| 724 | Ga0500642_0000183 | 3300053130 | Bacteria | 25867 |
| 725 | Ga0500642_0030123 | 3300053130 | Bacteria | 2255 |
| 726 | Ga0500652_001628 | 3300053131 | Bacteria | 6828 |
| 727 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 728 | Ga0500559_0001644 | 3300053136 | Bacteria | 12374 |
| 729 | Ga0500559_0004871 | 3300053136 | Bacteria | 6261 |
| 730 | Ga0500568_0010399 | 3300053139 | Bacteria | 4359 |
| 731 | Ga0500568_0030179 | 3300053139 | Bacteria | 2245 |
| 732 | Ga0500568_0031881 | 3300053139 | Bacteria | 2170 |
| 733 | Ga0500577_0000991 | 3300053142 | Bacteria | 7308 |
| 734 | Ga0500603_000576 | 3300053150 | Bacteria | 9221 |
| 735 | Ga0500603_051801 | 3300053150 | Bacteria | 1126 |
| 736 | Ga0500604_0002170 | 3300053151 | Bacteria | 5398 |
| 737 | Ga0500604_0008009 | 3300053151 | Bacteria | 2803 |
| 738 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 739 | Ga0500616_0000784 | 3300053153 | Bacteria | 36530 |
| 740 | Ga0500619_025645 | 3300053154 | Bacteria | 1748 |
| 741 | Ga0500622_0002394 | 3300053156 | Bacteria | 13562 |
| 742 | Ga0500622_0008137 | 3300053156 | Bacteria | 5893 |
| 743 | Ga0500627_0022514 | 3300053158 | Bacteria | 2557 |
| 744 | Ga0500627_0098195 | 3300053158 | Bacteria | 1313 |
| 745 | Ga0500638_000230 | 3300053162 | Bacteria | 11941 |
| 746 | Ga0500636_0000592 | 3300053177 | Bacteria | 19795 |
| 747 | Ga0500636_0003094 | 3300053177 | Bacteria | 9326 |
| 748 | Ga0500636_0009727 | 3300053177 | Bacteria | 5600 |
| 749 | Ga0500636_0054374 | 3300053177 | Bacteria | 2347 |
| 750 | Ga0500636_0082718 | 3300053177 | Bacteria | 1847 |
| 751 | Ga0500636_0104233 | 3300053177 | Bacteria | 1609 |
| 752 | Ga0500637_0001711 | 3300053178 | Bacteria | 9461 |
| 753 | Ga0500637_0003917 | 3300053178 | Bacteria | 6950 |
| 754 | Ga0500625_000232 | 3300053729 | Bacteria | 12898 |
| 755 | Ga0500645_007739 | 3300053730 | Bacteria | 3717 |
| 756 | Ga0500645_024708 | 3300053730 | Bacteria | 1836 |
| 757 | Ga0500609_009508 | 3300053731 | Bacteria | 1310 |
| 758 | Ga0500596_003778 | 3300053735 | Bacteria | 2840 |
| 759 | Ga0500596_003966 | 3300053735 | Bacteria | 2756 |
| 760 | Ga0500599_000651 | 3300053736 | Bacteria | 3722 |
| 761 | Ga0500601_000888 | 3300053737 | Bacteria | 3585 |
| 762 | Ga0501084_0008150 | 3300054114 | Bacteria | 8638 |
| 763 | Ga0500661_000294 | 3300055283 | Bacteria | 9104 |
| 764 | Ga0501082_0005663 | 3300060353 | Bacteria | 10842 |
| 765 | Ga0530510_0214055 | 3300061734 | Bacteria | 1432 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_313834_314853 | 304 |
| 2 | 3300048929 | Ga0496126_0038680 | Ga0496126_0038680_1832_2851 | 306 |
| 3 | 3300044765 | Ga0466970_0169879 | Ga0466970_0169879_157_1104 | 308 |
| 4 | 3300025295 | Ga0209564_1000477 | Ga0209564_10004773 | 310 |
| 5 | 3300031249 | Ga0265339_10026845 | Ga0265339_100268452 | 311 |
| 6 | 3300031711 | Ga0265314_10063614 | Ga0265314_100636142 | 311 |
| 7 | 3300048929 | Ga0496126_0035603 | Ga0496126_0035603_1951_2970 | 311 |
| 8 | 3300053730 | Ga0500645_024708 | Ga0500645_024708_190_1209 | 312 |
| 9 | 3300005436 | Ga0070713_100162662 | Ga0070713_1001626621 | 314 |
| 10 | 3300025928 | Ga0207700_10053147 | Ga0207700_100531471 | 314 |
| 11 | 3300025929 | Ga0207664_10120275 | Ga0207664_101202752 | 314 |
| 12 | 3300035120 | Ga0373957_0013220 | Ga0373957_0013220_159_1178 | 314 |
| 13 | 3300025297 | Ga0209758_1004564 | Ga0209758_100456412 | 315 |
| 14 | 3300039447 | Ga0436361_0686082 | Ga0436361_0686082_6841_7857 | 315 |
| 15 | 3300047320 | Ga0495672_0081743 | Ga0495672_0081743_402_1421 | 315 |
| 16 | 3300006175 | Ga0070712_100152298 | Ga0070712_1001522981 | 317 |
| 17 | 3300048921 | Ga0496118_0101437 | Ga0496118_0101437_221_1240 | 317 |
| 18 | 3300048929 | Ga0496126_0093307 | Ga0496126_0093307_148_1167 | 317 |
| 19 | 3300053150 | Ga0500603_051801 | Ga0500603_051801_29_1045 | 317 |
| 20 | 3300053177 | Ga0500636_0009727 | Ga0500636_0009727_1749_2765 | 317 |
| 21 | 3300053177 | Ga0500636_0054374 | Ga0500636_0054374_262_1278 | 317 |
| 22 | 3300047320 | Ga0495672_0005199 | Ga0495672_0005199_6756_7775 | 320 |
| 23 | 3300046462 | Ga0495651_0032670 | Ga0495651_0032670_1763_2782 | 321 |
| 24 | iso_pu_bacteria | 8019547302 | 8019551008 | 321 |
| 25 | 3300048909 | Ga0496106_0043115 | Ga0496106_0043115_2366_3337 | 323 |
| 26 | 3300003752 | Ga0055539_1002997 | Ga0055539_10029972 | 324 |
| 27 | 3300025272 | Ga0209455_1023034 | Ga0209455_10230341 | 324 |
| 28 | 3300048921 | Ga0496118_0015057 | Ga0496118_0015057_2970_3983 | 324 |
| 29 | 3300048924 | Ga0496121_0024664 | Ga0496121_0024664_2320_3333 | 324 |
| 30 | 3300031507 | Ga0307509_10106470 | Ga0307509_101064703 | 325 |
| 31 | 3300048928 | Ga0496125_0074537 | Ga0496125_0074537_31_1044 | 325 |
| 32 | 3300039453 | Ga0436362_1080726 | Ga0436362_1080726_12_1028 | 326 |
| 33 | 3300046559 | Ga0495667_0281418 | Ga0495667_0281418_12_1001 | 327 |
| 34 | 3300053177 | Ga0500636_0082718 | Ga0500636_0082718_787_1806 | 327 |
| 35 | 3300053735 | Ga0500596_003778 | Ga0500596_003778_173_1192 | 327 |
| 36 | 3300037471 | Ga0395905_0083368 | Ga0395905_0083368_1423_2442 | 328 |
| 37 | 3300048924 | Ga0496121_0292411 | Ga0496121_0292411_47_1066 | 328 |
| 38 | 3300005436 | Ga0070713_100129624 | Ga0070713_1001296242 | 331 |
| 39 | 3300005843 | Ga0068860_100000837 | Ga0068860_10000083723 | 331 |
| 40 | 3300025898 | Ga0207692_10000138 | Ga0207692_1000013813 | 331 |
| 41 | 3300025906 | Ga0207699_10000122 | Ga0207699_1000012214 | 331 |
| 42 | 3300025915 | Ga0207693_10009351 | Ga0207693_100093513 | 331 |
| 43 | 3300025916 | Ga0207663_10000623 | Ga0207663_1000062311 | 331 |
| 44 | 3300028381 | Ga0268264_10000537 | Ga0268264_1000053715 | 331 |
| 45 | 3300053119 | Ga0500595_015941 | Ga0500595_015941_884_1903 | 331 |
| 46 | 3300053139 | Ga0500568_0031881 | Ga0500568_0031881_1123_2142 | 331 |
| 47 | iso_pu_bacteria | 2507262055 | 2507505934 | 331 |
| 48 | iso_pu_bacteria | 2508501009 | 2508540123 | 331 |
| 49 | iso_pu_bacteria | 2511231028 | 2511396578 | 331 |
| 50 | iso_pu_bacteria | 2513237092 | 2513627430 | 331 |
| 51 | iso_pu_bacteria | 2515154112 | 2515628524 | 331 |
| 52 | iso_pu_bacteria | 2528768022 | 2528850701 | 331 |
| 53 | iso_pu_bacteria | 2617270741 | 2617374738 | 331 |
| 54 | iso_pu_bacteria | 2824661429 | 2824667356 | 331 |
| 55 | iso_pu_bacteria | 2824732956 | 2824737037 | 331 |
| 56 | iso_pu_bacteria | 2824746037 | 2824750817 | 331 |
| 57 | iso_pu_bacteria | 2841957949 | 2841963963 | 331 |
| 58 | iso_pu_bacteria | 2842038055 | 2842044401 | 331 |
| 59 | iso_pu_bacteria | 2842045827 | 2842051610 | 331 |
| 60 | iso_pu_bacteria | 2857509624 | 2857513353 | 331 |
| 61 | iso_pu_bacteria | 2874590934 | 2874596330 | 331 |
| 62 | iso_pu_bacteria | 2874612657 | 2874616469 | 331 |
| 63 | iso_pu_bacteria | 2874645413 | 2874650317 | 331 |
| 64 | iso_pu_bacteria | 2876761206 | 2876761654 | 331 |
| 65 | iso_pu_bacteria | 2876771140 | 2876776795 | 331 |
| 66 | iso_pu_bacteria | 2876818435 | 2876824585 | 331 |
| 67 | iso_pu_bacteria | 2879074833 | 2879080932 | 331 |
| 68 | iso_pu_bacteria | 2879099564 | 2879104427 | 331 |
| 69 | iso_pu_bacteria | 2879127579 | 2879133777 | 331 |
| 70 | iso_pu_bacteria | 2879142872 | 2879148279 | 331 |
| 71 | iso_pu_bacteria | 2888388044 | 2888389921 | 331 |
| 72 | iso_pu_bacteria | 2908775508 | 2908777220 | 331 |
| 73 | iso_pu_bacteria | 2922368715 | 2922377409 | 331 |
| 74 | iso_pu_bacteria | 2929615660 | 2929622197 | 331 |
| 75 | iso_pu_bacteria | 2929624759 | 2929630156 | 331 |
| 76 | iso_pu_bacteria | 2932784394 | 2932787915 | 331 |
| 77 | iso_pu_bacteria | 2932809354 | 2932817641 | 331 |
| 78 | iso_pu_bacteria | 2932818245 | 2932826199 | 331 |
| 79 | iso_pu_bacteria | 2932828146 | 2932835057 | 331 |
| 80 | iso_pu_bacteria | 2933577622 | 2933584188 | 331 |
| 81 | iso_pu_bacteria | 2935608549 | 2935614359 | 331 |
| 82 | iso_pu_bacteria | 2935616580 | 2935620434 | 331 |
| 83 | iso_pu_bacteria | 2935638405 | 2935640757 | 331 |
| 84 | iso_pu_bacteria | 2935648319 | 2935649388 | 331 |
| 85 | iso_pu_bacteria | 2935656913 | 2935657840 | 331 |
| 86 | iso_pu_bacteria | 2935665750 | 2935670260 | 331 |
| 87 | iso_pu_bacteria | 2935675223 | 2935679689 | 331 |
| 88 | iso_pu_bacteria | 2935684952 | 2935687258 | 331 |
| 89 | iso_pu_bacteria | 2935694250 | 2935696771 | 331 |
| 90 | iso_pu_bacteria | 2935703347 | 2935709137 | 331 |
| 91 | iso_pu_bacteria | 2935713505 | 2935718717 | 331 |
| 92 | iso_pu_bacteria | 2935722832 | 2935728369 | 331 |
| 93 | iso_pu_bacteria | 2935732158 | 2935737034 | 331 |
| 94 | iso_pu_bacteria | 2935741537 | 2935745963 | 331 |
| 95 | iso_pu_bacteria | 2935750917 | 2935753224 | 331 |
| 96 | iso_pu_bacteria | 2935760218 | 2935766384 | 331 |
| 97 | iso_pu_bacteria | 2935769743 | 2935770223 | 331 |
| 98 | iso_pu_bacteria | 2935777560 | 2935777748 | 331 |
| 99 | iso_pu_bacteria | 2935785616 | 2935786724 | 331 |
| 100 | iso_pu_bacteria | 2935793552 | 2935794778 | 331 |
| 101 | iso_pu_bacteria | 2935801545 | 2935809064 | 331 |
| 102 | iso_pu_bacteria | 2935810662 | 2935813755 | 331 |
| 103 | iso_pu_bacteria | 2935819856 | 2935826577 | 331 |
| 104 | iso_pu_bacteria | 2935827899 | 2935832264 | 331 |
| 105 | iso_pu_bacteria | 2935837841 | 2935843969 | 331 |
| 106 | iso_pu_bacteria | 2935847175 | 2935851129 | 331 |
| 107 | iso_pu_bacteria | 2935855204 | 2935862760 | 331 |
| 108 | iso_pu_bacteria | 2935864058 | 2935864503 | 331 |
| 109 | iso_pu_bacteria | 2935873716 | 2935875145 | 331 |
| 110 | iso_pu_bacteria | 2935908558 | 2935913179 | 331 |
| 111 | iso_pu_bacteria | 2935916978 | 2935922601 | 331 |
| 112 | iso_pu_bacteria | 2935926038 | 2935930896 | 331 |
| 113 | iso_pu_bacteria | 2935934488 | 2935939770 | 331 |
| 114 | iso_pu_bacteria | 2935942939 | 2935946719 | 331 |
| 115 | iso_pu_bacteria | 2935951376 | 2935956080 | 331 |
| 116 | iso_pu_bacteria | 2935959822 | 2935964984 | 331 |
| 117 | iso_pu_bacteria | 2935967501 | 2935972873 | 331 |
| 118 | iso_pu_bacteria | 2935975950 | 2935978212 | 331 |
| 119 | iso_pu_bacteria | 2935984226 | 2935985664 | 331 |
| 120 | iso_pu_bacteria | 2935992306 | 2935999236 | 331 |
| 121 | iso_pu_bacteria | 2936002035 | 2936005791 | 331 |
| 122 | iso_pu_bacteria | 2936011229 | 2936012059 | 331 |
| 123 | iso_pu_bacteria | 2936019824 | 2936020860 | 331 |
| 124 | iso_pu_bacteria | 2936028420 | 2936029352 | 331 |
| 125 | iso_pu_bacteria | 2936037263 | 2936039311 | 331 |
| 126 | iso_pu_bacteria | 2936046547 | 2936048324 | 331 |
| 127 | iso_pu_bacteria | 2940556831 | 2940559137 | 331 |
| 128 | iso_pu_bacteria | 2941538514 | 2941541832 | 331 |
| 129 | iso_pu_bacteria | 3005483717 | 3005491082 | 331 |
| 130 | iso_pu_bacteria | 3005587118 | 3005592162 | 331 |
| 131 | iso_pu_bacteria | 3005594810 | 3005595877 | 331 |
| 132 | iso_pu_bacteria | 8016511872 | 8016517250 | 331 |
| 133 | iso_pu_bacteria | 8016522445 | 8016526987 | 331 |
| 134 | iso_pu_bacteria | 8016530956 | 8016532066 | 331 |
| 135 | iso_pu_bacteria | 8016539877 | 8016545277 | 331 |
| 136 | iso_pu_bacteria | 8016548790 | 8016556811 | 331 |
| 137 | iso_pu_bacteria | 8016566248 | 8016570356 | 331 |
| 138 | iso_pu_bacteria | 8016575299 | 8016582902 | 331 |
| 139 | iso_pu_bacteria | 8016595262 | 8016602810 | 331 |
| 140 | iso_pu_bacteria | 8016603502 | 8016605674 | 331 |
| 141 | iso_pu_bacteria | 8016613128 | 8016617585 | 331 |
| 142 | iso_pu_bacteria | 8016622563 | 8016623986 | 331 |
| 143 | iso_pu_bacteria | 8016630954 | 8016634874 | 331 |
| 144 | iso_pu_bacteria | 8017057580 | 8017059343 | 331 |
| 145 | iso_pu_bacteria | 8019538911 | 8019539645 | 331 |
| 146 | iso_pu_bacteria | 8019576017 | 8019576282 | 331 |
| 147 | iso_pu_bacteria | 8019586578 | 8019594156 | 331 |
| 148 | iso_pu_bacteria | 8019597564 | 8019607407 | 331 |
| 149 | iso_pu_bacteria | 8019608314 | 8019611105 | 331 |
| 150 | iso_pu_bacteria | 8019629233 | 8019631370 | 331 |
| 151 | iso_pu_bacteria | 8019638758 | 8019639246 | 331 |
| 152 | iso_pu_bacteria | 8019659431 | 8019668175 | 331 |
| 153 | iso_pu_bacteria | 8019668869 | 8019677637 | 331 |
| 154 | iso_pu_bacteria | 8019678201 | 8019687308 | 331 |
| 155 | iso_pu_bacteria | 8055742211 | 8055743553 | 331 |
| 156 | 3300005339 | Ga0070660_100280343 | Ga0070660_1002803431 | 332 |
| 157 | 3300005563 | Ga0068855_100080478 | Ga0068855_1000804781 | 332 |
| 158 | 3300005563 | Ga0068855_100117639 | Ga0068855_1001176393 | 332 |
| 159 | 3300005616 | Ga0068852_100006606 | Ga0068852_1000066062 | 332 |
| 160 | 3300013104 | Ga0157370_10532625 | Ga0157370_105326251 | 332 |
| 161 | 3300013105 | Ga0157369_10151451 | Ga0157369_101514512 | 332 |
| 162 | 3300025917 | Ga0207660_10227703 | Ga0207660_102277032 | 332 |
| 163 | 3300025919 | Ga0207657_10242711 | Ga0207657_102427111 | 332 |
| 164 | 3300025924 | Ga0207694_10038204 | Ga0207694_100382042 | 332 |
| 165 | 3300025949 | Ga0207667_10072942 | Ga0207667_100729422 | 332 |
| 166 | 3300026078 | Ga0207702_10063018 | Ga0207702_100630182 | 332 |
| 167 | 3300026142 | Ga0207698_10057730 | Ga0207698_100577303 | 332 |
| 168 | 3300028800 | Ga0265338_10063970 | Ga0265338_100639701 | 332 |
| 169 | 3300031712 | Ga0265342_10014904 | Ga0265342_100149044 | 332 |
| 170 | 3300031730 | Ga0307516_10014001 | Ga0307516_100140014 | 332 |
| 171 | 3300031730 | Ga0307516_10290305 | Ga0307516_102903051 | 332 |
| 172 | 3300048927 | Ga0496124_0212595 | Ga0496124_0212595_223_1221 | 332 |
| 173 | 3300048929 | Ga0496126_0032301 | Ga0496126_0032301_131_1150 | 332 |
| 174 | iso_pu_bacteria | 2513237094 | 2513638320 | 332 |
| 175 | iso_pu_bacteria | 2513237095 | 2513649162 | 332 |
| 176 | iso_pu_bacteria | 2513237102 | 2513700225 | 332 |
| 177 | iso_pu_bacteria | 2513237139 | 2513877237 | 332 |
| 178 | iso_pu_bacteria | 2513237161 | 2514014607 | 332 |
| 179 | iso_pu_bacteria | 2517093001 | 2517103119 | 332 |
| 180 | iso_pu_bacteria | 2524023205 | 2524442995 | 332 |
| 181 | iso_pu_bacteria | 2617270735 | 2617347816 | 332 |
| 182 | iso_pu_bacteria | 2744054633 | 2745081916 | 332 |
| 183 | iso_pu_bacteria | 2802429603 | 2805916163 | 332 |
| 184 | iso_pu_bacteria | 2816332527 | 2818240553 | 332 |
| 185 | iso_pu_bacteria | 2824600985 | 2824603628 | 332 |
| 186 | iso_pu_bacteria | 2824609381 | 2824610786 | 332 |
| 187 | iso_pu_bacteria | 2824617872 | 2824623208 | 332 |
| 188 | iso_pu_bacteria | 2824626560 | 2824632194 | 332 |
| 189 | iso_pu_bacteria | 2824635225 | 2824640813 | 332 |
| 190 | iso_pu_bacteria | 2824644064 | 2824647965 | 332 |
| 191 | iso_pu_bacteria | 2824653114 | 2824655232 | 332 |
| 192 | iso_pu_bacteria | 2824671348 | 2824675049 | 332 |
| 193 | iso_pu_bacteria | 2824687955 | 2824691784 | 332 |
| 194 | iso_pu_bacteria | 2824696289 | 2824701063 | 332 |
| 195 | iso_pu_bacteria | 2824704595 | 2824709281 | 332 |
| 196 | iso_pu_bacteria | 2824714736 | 2824717978 | 332 |
| 197 | iso_pu_bacteria | 2824723954 | 2824728194 | 332 |
| 198 | iso_pu_bacteria | 2824753945 | 2824762003 | 332 |
| 199 | iso_pu_bacteria | 2824763712 | 2824772370 | 332 |
| 200 | iso_pu_bacteria | 2824773399 | 2824775702 | 332 |
| 201 | iso_pu_bacteria | 2838122688 | 2838125077 | 332 |
| 202 | iso_pu_bacteria | 2841941048 | 2841945815 | 332 |
| 203 | iso_pu_bacteria | 2841949485 | 2841956914 | 332 |
| 204 | iso_pu_bacteria | 2841966195 | 2841973525 | 332 |
| 205 | iso_pu_bacteria | 2841974524 | 2841981996 | 332 |
| 206 | iso_pu_bacteria | 2841983080 | 2841989413 | 332 |
| 207 | iso_pu_bacteria | 2844315083 | 2844316264 | 332 |
| 208 | iso_pu_bacteria | 2847930680 | 2847939424 | 332 |
| 209 | iso_pu_bacteria | 2847939898 | 2847941185 | 332 |
| 210 | iso_pu_bacteria | 2849076700 | 2849082171 | 332 |
| 211 | iso_pu_bacteria | 2874628541 | 2874633394 | 332 |
| 212 | iso_pu_bacteria | 2879083081 | 2879087096 | 332 |
| 213 | iso_pu_bacteria | 2881364244 | 2881369588 | 332 |
| 214 | iso_pu_bacteria | 2881665667 | 2881669694 | 332 |
| 215 | iso_pu_bacteria | 2885409591 | 2885418886 | 332 |
| 216 | iso_pu_bacteria | 2888378607 | 2888387230 | 332 |
| 217 | iso_pu_bacteria | 2888419890 | 2888421180 | 332 |
| 218 | iso_pu_bacteria | 2903727486 | 2903728400 | 332 |
| 219 | iso_pu_bacteria | 2904711408 | 2904719805 | 332 |
| 220 | iso_pu_bacteria | 2906602504 | 2906606541 | 332 |
| 221 | iso_pu_bacteria | 2906626472 | 2906631421 | 332 |
| 222 | iso_pu_bacteria | 2906643746 | 2906650657 | 332 |
| 223 | iso_pu_bacteria | 2932794094 | 2932796038 | 332 |
| 224 | iso_pu_bacteria | 2932801729 | 2932807615 | 332 |
| 225 | iso_pu_bacteria | 2935883170 | 2935887307 | 332 |
| 226 | iso_pu_bacteria | 2941531003 | 2941534578 | 332 |
| 227 | iso_pu_bacteria | 3005710791 | 3005711819 | 332 |
| 228 | iso_pu_bacteria | 3005718088 | 3005719073 | 332 |
| 229 | iso_pu_bacteria | 8006926726 | 8006930187 | 332 |
| 230 | iso_pu_bacteria | 8016583857 | 8016585395 | 332 |
| 231 | iso_pu_bacteria | 8056967851 | 8056974152 | 332 |
| 232 | 3300025913 | Ga0207695_10402539 | Ga0207695_104025392 | 333 |
| 233 | iso_pu_bacteria | 2508501128 | 2509148121 | 333 |
| 234 | iso_pu_bacteria | 2513237096 | 2513657473 | 333 |
| 235 | iso_pu_bacteria | 2513237098 | 2513674951 | 333 |
| 236 | iso_pu_bacteria | 2513237101 | 2513696278 | 333 |
| 237 | iso_pu_bacteria | 2513237137 | 2513861199 | 333 |
| 238 | iso_pu_bacteria | 2513237141 | 2513891600 | 333 |
| 239 | iso_pu_bacteria | 2513237145 | 2513916726 | 333 |
| 240 | iso_pu_bacteria | 2517572143 | 2517889633 | 333 |
| 241 | iso_pu_bacteria | 2524023210 | 2524465267 | 333 |
| 242 | iso_pu_bacteria | 2524023228 | 2524533197 | 333 |
| 243 | iso_pu_bacteria | 2602042107 | 2603857125 | 333 |
| 244 | iso_pu_bacteria | 2643221651 | 2644290486 | 333 |
| 245 | iso_pu_bacteria | 2667528175 | 2671119485 | 333 |
| 246 | iso_pu_bacteria | 2721755755 | 2723842287 | 333 |
| 247 | iso_pu_bacteria | 2791355196 | 2793061530 | 333 |
| 248 | iso_pu_bacteria | 2791355197 | 2793070386 | 333 |
| 249 | iso_pu_bacteria | 2791355199 | 2793080141 | 333 |
| 250 | iso_pu_bacteria | 2824679649 | 2824684446 | 333 |
| 251 | iso_pu_bacteria | 2857524615 | 2857530870 | 333 |
| 252 | iso_pu_bacteria | 2874604998 | 2874610124 | 333 |
| 253 | iso_pu_bacteria | 2874620515 | 2874622488 | 333 |
| 254 | iso_pu_bacteria | 2879110137 | 2879116991 | 333 |
| 255 | iso_pu_bacteria | 2885366525 | 2885367766 | 333 |
| 256 | iso_pu_bacteria | 2885374607 | 2885380886 | 333 |
| 257 | iso_pu_bacteria | 2889033259 | 2889036410 | 333 |
| 258 | iso_pu_bacteria | 2893066018 | 2893066373 | 333 |
| 259 | iso_pu_bacteria | 2903748898 | 2903756086 | 333 |
| 260 | iso_pu_bacteria | 2903768456 | 2903774682 | 333 |
| 261 | iso_pu_bacteria | 2904666416 | 2904671505 | 333 |
| 262 | iso_pu_bacteria | 2904690495 | 2904692069 | 333 |
| 263 | iso_pu_bacteria | 2904699407 | 2904707611 | 333 |
| 264 | iso_pu_bacteria | 2906610324 | 2906614611 | 333 |
| 265 | iso_pu_bacteria | 2906635258 | 2906641980 | 333 |
| 266 | iso_pu_bacteria | 2906660503 | 2906660934 | 333 |
| 267 | iso_pu_bacteria | 2908739725 | 2908746567 | 333 |
| 268 | iso_pu_bacteria | 2908756301 | 2908757349 | 333 |
| 269 | iso_pu_bacteria | 2922361189 | 2922366714 | 333 |
| 270 | iso_pu_bacteria | 2922386360 | 2922389382 | 333 |
| 271 | iso_pu_bacteria | 2922393267 | 2922398498 | 333 |
| 272 | iso_pu_bacteria | 2922425934 | 2922426472 | 333 |
| 273 | iso_pu_bacteria | 2935630451 | 2935632813 | 333 |
| 274 | iso_pu_bacteria | 2941507105 | 2941508523 | 333 |
| 275 | iso_pu_bacteria | 2941515067 | 2941516353 | 333 |
| 276 | iso_pu_bacteria | 2941523033 | 2941524631 | 333 |
| 277 | iso_pu_bacteria | 3005474847 | 3005475814 | 333 |
| 278 | iso_pu_bacteria | 3005506211 | 3005510923 | 333 |
| 279 | iso_pu_bacteria | 8006964411 | 8006966308 | 333 |
| 280 | iso_pu_bacteria | 8006984368 | 8006993122 | 333 |
| 281 | iso_pu_bacteria | 8006994254 | 8006996975 | 333 |
| 282 | iso_pu_bacteria | 8019648815 | 8019651393 | 333 |
| 283 | iso_pu_bacteria | 8056673599 | 8056678162 | 333 |
| 284 | iso_pu_bacteria | 8056681323 | 8056683411 | 333 |
| 285 | 3300025933 | Ga0207706_10065562 | Ga0207706_100655624 | 334 |
| 286 | 3300003215 | JGI25153J46596_10008046 | JGI25153J46596_100080462 | 335 |
| 287 | 3300003354 | JGI25160J50197_1005561 | JGI25160J50197_10055612 | 335 |
| 288 | 3300005262 | Ga0065165_1007672 | Ga0065165_10076722 | 335 |
| 289 | 3300005355 | Ga0070671_100044664 | Ga0070671_1000446641 | 335 |
| 290 | 3300005455 | Ga0070663_100169745 | Ga0070663_1001697451 | 335 |
| 291 | 3300005563 | Ga0068855_100218105 | Ga0068855_1002181052 | 335 |
| 292 | 3300005614 | Ga0068856_100118565 | Ga0068856_1001185652 | 335 |
| 293 | 3300005616 | Ga0068852_100010212 | Ga0068852_1000102123 | 335 |
| 294 | 3300005844 | Ga0068862_100137583 | Ga0068862_1001375832 | 335 |
| 295 | 3300006048 | Ga0075363_100125154 | Ga0075363_1001251542 | 335 |
| 296 | 3300006178 | Ga0075367_10061551 | Ga0075367_100615511 | 335 |
| 297 | 3300009093 | Ga0105240_10012243 | Ga0105240_100122435 | 335 |
| 298 | 3300009174 | Ga0105241_10043926 | Ga0105241_100439263 | 335 |
| 299 | 3300009174 | Ga0105241_10070526 | Ga0105241_100705262 | 335 |
| 300 | 3300013308 | Ga0157375_10190888 | Ga0157375_101908882 | 335 |
| 301 | 3300014325 | Ga0163163_10150156 | Ga0163163_101501562 | 335 |
| 302 | 3300014325 | Ga0163163_10268407 | Ga0163163_102684071 | 335 |
| 303 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011120 | 335 |
| 304 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009122 | 335 |
| 305 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007120 | 335 |
| 306 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020122 | 335 |
| 307 | 3300025253 | Ga0209677_102183 | Ga0209677_1021833 | 335 |
| 308 | 3300025254 | Ga0209148_1000321 | Ga0209148_100032116 | 335 |
| 309 | 3300025261 | Ga0209233_1004336 | Ga0209233_10043362 | 335 |
| 310 | 3300025272 | Ga0209455_1000807 | Ga0209455_10008073 | 335 |
| 311 | 3300025297 | Ga0209758_1000206 | Ga0209758_10002068 | 335 |
| 312 | 3300025297 | Ga0209758_1002309 | Ga0209758_10023099 | 335 |
| 313 | 3300025299 | Ga0209256_1011364 | Ga0209256_10113642 | 335 |
| 314 | 3300025302 | Ga0207426_1003444 | Ga0207426_10034443 | 335 |
| 315 | 3300025303 | Ga0209051_1048370 | Ga0209051_10483701 | 335 |
| 316 | 3300025304 | Ga0209257_1000394 | Ga0209257_10003948 | 335 |
| 317 | 3300025304 | Ga0209257_1011695 | Ga0209257_10116953 | 335 |
| 318 | 3300025304 | Ga0209257_1034598 | Ga0209257_10345982 | 335 |
| 319 | 3300025911 | Ga0207654_10048569 | Ga0207654_100485692 | 335 |
| 320 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006583 | 335 |
| 321 | 3300025914 | Ga0207671_10021063 | Ga0207671_100210633 | 335 |
| 322 | 3300025949 | Ga0207667_10119463 | Ga0207667_101194632 | 335 |
| 323 | 3300026067 | Ga0207678_10038686 | Ga0207678_100386863 | 335 |
| 324 | 3300026078 | Ga0207702_10610005 | Ga0207702_106100051 | 335 |
| 325 | 3300044683 | Ga0466965_0022945 | Ga0466965_0022945_768_1781 | 335 |
| 326 | 3300044901 | Ga0466960_0009796 | Ga0466960_0009796_2623_3636 | 335 |
| 327 | 3300044901 | Ga0466960_0041081 | Ga0466960_0041081_570_1583 | 335 |
| 328 | 3300045049 | Ga0466959_0181687 | Ga0466959_0181687_237_1250 | 335 |
| 329 | 3300046460 | Ga0495638_0022001 | Ga0495638_0022001_508_1521 | 335 |
| 330 | 3300046524 | Ga0495648_0130331 | Ga0495648_0130331_309_1322 | 335 |
| 331 | 3300046538 | Ga0495609_0026332 | Ga0495609_0026332_330_1343 | 335 |
| 332 | 3300046542 | Ga0495597_0028026 | Ga0495597_0028026_1186_2199 | 335 |
| 333 | 3300047443 | Ga0495687_046825 | Ga0495687_046825_30_1043 | 335 |
| 334 | 3300048904 | Ga0496101_0146965 | Ga0496101_0146965_174_1190 | 335 |
| 335 | 3300048905 | Ga0496102_0007923 | Ga0496102_0007923_6599_7612 | 335 |
| 336 | 3300048907 | Ga0496104_0069177 | Ga0496104_0069177_280_1293 | 335 |
| 337 | 3300048908 | Ga0496105_0322725 | Ga0496105_0322725_211_1224 | 335 |
| 338 | 3300048915 | Ga0496112_0042235 | Ga0496112_0042235_463_1476 | 335 |
| 339 | 3300048915 | Ga0496112_0218968 | Ga0496112_0218968_594_1607 | 335 |
| 340 | 3300048919 | Ga0496116_0040127 | Ga0496116_0040127_313_1326 | 335 |
| 341 | 3300048920 | Ga0496117_0153103 | Ga0496117_0153103_25_1038 | 335 |
| 342 | 3300048921 | Ga0496118_0093022 | Ga0496118_0093022_892_1905 | 335 |
| 343 | 3300048923 | Ga0496120_0018821 | Ga0496120_0018821_2136_3149 | 335 |
| 344 | 3300048924 | Ga0496121_0022584 | Ga0496121_0022584_361_1374 | 335 |
| 345 | 3300048924 | Ga0496121_0050936 | Ga0496121_0050936_1684_2697 | 335 |
| 346 | 3300048924 | Ga0496121_0055607 | Ga0496121_0055607_845_1858 | 335 |
| 347 | 3300048929 | Ga0496126_0285803 | Ga0496126_0285803_67_1080 | 335 |
| 348 | 3300050491 | nmdc:mga00v17_215349_c1 | nmdc:mga00v17_215349_c1_48_1061 | 335 |
| 349 | 3300050492 | nmdc:mga0yw44_91521_c1 | nmdc:mga0yw44_91521_c1_159_1172 | 335 |
| 350 | 3300050494 | nmdc:mga06z11_30068_c1 | nmdc:mga06z11_30068_c1_1511_2524 | 335 |
| 351 | 3300053085 | Ga0495619_0217529 | Ga0495619_0217529_105_1118 | 335 |
| 352 | 3300053094 | Ga0500566_0015378 | Ga0500566_0015378_1908_2921 | 335 |
| 353 | 3300053156 | Ga0500622_0008137 | Ga0500622_0008137_1546_2559 | 335 |
| 354 | 3300053736 | Ga0500599_000651 | Ga0500599_000651_2684_3697 | 335 |
| 355 | 3300003354 | JGI25160J50197_1007198 | JGI25160J50197_10071983 | 336 |
| 356 | 3300003354 | JGI25160J50197_1015110 | JGI25160J50197_10151102 | 336 |
| 357 | 3300004625 | Ga0055543_1005993 | Ga0055543_10059932 | 336 |
| 358 | 3300005262 | Ga0065165_1000982 | Ga0065165_10009824 | 336 |
| 359 | 3300005262 | Ga0065165_1008445 | Ga0065165_10084452 | 336 |
| 360 | 3300005455 | Ga0070663_100028428 | Ga0070663_1000284283 | 336 |
| 361 | 3300005843 | Ga0068860_100468621 | Ga0068860_1004686211 | 336 |
| 362 | 3300005844 | Ga0068862_100315305 | Ga0068862_1003153051 | 336 |
| 363 | 3300005983 | Ga0081540_1051055 | Ga0081540_10510552 | 336 |
| 364 | 3300006186 | Ga0075369_10132724 | Ga0075369_101327241 | 336 |
| 365 | 3300009174 | Ga0105241_10081915 | Ga0105241_100819152 | 336 |
| 366 | 3300010375 | Ga0105239_10211117 | Ga0105239_102111171 | 336 |
| 367 | 3300025261 | Ga0209233_1008907 | Ga0209233_10089072 | 336 |
| 368 | 3300025297 | Ga0209758_1001539 | Ga0209758_100153913 | 336 |
| 369 | 3300025297 | Ga0209758_1001550 | Ga0209758_100155012 | 336 |
| 370 | 3300025302 | Ga0207426_1000773 | Ga0207426_100077314 | 336 |
| 371 | 3300025302 | Ga0207426_1000990 | Ga0207426_100099020 | 336 |
| 372 | 3300027296 | Ga0209389_1000034 | Ga0209389_1000034113 | 336 |
| 373 | 3300027296 | Ga0209389_1000039 | Ga0209389_1000039112 | 336 |
| 374 | 3300027357 | Ga0209589_1000038 | Ga0209589_10000387 | 336 |
| 375 | 3300027361 | Ga0209489_100023 | Ga0209489_100023186 | 336 |
| 376 | 3300027361 | Ga0209489_100087 | Ga0209489_100087112 | 336 |
| 377 | 3300027363 | Ga0209700_100090 | Ga0209700_1000904 | 336 |
| 378 | 3300028380 | Ga0268265_10461022 | Ga0268265_104610221 | 336 |
| 379 | 3300031616 | Ga0307508_10210862 | Ga0307508_102108621 | 336 |
| 380 | 3300037418 | Ga0395900_0001496 | Ga0395900_0001496_20806_21822 | 336 |
| 381 | 3300037466 | Ga0395898_0019947 | Ga0395898_0019947_182_1198 | 336 |
| 382 | 3300037471 | Ga0395905_0032236 | Ga0395905_0032236_2317_3333 | 336 |
| 383 | 3300037471 | Ga0395905_0124402 | Ga0395905_0124402_1206_2222 | 336 |
| 384 | 3300038443 | Ga0395901_0064055 | Ga0395901_0064055_2296_3312 | 336 |
| 385 | 3300039437 | Ga0436365_0344664 | Ga0436365_0344664_214_1230 | 336 |
| 386 | 3300039437 | Ga0436365_0389593 | Ga0436365_0389593_263_1279 | 336 |
| 387 | 3300044684 | Ga0466966_0003788 | Ga0466966_0003788_4878_5894 | 336 |
| 388 | 3300044693 | Ga0466961_0000227 | Ga0466961_0000227_24320_25336 | 336 |
| 389 | 3300044694 | Ga0466963_0018798 | Ga0466963_0018798_3019_4035 | 336 |
| 390 | 3300044842 | Ga0466957_0148709 | Ga0466957_0148709_92_1108 | 336 |
| 391 | 3300045049 | Ga0466959_0000605 | Ga0466959_0000605_916_1932 | 336 |
| 392 | 3300045976 | Ga0466967_0157884 | Ga0466967_0157884_464_1480 | 336 |
| 393 | 3300046463 | Ga0495653_0080356 | Ga0495653_0080356_134_1150 | 336 |
| 394 | 3300046475 | Ga0495639_0055478 | Ga0495639_0055478_550_1566 | 336 |
| 395 | 3300046477 | Ga0495664_0015540 | Ga0495664_0015540_1344_2360 | 336 |
| 396 | 3300046511 | Ga0495608_0139318 | Ga0495608_0139318_349_1365 | 336 |
| 397 | 3300046514 | Ga0495618_0081584 | Ga0495618_0081584_955_1971 | 336 |
| 398 | 3300046514 | Ga0495618_0184896 | Ga0495618_0184896_96_1112 | 336 |
| 399 | 3300046516 | Ga0495628_0032806 | Ga0495628_0032806_3131_4147 | 336 |
| 400 | 3300046522 | Ga0495643_0121212 | Ga0495643_0121212_242_1258 | 336 |
| 401 | 3300046529 | Ga0495652_0033885 | Ga0495652_0033885_871_1887 | 336 |
| 402 | 3300046529 | Ga0495652_0076325 | Ga0495652_0076325_767_1783 | 336 |
| 403 | 3300046529 | Ga0495652_0103067 | Ga0495652_0103067_118_1134 | 336 |
| 404 | 3300046533 | Ga0495640_0058195 | Ga0495640_0058195_1528_2544 | 336 |
| 405 | 3300046536 | Ga0495587_0028742 | Ga0495587_0028742_2338_3354 | 336 |
| 406 | 3300046543 | Ga0495645_0018632 | Ga0495645_0018632_2187_3203 | 336 |
| 407 | 3300046642 | Ga0495634_0015671 | Ga0495634_0015671_136_1152 | 336 |
| 408 | 3300046663 | Ga0495635_0059745 | Ga0495635_0059745_408_1424 | 336 |
| 409 | 3300046663 | Ga0495635_0059871 | Ga0495635_0059871_281_1297 | 336 |
| 410 | 3300046675 | Ga0495657_0005912 | Ga0495657_0005912_1346_2362 | 336 |
| 411 | 3300046675 | Ga0495657_0022986 | Ga0495657_0022986_311_1327 | 336 |
| 412 | 3300046680 | Ga0495646_0014985 | Ga0495646_0014985_1082_2098 | 336 |
| 413 | 3300046809 | Ga0495600_0227209 | Ga0495600_0227209_79_1095 | 336 |
| 414 | 3300047317 | Ga0495604_0012567 | Ga0495604_0012567_2719_3735 | 336 |
| 415 | 3300047317 | Ga0495604_0100106 | Ga0495604_0100106_431_1447 | 336 |
| 416 | 3300047319 | Ga0495674_0036232 | Ga0495674_0036232_2311_3327 | 336 |
| 417 | 3300047319 | Ga0495674_0106388 | Ga0495674_0106388_1183_2199 | 336 |
| 418 | 3300047321 | Ga0495676_0066520 | Ga0495676_0066520_122_1138 | 336 |
| 419 | 3300047322 | Ga0495680_0001308 | Ga0495680_0001308_12010_13026 | 336 |
| 420 | 3300047323 | Ga0495683_0074363 | Ga0495683_0074363_120_1136 | 336 |
| 421 | 3300047472 | Ga0495686_0126470 | Ga0495686_0126470_157_1170 | 336 |
| 422 | 3300047673 | Ga0495593_0124049 | Ga0495593_0124049_162_1178 | 336 |
| 423 | 3300048088 | Ga0495602_0028623 | Ga0495602_0028623_2999_4015 | 336 |
| 424 | 3300048088 | Ga0495602_0146601 | Ga0495602_0146601_725_1741 | 336 |
| 425 | 3300048907 | Ga0496104_0168040 | Ga0496104_0168040_460_1476 | 336 |
| 426 | 3300048908 | Ga0496105_0026827 | Ga0496105_0026827_756_1772 | 336 |
| 427 | 3300048916 | Ga0496113_0061050 | Ga0496113_0061050_1691_2707 | 336 |
| 428 | 3300048918 | Ga0496115_0142236 | Ga0496115_0142236_265_1281 | 336 |
| 429 | 3300048921 | Ga0496118_0100783 | Ga0496118_0100783_136_1152 | 336 |
| 430 | 3300048922 | Ga0496119_0007315 | Ga0496119_0007315_2216_3232 | 336 |
| 431 | 3300048923 | Ga0496120_0002476 | Ga0496120_0002476_13579_14595 | 336 |
| 432 | 3300048928 | Ga0496125_0056873 | Ga0496125_0056873_1851_2867 | 336 |
| 433 | 3300048929 | Ga0496126_0007864 | Ga0496126_0007864_9924_10940 | 336 |
| 434 | 3300048929 | Ga0496126_0292181 | Ga0496126_0292181_51_1076 | 336 |
| 435 | 3300049460 | Ga0495682_0051142 | Ga0495682_0051142_343_1359 | 336 |
| 436 | 3300050496 | nmdc:mga07m45_69423_c1 | nmdc:mga07m45_69423_c1_24_1040 | 336 |
| 437 | 3300053079 | Ga0500610_0097521 | Ga0500610_0097521_465_1481 | 336 |
| 438 | 3300053080 | Ga0500635_0044597 | Ga0500635_0044597_61_1077 | 336 |
| 439 | 3300053087 | Ga0500643_000168 | Ga0500643_000168_62409_63422 | 336 |
| 440 | 3300053092 | Ga0500583_0012288 | Ga0500583_0012288_1488_2501 | 336 |
| 441 | 3300053093 | Ga0500651_0127566 | Ga0500651_0127566_155_1171 | 336 |
| 442 | 3300053103 | Ga0500555_003167 | Ga0500555_003167_2506_3519 | 336 |
| 443 | 3300053130 | Ga0500642_0000183 | Ga0500642_0000183_16841_17857 | 336 |
| 444 | 3300053130 | Ga0500642_0030123 | Ga0500642_0030123_1071_2084 | 336 |
| 445 | 3300053136 | Ga0500559_0004871 | Ga0500559_0004871_2312_3328 | 336 |
| 446 | 3300053139 | Ga0500568_0030179 | Ga0500568_0030179_287_1300 | 336 |
| 447 | 3300053151 | Ga0500604_0008009 | Ga0500604_0008009_1622_2635 | 336 |
| 448 | 3300053154 | Ga0500619_025645 | Ga0500619_025645_393_1409 | 336 |
| 449 | 3300053158 | Ga0500627_0022514 | Ga0500627_0022514_1019_2032 | 336 |
| 450 | 3300053177 | Ga0500636_0000592 | Ga0500636_0000592_3898_4914 | 336 |
| 451 | 3300053729 | Ga0500625_000232 | Ga0500625_000232_2418_3434 | 336 |
| 452 | 3300053731 | Ga0500609_009508 | Ga0500609_009508_105_1121 | 336 |
| 453 | 3300053737 | Ga0500601_000888 | Ga0500601_000888_52_1071 | 336 |
| 454 | 3300001979 | JGI24740J21852_10005937 | JGI24740J21852_100059372 | 337 |
| 455 | 3300003203 | JGI25406J46586_10000012 | JGI25406J46586_1000001250 | 337 |
| 456 | 3300003203 | JGI25406J46586_10038146 | JGI25406J46586_100381462 | 337 |
| 457 | 3300003215 | JGI25153J46596_10019332 | JGI25153J46596_100193322 | 337 |
| 458 | 3300003659 | JGI25404J52841_10006703 | JGI25404J52841_100067031 | 337 |
| 459 | 3300003659 | JGI25404J52841_10010612 | JGI25404J52841_100106122 | 337 |
| 460 | 3300005331 | Ga0070670_100068271 | Ga0070670_1000682711 | 337 |
| 461 | 3300005334 | Ga0068869_100023869 | Ga0068869_1000238692 | 337 |
| 462 | 3300005336 | Ga0070680_100016577 | Ga0070680_1000165776 | 337 |
| 463 | 3300005336 | Ga0070680_100064099 | Ga0070680_1000640992 | 337 |
| 464 | 3300005336 | Ga0070680_100367073 | Ga0070680_1003670731 | 337 |
| 465 | 3300005338 | Ga0068868_100071269 | Ga0068868_1000712692 | 337 |
| 466 | 3300005339 | Ga0070660_100238356 | Ga0070660_1002383561 | 337 |
| 467 | 3300005344 | Ga0070661_100310121 | Ga0070661_1003101211 | 337 |
| 468 | 3300005347 | Ga0070668_100041152 | Ga0070668_1000411523 | 337 |
| 469 | 3300005347 | Ga0070668_100087155 | Ga0070668_1000871552 | 337 |
| 470 | 3300005347 | Ga0070668_100137630 | Ga0070668_1001376302 | 337 |
| 471 | 3300005356 | Ga0070674_100096396 | Ga0070674_1000963961 | 337 |
| 472 | 3300005365 | Ga0070688_100166279 | Ga0070688_1001662791 | 337 |
| 473 | 3300005434 | Ga0070709_10002283 | Ga0070709_100022834 | 337 |
| 474 | 3300005435 | Ga0070714_100022105 | Ga0070714_1000221054 | 337 |
| 475 | 3300005435 | Ga0070714_100039738 | Ga0070714_1000397383 | 337 |
| 476 | 3300005436 | Ga0070713_100022749 | Ga0070713_1000227494 | 337 |
| 477 | 3300005436 | Ga0070713_100060987 | Ga0070713_1000609873 | 337 |
| 478 | 3300005437 | Ga0070710_10018697 | Ga0070710_100186974 | 337 |
| 479 | 3300005445 | Ga0070708_100387090 | Ga0070708_1003870901 | 337 |
| 480 | 3300005456 | Ga0070678_100178156 | Ga0070678_1001781561 | 337 |
| 481 | 3300005456 | Ga0070678_100279634 | Ga0070678_1002796342 | 337 |
| 482 | 3300005457 | Ga0070662_100185930 | Ga0070662_1001859302 | 337 |
| 483 | 3300005457 | Ga0070662_100367923 | Ga0070662_1003679231 | 337 |
| 484 | 3300005458 | Ga0070681_10187131 | Ga0070681_101871312 | 337 |
| 485 | 3300005458 | Ga0070681_10419787 | Ga0070681_104197871 | 337 |
| 486 | 3300005467 | Ga0070706_100133515 | Ga0070706_1001335151 | 337 |
| 487 | 3300005468 | Ga0070707_100054763 | Ga0070707_1000547633 | 337 |
| 488 | 3300005468 | Ga0070707_100433063 | Ga0070707_1004330631 | 337 |
| 489 | 3300005471 | Ga0070698_100047957 | Ga0070698_1000479575 | 337 |
| 490 | 3300005530 | Ga0070679_100270231 | Ga0070679_1002702312 | 337 |
| 491 | 3300005535 | Ga0070684_100065197 | Ga0070684_1000651972 | 337 |
| 492 | 3300005535 | Ga0070684_100115278 | Ga0070684_1001152781 | 337 |
| 493 | 3300005535 | Ga0070684_100213839 | Ga0070684_1002138391 | 337 |
| 494 | 3300005539 | Ga0068853_100032830 | Ga0068853_1000328303 | 337 |
| 495 | 3300005539 | Ga0068853_100040910 | Ga0068853_1000409102 | 337 |
| 496 | 3300005539 | Ga0068853_100109745 | Ga0068853_1001097451 | 337 |
| 497 | 3300005543 | Ga0070672_100185134 | Ga0070672_1001851341 | 337 |
| 498 | 3300005544 | Ga0070686_100183444 | Ga0070686_1001834442 | 337 |
| 499 | 3300005548 | Ga0070665_100012864 | Ga0070665_1000128646 | 337 |
| 500 | 3300005548 | Ga0070665_100058353 | Ga0070665_1000583533 | 337 |
| 501 | 3300005563 | Ga0068855_100154127 | Ga0068855_1001541272 | 337 |
| 502 | 3300005563 | Ga0068855_100358675 | Ga0068855_1003586752 | 337 |
| 503 | 3300005577 | Ga0068857_100023618 | Ga0068857_1000236182 | 337 |
| 504 | 3300005578 | Ga0068854_100072638 | Ga0068854_1000726382 | 337 |
| 505 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013757 | 337 |
| 506 | 3300005614 | Ga0068856_100063543 | Ga0068856_1000635434 | 337 |
| 507 | 3300005614 | Ga0068856_100540575 | Ga0068856_1005405752 | 337 |
| 508 | 3300005616 | Ga0068852_100448392 | Ga0068852_1004483921 | 337 |
| 509 | 3300005834 | Ga0068851_10003838 | Ga0068851_100038381 | 337 |
| 510 | 3300005834 | Ga0068851_10061017 | Ga0068851_100610172 | 337 |
| 511 | 3300005843 | Ga0068860_100274052 | Ga0068860_1002740522 | 337 |
| 512 | 3300005844 | Ga0068862_100249676 | Ga0068862_1002496762 | 337 |
| 513 | 3300005937 | Ga0081455_10008940 | Ga0081455_100089407 | 337 |
| 514 | 3300005937 | Ga0081455_10011276 | Ga0081455_100112765 | 337 |
| 515 | 3300005937 | Ga0081455_10013423 | Ga0081455_100134236 | 337 |
| 516 | 3300005937 | Ga0081455_10032605 | Ga0081455_100326054 | 337 |
| 517 | 3300005981 | Ga0081538_10037995 | Ga0081538_100379952 | 337 |
| 518 | 3300005983 | Ga0081540_1002034 | Ga0081540_10020348 | 337 |
| 519 | 3300005983 | Ga0081540_1007800 | Ga0081540_10078003 | 337 |
| 520 | 3300005983 | Ga0081540_1008423 | Ga0081540_10084235 | 337 |
| 521 | 3300005983 | Ga0081540_1012078 | Ga0081540_10120783 | 337 |
| 522 | 3300005983 | Ga0081540_1020975 | Ga0081540_10209753 | 337 |
| 523 | 3300005983 | Ga0081540_1023647 | Ga0081540_10236472 | 337 |
| 524 | 3300005983 | Ga0081540_1065713 | Ga0081540_10657132 | 337 |
| 525 | 3300005983 | Ga0081540_1068142 | Ga0081540_10681421 | 337 |
| 526 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040215 | 337 |
| 527 | 3300005985 | Ga0081539_10000157 | Ga0081539_1000015716 | 337 |
| 528 | 3300005985 | Ga0081539_10006006 | Ga0081539_100060068 | 337 |
| 529 | 3300005985 | Ga0081539_10063904 | Ga0081539_100639042 | 337 |
| 530 | 3300005985 | Ga0081539_10105346 | Ga0081539_101053461 | 337 |
| 531 | 3300006028 | Ga0070717_10017655 | Ga0070717_100176554 | 337 |
| 532 | 3300006038 | Ga0075365_10043977 | Ga0075365_100439773 | 337 |
| 533 | 3300006038 | Ga0075365_10110776 | Ga0075365_101107763 | 337 |
| 534 | 3300006042 | Ga0075368_10016127 | Ga0075368_100161271 | 337 |
| 535 | 3300006048 | Ga0075363_100115619 | Ga0075363_1001156191 | 337 |
| 536 | 3300006173 | Ga0070716_100014843 | Ga0070716_1000148432 | 337 |
| 537 | 3300006173 | Ga0070716_100021483 | Ga0070716_1000214834 | 337 |
| 538 | 3300006173 | Ga0070716_100114369 | Ga0070716_1001143691 | 337 |
| 539 | 3300006178 | Ga0075367_10121060 | Ga0075367_101210601 | 337 |
| 540 | 3300006186 | Ga0075369_10010149 | Ga0075369_100101492 | 337 |
| 541 | 3300006195 | Ga0075366_10023825 | Ga0075366_100238251 | 337 |
| 542 | 3300007265 | Ga0099794_10005590 | Ga0099794_100055901 | 337 |
| 543 | 3300009093 | Ga0105240_10015437 | Ga0105240_100154372 | 337 |
| 544 | 3300009093 | Ga0105240_10069358 | Ga0105240_100693583 | 337 |
| 545 | 3300009093 | Ga0105240_10135717 | Ga0105240_101357172 | 337 |
| 546 | 3300009094 | Ga0111539_10347138 | Ga0111539_103471381 | 337 |
| 547 | 3300009094 | Ga0111539_10351823 | Ga0111539_103518232 | 337 |
| 548 | 3300009098 | Ga0105245_10148468 | Ga0105245_101484682 | 337 |
| 549 | 3300009148 | Ga0105243_10224948 | Ga0105243_102249482 | 337 |
| 550 | 3300009174 | Ga0105241_10001280 | Ga0105241_100012809 | 337 |
| 551 | 3300009177 | Ga0105248_10036476 | Ga0105248_100364763 | 337 |
| 552 | 3300009177 | Ga0105248_10497588 | Ga0105248_104975881 | 337 |
| 553 | 3300009545 | Ga0105237_10044776 | Ga0105237_100447763 | 337 |
| 554 | 3300009545 | Ga0105237_10140850 | Ga0105237_101408502 | 337 |
| 555 | 3300009551 | Ga0105238_10044002 | Ga0105238_100440022 | 337 |
| 556 | 3300009551 | Ga0105238_10079710 | Ga0105238_100797102 | 337 |
| 557 | 3300010159 | Ga0099796_10019249 | Ga0099796_100192492 | 337 |
| 558 | 3300010375 | Ga0105239_10054114 | Ga0105239_100541143 | 337 |
| 559 | 3300010375 | Ga0105239_10187359 | Ga0105239_101873593 | 337 |
| 560 | 3300010375 | Ga0105239_10267778 | Ga0105239_102677781 | 337 |
| 561 | 3300011119 | Ga0105246_10111990 | Ga0105246_101119902 | 337 |
| 562 | 3300013104 | Ga0157370_10040880 | Ga0157370_100408803 | 337 |
| 563 | 3300013296 | Ga0157374_10134006 | Ga0157374_101340062 | 337 |
| 564 | 3300013297 | Ga0157378_10074226 | Ga0157378_100742263 | 337 |
| 565 | 3300013297 | Ga0157378_10078348 | Ga0157378_100783483 | 337 |
| 566 | 3300013297 | Ga0157378_10544548 | Ga0157378_105445481 | 337 |
| 567 | 3300013306 | Ga0163162_10654083 | Ga0163162_106540831 | 337 |
| 568 | 3300013307 | Ga0157372_10100045 | Ga0157372_101000453 | 337 |
| 569 | 3300013308 | Ga0157375_10055890 | Ga0157375_100558902 | 337 |
| 570 | 3300014325 | Ga0163163_10222436 | Ga0163163_102224361 | 337 |
| 571 | 3300014969 | Ga0157376_10022471 | Ga0157376_100224714 | 337 |
| 572 | 3300014969 | Ga0157376_10240448 | Ga0157376_102404481 | 337 |
| 573 | 3300021441 | Ga0213871_10033779 | Ga0213871_100337791 | 337 |
| 574 | 3300025297 | Ga0209758_1000536 | Ga0209758_10005367 | 337 |
| 575 | 3300025321 | Ga0207656_10005846 | Ga0207656_100058463 | 337 |
| 576 | 3300025898 | Ga0207692_10008172 | Ga0207692_100081722 | 337 |
| 577 | 3300025898 | Ga0207692_10010497 | Ga0207692_100104973 | 337 |
| 578 | 3300025900 | Ga0207710_10035205 | Ga0207710_100352052 | 337 |
| 579 | 3300025904 | Ga0207647_10005671 | Ga0207647_100056713 | 337 |
| 580 | 3300025906 | Ga0207699_10003146 | Ga0207699_100031463 | 337 |
| 581 | 3300025906 | Ga0207699_10221479 | Ga0207699_102214792 | 337 |
| 582 | 3300025908 | Ga0207643_10008642 | Ga0207643_100086424 | 337 |
| 583 | 3300025909 | Ga0207705_10124422 | Ga0207705_101244222 | 337 |
| 584 | 3300025910 | Ga0207684_10037662 | Ga0207684_100376623 | 337 |
| 585 | 3300025911 | Ga0207654_10000153 | Ga0207654_100001532 | 337 |
| 586 | 3300025911 | Ga0207654_10039326 | Ga0207654_100393263 | 337 |
| 587 | 3300025912 | Ga0207707_10002207 | Ga0207707_100022073 | 337 |
| 588 | 3300025913 | Ga0207695_10000506 | Ga0207695_1000050676 | 337 |
| 589 | 3300025913 | Ga0207695_10051564 | Ga0207695_100515642 | 337 |
| 590 | 3300025914 | Ga0207671_10110521 | Ga0207671_101105212 | 337 |
| 591 | 3300025914 | Ga0207671_10313295 | Ga0207671_103132951 | 337 |
| 592 | 3300025915 | Ga0207693_10004906 | Ga0207693_100049061 | 337 |
| 593 | 3300025915 | Ga0207693_10068086 | Ga0207693_100680863 | 337 |
| 594 | 3300025916 | Ga0207663_10000161 | Ga0207663_100001613 | 337 |
| 595 | 3300025916 | Ga0207663_10209013 | Ga0207663_102090131 | 337 |
| 596 | 3300025917 | Ga0207660_10243940 | Ga0207660_102439401 | 337 |
| 597 | 3300025918 | Ga0207662_10099985 | Ga0207662_100999851 | 337 |
| 598 | 3300025919 | Ga0207657_10033356 | Ga0207657_100333563 | 337 |
| 599 | 3300025921 | Ga0207652_10047975 | Ga0207652_100479751 | 337 |
| 600 | 3300025921 | Ga0207652_10373220 | Ga0207652_103732201 | 337 |
| 601 | 3300025922 | Ga0207646_10050177 | Ga0207646_100501771 | 337 |
| 602 | 3300025923 | Ga0207681_10275586 | Ga0207681_102755861 | 337 |
| 603 | 3300025924 | Ga0207694_10003910 | Ga0207694_100039105 | 337 |
| 604 | 3300025924 | Ga0207694_10034184 | Ga0207694_100341842 | 337 |
| 605 | 3300025924 | Ga0207694_10081906 | Ga0207694_100819063 | 337 |
| 606 | 3300025924 | Ga0207694_10219491 | Ga0207694_102194911 | 337 |
| 607 | 3300025927 | Ga0207687_10009895 | Ga0207687_100098953 | 337 |
| 608 | 3300025927 | Ga0207687_10029818 | Ga0207687_100298182 | 337 |
| 609 | 3300025927 | Ga0207687_10274318 | Ga0207687_102743182 | 337 |
| 610 | 3300025928 | Ga0207700_10045317 | Ga0207700_100453173 | 337 |
| 611 | 3300025928 | Ga0207700_10057556 | Ga0207700_100575562 | 337 |
| 612 | 3300025929 | Ga0207664_10021734 | Ga0207664_100217343 | 337 |
| 613 | 3300025933 | Ga0207706_10312768 | Ga0207706_103127682 | 337 |
| 614 | 3300025937 | Ga0207669_10029132 | Ga0207669_100291322 | 337 |
| 615 | 3300025939 | Ga0207665_10000183 | Ga0207665_1000018337 | 337 |
| 616 | 3300025939 | Ga0207665_10171674 | Ga0207665_101716741 | 337 |
| 617 | 3300025939 | Ga0207665_10175312 | Ga0207665_101753122 | 337 |
| 618 | 3300025940 | Ga0207691_10049861 | Ga0207691_100498612 | 337 |
| 619 | 3300025940 | Ga0207691_10274416 | Ga0207691_102744161 | 337 |
| 620 | 3300025941 | Ga0207711_10033479 | Ga0207711_100334792 | 337 |
| 621 | 3300025942 | Ga0207689_10046436 | Ga0207689_100464362 | 337 |
| 622 | 3300025942 | Ga0207689_10093199 | Ga0207689_100931992 | 337 |
| 623 | 3300025942 | Ga0207689_10104918 | Ga0207689_101049182 | 337 |
| 624 | 3300025944 | Ga0207661_10000828 | Ga0207661_100008283 | 337 |
| 625 | 3300025949 | Ga0207667_10087422 | Ga0207667_100874223 | 337 |
| 626 | 3300025949 | Ga0207667_10114421 | Ga0207667_101144212 | 337 |
| 627 | 3300025949 | Ga0207667_10244025 | Ga0207667_102440252 | 337 |
| 628 | 3300025949 | Ga0207667_10271534 | Ga0207667_102715342 | 337 |
| 629 | 3300025961 | Ga0207712_10128647 | Ga0207712_101286472 | 337 |
| 630 | 3300025972 | Ga0207668_10104398 | Ga0207668_101043982 | 337 |
| 631 | 3300025972 | Ga0207668_10118457 | Ga0207668_101184571 | 337 |
| 632 | 3300025972 | Ga0207668_10366631 | Ga0207668_103666311 | 337 |
| 633 | 3300026023 | Ga0207677_10175196 | Ga0207677_101751961 | 337 |
| 634 | 3300026041 | Ga0207639_10007981 | Ga0207639_100079811 | 337 |
| 635 | 3300026041 | Ga0207639_10042056 | Ga0207639_100420563 | 337 |
| 636 | 3300026041 | Ga0207639_10346164 | Ga0207639_103461641 | 337 |
| 637 | 3300026067 | Ga0207678_10065333 | Ga0207678_100653332 | 337 |
| 638 | 3300026067 | Ga0207678_10086765 | Ga0207678_100867652 | 337 |
| 639 | 3300026067 | Ga0207678_10174584 | Ga0207678_101745841 | 337 |
| 640 | 3300026067 | Ga0207678_10426764 | Ga0207678_104267641 | 337 |
| 641 | 3300026078 | Ga0207702_10000006 | Ga0207702_10000006289 | 337 |
| 642 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006354 | 337 |
| 643 | 3300026089 | Ga0207648_10285701 | Ga0207648_102857011 | 337 |
| 644 | 3300026095 | Ga0207676_10089134 | Ga0207676_100891342 | 337 |
| 645 | 3300026116 | Ga0207674_10048571 | Ga0207674_100485713 | 337 |
| 646 | 3300026116 | Ga0207674_10048718 | Ga0207674_100487182 | 337 |
| 647 | 3300026116 | Ga0207674_10130837 | Ga0207674_101308372 | 337 |
| 648 | 3300026118 | Ga0207675_100236199 | Ga0207675_1002361991 | 337 |
| 649 | 3300026121 | Ga0207683_10121878 | Ga0207683_101218782 | 337 |
| 650 | 3300026121 | Ga0207683_10174513 | Ga0207683_101745132 | 337 |
| 651 | 3300026121 | Ga0207683_10308371 | Ga0207683_103083711 | 337 |
| 652 | 3300026121 | Ga0207683_10375902 | Ga0207683_103759021 | 337 |
| 653 | 3300026142 | Ga0207698_10045959 | Ga0207698_100459592 | 337 |
| 654 | 3300026142 | Ga0207698_10420215 | Ga0207698_104202151 | 337 |
| 655 | 3300026142 | Ga0207698_10427495 | Ga0207698_104274952 | 337 |
| 656 | 3300027671 | Ga0209588_1005208 | Ga0209588_10052083 | 337 |
| 657 | 3300028379 | Ga0268266_10034894 | Ga0268266_100348944 | 337 |
| 658 | 3300028379 | Ga0268266_10053634 | Ga0268266_100536343 | 337 |
| 659 | 3300028379 | Ga0268266_10163006 | Ga0268266_101630062 | 337 |
| 660 | 3300028379 | Ga0268266_10187728 | Ga0268266_101877282 | 337 |
| 661 | 3300028379 | Ga0268266_10497615 | Ga0268266_104976151 | 337 |
| 662 | 3300028380 | Ga0268265_10277711 | Ga0268265_102777111 | 337 |
| 663 | 3300028381 | Ga0268264_10066486 | Ga0268264_100664863 | 337 |
| 664 | 3300028786 | Ga0307517_10050575 | Ga0307517_100505751 | 337 |
| 665 | 3300028794 | Ga0307515_10046793 | Ga0307515_100467933 | 337 |
| 666 | 3300028794 | Ga0307515_10063600 | Ga0307515_100636001 | 337 |
| 667 | 3300030763 | Ga0265763_1002954 | Ga0265763_10029542 | 337 |
| 668 | 3300031235 | Ga0265330_10072948 | Ga0265330_100729482 | 337 |
| 669 | 3300031247 | Ga0265340_10052128 | Ga0265340_100521282 | 337 |
| 670 | 3300031249 | Ga0265339_10000281 | Ga0265339_1000028136 | 337 |
| 671 | 3300031456 | Ga0307513_10139543 | Ga0307513_101395431 | 337 |
| 672 | 3300031507 | Ga0307509_10053131 | Ga0307509_100531313 | 337 |
| 673 | 3300031616 | Ga0307508_10000012 | Ga0307508_1000001243 | 337 |
| 674 | 3300031616 | Ga0307508_10033210 | Ga0307508_100332102 | 337 |
| 675 | 3300031616 | Ga0307508_10078988 | Ga0307508_100789882 | 337 |
| 676 | 3300031616 | Ga0307508_10217175 | Ga0307508_102171752 | 337 |
| 677 | 3300031711 | Ga0265314_10011033 | Ga0265314_100110334 | 337 |
| 678 | 3300031712 | Ga0265342_10049510 | Ga0265342_100495102 | 337 |
| 679 | 3300031730 | Ga0307516_10068943 | Ga0307516_100689434 | 337 |
| 680 | 3300031731 | Ga0307405_10223239 | Ga0307405_102232392 | 337 |
| 681 | 3300031911 | Ga0307412_10029996 | Ga0307412_100299963 | 337 |
| 682 | 3300032005 | Ga0307411_10210904 | Ga0307411_102109041 | 337 |
| 683 | 3300033180 | Ga0307510_10022874 | Ga0307510_100228743 | 337 |
| 684 | 3300033180 | Ga0307510_10037361 | Ga0307510_100373613 | 337 |
| 685 | 3300035089 | Ga0373944_0021553 | Ga0373944_0021553_715_1734 | 337 |
| 686 | 3300035089 | Ga0373944_0026026 | Ga0373944_0026026_422_1441 | 337 |
| 687 | 3300035111 | Ga0373923_0065718 | Ga0373923_0065718_434_1453 | 337 |
| 688 | 3300035113 | Ga0373936_0114188 | Ga0373936_0114188_66_1085 | 337 |
| 689 | 3300035117 | Ga0373953_0001704 | Ga0373953_0001704_2236_3255 | 337 |
| 690 | 3300035117 | Ga0373953_0002691 | Ga0373953_0002691_2995_4014 | 337 |
| 691 | 3300035118 | Ga0373954_0007407 | Ga0373954_0007407_2428_3447 | 337 |
| 692 | 3300035118 | Ga0373954_0037173 | Ga0373954_0037173_250_1269 | 337 |
| 693 | 3300035119 | Ga0373956_0012937 | Ga0373956_0012937_200_1219 | 337 |
| 694 | 3300035120 | Ga0373957_0012302 | Ga0373957_0012302_1471_2490 | 337 |
| 695 | 3300035170 | Ga0373943_0002235 | Ga0373943_0002235_821_1840 | 337 |
| 696 | 3300035171 | Ga0373946_0126793 | Ga0373946_0126793_54_1073 | 337 |
| 697 | 3300035172 | Ga0373955_0027684 | Ga0373955_0027684_1064_2083 | 337 |
| 698 | 3300035172 | Ga0373955_0154980 | Ga0373955_0154980_267_1286 | 337 |
| 699 | 3300035410 | Ga0373924_0069573 | Ga0373924_0069573_391_1410 | 337 |
| 700 | 3300035692 | Ga0373935_0003730 | Ga0373935_0003730_4682_5701 | 337 |
| 701 | 3300035692 | Ga0373935_0048374 | Ga0373935_0048374_1426_2445 | 337 |
| 702 | 3300035695 | Ga0373927_0001492 | Ga0373927_0001492_15028_16047 | 337 |
| 703 | 3300035695 | Ga0373927_0001793 | Ga0373927_0001793_12865_13890 | 337 |
| 704 | 3300035695 | Ga0373927_0033848 | Ga0373927_0033848_1300_2319 | 337 |
| 705 | 3300035695 | Ga0373927_0140989 | Ga0373927_0140989_61_1080 | 337 |
| 706 | 3300035724 | Ga0373933_0000267 | Ga0373933_0000267_21715_22734 | 337 |
| 707 | 3300035725 | Ga0373947_0001861 | Ga0373947_0001861_4099_5118 | 337 |
| 708 | 3300035725 | Ga0373947_0133714 | Ga0373947_0133714_332_1357 | 337 |
| 709 | 3300036401 | Ga0373937_0034261 | Ga0373937_0034261_3521_4540 | 337 |
| 710 | 3300036401 | Ga0373937_0051137 | Ga0373937_0051137_375_1394 | 337 |
| 711 | 3300036401 | Ga0373937_0057297 | Ga0373937_0057297_853_1872 | 337 |
| 712 | 3300036459 | Ga0372808_013234 | Ga0372808_013234_136_1155 | 337 |
| 713 | 3300037068 | Ga0373925_0013546 | Ga0373925_0013546_2435_3454 | 337 |
| 714 | 3300037068 | Ga0373925_0058364 | Ga0373925_0058364_1645_2709 | 337 |
| 715 | 3300037068 | Ga0373925_0114613 | Ga0373925_0114613_765_1784 | 337 |
| 716 | 3300037466 | Ga0395898_0070389 | Ga0395898_0070389_1549_2565 | 337 |
| 717 | 3300037471 | Ga0395905_0004165 | Ga0395905_0004165_8369_9385 | 337 |
| 718 | 3300038443 | Ga0395901_0231437 | Ga0395901_0231437_656_1672 | 337 |
| 719 | 3300039438 | Ga0436360_0441680 | Ga0436360_0441680_79_1098 | 337 |
| 720 | 3300039438 | Ga0436360_0560055 | Ga0436360_0560055_171_1190 | 337 |
| 721 | 3300039438 | Ga0436360_0600621 | Ga0436360_0600621_3072_4118 | 337 |
| 722 | 3300039447 | Ga0436361_1065603 | Ga0436361_1065603_301_1320 | 337 |
| 723 | 3300039450 | Ga0436363_0135082 | Ga0436363_0135082_1615_2670 | 337 |
| 724 | 3300039450 | Ga0436363_0460586 | Ga0436363_0460586_1660_2679 | 337 |
| 725 | 3300044693 | Ga0466961_0059356 | Ga0466961_0059356_173_1330 | 337 |
| 726 | 3300044901 | Ga0466960_0113129 | Ga0466960_0113129_328_1344 | 337 |
| 727 | 3300045049 | Ga0466959_0024944 | Ga0466959_0024944_1869_3026 | 337 |
| 728 | 3300045049 | Ga0466959_0061469 | Ga0466959_0061469_1462_2490 | 337 |
| 729 | 3300046452 | Ga0495617_013424 | Ga0495617_013424_124_1143 | 337 |
| 730 | 3300046454 | Ga0495592_0002227 | Ga0495592_0002227_5443_6462 | 337 |
| 731 | 3300046454 | Ga0495592_0041547 | Ga0495592_0041547_276_1295 | 337 |
| 732 | 3300046454 | Ga0495592_0060638 | Ga0495592_0060638_1209_2228 | 337 |
| 733 | 3300046455 | Ga0495603_0000036 | Ga0495603_0000036_52880_53899 | 337 |
| 734 | 3300046455 | Ga0495603_0008447 | Ga0495603_0008447_2387_3406 | 337 |
| 735 | 3300046455 | Ga0495603_0015690 | Ga0495603_0015690_3554_4573 | 337 |
| 736 | 3300046459 | Ga0495629_0000148 | Ga0495629_0000148_7627_8646 | 337 |
| 737 | 3300046459 | Ga0495629_0000331 | Ga0495629_0000331_11136_12155 | 337 |
| 738 | 3300046459 | Ga0495629_0049085 | Ga0495629_0049085_817_1836 | 337 |
| 739 | 3300046459 | Ga0495629_0242116 | Ga0495629_0242116_137_1156 | 337 |
| 740 | 3300046460 | Ga0495638_0032248 | Ga0495638_0032248_1860_2876 | 337 |
| 741 | 3300046460 | Ga0495638_0033836 | Ga0495638_0033836_58_1077 | 337 |
| 742 | 3300046461 | Ga0495641_0008477 | Ga0495641_0008477_4126_5145 | 337 |
| 743 | 3300046461 | Ga0495641_0121183 | Ga0495641_0121183_112_1131 | 337 |
| 744 | 3300046462 | Ga0495651_0015094 | Ga0495651_0015094_4246_5265 | 337 |
| 745 | 3300046462 | Ga0495651_0016761 | Ga0495651_0016761_1629_2648 | 337 |
| 746 | 3300046463 | Ga0495653_0000697 | Ga0495653_0000697_13336_14355 | 337 |
| 747 | 3300046463 | Ga0495653_0033411 | Ga0495653_0033411_1840_2859 | 337 |
| 748 | 3300046463 | Ga0495653_0228582 | Ga0495653_0228582_55_1074 | 337 |
| 749 | 3300046472 | Ga0495580_0000705 | Ga0495580_0000705_4155_5174 | 337 |
| 750 | 3300046473 | Ga0495582_0002450 | Ga0495582_0002450_7661_8680 | 337 |
| 751 | 3300046475 | Ga0495639_0000135 | Ga0495639_0000135_8094_9113 | 337 |
| 752 | 3300046475 | Ga0495639_0004541 | Ga0495639_0004541_1426_2445 | 337 |
| 753 | 3300046476 | Ga0495662_0000811 | Ga0495662_0000811_6663_7682 | 337 |
| 754 | 3300046491 | Ga0495584_0137167 | Ga0495584_0137167_42_1061 | 337 |
| 755 | 3300046492 | Ga0495585_0049604 | Ga0495585_0049604_991_2010 | 337 |
| 756 | 3300046499 | Ga0495594_0001252 | Ga0495594_0001252_7789_8808 | 337 |
| 757 | 3300046499 | Ga0495594_0016885 | Ga0495594_0016885_454_1473 | 337 |
| 758 | 3300046501 | Ga0495607_0035604 | Ga0495607_0035604_885_1901 | 337 |
| 759 | 3300046507 | Ga0495606_0001350 | Ga0495606_0001350_22718_23737 | 337 |
| 760 | 3300046511 | Ga0495608_0038216 | Ga0495608_0038216_250_1269 | 337 |
| 761 | 3300046511 | Ga0495608_0130635 | Ga0495608_0130635_389_1408 | 337 |
| 762 | 3300046511 | Ga0495608_0183184 | Ga0495608_0183184_269_1288 | 337 |
| 763 | 3300046512 | Ga0495610_0039906 | Ga0495610_0039906_313_1329 | 337 |
| 764 | 3300046513 | Ga0495616_0132872 | Ga0495616_0132872_89_1108 | 337 |
| 765 | 3300046514 | Ga0495618_0149881 | Ga0495618_0149881_344_1363 | 337 |
| 766 | 3300046515 | Ga0495620_0013412 | Ga0495620_0013412_2840_3856 | 337 |
| 767 | 3300046516 | Ga0495628_0028014 | Ga0495628_0028014_2756_3775 | 337 |
| 768 | 3300046516 | Ga0495628_0037061 | Ga0495628_0037061_753_1772 | 337 |
| 769 | 3300046516 | Ga0495628_0211900 | Ga0495628_0211900_341_1360 | 337 |
| 770 | 3300046518 | Ga0495631_0070222 | Ga0495631_0070222_159_1175 | 337 |
| 771 | 3300046522 | Ga0495643_0037685 | Ga0495643_0037685_883_1899 | 337 |
| 772 | 3300046524 | Ga0495648_0000310 | Ga0495648_0000310_28350_29369 | 337 |
| 773 | 3300046524 | Ga0495648_0004337 | Ga0495648_0004337_10461_11477 | 337 |
| 774 | 3300046526 | Ga0495666_0118010 | Ga0495666_0118010_159_1178 | 337 |
| 775 | 3300046529 | Ga0495652_0025648 | Ga0495652_0025648_2563_3582 | 337 |
| 776 | 3300046529 | Ga0495652_0174301 | Ga0495652_0174301_161_1180 | 337 |
| 777 | 3300046531 | Ga0495665_0000118 | Ga0495665_0000118_7801_8820 | 337 |
| 778 | 3300046533 | Ga0495640_0032839 | Ga0495640_0032839_661_1680 | 337 |
| 779 | 3300046533 | Ga0495640_0045231 | Ga0495640_0045231_775_1794 | 337 |
| 780 | 3300046536 | Ga0495587_0021863 | Ga0495587_0021863_1820_2839 | 337 |
| 781 | 3300046543 | Ga0495645_0162202 | Ga0495645_0162202_206_1225 | 337 |
| 782 | 3300046557 | Ga0495622_0002977 | Ga0495622_0002977_6810_7829 | 337 |
| 783 | 3300046559 | Ga0495667_0000379 | Ga0495667_0000379_8974_9993 | 337 |
| 784 | 3300046559 | Ga0495667_0092297 | Ga0495667_0092297_594_1613 | 337 |
| 785 | 3300046615 | Ga0495656_0021970 | Ga0495656_0021970_1156_2175 | 337 |
| 786 | 3300046642 | Ga0495634_0000969 | Ga0495634_0000969_2009_3028 | 337 |
| 787 | 3300046642 | Ga0495634_0018562 | Ga0495634_0018562_3680_4699 | 337 |
| 788 | 3300046642 | Ga0495634_0044526 | Ga0495634_0044526_1005_2024 | 337 |
| 789 | 3300046660 | Ga0495625_0053068 | Ga0495625_0053068_261_1280 | 337 |
| 790 | 3300046660 | Ga0495625_0283918 | Ga0495625_0283918_22_1041 | 337 |
| 791 | 3300046663 | Ga0495635_0000434 | Ga0495635_0000434_1071_2090 | 337 |
| 792 | 3300046663 | Ga0495635_0025444 | Ga0495635_0025444_434_1453 | 337 |
| 793 | 3300046665 | Ga0495661_0016991 | Ga0495661_0016991_3224_4240 | 337 |
| 794 | 3300046674 | Ga0495588_0063025 | Ga0495588_0063025_540_1556 | 337 |
| 795 | 3300046674 | Ga0495588_0073316 | Ga0495588_0073316_613_1632 | 337 |
| 796 | 3300046675 | Ga0495657_0007977 | Ga0495657_0007977_5015_6034 | 337 |
| 797 | 3300046678 | Ga0495599_0002117 | Ga0495599_0002117_1023_2042 | 337 |
| 798 | 3300046678 | Ga0495599_0062858 | Ga0495599_0062858_1120_2139 | 337 |
| 799 | 3300046678 | Ga0495599_0129549 | Ga0495599_0129549_227_1246 | 337 |
| 800 | 3300046679 | Ga0495623_0022452 | Ga0495623_0022452_79_1098 | 337 |
| 801 | 3300046679 | Ga0495623_0064649 | Ga0495623_0064649_317_1336 | 337 |
| 802 | 3300046680 | Ga0495646_0021600 | Ga0495646_0021600_2886_3905 | 337 |
| 803 | 3300046680 | Ga0495646_0027263 | Ga0495646_0027263_1491_2510 | 337 |
| 804 | 3300046680 | Ga0495646_0141558 | Ga0495646_0141558_259_1278 | 337 |
| 805 | 3300046681 | Ga0495647_0000360 | Ga0495647_0000360_1938_2957 | 337 |
| 806 | 3300046683 | Ga0495658_0009177 | Ga0495658_0009177_1992_3011 | 337 |
| 807 | 3300046683 | Ga0495658_0020094 | Ga0495658_0020094_2060_3079 | 337 |
| 808 | 3300046683 | Ga0495658_0109479 | Ga0495658_0109479_16_1035 | 337 |
| 809 | 3300046689 | Ga0495613_0030595 | Ga0495613_0030595_188_1207 | 337 |
| 810 | 3300046689 | Ga0495613_0031204 | Ga0495613_0031204_2842_3861 | 337 |
| 811 | 3300046690 | Ga0495624_0000445 | Ga0495624_0000445_7645_8664 | 337 |
| 812 | 3300046690 | Ga0495624_0105050 | Ga0495624_0105050_356_1420 | 337 |
| 813 | 3300046691 | Ga0495670_0041658 | Ga0495670_0041658_849_1868 | 337 |
| 814 | 3300046692 | Ga0495671_0156236 | Ga0495671_0156236_63_1079 | 337 |
| 815 | 3300046809 | Ga0495600_0003883 | Ga0495600_0003883_2487_3506 | 337 |
| 816 | 3300046809 | Ga0495600_0015470 | Ga0495600_0015470_387_1406 | 337 |
| 817 | 3300047315 | Ga0495581_0001178 | Ga0495581_0001178_8763_9782 | 337 |
| 818 | 3300047315 | Ga0495581_0039724 | Ga0495581_0039724_1634_2653 | 337 |
| 819 | 3300047315 | Ga0495581_0164853 | Ga0495581_0164853_256_1275 | 337 |
| 820 | 3300047317 | Ga0495604_0043465 | Ga0495604_0043465_2447_3466 | 337 |
| 821 | 3300047317 | Ga0495604_0175565 | Ga0495604_0175565_145_1164 | 337 |
| 822 | 3300047319 | Ga0495674_0000443 | Ga0495674_0000443_32239_33258 | 337 |
| 823 | 3300047319 | Ga0495674_0010317 | Ga0495674_0010317_2670_3689 | 337 |
| 824 | 3300047319 | Ga0495674_0038574 | Ga0495674_0038574_1618_2637 | 337 |
| 825 | 3300047319 | Ga0495674_0171479 | Ga0495674_0171479_506_1525 | 337 |
| 826 | 3300047320 | Ga0495672_0006462 | Ga0495672_0006462_384_1403 | 337 |
| 827 | 3300047321 | Ga0495676_0144347 | Ga0495676_0144347_75_1091 | 337 |
| 828 | 3300047322 | Ga0495680_0042578 | Ga0495680_0042578_946_1965 | 337 |
| 829 | 3300047322 | Ga0495680_0076152 | Ga0495680_0076152_567_1586 | 337 |
| 830 | 3300047444 | Ga0495675_0068237 | Ga0495675_0068237_170_1189 | 337 |
| 831 | 3300047447 | Ga0495685_063973 | Ga0495685_063973_120_1139 | 337 |
| 832 | 3300047469 | Ga0495673_0013330 | Ga0495673_0013330_2048_3067 | 337 |
| 833 | 3300047471 | Ga0495684_0002730 | Ga0495684_0002730_6302_7321 | 337 |
| 834 | 3300047471 | Ga0495684_0054251 | Ga0495684_0054251_1996_3015 | 337 |
| 835 | 3300047471 | Ga0495684_0105859 | Ga0495684_0105859_321_1340 | 337 |
| 836 | 3300047471 | Ga0495684_0127653 | Ga0495684_0127653_312_1331 | 337 |
| 837 | 3300047673 | Ga0495593_0000495 | Ga0495593_0000495_38_1057 | 337 |
| 838 | 3300047673 | Ga0495593_0001203 | Ga0495593_0001203_1906_2925 | 337 |
| 839 | 3300047673 | Ga0495593_0022477 | Ga0495593_0022477_1677_2696 | 337 |
| 840 | 3300048088 | Ga0495602_0049654 | Ga0495602_0049654_2487_3506 | 337 |
| 841 | 3300048088 | Ga0495602_0055132 | Ga0495602_0055132_559_1578 | 337 |
| 842 | 3300048903 | Ga0496100_0011667 | Ga0496100_0011667_2061_3080 | 337 |
| 843 | 3300048904 | Ga0496101_0003579 | Ga0496101_0003579_3206_4225 | 337 |
| 844 | 3300048904 | Ga0496101_0052485 | Ga0496101_0052485_1848_2867 | 337 |
| 845 | 3300048904 | Ga0496101_0183960 | Ga0496101_0183960_566_1585 | 337 |
| 846 | 3300048905 | Ga0496102_0139950 | Ga0496102_0139950_668_1687 | 337 |
| 847 | 3300048906 | Ga0496103_0121183 | Ga0496103_0121183_322_1341 | 337 |
| 848 | 3300048906 | Ga0496103_0161673 | Ga0496103_0161673_52_1071 | 337 |
| 849 | 3300048907 | Ga0496104_0237482 | Ga0496104_0237482_583_1602 | 337 |
| 850 | 3300048908 | Ga0496105_0016857 | Ga0496105_0016857_4403_5422 | 337 |
| 851 | 3300048908 | Ga0496105_0258754 | Ga0496105_0258754_123_1142 | 337 |
| 852 | 3300048909 | Ga0496106_0104052 | Ga0496106_0104052_923_1942 | 337 |
| 853 | 3300048910 | Ga0496107_0033299 | Ga0496107_0033299_202_1221 | 337 |
| 854 | 3300048910 | Ga0496107_0066411 | Ga0496107_0066411_1080_2099 | 337 |
| 855 | 3300048910 | Ga0496107_0096532 | Ga0496107_0096532_745_1764 | 337 |
| 856 | 3300048910 | Ga0496107_0140661 | Ga0496107_0140661_745_1761 | 337 |
| 857 | 3300048910 | Ga0496107_0230720 | Ga0496107_0230720_221_1240 | 337 |
| 858 | 3300048911 | Ga0496108_0074802 | Ga0496108_0074802_150_1169 | 337 |
| 859 | 3300048912 | Ga0496109_0017997 | Ga0496109_0017997_73_1092 | 337 |
| 860 | 3300048912 | Ga0496109_0116893 | Ga0496109_0116893_1063_2082 | 337 |
| 861 | 3300048913 | Ga0496110_0067181 | Ga0496110_0067181_1668_2687 | 337 |
| 862 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_15443_16462 | 337 |
| 863 | 3300048915 | Ga0496112_0074363 | Ga0496112_0074363_407_1426 | 337 |
| 864 | 3300048915 | Ga0496112_0173866 | Ga0496112_0173866_82_1101 | 337 |
| 865 | 3300048915 | Ga0496112_0197092 | Ga0496112_0197092_324_1340 | 337 |
| 866 | 3300048915 | Ga0496112_0396022 | Ga0496112_0396022_209_1228 | 337 |
| 867 | 3300048916 | Ga0496113_0182878 | Ga0496113_0182878_596_1615 | 337 |
| 868 | 3300048916 | Ga0496113_0207468 | Ga0496113_0207468_341_1360 | 337 |
| 869 | 3300048917 | Ga0496114_0011325 | Ga0496114_0011325_5615_6634 | 337 |
| 870 | 3300048917 | Ga0496114_0056814 | Ga0496114_0056814_448_1467 | 337 |
| 871 | 3300048918 | Ga0496115_0000295 | Ga0496115_0000295_7333_8352 | 337 |
| 872 | 3300048918 | Ga0496115_0018198 | Ga0496115_0018198_1447_2466 | 337 |
| 873 | 3300048918 | Ga0496115_0076474 | Ga0496115_0076474_1544_2563 | 337 |
| 874 | 3300048918 | Ga0496115_0079903 | Ga0496115_0079903_1249_2268 | 337 |
| 875 | 3300048919 | Ga0496116_0002462 | Ga0496116_0002462_18156_19172 | 337 |
| 876 | 3300048920 | Ga0496117_0086744 | Ga0496117_0086744_398_1414 | 337 |
| 877 | 3300048921 | Ga0496118_0037848 | Ga0496118_0037848_2281_3297 | 337 |
| 878 | 3300048921 | Ga0496118_0128456 | Ga0496118_0128456_68_1084 | 337 |
| 879 | 3300048923 | Ga0496120_0126979 | Ga0496120_0126979_69_1085 | 337 |
| 880 | 3300048924 | Ga0496121_0001687 | Ga0496121_0001687_14754_15773 | 337 |
| 881 | 3300048924 | Ga0496121_0036588 | Ga0496121_0036588_1993_3009 | 337 |
| 882 | 3300048924 | Ga0496121_0041193 | Ga0496121_0041193_384_1400 | 337 |
| 883 | 3300048924 | Ga0496121_0063679 | Ga0496121_0063679_475_1494 | 337 |
| 884 | 3300048924 | Ga0496121_0155941 | Ga0496121_0155941_166_1185 | 337 |
| 885 | 3300048924 | Ga0496121_0158418 | Ga0496121_0158418_461_1480 | 337 |
| 886 | 3300048927 | Ga0496124_0134256 | Ga0496124_0134256_62_1078 | 337 |
| 887 | 3300048927 | Ga0496124_0165185 | Ga0496124_0165185_128_1147 | 337 |
| 888 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_20024_21040 | 337 |
| 889 | 3300048928 | Ga0496125_0004393 | Ga0496125_0004393_10092_11108 | 337 |
| 890 | 3300048929 | Ga0496126_0005939 | Ga0496126_0005939_3017_4036 | 337 |
| 891 | 3300048929 | Ga0496126_0007926 | Ga0496126_0007926_5514_6533 | 337 |
| 892 | 3300048929 | Ga0496126_0010008 | Ga0496126_0010008_2085_3104 | 337 |
| 893 | 3300048929 | Ga0496126_0082697 | Ga0496126_0082697_817_1836 | 337 |
| 894 | 3300048929 | Ga0496126_0258306 | Ga0496126_0258306_67_1086 | 337 |
| 895 | 3300048929 | Ga0496126_0290432 | Ga0496126_0290432_232_1248 | 337 |
| 896 | 3300049568 | Ga0501031_0003990 | Ga0501031_0003990_8391_9407 | 337 |
| 897 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_47734_48750 | 337 |
| 898 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_9759_10775 | 337 |
| 899 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_28310_29326 | 337 |
| 900 | 3300049571 | Ga0501034_0116531 | Ga0501034_0116531_61_1080 | 337 |
| 901 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_60188_61204 | 337 |
| 902 | 3300049572 | Ga0501036_0202301 | Ga0501036_0202301_279_1298 | 337 |
| 903 | 3300049573 | Ga0501037_0000040 | Ga0501037_0000040_24672_25688 | 337 |
| 904 | 3300049574 | Ga0501038_0000150 | Ga0501038_0000150_34471_35487 | 337 |
| 905 | 3300049574 | Ga0501038_0368549 | Ga0501038_0368549_59_1078 | 337 |
| 906 | 3300049575 | Ga0501039_0003418 | Ga0501039_0003418_3329_4345 | 337 |
| 907 | 3300049576 | Ga0501040_0300295 | Ga0501040_0300295_42_1058 | 337 |
| 908 | 3300049578 | Ga0501042_0008136 | Ga0501042_0008136_2900_3916 | 337 |
| 909 | 3300049579 | Ga0501043_0000464 | Ga0501043_0000464_14564_15580 | 337 |
| 910 | 3300049579 | Ga0501043_0191031 | Ga0501043_0191031_103_1122 | 337 |
| 911 | 3300049580 | Ga0501046_0000398 | Ga0501046_0000398_27844_28860 | 337 |
| 912 | 3300049580 | Ga0501046_0223674 | Ga0501046_0223674_304_1323 | 337 |
| 913 | 3300049581 | Ga0501047_0000656 | Ga0501047_0000656_28080_29096 | 337 |
| 914 | 3300049581 | Ga0501047_0294580 | Ga0501047_0294580_437_1456 | 337 |
| 915 | 3300049582 | Ga0501048_0000906 | Ga0501048_0000906_10964_11980 | 337 |
| 916 | 3300049583 | Ga0501067_0000192 | Ga0501067_0000192_19925_20941 | 337 |
| 917 | 3300049583 | Ga0501067_0035211 | Ga0501067_0035211_363_1382 | 337 |
| 918 | 3300049584 | Ga0501068_0002765 | Ga0501068_0002765_3245_4261 | 337 |
| 919 | 3300049585 | Ga0501069_0014897 | Ga0501069_0014897_2398_3414 | 337 |
| 920 | 3300049586 | Ga0501070_0037271 | Ga0501070_0037271_2822_3841 | 337 |
| 921 | 3300049586 | Ga0501070_0076207 | Ga0501070_0076207_383_1399 | 337 |
| 922 | 3300049586 | Ga0501070_0179220 | Ga0501070_0179220_505_1524 | 337 |
| 923 | 3300049586 | Ga0501070_0203936 | Ga0501070_0203936_503_1519 | 337 |
| 924 | 3300049587 | Ga0501071_0053825 | Ga0501071_0053825_1462_2478 | 337 |
| 925 | 3300049588 | Ga0501072_0002128 | Ga0501072_0002128_10200_11216 | 337 |
| 926 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_26069_27085 | 337 |
| 927 | 3300049590 | Ga0501074_0000133 | Ga0501074_0000133_36746_37762 | 337 |
| 928 | 3300049741 | Ga0501079_0024353 | Ga0501079_0024353_3478_4494 | 337 |
| 929 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_33663_34679 | 337 |
| 930 | 3300049742 | Ga0501080_0005201 | Ga0501080_0005201_5656_6675 | 337 |
| 931 | 3300049744 | Ga0501083_0001153 | Ga0501083_0001153_282_1298 | 337 |
| 932 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_58236_59252 | 337 |
| 933 | 3300049822 | Ga0501035_0278135 | Ga0501035_0278135_283_1302 | 337 |
| 934 | 3300049823 | Ga0501044_0000985 | Ga0501044_0000985_28310_29326 | 337 |
| 935 | 3300049823 | Ga0501044_0102936 | Ga0501044_0102936_44_1063 | 337 |
| 936 | 3300049824 | Ga0501045_0019721 | Ga0501045_0019721_3045_4061 | 337 |
| 937 | 3300050489 | nmdc:mga03683_17647_c1 | nmdc:mga03683_17647_c1_1303_2367 | 337 |
| 938 | 3300050491 | nmdc:mga00v17_20486_c1 | nmdc:mga00v17_20486_c1_226_1242 | 337 |
| 939 | 3300050492 | nmdc:mga0yw44_942_c1 | nmdc:mga0yw44_942_c1_9589_10653 | 337 |
| 940 | 3300050494 | nmdc:mga06z11_14027_c1 | nmdc:mga06z11_14027_c1_1994_3013 | 337 |
| 941 | 3300050496 | nmdc:mga07m45_6998_c1 | nmdc:mga07m45_6998_c1_2893_3912 | 337 |
| 942 | 3300050512 | nmdc:mga0n895_115792_c1 | nmdc:mga0n895_115792_c1_899_1918 | 337 |
| 943 | 3300050512 | nmdc:mga0n895_30146_c1 | nmdc:mga0n895_30146_c1_3808_4827 | 337 |
| 944 | 3300050516 | nmdc:mga0sz30_9846_c1 | nmdc:mga0sz30_9846_c1_331_1347 | 337 |
| 945 | 3300053077 | Ga0495601_0013434 | Ga0495601_0013434_3591_4610 | 337 |
| 946 | 3300053077 | Ga0495601_0083775 | Ga0495601_0083775_331_1350 | 337 |
| 947 | 3300053078 | Ga0495612_0062530 | Ga0495612_0062530_165_1184 | 337 |
| 948 | 3300053084 | Ga0495595_0000758 | Ga0495595_0000758_9771_10790 | 337 |
| 949 | 3300053085 | Ga0495619_0000617 | Ga0495619_0000617_17237_18256 | 337 |
| 950 | 3300053089 | Ga0500581_052116 | Ga0500581_052116_978_1994 | 337 |
| 951 | 3300053090 | Ga0500646_0035013 | Ga0500646_0035013_167_1183 | 337 |
| 952 | 3300053093 | Ga0500651_0026339 | Ga0500651_0026339_1681_2694 | 337 |
| 953 | 3300053093 | Ga0500651_0098104 | Ga0500651_0098104_737_1753 | 337 |
| 954 | 3300053094 | Ga0500566_0000822 | Ga0500566_0000822_2570_3583 | 337 |
| 955 | 3300053094 | Ga0500566_0003799 | Ga0500566_0003799_1216_2238 | 337 |
| 956 | 3300053096 | Ga0500641_0016085 | Ga0500641_0016085_636_1655 | 337 |
| 957 | 3300053096 | Ga0500641_0039404 | Ga0500641_0039404_656_1672 | 337 |
| 958 | 3300053098 | Ga0500650_0006577 | Ga0500650_0006577_2867_3883 | 337 |
| 959 | 3300053104 | Ga0500556_0000047 | Ga0500556_0000047_10108_11124 | 337 |
| 960 | 3300053119 | Ga0500595_003841 | Ga0500595_003841_363_1385 | 337 |
| 961 | 3300053119 | Ga0500595_023858 | Ga0500595_023858_779_1798 | 337 |
| 962 | 3300053122 | Ga0500608_015167 | Ga0500608_015167_464_1477 | 337 |
| 963 | 3300053125 | Ga0500618_011635 | Ga0500618_011635_90_1103 | 337 |
| 964 | 3300053130 | Ga0500642_0000142 | Ga0500642_0000142_5411_6427 | 337 |
| 965 | 3300053131 | Ga0500652_001628 | Ga0500652_001628_5326_6342 | 337 |
| 966 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_27639_28652 | 337 |
| 967 | 3300053136 | Ga0500559_0001644 | Ga0500559_0001644_9401_10471 | 337 |
| 968 | 3300053139 | Ga0500568_0010399 | Ga0500568_0010399_2291_3307 | 337 |
| 969 | 3300053142 | Ga0500577_0000991 | Ga0500577_0000991_5801_6817 | 337 |
| 970 | 3300053150 | Ga0500603_000576 | Ga0500603_000576_2552_3571 | 337 |
| 971 | 3300053151 | Ga0500604_0002170 | Ga0500604_0002170_2960_3976 | 337 |
| 972 | 3300053153 | Ga0500616_0000784 | Ga0500616_0000784_25269_26285 | 337 |
| 973 | 3300053156 | Ga0500622_0002394 | Ga0500622_0002394_11480_12496 | 337 |
| 974 | 3300053158 | Ga0500627_0098195 | Ga0500627_0098195_158_1174 | 337 |
| 975 | 3300053162 | Ga0500638_000230 | Ga0500638_000230_7819_8841 | 337 |
| 976 | 3300053177 | Ga0500636_0003094 | Ga0500636_0003094_7453_8466 | 337 |
| 977 | 3300053177 | Ga0500636_0104233 | Ga0500636_0104233_126_1145 | 337 |
| 978 | 3300053178 | Ga0500637_0001711 | Ga0500637_0001711_8189_9208 | 337 |
| 979 | 3300053178 | Ga0500637_0003917 | Ga0500637_0003917_2470_3492 | 337 |
| 980 | 3300053730 | Ga0500645_007739 | Ga0500645_007739_1322_2341 | 337 |
| 981 | 3300053735 | Ga0500596_003966 | Ga0500596_003966_1481_2551 | 337 |
| 982 | 3300054114 | Ga0501084_0008150 | Ga0501084_0008150_3877_4893 | 337 |
| 983 | 3300055283 | Ga0500661_000294 | Ga0500661_000294_6511_7533 | 337 |
| 984 | 3300060353 | Ga0501082_0005663 | Ga0501082_0005663_2936_3952 | 337 |
| 985 | 3300061734 | Ga0530510_0214055 | Ga0530510_0214055_401_1420 | 337 |
| 986 | iso_pu_bacteria | 8019565922 | 8019571604 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9176 | 1 | 334 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.9176 | 2 | 334 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.9113 | 1 | 334 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9096 | 1 | 334 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.9034 | 1 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9164 | 1 | 334 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9162 | 1 | 330 | 3.20.20.30 |
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9083 | 1 | 334 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9056 | 1 | 330 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8972 | 2 | 332 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H4ZNQ5-F1-model_v4 | Luciferase family oxidoreductase, group 1 | 0.9752 | 1 | 337 |
GO:0005829
GO:0016705 |
| AF-A0A1H4ZNQ5-F1-model_v4 | Luciferase family oxidoreductase, group 1 | 0.9723 | 1 | 337 |
GO:0005829
GO:0016705 |
| AF-A0A7C9RFL3-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.962 | 68 | 332 |
GO:0005829
GO:0016705 |
| AF-A0A537S3K2-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9615 | 65 | 334 |
GO:0005829
GO:0016705 |
| AF-A0A401U2I4-F1-model_v4 | Luciferase-like domain-containing protein | 0.9613 | 208 | 337 |
GO:0005829
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar