F487537

General Info

Members Datasets Scaffolds Average Seq Length
986 591 765 337

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_024708|Ga0500645_024708_190_1209
Length 314
Sequence MIPLSVLDLSVVTTGTKPAQSLRNSIDLAKHADQLGYTRYWLAEHHSLLSVASPAPEIMIGQIAAATQRIRVGSGGVMLPNHAPLMVAERFKMLEALFPGRIDLGLGRAPGTDQTTMHALRQRFDPRGGDDFIERLIELTLWETREFPEGHPYNKVVAMPDDTPLPPIWLLGSSDYSMIHYRAHFKPSRWRENPHAILAIAVIMAETDEEADKLASSADLNRLLRDRGQYRPLPSVEEAQAYPYTDAERASIARNRSRLFVGSKQTVMEKVTPLIETSKPDEVMVITATYDHDARKRSYSLLADAFGIGRQAAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
82 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
83 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
84 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
85 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
86 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
87 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
88 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
89 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
93 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
94 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
95 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
96 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
97 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
98 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
99 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
100 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
101 2904699407
102 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
103 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
104 2906610324
105 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
106 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
107 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
108 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
109 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
110 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
111 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
112 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
113 2922368715
114 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
115 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
116 2922425934
117 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
118 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
119 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
120 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
121 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
122 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
123 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
124 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
125 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
126 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
127 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
128 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
129 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
130 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
131 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
132 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
133 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
134 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
135 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
136 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
137 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
138 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
139 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
140 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
141 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
142 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
143 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
144 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
145 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
146 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
147 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
148 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
149 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
150 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
151 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
152 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
153 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
154 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
155 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
156 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
157 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
158 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
159 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
160 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
161 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
162 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
163 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
164 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
165 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
166 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
167 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
168 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
169 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
170 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
171 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
172 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
173 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
174 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
175 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
176 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
177 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
178 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
179 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
180 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
181 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
182 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
183 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
184 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
185 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
186 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
187 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
188 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
189 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
190 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
191 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
193 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
194 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
195 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
196 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
197 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
198 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
199 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
200 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
201 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
202 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
203 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
204 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
205 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
206 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
207 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
208 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
209 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
210 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
211 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
214 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
215 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
216 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
217 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
218 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
219 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
220 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
221 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
225 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
226 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
229 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
230 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
231 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
232 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
233 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
243 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
244 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
245 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
246 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
247 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
248 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
249 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
250 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
251 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
252 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
253 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
254 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
255 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
256 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
257 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
258 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
259 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
260 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
261 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
262 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
263 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
264 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
265 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
266 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
267 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
268 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
269 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
270 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
273 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
276 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
325 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
326 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
327 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
328 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
333 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
334 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
335 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
337 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
338 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
339 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
340 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
343 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
344 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
345 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
346 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
347 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
350 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
353 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
354 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
355 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
356 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
357 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
358 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
359 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
362 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
363 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
364 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
365 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
366 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
367 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
368 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
369 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
370 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
371 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
372 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
373 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
374 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
375 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
376 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
377 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
378 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
379 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
380 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
381 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
382 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
383 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
384 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
385 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
391 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
392 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
393 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
394 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
395 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
396 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
397 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
398 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
399 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
400 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
401 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
402 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
403 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
404 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
405 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
406 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
407 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
408 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
409 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
410 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
411 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
412 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
413 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
414 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
415 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
416 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
417 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
420 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
424 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
425 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
426 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
427 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
428 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
429 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
430 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
431 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
432 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
433 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
434 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
435 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
436 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
437 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
440 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
441 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
442 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
443 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
444 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
445 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
446 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
447 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
448 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
449 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
450 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
451 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
452 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
453 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
454 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
455 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
456 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
457 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
458 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
459 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
460 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
461 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
462 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
463 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
464 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
465 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
466 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
467 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
468 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
469 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
470 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
471 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
472 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
473 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
474 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
475 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
476 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
477 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
478 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
494 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
495 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
496 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
497 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
498 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
499 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
500 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
501 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
502 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
503 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
504 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
509 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
510 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
511 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
512 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
516 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
517 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
518 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
519 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
520 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
521 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
522 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
523 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
524 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
525 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
526 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
527 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
528 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
531 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
532 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
533 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
534 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
535 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
536 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
537 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
538 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
539 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
540 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
541 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
542 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
543 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
544 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
545 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
546 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
547 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
550 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
551 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
552 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
553 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
554 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
555 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
556 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
557 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
558 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
559 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
560 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
561 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
562 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
563 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
564 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
565 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
566 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
567 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
568 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
569 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
570 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
571 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
572 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
573 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
574 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
575 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
576 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
577 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
578 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
579 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
580 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
581 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
582 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
583 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
584 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
585 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
586 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
587 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
588 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
589 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
590 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
591 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.78
Metatranscriptomes 0.2
Isolates 22.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 16.94
Rhizoplane 4.67
Rhizosphere 54.06
Stem 0
Stem Tuber 0
Unclassified 12.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005937 3300001979 Bacteria 5113
2 JGI25406J46586_10000012 3300003203 Bacteria 102438
3 JGI25406J46586_10038146 3300003203 Bacteria 1725
4 JGI25153J46596_10008046 3300003215 Bacteria 5094
5 JGI25153J46596_10019332 3300003215 Bacteria 2615
6 JGI25160J50197_1005561 3300003354 Bacteria 5227
7 JGI25160J50197_1007198 3300003354 Bacteria 4383
8 JGI25160J50197_1015110 3300003354 Bacteria 2548
9 JGI25404J52841_10006703 3300003659 Bacteria 2417
10 JGI25404J52841_10010612 3300003659 Bacteria 1979
11 Ga0055539_1002997 3300003752 Bacteria 2435
12 Ga0055543_1005993 3300004625 Bacteria 3016
13 Ga0065165_1000982 3300005262 Bacteria 35331
14 Ga0065165_1007672 3300005262 Bacteria 5235
15 Ga0065165_1008445 3300005262 Bacteria 4816
16 Ga0070670_100068271 3300005331 Bacteria 3051
17 Ga0068869_100023869 3300005334 Bacteria 4232
18 Ga0070680_100016577 3300005336 Bacteria 5798
19 Ga0070680_100064099 3300005336 Bacteria 3011
20 Ga0070680_100367073 3300005336 Bacteria 1225
21 Ga0068868_100071269 3300005338 Bacteria 2771
22 Ga0070660_100238356 3300005339 Bacteria 1481
23 Ga0070660_100280343 3300005339 Bacteria 1364
24 Ga0070661_100310121 3300005344 Bacteria 1230
25 Ga0070668_100041152 3300005347 Bacteria 3540
26 Ga0070668_100087155 3300005347 Bacteria 2456
27 Ga0070668_100137630 3300005347 Bacteria 1965
28 Ga0070671_100044664 3300005355 Bacteria 3682
29 Ga0070674_100096396 3300005356 Bacteria 2146
30 Ga0070688_100166279 3300005365 Bacteria 1519
31 Ga0070709_10002283 3300005434 Bacteria 10401
32 Ga0070714_100022105 3300005435 Bacteria 5212
33 Ga0070714_100039738 3300005435 Bacteria 3962
34 Ga0070713_100022749 3300005436 Bacteria 4849
35 Ga0070713_100060987 3300005436 Bacteria 3155
36 Ga0070713_100129624 3300005436 Bacteria 2223
37 Ga0070713_100162662 3300005436 Bacteria 1993
38 Ga0070710_10018697 3300005437 Bacteria 3569
39 Ga0070708_100387090 3300005445 Bacteria 1319
40 Ga0070663_100028428 3300005455 Bacteria 3806
41 Ga0070663_100169745 3300005455 Bacteria 1685
42 Ga0070678_100178156 3300005456 Bacteria 1738
43 Ga0070678_100279634 3300005456 Bacteria 1411
44 Ga0070662_100185930 3300005457 Bacteria 1640
45 Ga0070662_100367923 3300005457 Bacteria 1181
46 Ga0070681_10187131 3300005458 Bacteria 1991
47 Ga0070681_10419787 3300005458 Bacteria 1250
48 Ga0070706_100133515 3300005467 Bacteria 2317
49 Ga0070707_100054763 3300005468 Bacteria 3825
50 Ga0070707_100433063 3300005468 Bacteria 1275
51 Ga0070698_100047957 3300005471 Bacteria 4366
52 Ga0070679_100270231 3300005530 Bacteria 1654
53 Ga0070684_100065197 3300005535 Bacteria 3196
54 Ga0070684_100115278 3300005535 Bacteria 2413
55 Ga0070684_100213839 3300005535 Bacteria 1757
56 Ga0068853_100032830 3300005539 Bacteria 4400
57 Ga0068853_100040910 3300005539 Bacteria 3957
58 Ga0068853_100109745 3300005539 Bacteria 2449
59 Ga0070672_100185134 3300005543 Bacteria 1736
60 Ga0070686_100183444 3300005544 Bacteria 1488
61 Ga0070665_100012864 3300005548 Bacteria 8426
62 Ga0070665_100058353 3300005548 Bacteria 3870
63 Ga0068855_100080478 3300005563 Bacteria 3777
64 Ga0068855_100117639 3300005563 Bacteria 3044
65 Ga0068855_100154127 3300005563 Bacteria 2611
66 Ga0068855_100218105 3300005563 Bacteria 2141
67 Ga0068855_100358675 3300005563 Bacteria 1604
68 Ga0068857_100023618 3300005577 Bacteria 5413
69 Ga0068854_100072638 3300005578 Bacteria 2519
70 Ga0068856_100000137 3300005614 Bacteria 73762
71 Ga0068856_100063543 3300005614 Bacteria 3647
72 Ga0068856_100118565 3300005614 Bacteria 2647
73 Ga0068856_100540575 3300005614 Bacteria 1186
74 Ga0068852_100006606 3300005616 Bacteria 8399
75 Ga0068852_100010212 3300005616 Bacteria 6998
76 Ga0068852_100448392 3300005616 Bacteria 1277
77 Ga0068851_10003838 3300005834 Bacteria 6727
78 Ga0068851_10061017 3300005834 Bacteria 1932
79 Ga0068860_100000837 3300005843 Bacteria 34452
80 Ga0068860_100274052 3300005843 Bacteria 1647
81 Ga0068860_100468621 3300005843 Bacteria 1254
82 Ga0068862_100137583 3300005844 Bacteria 2166
83 Ga0068862_100249676 3300005844 Bacteria 1616
84 Ga0068862_100315305 3300005844 Bacteria 1442
85 Ga0081455_10008940 3300005937 Bacteria 10353
86 Ga0081455_10011276 3300005937 Bacteria 8994
87 Ga0081455_10013423 3300005937 Bacteria 8097
88 Ga0081455_10032605 3300005937 Bacteria 4692
89 Ga0081538_10037995 3300005981 Bacteria 3113
90 Ga0081540_1002034 3300005983 Bacteria 16870
91 Ga0081540_1007800 3300005983 Bacteria 7574
92 Ga0081540_1008423 3300005983 Bacteria 7210
93 Ga0081540_1012078 3300005983 Bacteria 5714
94 Ga0081540_1020975 3300005983 Bacteria 3910
95 Ga0081540_1023647 3300005983 Bacteria 3588
96 Ga0081540_1051055 3300005983 Bacteria 2048
97 Ga0081540_1065713 3300005983 Bacteria 1704
98 Ga0081540_1068142 3300005983 Bacteria 1659
99 Ga0081539_10000040 3300005985 Bacteria 292753
100 Ga0081539_10000157 3300005985 Bacteria 158278
101 Ga0081539_10006006 3300005985 Bacteria 11928
102 Ga0081539_10063904 3300005985 Bacteria 2006
103 Ga0081539_10105346 3300005985 Bacteria 1430
104 Ga0070717_10017655 3300006028 Bacteria 5555
105 Ga0075365_10043977 3300006038 Bacteria 2925
106 Ga0075365_10110776 3300006038 Bacteria 1886
107 Ga0075368_10016127 3300006042 Bacteria 2781
108 Ga0075363_100115619 3300006048 Bacteria 1494
109 Ga0075363_100125154 3300006048 Bacteria 1438
110 Ga0070716_100014843 3300006173 Bacteria 3996
111 Ga0070716_100021483 3300006173 Bacteria 3402
112 Ga0070716_100114369 3300006173 Bacteria 1678
113 Ga0070712_100152298 3300006175 Bacteria 1777
114 Ga0075367_10061551 3300006178 Bacteria 2240
115 Ga0075367_10121060 3300006178 Bacteria 1612
116 Ga0075369_10010149 3300006186 Bacteria 3680
117 Ga0075369_10132724 3300006186 Bacteria 1132
118 Ga0075366_10023825 3300006195 Bacteria 3567
119 Ga0099794_10005590 3300007265 Bacteria 5052
120 Ga0105240_10012243 3300009093 Bacteria 11853
121 Ga0105240_10015437 3300009093 Bacteria 10386
122 Ga0105240_10069358 3300009093 Bacteria 4364
123 Ga0105240_10135717 3300009093 Bacteria 2947
124 Ga0111539_10347138 3300009094 Bacteria 1727
125 Ga0111539_10351823 3300009094 Bacteria 1714
126 Ga0105245_10148468 3300009098 Bacteria 2214
127 Ga0105243_10224948 3300009148 Bacteria 1661
128 Ga0105241_10001280 3300009174 Bacteria 19200
129 Ga0105241_10043926 3300009174 Bacteria 3385
130 Ga0105241_10070526 3300009174 Bacteria 2711
131 Ga0105241_10081915 3300009174 Bacteria 2529
132 Ga0105248_10036476 3300009177 Bacteria 5498
133 Ga0105248_10497588 3300009177 Bacteria 1374
134 Ga0105237_10044776 3300009545 Bacteria 4455
135 Ga0105237_10140850 3300009545 Bacteria 2406
136 Ga0105238_10044002 3300009551 Bacteria 4517
137 Ga0105238_10079710 3300009551 Bacteria 3264
138 Ga0099796_10019249 3300010159 Bacteria 2067
139 Ga0105239_10054114 3300010375 Bacteria 4401
140 Ga0105239_10187359 3300010375 Bacteria 2316
141 Ga0105239_10211117 3300010375 Bacteria 2176
142 Ga0105239_10267778 3300010375 Bacteria 1921
143 Ga0105246_10111990 3300011119 Bacteria 2006
144 Ga0157370_10040880 3300013104 Bacteria 4475
145 Ga0157370_10532625 3300013104 Bacteria 1077
146 Ga0157369_10151451 3300013105 Bacteria 2451
147 Ga0157374_10134006 3300013296 Bacteria 2400
148 Ga0157378_10074226 3300013297 Bacteria 3060
149 Ga0157378_10078348 3300013297 Bacteria 2981
150 Ga0157378_10544548 3300013297 Bacteria 1165
151 Ga0163162_10654083 3300013306 Bacteria 1174
152 Ga0157372_10100045 3300013307 Bacteria 3308
153 Ga0157375_10055890 3300013308 Bacteria 3893
154 Ga0157375_10190888 3300013308 Bacteria 2203
155 Ga0163163_10150156 3300014325 Bacteria 2374
156 Ga0163163_10222436 3300014325 Bacteria 1936
157 Ga0163163_10268407 3300014325 Bacteria 1757
158 Ga0157376_10022471 3300014969 Bacteria 4919
159 Ga0157376_10240448 3300014969 Bacteria 1687
160 Ga0214544_1000011 3300021320 Bacteria 262952
161 Ga0214542_1000009 3300021321 Bacteria 262861
162 Ga0214545_1000007 3300021324 Bacteria 262984
163 Ga0214543_1000020 3300021327 Bacteria 262861
164 Ga0213871_10033779 3300021441 Bacteria 1346
165 Ga0209677_102183 3300025253 Bacteria 7623
166 Ga0209148_1000321 3300025254 Bacteria 66604
167 Ga0209233_1004336 3300025261 Bacteria 4843
168 Ga0209233_1008907 3300025261 Bacteria 3075
169 Ga0209455_1000807 3300025272 Bacteria 17148
170 Ga0209455_1023034 3300025272 Bacteria 1176
171 Ga0209564_1000477 3300025295 Bacteria 66843
172 Ga0209758_1000206 3300025297 Bacteria 130177
173 Ga0209758_1000536 3300025297 Bacteria 60374
174 Ga0209758_1001539 3300025297 Bacteria 26507
175 Ga0209758_1001550 3300025297 Bacteria 26398
176 Ga0209758_1002309 3300025297 Bacteria 19718
177 Ga0209758_1004564 3300025297 Bacteria 11423
178 Ga0209256_1011364 3300025299 Bacteria 3571
179 Ga0207426_1000773 3300025302 Bacteria 35199
180 Ga0207426_1000990 3300025302 Bacteria 27830
181 Ga0207426_1003444 3300025302 Bacteria 8596
182 Ga0209051_1048370 3300025303 Bacteria 1442
183 Ga0209257_1000394 3300025304 Bacteria 86654
184 Ga0209257_1011695 3300025304 Bacteria 4183
185 Ga0209257_1034598 3300025304 Bacteria 1573
186 Ga0207656_10005846 3300025321 Bacteria 4382
187 Ga0207692_10000138 3300025898 Bacteria 22336
188 Ga0207692_10008172 3300025898 Bacteria 4323
189 Ga0207692_10010497 3300025898 Bacteria 3906
190 Ga0207710_10035205 3300025900 Bacteria 2202
191 Ga0207647_10005671 3300025904 Bacteria 9117
192 Ga0207699_10000122 3300025906 Bacteria 55116
193 Ga0207699_10003146 3300025906 Bacteria 7851
194 Ga0207699_10221479 3300025906 Bacteria 1292
195 Ga0207643_10008642 3300025908 Bacteria 5462
196 Ga0207705_10124422 3300025909 Bacteria 1915
197 Ga0207684_10037662 3300025910 Bacteria 4104
198 Ga0207654_10000153 3300025911 Bacteria 43627
199 Ga0207654_10039326 3300025911 Bacteria 2660
200 Ga0207654_10048569 3300025911 Bacteria 2429
201 Ga0207707_10002207 3300025912 Bacteria 17632
202 Ga0207695_10000006 3300025913 Bacteria 1135309
203 Ga0207695_10000506 3300025913 Bacteria 82904
204 Ga0207695_10051564 3300025913 Bacteria 4318
205 Ga0207695_10402539 3300025913 Bacteria 1253
206 Ga0207671_10021063 3300025914 Bacteria 4952
207 Ga0207671_10110521 3300025914 Bacteria 2091
208 Ga0207671_10313295 3300025914 Bacteria 1241
209 Ga0207693_10004906 3300025915 Bacteria 11244
210 Ga0207693_10009351 3300025915 Bacteria 7991
211 Ga0207693_10068086 3300025915 Bacteria 2787
212 Ga0207663_10000161 3300025916 Bacteria 30665
213 Ga0207663_10000623 3300025916 Bacteria 15689
214 Ga0207663_10209013 3300025916 Bacteria 1413
215 Ga0207660_10227703 3300025917 Bacteria 1465
216 Ga0207660_10243940 3300025917 Bacteria 1416
217 Ga0207662_10099985 3300025918 Bacteria 1796
218 Ga0207657_10033356 3300025919 Bacteria 4642
219 Ga0207657_10242711 3300025919 Bacteria 1438
220 Ga0207652_10047975 3300025921 Bacteria 3649
221 Ga0207652_10373220 3300025921 Bacteria 1288
222 Ga0207646_10050177 3300025922 Bacteria 3735
223 Ga0207681_10275586 3300025923 Bacteria 1322
224 Ga0207694_10003910 3300025924 Bacteria 11770
225 Ga0207694_10034184 3300025924 Bacteria 3898
226 Ga0207694_10038204 3300025924 Bacteria 3691
227 Ga0207694_10081906 3300025924 Bacteria 2536
228 Ga0207694_10219491 3300025924 Bacteria 1550
229 Ga0207687_10009895 3300025927 Bacteria 6243
230 Ga0207687_10029818 3300025927 Bacteria 3672
231 Ga0207687_10274318 3300025927 Bacteria 1349
232 Ga0207700_10045317 3300025928 Bacteria 3244
233 Ga0207700_10053147 3300025928 Bacteria 3033
234 Ga0207700_10057556 3300025928 Bacteria 2932
235 Ga0207664_10021734 3300025929 Bacteria 4779
236 Ga0207664_10120275 3300025929 Bacteria 2196
237 Ga0207706_10065562 3300025933 Bacteria 3198
238 Ga0207706_10312768 3300025933 Bacteria 1367
239 Ga0207669_10029132 3300025937 Bacteria 3048
240 Ga0207665_10000183 3300025939 Bacteria 41938
241 Ga0207665_10171674 3300025939 Bacteria 1566
242 Ga0207665_10175312 3300025939 Bacteria 1550
243 Ga0207691_10049861 3300025940 Bacteria 3835
244 Ga0207691_10274416 3300025940 Bacteria 1451
245 Ga0207711_10033479 3300025941 Bacteria 4348
246 Ga0207689_10046436 3300025942 Bacteria 3589
247 Ga0207689_10093199 3300025942 Bacteria 2474
248 Ga0207689_10104918 3300025942 Bacteria 2322
249 Ga0207661_10000828 3300025944 Bacteria 20288
250 Ga0207667_10072942 3300025949 Bacteria 3568
251 Ga0207667_10087422 3300025949 Bacteria 3224
252 Ga0207667_10114421 3300025949 Bacteria 2781
253 Ga0207667_10119463 3300025949 Bacteria 2716
254 Ga0207667_10244025 3300025949 Bacteria 1838
255 Ga0207667_10271534 3300025949 Bacteria 1733
256 Ga0207712_10128647 3300025961 Bacteria 1927
257 Ga0207668_10104398 3300025972 Bacteria 2112
258 Ga0207668_10118457 3300025972 Bacteria 2000
259 Ga0207668_10366631 3300025972 Bacteria 1208
260 Ga0207677_10175196 3300026023 Bacteria 1682
261 Ga0207639_10007981 3300026041 Bacteria 7230
262 Ga0207639_10042056 3300026041 Bacteria 3423
263 Ga0207639_10346164 3300026041 Bacteria 1326
264 Ga0207678_10038686 3300026067 Bacteria 4143
265 Ga0207678_10065333 3300026067 Bacteria 3124
266 Ga0207678_10086765 3300026067 Bacteria 2674
267 Ga0207678_10174584 3300026067 Bacteria 1835
268 Ga0207678_10426764 3300026067 Bacteria 1150
269 Ga0207702_10000006 3300026078 Bacteria 346370
270 Ga0207702_10000063 3300026078 Bacteria 123034
271 Ga0207702_10063018 3300026078 Bacteria 3169
272 Ga0207702_10610005 3300026078 Bacteria 1071
273 Ga0207648_10285701 3300026089 Bacteria 1476
274 Ga0207676_10089134 3300026095 Bacteria 2527
275 Ga0207674_10048571 3300026116 Bacteria 4343
276 Ga0207674_10048718 3300026116 Bacteria 4336
277 Ga0207674_10130837 3300026116 Bacteria 2473
278 Ga0207675_100236199 3300026118 Bacteria 1765
279 Ga0207683_10121878 3300026121 Bacteria 2342
280 Ga0207683_10174513 3300026121 Bacteria 1947
281 Ga0207683_10308371 3300026121 Bacteria 1448
282 Ga0207683_10375902 3300026121 Bacteria 1306
283 Ga0207698_10045959 3300026142 Bacteria 3293
284 Ga0207698_10057730 3300026142 Bacteria 3004
285 Ga0207698_10420215 3300026142 Bacteria 1283
286 Ga0207698_10427495 3300026142 Bacteria 1273
287 Ga0209389_1000034 3300027296 Bacteria 127289
288 Ga0209389_1000039 3300027296 Bacteria 124545
289 Ga0209589_1000038 3300027357 Bacteria 127285
290 Ga0209489_100023 3300027361 Bacteria 198829
291 Ga0209489_100087 3300027361 Bacteria 124545
292 Ga0209700_100090 3300027363 Bacteria 124545
293 Ga0209588_1005208 3300027671 Bacteria 3711
294 Ga0268266_10034894 3300028379 Bacteria 4278
295 Ga0268266_10053634 3300028379 Bacteria 3464
296 Ga0268266_10163006 3300028379 Bacteria 2018
297 Ga0268266_10187728 3300028379 Bacteria 1886
298 Ga0268266_10497615 3300028379 Bacteria 1163
299 Ga0268265_10277711 3300028380 Bacteria 1497
300 Ga0268265_10461022 3300028380 Bacteria 1189
301 Ga0268264_10000537 3300028381 Bacteria 48029
302 Ga0268264_10066486 3300028381 Bacteria 3040
303 Ga0307517_10050575 3300028786 Bacteria 4220
304 Ga0307515_10046793 3300028794 Bacteria 6600
305 Ga0307515_10063600 3300028794 Bacteria 5178
306 Ga0265338_10063970 3300028800 Bacteria 3203
307 Ga0265763_1002954 3300030763 Bacteria 1326
308 Ga0265330_10072948 3300031235 Bacteria 1484
309 Ga0265340_10052128 3300031247 Bacteria 1979
310 Ga0265339_10000281 3300031249 Bacteria 41044
311 Ga0265339_10026845 3300031249 Bacteria 3294
312 Ga0307513_10139543 3300031456 Bacteria 2353
313 Ga0307509_10053131 3300031507 Bacteria 4322
314 Ga0307509_10106470 3300031507 Bacteria 2823
315 Ga0307508_10000012 3300031616 Bacteria 243167
316 Ga0307508_10033210 3300031616 Bacteria 4657
317 Ga0307508_10078988 3300031616 Bacteria 2871
318 Ga0307508_10210862 3300031616 Bacteria 1543
319 Ga0307508_10217175 3300031616 Bacteria 1512
320 Ga0265314_10011033 3300031711 Bacteria 7493
321 Ga0265314_10063614 3300031711 Bacteria 2502
322 Ga0265342_10014904 3300031712 Bacteria 5138
323 Ga0265342_10049510 3300031712 Bacteria 2514
324 Ga0307516_10014001 3300031730 Bacteria 8506
325 Ga0307516_10068943 3300031730 Bacteria 3403
326 Ga0307516_10290305 3300031730 Bacteria 1314
327 Ga0307405_10223239 3300031731 Bacteria 1384
328 Ga0307412_10029996 3300031911 Bacteria 3419
329 Ga0307411_10210904 3300032005 Bacteria 1500
330 Ga0307510_10022874 3300033180 Bacteria 7250
331 Ga0307510_10037361 3300033180 Bacteria 5388
332 Ga0373944_0021553 3300035089 Bacteria 1866
333 Ga0373944_0026026 3300035089 Bacteria 1726
334 Ga0373923_0065718 3300035111 Bacteria 1549
335 Ga0373936_0114188 3300035113 Bacteria 1149
336 Ga0373953_0001704 3300035117 Bacteria 6467
337 Ga0373953_0002691 3300035117 Bacteria 5390
338 Ga0373954_0007407 3300035118 Bacteria 4802
339 Ga0373954_0037173 3300035118 Bacteria 2262
340 Ga0373956_0012937 3300035119 Bacteria 3467
341 Ga0373957_0012302 3300035120 Bacteria 2878
342 Ga0373957_0013220 3300035120 Bacteria 2796
343 Ga0373943_0002235 3300035170 Bacteria 8797
344 Ga0373946_0126793 3300035171 Bacteria 1170
345 Ga0373955_0027684 3300035172 Bacteria 2933
346 Ga0373955_0154980 3300035172 Bacteria 1349
347 Ga0373924_0069573 3300035410 Bacteria 1483
348 Ga0373935_0003730 3300035692 Bacteria 8891
349 Ga0373935_0048374 3300035692 Bacteria 2692
350 Ga0373927_0001492 3300035695 Bacteria 17635
351 Ga0373927_0001793 3300035695 Bacteria 16018
352 Ga0373927_0033848 3300035695 Bacteria 3325
353 Ga0373927_0140989 3300035695 Bacteria 1577
354 Ga0373933_0000267 3300035724 Bacteria 34008
355 Ga0373947_0001861 3300035725 Bacteria 12857
356 Ga0373947_0133714 3300035725 Bacteria 1585
357 Ga0373937_0034261 3300036401 Bacteria 4618
358 Ga0373937_0051137 3300036401 Bacteria 3787
359 Ga0373937_0057297 3300036401 Bacteria 3579
360 Ga0372808_013234 3300036459 Bacteria 1175
361 Ga0373925_0013546 3300037068 Bacteria 5904
362 Ga0373925_0058364 3300037068 Bacteria 2894
363 Ga0373925_0114613 3300037068 Bacteria 2086
364 Ga0395900_0001496 3300037418 Bacteria 27775
365 Ga0395898_0019947 3300037466 Bacteria 6816
366 Ga0395898_0070389 3300037466 Bacteria 3382
367 Ga0395905_0004165 3300037471 Bacteria 15125
368 Ga0395905_0032236 3300037471 Bacteria 4928
369 Ga0395905_0083368 3300037471 Bacteria 2995
370 Ga0395905_0124402 3300037471 Bacteria 2425
371 Ga0395901_0064055 3300038443 Bacteria 3826
372 Ga0395901_0231437 3300038443 Bacteria 1929
373 Ga0436365_0344664 3300039437 Bacteria 1367
374 Ga0436365_0389593 3300039437 Bacteria 1415
375 Ga0436360_0441680 3300039438 Bacteria 2202
376 Ga0436360_0560055 3300039438 Bacteria 1418
377 Ga0436360_0600621 3300039438 Bacteria 4286
378 Ga0436361_0686082 3300039447 Bacteria 8872
379 Ga0436361_1065603 3300039447 Bacteria 2482
380 Ga0436363_0135082 3300039450 Bacteria 2969
381 Ga0436363_0460586 3300039450 Bacteria 3703
382 Ga0436362_1080726 3300039453 Bacteria 1041
383 Ga0466965_0022945 3300044683 Bacteria 3011
384 Ga0466966_0003788 3300044684 Bacteria 9975
385 Ga0466961_0000227 3300044693 Bacteria 38175
386 Ga0466961_0059356 3300044693 Bacteria 2433
387 Ga0466963_0018798 3300044694 Bacteria 4326
388 Ga0466970_0169879 3300044765 Bacteria 1208
389 Ga0466957_0148709 3300044842 Bacteria 1513
390 Ga0466960_0009796 3300044901 Bacteria 3961
391 Ga0466960_0041081 3300044901 Bacteria 2190
392 Ga0466960_0113129 3300044901 Bacteria 1413
393 Ga0466959_0000605 3300045049 Bacteria 20930
394 Ga0466959_0024944 3300045049 Bacteria 4429
395 Ga0466959_0061469 3300045049 Bacteria 2731
396 Ga0466959_0181687 3300045049 Bacteria 1471
397 Ga0466967_0157884 3300045976 Bacteria 2126
398 Ga0495617_013424 3300046452 Bacteria 2788
399 Ga0495592_0002227 3300046454 Bacteria 13684
400 Ga0495592_0041547 3300046454 Bacteria 3446
401 Ga0495592_0060638 3300046454 Bacteria 2782
402 Ga0495603_0000036 3300046455 Bacteria 57443
403 Ga0495603_0008447 3300046455 Bacteria 6220
404 Ga0495603_0015690 3300046455 Bacteria 4583
405 Ga0495629_0000148 3300046459 Bacteria 61440
406 Ga0495629_0000331 3300046459 Bacteria 40528
407 Ga0495629_0049085 3300046459 Bacteria 2959
408 Ga0495629_0242116 3300046459 Bacteria 1242
409 Ga0495638_0022001 3300046460 Bacteria 4191
410 Ga0495638_0032248 3300046460 Bacteria 3360
411 Ga0495638_0033836 3300046460 Bacteria 3265
412 Ga0495641_0008477 3300046461 Bacteria 6258
413 Ga0495641_0121183 3300046461 Bacteria 1167
414 Ga0495651_0015094 3300046462 Bacteria 5970
415 Ga0495651_0016761 3300046462 Bacteria 5675
416 Ga0495651_0032670 3300046462 Bacteria 4058
417 Ga0495653_0000697 3300046463 Bacteria 25621
418 Ga0495653_0033411 3300046463 Bacteria 4076
419 Ga0495653_0080356 3300046463 Bacteria 2412
420 Ga0495653_0228582 3300046463 Bacteria 1246
421 Ga0495580_0000705 3300046472 Bacteria 28569
422 Ga0495582_0002450 3300046473 Bacteria 10340
423 Ga0495639_0000135 3300046475 Bacteria 38122
424 Ga0495639_0004541 3300046475 Bacteria 5951
425 Ga0495639_0055478 3300046475 Bacteria 1807
426 Ga0495662_0000811 3300046476 Bacteria 15187
427 Ga0495664_0015540 3300046477 Bacteria 4328
428 Ga0495584_0137167 3300046491 Bacteria 1242
429 Ga0495585_0049604 3300046492 Bacteria 2330
430 Ga0495594_0001252 3300046499 Bacteria 13306
431 Ga0495594_0016885 3300046499 Bacteria 3851
432 Ga0495607_0035604 3300046501 Bacteria 3009
433 Ga0495606_0001350 3300046507 Bacteria 33317
434 Ga0495608_0038216 3300046511 Bacteria 3224
435 Ga0495608_0130635 3300046511 Bacteria 1607
436 Ga0495608_0139318 3300046511 Bacteria 1549
437 Ga0495608_0183184 3300046511 Bacteria 1324
438 Ga0495610_0039906 3300046512 Bacteria 2370
439 Ga0495616_0132872 3300046513 Bacteria 1139
440 Ga0495618_0081584 3300046514 Bacteria 2065
441 Ga0495618_0149881 3300046514 Bacteria 1490
442 Ga0495618_0184896 3300046514 Bacteria 1323
443 Ga0495620_0013412 3300046515 Bacteria 4195
444 Ga0495628_0028014 3300046516 Bacteria 4582
445 Ga0495628_0032806 3300046516 Bacteria 4189
446 Ga0495628_0037061 3300046516 Bacteria 3910
447 Ga0495628_0211900 3300046516 Bacteria 1457
448 Ga0495631_0070222 3300046518 Bacteria 1514
449 Ga0495643_0037685 3300046522 Bacteria 2650
450 Ga0495643_0121212 3300046522 Bacteria 1321
451 Ga0495648_0000310 3300046524 Bacteria 53884
452 Ga0495648_0004337 3300046524 Bacteria 12150
453 Ga0495648_0130331 3300046524 Bacteria 1338
454 Ga0495666_0118010 3300046526 Bacteria 1243
455 Ga0495652_0025648 3300046529 Bacteria 5210
456 Ga0495652_0033885 3300046529 Bacteria 4454
457 Ga0495652_0076325 3300046529 Bacteria 2780
458 Ga0495652_0103067 3300046529 Bacteria 2310
459 Ga0495652_0174301 3300046529 Bacteria 1657
460 Ga0495665_0000118 3300046531 Bacteria 37731
461 Ga0495640_0032839 3300046533 Bacteria 3693
462 Ga0495640_0045231 3300046533 Bacteria 3056
463 Ga0495640_0058195 3300046533 Bacteria 2636
464 Ga0495587_0021863 3300046536 Bacteria 3945
465 Ga0495587_0028742 3300046536 Bacteria 3379
466 Ga0495609_0026332 3300046538 Bacteria 2663
467 Ga0495597_0028026 3300046542 Bacteria 2580
468 Ga0495645_0018632 3300046543 Bacteria 4988
469 Ga0495645_0162202 3300046543 Bacteria 1545
470 Ga0495622_0002977 3300046557 Bacteria 8052
471 Ga0495667_0000379 3300046559 Bacteria 28161
472 Ga0495667_0092297 3300046559 Bacteria 1960
473 Ga0495667_0281418 3300046559 Bacteria 1056
474 Ga0495656_0021970 3300046615 Bacteria 2492
475 Ga0495634_0000969 3300046642 Bacteria 27075
476 Ga0495634_0015671 3300046642 Bacteria 5438
477 Ga0495634_0018562 3300046642 Bacteria 4949
478 Ga0495634_0044526 3300046642 Bacteria 3003
479 Ga0495625_0053068 3300046660 Bacteria 2901
480 Ga0495625_0283918 3300046660 Bacteria 1064
481 Ga0495635_0000434 3300046663 Bacteria 26421
482 Ga0495635_0025444 3300046663 Bacteria 4122
483 Ga0495635_0059745 3300046663 Bacteria 2621
484 Ga0495635_0059871 3300046663 Bacteria 2619
485 Ga0495661_0016991 3300046665 Bacteria 4808
486 Ga0495588_0063025 3300046674 Bacteria 1922
487 Ga0495588_0073316 3300046674 Bacteria 1782
488 Ga0495657_0005912 3300046675 Bacteria 9612
489 Ga0495657_0007977 3300046675 Bacteria 8117
490 Ga0495657_0022986 3300046675 Bacteria 4460
491 Ga0495599_0002117 3300046678 Bacteria 11526
492 Ga0495599_0062858 3300046678 Bacteria 2319
493 Ga0495599_0129549 3300046678 Bacteria 1567
494 Ga0495623_0022452 3300046679 Bacteria 4076
495 Ga0495623_0064649 3300046679 Bacteria 2289
496 Ga0495646_0014985 3300046680 Bacteria 4925
497 Ga0495646_0021600 3300046680 Bacteria 4066
498 Ga0495646_0027263 3300046680 Bacteria 3584
499 Ga0495646_0141558 3300046680 Bacteria 1344
500 Ga0495647_0000360 3300046681 Bacteria 12869
501 Ga0495658_0009177 3300046683 Bacteria 4918
502 Ga0495658_0020094 3300046683 Bacteria 3498
503 Ga0495658_0109479 3300046683 Bacteria 1659
504 Ga0495613_0030595 3300046689 Bacteria 3999
505 Ga0495613_0031204 3300046689 Bacteria 3957
506 Ga0495624_0000445 3300046690 Bacteria 32525
507 Ga0495624_0105050 3300046690 Bacteria 1738
508 Ga0495670_0041658 3300046691 Bacteria 2291
509 Ga0495671_0156236 3300046692 Bacteria 1110
510 Ga0495600_0003883 3300046809 Bacteria 8870
511 Ga0495600_0015470 3300046809 Bacteria 4822
512 Ga0495600_0227209 3300046809 Bacteria 1192
513 Ga0495581_0001178 3300047315 Bacteria 14344
514 Ga0495581_0039724 3300047315 Bacteria 2724
515 Ga0495581_0164853 3300047315 Bacteria 1296
516 Ga0495604_0012567 3300047317 Bacteria 6733
517 Ga0495604_0043465 3300047317 Bacteria 3517
518 Ga0495604_0100106 3300047317 Bacteria 2131
519 Ga0495604_0175565 3300047317 Bacteria 1503
520 Ga0495674_0000443 3300047319 Bacteria 37259
521 Ga0495674_0010317 3300047319 Bacteria 8845
522 Ga0495674_0036232 3300047319 Bacteria 4443
523 Ga0495674_0038574 3300047319 Bacteria 4287
524 Ga0495674_0106388 3300047319 Bacteria 2383
525 Ga0495674_0171479 3300047319 Bacteria 1810
526 Ga0495672_0005199 3300047320 Bacteria 10374
527 Ga0495672_0006462 3300047320 Bacteria 9068
528 Ga0495672_0081743 3300047320 Bacteria 1798
529 Ga0495676_0066520 3300047321 Bacteria 2792
530 Ga0495676_0144347 3300047321 Bacteria 1702
531 Ga0495680_0001308 3300047322 Bacteria 27152
532 Ga0495680_0042578 3300047322 Bacteria 3601
533 Ga0495680_0076152 3300047322 Bacteria 2544
534 Ga0495683_0074363 3300047323 Bacteria 1665
535 Ga0495687_046825 3300047443 Bacteria 1864
536 Ga0495675_0068237 3300047444 Bacteria 2246
537 Ga0495685_063973 3300047447 Bacteria 1238
538 Ga0495673_0013330 3300047469 Bacteria 4323
539 Ga0495684_0002730 3300047471 Bacteria 13961
540 Ga0495684_0054251 3300047471 Bacteria 3057
541 Ga0495684_0105859 3300047471 Bacteria 2125
542 Ga0495684_0127653 3300047471 Bacteria 1912
543 Ga0495686_0126470 3300047472 Bacteria 1519
544 Ga0495593_0000495 3300047673 Bacteria 22212
545 Ga0495593_0001203 3300047673 Bacteria 15131
546 Ga0495593_0022477 3300047673 Bacteria 3513
547 Ga0495593_0124049 3300047673 Bacteria 1313
548 Ga0495602_0028623 3300048088 Bacteria 5327
549 Ga0495602_0049654 3300048088 Bacteria 3755
550 Ga0495602_0055132 3300048088 Bacteria 3502
551 Ga0495602_0146601 3300048088 Bacteria 1861
552 Ga0496100_0011667 3300048903 Bacteria 5008
553 Ga0496101_0003579 3300048904 Bacteria 9698
554 Ga0496101_0052485 3300048904 Bacteria 2940
555 Ga0496101_0146965 3300048904 Bacteria 1801
556 Ga0496101_0183960 3300048904 Bacteria 1610
557 Ga0496102_0007923 3300048905 Bacteria 9080
558 Ga0496102_0139950 3300048905 Bacteria 2269
559 Ga0496103_0121183 3300048906 Bacteria 1666
560 Ga0496103_0161673 3300048906 Bacteria 1436
561 Ga0496104_0069177 3300048907 Bacteria 3355
562 Ga0496104_0168040 3300048907 Bacteria 2103
563 Ga0496104_0237482 3300048907 Bacteria 1734
564 Ga0496105_0016857 3300048908 Bacteria 5843
565 Ga0496105_0026827 3300048908 Bacteria 4701
566 Ga0496105_0258754 3300048908 Bacteria 1408
567 Ga0496105_0322725 3300048908 Bacteria 1237
568 Ga0496106_0043115 3300048909 Bacteria 3385
569 Ga0496106_0104052 3300048909 Bacteria 2204
570 Ga0496107_0033299 3300048910 Bacteria 3686
571 Ga0496107_0066411 3300048910 Bacteria 2615
572 Ga0496107_0096532 3300048910 Bacteria 2163
573 Ga0496107_0140661 3300048910 Bacteria 1784
574 Ga0496107_0230720 3300048910 Bacteria 1377
575 Ga0496108_0074802 3300048911 Bacteria 2861
576 Ga0496109_0017997 3300048912 Bacteria 6203
577 Ga0496109_0116893 3300048912 Bacteria 2482
578 Ga0496110_0067181 3300048913 Bacteria 3172
579 Ga0496112_0000029 3300048915 Bacteria 122291
580 Ga0496112_0042235 3300048915 Bacteria 4460
581 Ga0496112_0074363 3300048915 Bacteria 3359
582 Ga0496112_0173866 3300048915 Bacteria 2119
583 Ga0496112_0197092 3300048915 Bacteria 1974
584 Ga0496112_0218968 3300048915 Bacteria 1860
585 Ga0496112_0396022 3300048915 Bacteria 1321
586 Ga0496113_0061050 3300048916 Bacteria 2843
587 Ga0496113_0182878 3300048916 Bacteria 1662
588 Ga0496113_0207468 3300048916 Bacteria 1559
589 Ga0496114_0011325 3300048917 Bacteria 7124
590 Ga0496114_0056814 3300048917 Bacteria 3266
591 Ga0496115_0000295 3300048918 Bacteria 42998
592 Ga0496115_0018198 3300048918 Bacteria 5389
593 Ga0496115_0076474 3300048918 Bacteria 2721
594 Ga0496115_0079903 3300048918 Bacteria 2662
595 Ga0496115_0142236 3300048918 Bacteria 1979
596 Ga0496116_0002462 3300048919 Bacteria 19411
597 Ga0496116_0040127 3300048919 Bacteria 3227
598 Ga0496117_0086744 3300048920 Bacteria 2032
599 Ga0496117_0153103 3300048920 Bacteria 1362
600 Ga0496118_0015057 3300048921 Bacteria 7190
601 Ga0496118_0037848 3300048921 Bacteria 3875
602 Ga0496118_0093022 3300048921 Bacteria 2067
603 Ga0496118_0100783 3300048921 Bacteria 1952
604 Ga0496118_0101437 3300048921 Bacteria 1943
605 Ga0496118_0128456 3300048921 Bacteria 1633
606 Ga0496119_0007315 3300048922 Bacteria 9989
607 Ga0496120_0002476 3300048923 Bacteria 18594
608 Ga0496120_0018821 3300048923 Bacteria 4437
609 Ga0496120_0126979 3300048923 Bacteria 1311
610 Ga0496121_0001687 3300048924 Bacteria 36333
611 Ga0496121_0022584 3300048924 Bacteria 6095
612 Ga0496121_0024664 3300048924 Bacteria 5741
613 Ga0496121_0036588 3300048924 Bacteria 4372
614 Ga0496121_0041193 3300048924 Bacteria 4041
615 Ga0496121_0050936 3300048924 Bacteria 3492
616 Ga0496121_0055607 3300048924 Bacteria 3295
617 Ga0496121_0063679 3300048924 Bacteria 3011
618 Ga0496121_0155941 3300048924 Bacteria 1675
619 Ga0496121_0158418 3300048924 Bacteria 1658
620 Ga0496121_0292411 3300048924 Bacteria 1109
621 Ga0496124_0134256 3300048927 Bacteria 1962
622 Ga0496124_0165185 3300048927 Bacteria 1721
623 Ga0496124_0212595 3300048927 Bacteria 1462
624 Ga0496125_0000154 3300048928 Bacteria 152240
625 Ga0496125_0004393 3300048928 Bacteria 16325
626 Ga0496125_0056873 3300048928 Bacteria 3173
627 Ga0496125_0074537 3300048928 Bacteria 2631
628 Ga0496126_0005939 3300048929 Bacteria 13755
629 Ga0496126_0007864 3300048929 Bacteria 11610
630 Ga0496126_0007926 3300048929 Bacteria 11546
631 Ga0496126_0010008 3300048929 Bacteria 10006
632 Ga0496126_0032301 3300048929 Bacteria 4932
633 Ga0496126_0035603 3300048929 Bacteria 4664
634 Ga0496126_0038680 3300048929 Bacteria 4435
635 Ga0496126_0082697 3300048929 Bacteria 2836
636 Ga0496126_0093307 3300048929 Bacteria 2643
637 Ga0496126_0258306 3300048929 Bacteria 1449
638 Ga0496126_0285803 3300048929 Bacteria 1365
639 Ga0496126_0290432 3300048929 Bacteria 1352
640 Ga0496126_0292181 3300048929 Bacteria 1347
641 Ga0495682_0051142 3300049460 Bacteria 1503
642 Ga0501031_0003990 3300049568 Bacteria 9517
643 Ga0501032_0000073 3300049569 Bacteria 85584
644 Ga0501033_0000136 3300049570 Bacteria 70952
645 Ga0501034_0000251 3300049571 Bacteria 99406
646 Ga0501034_0116531 3300049571 Bacteria 2659
647 Ga0501036_0000036 3300049572 Bacteria 87244
648 Ga0501036_0202301 3300049572 Bacteria 1670
649 Ga0501037_0000040 3300049573 Bacteria 119364
650 Ga0501038_0000150 3300049574 Bacteria 59508
651 Ga0501038_0368549 3300049574 Bacteria 1116
652 Ga0501039_0003418 3300049575 Bacteria 11852
653 Ga0501040_0300295 3300049576 Bacteria 1148
654 Ga0501042_0008136 3300049578 Bacteria 6907
655 Ga0501043_0000464 3300049579 Bacteria 36232
656 Ga0501043_0191031 3300049579 Bacteria 1592
657 Ga0501046_0000398 3300049580 Bacteria 43497
658 Ga0501046_0223674 3300049580 Bacteria 1392
659 Ga0501047_0000656 3300049581 Bacteria 36126
660 Ga0501047_0294580 3300049581 Bacteria 1466
661 Ga0501048_0000906 3300049582 Bacteria 21866
662 Ga0501067_0000192 3300049583 Bacteria 34520
663 Ga0501067_0035211 3300049583 Bacteria 2780
664 Ga0501068_0002765 3300049584 Bacteria 9319
665 Ga0501069_0014897 3300049585 Bacteria 4163
666 Ga0501070_0037271 3300049586 Bacteria 4060
667 Ga0501070_0076207 3300049586 Bacteria 2776
668 Ga0501070_0179220 3300049586 Bacteria 1744
669 Ga0501070_0203936 3300049586 Bacteria 1624
670 Ga0501071_0053825 3300049587 Bacteria 2903
671 Ga0501072_0002128 3300049588 Bacteria 14764
672 Ga0501073_0000037 3300049589 Bacteria 87345
673 Ga0501074_0000133 3300049590 Bacteria 38342
674 Ga0501079_0024353 3300049741 Bacteria 4643
675 Ga0501080_0000054 3300049742 Bacteria 74316
676 Ga0501080_0005201 3300049742 Bacteria 11597
677 Ga0501083_0001153 3300049744 Bacteria 17779
678 Ga0501035_0000142 3300049822 Bacteria 87561
679 Ga0501035_0278135 3300049822 Bacteria 1415
680 Ga0501044_0000985 3300049823 Bacteria 34233
681 Ga0501044_0102936 3300049823 Bacteria 2870
682 Ga0501045_0019721 3300049824 Bacteria 4811
683 nmdc:mga03683_17647_c1 3300050489 Bacteria 2704
684 nmdc:mga00v17_20486_c1 3300050491 Bacteria 3789
685 nmdc:mga00v17_215349_c1 3300050491 Bacteria 1243
686 nmdc:mga0yw44_91521_c1 3300050492 Bacteria 1923
687 nmdc:mga0yw44_942_c1 3300050492 Bacteria 11041
688 nmdc:mga06z11_14027_c1 3300050494 Bacteria 3536
689 nmdc:mga06z11_30068_c1 3300050494 Bacteria 2625
690 nmdc:mga07m45_69423_c1 3300050496 Bacteria 1110
691 nmdc:mga07m45_6998_c1 3300050496 Bacteria 5738
692 nmdc:mga0n895_115792_c1 3300050512 Bacteria 2699
693 nmdc:mga0n895_30146_c1 3300050512 Bacteria 5181
694 nmdc:mga0sz30_9846_c1 3300050516 Bacteria 3646
695 Ga0495601_0013434 3300053077 Bacteria 4926
696 Ga0495601_0083775 3300053077 Bacteria 2048
697 Ga0495612_0062530 3300053078 Bacteria 1543
698 Ga0500610_0097521 3300053079 Bacteria 1524
699 Ga0500635_0044597 3300053080 Bacteria 1497
700 Ga0495595_0000758 3300053084 Bacteria 12258
701 Ga0495619_0000617 3300053085 Bacteria 23526
702 Ga0495619_0217529 3300053085 Bacteria 1323
703 Ga0500643_000168 3300053087 Bacteria 64858
704 Ga0500581_052116 3300053089 Bacteria 2085
705 Ga0500646_0035013 3300053090 Bacteria 1394
706 Ga0500583_0012288 3300053092 Bacteria 3260
707 Ga0500651_0026339 3300053093 Bacteria 3654
708 Ga0500651_0098104 3300053093 Bacteria 1799
709 Ga0500651_0127566 3300053093 Bacteria 1540
710 Ga0500566_0000822 3300053094 Bacteria 17706
711 Ga0500566_0003799 3300053094 Bacteria 9002
712 Ga0500566_0015378 3300053094 Bacteria 4489
713 Ga0500641_0016085 3300053096 Bacteria 2783
714 Ga0500641_0039404 3300053096 Bacteria 1903
715 Ga0500650_0006577 3300053098 Bacteria 4451
716 Ga0500555_003167 3300053103 Bacteria 4691
717 Ga0500556_0000047 3300053104 Bacteria 126199
718 Ga0500595_003841 3300053119 Bacteria 6904
719 Ga0500595_015941 3300053119 Bacteria 2808
720 Ga0500595_023858 3300053119 Bacteria 2143
721 Ga0500608_015167 3300053122 Bacteria 3456
722 Ga0500618_011635 3300053125 Bacteria 2328
723 Ga0500642_0000142 3300053130 Bacteria 32016
724 Ga0500642_0000183 3300053130 Bacteria 25867
725 Ga0500642_0030123 3300053130 Bacteria 2255
726 Ga0500652_001628 3300053131 Bacteria 6828
727 Ga0500559_0000105 3300053136 Bacteria 65809
728 Ga0500559_0001644 3300053136 Bacteria 12374
729 Ga0500559_0004871 3300053136 Bacteria 6261
730 Ga0500568_0010399 3300053139 Bacteria 4359
731 Ga0500568_0030179 3300053139 Bacteria 2245
732 Ga0500568_0031881 3300053139 Bacteria 2170
733 Ga0500577_0000991 3300053142 Bacteria 7308
734 Ga0500603_000576 3300053150 Bacteria 9221
735 Ga0500603_051801 3300053150 Bacteria 1126
736 Ga0500604_0002170 3300053151 Bacteria 5398
737 Ga0500604_0008009 3300053151 Bacteria 2803
738 Ga0500616_0000038 3300053153 Bacteria 386801
739 Ga0500616_0000784 3300053153 Bacteria 36530
740 Ga0500619_025645 3300053154 Bacteria 1748
741 Ga0500622_0002394 3300053156 Bacteria 13562
742 Ga0500622_0008137 3300053156 Bacteria 5893
743 Ga0500627_0022514 3300053158 Bacteria 2557
744 Ga0500627_0098195 3300053158 Bacteria 1313
745 Ga0500638_000230 3300053162 Bacteria 11941
746 Ga0500636_0000592 3300053177 Bacteria 19795
747 Ga0500636_0003094 3300053177 Bacteria 9326
748 Ga0500636_0009727 3300053177 Bacteria 5600
749 Ga0500636_0054374 3300053177 Bacteria 2347
750 Ga0500636_0082718 3300053177 Bacteria 1847
751 Ga0500636_0104233 3300053177 Bacteria 1609
752 Ga0500637_0001711 3300053178 Bacteria 9461
753 Ga0500637_0003917 3300053178 Bacteria 6950
754 Ga0500625_000232 3300053729 Bacteria 12898
755 Ga0500645_007739 3300053730 Bacteria 3717
756 Ga0500645_024708 3300053730 Bacteria 1836
757 Ga0500609_009508 3300053731 Bacteria 1310
758 Ga0500596_003778 3300053735 Bacteria 2840
759 Ga0500596_003966 3300053735 Bacteria 2756
760 Ga0500599_000651 3300053736 Bacteria 3722
761 Ga0500601_000888 3300053737 Bacteria 3585
762 Ga0501084_0008150 3300054114 Bacteria 8638
763 Ga0500661_000294 3300055283 Bacteria 9104
764 Ga0501082_0005663 3300060353 Bacteria 10842
765 Ga0530510_0214055 3300061734 Bacteria 1432

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0000038 Ga0500616_0000038_313834_314853 304
2 3300048929 Ga0496126_0038680 Ga0496126_0038680_1832_2851 306
3 3300044765 Ga0466970_0169879 Ga0466970_0169879_157_1104 308
4 3300025295 Ga0209564_1000477 Ga0209564_10004773 310
5 3300031249 Ga0265339_10026845 Ga0265339_100268452 311
6 3300031711 Ga0265314_10063614 Ga0265314_100636142 311
7 3300048929 Ga0496126_0035603 Ga0496126_0035603_1951_2970 311
8 3300053730 Ga0500645_024708 Ga0500645_024708_190_1209 312
9 3300005436 Ga0070713_100162662 Ga0070713_1001626621 314
10 3300025928 Ga0207700_10053147 Ga0207700_100531471 314
11 3300025929 Ga0207664_10120275 Ga0207664_101202752 314
12 3300035120 Ga0373957_0013220 Ga0373957_0013220_159_1178 314
13 3300025297 Ga0209758_1004564 Ga0209758_100456412 315
14 3300039447 Ga0436361_0686082 Ga0436361_0686082_6841_7857 315
15 3300047320 Ga0495672_0081743 Ga0495672_0081743_402_1421 315
16 3300006175 Ga0070712_100152298 Ga0070712_1001522981 317
17 3300048921 Ga0496118_0101437 Ga0496118_0101437_221_1240 317
18 3300048929 Ga0496126_0093307 Ga0496126_0093307_148_1167 317
19 3300053150 Ga0500603_051801 Ga0500603_051801_29_1045 317
20 3300053177 Ga0500636_0009727 Ga0500636_0009727_1749_2765 317
21 3300053177 Ga0500636_0054374 Ga0500636_0054374_262_1278 317
22 3300047320 Ga0495672_0005199 Ga0495672_0005199_6756_7775 320
23 3300046462 Ga0495651_0032670 Ga0495651_0032670_1763_2782 321
24 iso_pu_bacteria 8019547302 8019551008 321
25 3300048909 Ga0496106_0043115 Ga0496106_0043115_2366_3337 323
26 3300003752 Ga0055539_1002997 Ga0055539_10029972 324
27 3300025272 Ga0209455_1023034 Ga0209455_10230341 324
28 3300048921 Ga0496118_0015057 Ga0496118_0015057_2970_3983 324
29 3300048924 Ga0496121_0024664 Ga0496121_0024664_2320_3333 324
30 3300031507 Ga0307509_10106470 Ga0307509_101064703 325
31 3300048928 Ga0496125_0074537 Ga0496125_0074537_31_1044 325
32 3300039453 Ga0436362_1080726 Ga0436362_1080726_12_1028 326
33 3300046559 Ga0495667_0281418 Ga0495667_0281418_12_1001 327
34 3300053177 Ga0500636_0082718 Ga0500636_0082718_787_1806 327
35 3300053735 Ga0500596_003778 Ga0500596_003778_173_1192 327
36 3300037471 Ga0395905_0083368 Ga0395905_0083368_1423_2442 328
37 3300048924 Ga0496121_0292411 Ga0496121_0292411_47_1066 328
38 3300005436 Ga0070713_100129624 Ga0070713_1001296242 331
39 3300005843 Ga0068860_100000837 Ga0068860_10000083723 331
40 3300025898 Ga0207692_10000138 Ga0207692_1000013813 331
41 3300025906 Ga0207699_10000122 Ga0207699_1000012214 331
42 3300025915 Ga0207693_10009351 Ga0207693_100093513 331
43 3300025916 Ga0207663_10000623 Ga0207663_1000062311 331
44 3300028381 Ga0268264_10000537 Ga0268264_1000053715 331
45 3300053119 Ga0500595_015941 Ga0500595_015941_884_1903 331
46 3300053139 Ga0500568_0031881 Ga0500568_0031881_1123_2142 331
47 iso_pu_bacteria 2507262055 2507505934 331
48 iso_pu_bacteria 2508501009 2508540123 331
49 iso_pu_bacteria 2511231028 2511396578 331
50 iso_pu_bacteria 2513237092 2513627430 331
51 iso_pu_bacteria 2515154112 2515628524 331
52 iso_pu_bacteria 2528768022 2528850701 331
53 iso_pu_bacteria 2617270741 2617374738 331
54 iso_pu_bacteria 2824661429 2824667356 331
55 iso_pu_bacteria 2824732956 2824737037 331
56 iso_pu_bacteria 2824746037 2824750817 331
57 iso_pu_bacteria 2841957949 2841963963 331
58 iso_pu_bacteria 2842038055 2842044401 331
59 iso_pu_bacteria 2842045827 2842051610 331
60 iso_pu_bacteria 2857509624 2857513353 331
61 iso_pu_bacteria 2874590934 2874596330 331
62 iso_pu_bacteria 2874612657 2874616469 331
63 iso_pu_bacteria 2874645413 2874650317 331
64 iso_pu_bacteria 2876761206 2876761654 331
65 iso_pu_bacteria 2876771140 2876776795 331
66 iso_pu_bacteria 2876818435 2876824585 331
67 iso_pu_bacteria 2879074833 2879080932 331
68 iso_pu_bacteria 2879099564 2879104427 331
69 iso_pu_bacteria 2879127579 2879133777 331
70 iso_pu_bacteria 2879142872 2879148279 331
71 iso_pu_bacteria 2888388044 2888389921 331
72 iso_pu_bacteria 2908775508 2908777220 331
73 iso_pu_bacteria 2922368715 2922377409 331
74 iso_pu_bacteria 2929615660 2929622197 331
75 iso_pu_bacteria 2929624759 2929630156 331
76 iso_pu_bacteria 2932784394 2932787915 331
77 iso_pu_bacteria 2932809354 2932817641 331
78 iso_pu_bacteria 2932818245 2932826199 331
79 iso_pu_bacteria 2932828146 2932835057 331
80 iso_pu_bacteria 2933577622 2933584188 331
81 iso_pu_bacteria 2935608549 2935614359 331
82 iso_pu_bacteria 2935616580 2935620434 331
83 iso_pu_bacteria 2935638405 2935640757 331
84 iso_pu_bacteria 2935648319 2935649388 331
85 iso_pu_bacteria 2935656913 2935657840 331
86 iso_pu_bacteria 2935665750 2935670260 331
87 iso_pu_bacteria 2935675223 2935679689 331
88 iso_pu_bacteria 2935684952 2935687258 331
89 iso_pu_bacteria 2935694250 2935696771 331
90 iso_pu_bacteria 2935703347 2935709137 331
91 iso_pu_bacteria 2935713505 2935718717 331
92 iso_pu_bacteria 2935722832 2935728369 331
93 iso_pu_bacteria 2935732158 2935737034 331
94 iso_pu_bacteria 2935741537 2935745963 331
95 iso_pu_bacteria 2935750917 2935753224 331
96 iso_pu_bacteria 2935760218 2935766384 331
97 iso_pu_bacteria 2935769743 2935770223 331
98 iso_pu_bacteria 2935777560 2935777748 331
99 iso_pu_bacteria 2935785616 2935786724 331
100 iso_pu_bacteria 2935793552 2935794778 331
101 iso_pu_bacteria 2935801545 2935809064 331
102 iso_pu_bacteria 2935810662 2935813755 331
103 iso_pu_bacteria 2935819856 2935826577 331
104 iso_pu_bacteria 2935827899 2935832264 331
105 iso_pu_bacteria 2935837841 2935843969 331
106 iso_pu_bacteria 2935847175 2935851129 331
107 iso_pu_bacteria 2935855204 2935862760 331
108 iso_pu_bacteria 2935864058 2935864503 331
109 iso_pu_bacteria 2935873716 2935875145 331
110 iso_pu_bacteria 2935908558 2935913179 331
111 iso_pu_bacteria 2935916978 2935922601 331
112 iso_pu_bacteria 2935926038 2935930896 331
113 iso_pu_bacteria 2935934488 2935939770 331
114 iso_pu_bacteria 2935942939 2935946719 331
115 iso_pu_bacteria 2935951376 2935956080 331
116 iso_pu_bacteria 2935959822 2935964984 331
117 iso_pu_bacteria 2935967501 2935972873 331
118 iso_pu_bacteria 2935975950 2935978212 331
119 iso_pu_bacteria 2935984226 2935985664 331
120 iso_pu_bacteria 2935992306 2935999236 331
121 iso_pu_bacteria 2936002035 2936005791 331
122 iso_pu_bacteria 2936011229 2936012059 331
123 iso_pu_bacteria 2936019824 2936020860 331
124 iso_pu_bacteria 2936028420 2936029352 331
125 iso_pu_bacteria 2936037263 2936039311 331
126 iso_pu_bacteria 2936046547 2936048324 331
127 iso_pu_bacteria 2940556831 2940559137 331
128 iso_pu_bacteria 2941538514 2941541832 331
129 iso_pu_bacteria 3005483717 3005491082 331
130 iso_pu_bacteria 3005587118 3005592162 331
131 iso_pu_bacteria 3005594810 3005595877 331
132 iso_pu_bacteria 8016511872 8016517250 331
133 iso_pu_bacteria 8016522445 8016526987 331
134 iso_pu_bacteria 8016530956 8016532066 331
135 iso_pu_bacteria 8016539877 8016545277 331
136 iso_pu_bacteria 8016548790 8016556811 331
137 iso_pu_bacteria 8016566248 8016570356 331
138 iso_pu_bacteria 8016575299 8016582902 331
139 iso_pu_bacteria 8016595262 8016602810 331
140 iso_pu_bacteria 8016603502 8016605674 331
141 iso_pu_bacteria 8016613128 8016617585 331
142 iso_pu_bacteria 8016622563 8016623986 331
143 iso_pu_bacteria 8016630954 8016634874 331
144 iso_pu_bacteria 8017057580 8017059343 331
145 iso_pu_bacteria 8019538911 8019539645 331
146 iso_pu_bacteria 8019576017 8019576282 331
147 iso_pu_bacteria 8019586578 8019594156 331
148 iso_pu_bacteria 8019597564 8019607407 331
149 iso_pu_bacteria 8019608314 8019611105 331
150 iso_pu_bacteria 8019629233 8019631370 331
151 iso_pu_bacteria 8019638758 8019639246 331
152 iso_pu_bacteria 8019659431 8019668175 331
153 iso_pu_bacteria 8019668869 8019677637 331
154 iso_pu_bacteria 8019678201 8019687308 331
155 iso_pu_bacteria 8055742211 8055743553 331
156 3300005339 Ga0070660_100280343 Ga0070660_1002803431 332
157 3300005563 Ga0068855_100080478 Ga0068855_1000804781 332
158 3300005563 Ga0068855_100117639 Ga0068855_1001176393 332
159 3300005616 Ga0068852_100006606 Ga0068852_1000066062 332
160 3300013104 Ga0157370_10532625 Ga0157370_105326251 332
161 3300013105 Ga0157369_10151451 Ga0157369_101514512 332
162 3300025917 Ga0207660_10227703 Ga0207660_102277032 332
163 3300025919 Ga0207657_10242711 Ga0207657_102427111 332
164 3300025924 Ga0207694_10038204 Ga0207694_100382042 332
165 3300025949 Ga0207667_10072942 Ga0207667_100729422 332
166 3300026078 Ga0207702_10063018 Ga0207702_100630182 332
167 3300026142 Ga0207698_10057730 Ga0207698_100577303 332
168 3300028800 Ga0265338_10063970 Ga0265338_100639701 332
169 3300031712 Ga0265342_10014904 Ga0265342_100149044 332
170 3300031730 Ga0307516_10014001 Ga0307516_100140014 332
171 3300031730 Ga0307516_10290305 Ga0307516_102903051 332
172 3300048927 Ga0496124_0212595 Ga0496124_0212595_223_1221 332
173 3300048929 Ga0496126_0032301 Ga0496126_0032301_131_1150 332
174 iso_pu_bacteria 2513237094 2513638320 332
175 iso_pu_bacteria 2513237095 2513649162 332
176 iso_pu_bacteria 2513237102 2513700225 332
177 iso_pu_bacteria 2513237139 2513877237 332
178 iso_pu_bacteria 2513237161 2514014607 332
179 iso_pu_bacteria 2517093001 2517103119 332
180 iso_pu_bacteria 2524023205 2524442995 332
181 iso_pu_bacteria 2617270735 2617347816 332
182 iso_pu_bacteria 2744054633 2745081916 332
183 iso_pu_bacteria 2802429603 2805916163 332
184 iso_pu_bacteria 2816332527 2818240553 332
185 iso_pu_bacteria 2824600985 2824603628 332
186 iso_pu_bacteria 2824609381 2824610786 332
187 iso_pu_bacteria 2824617872 2824623208 332
188 iso_pu_bacteria 2824626560 2824632194 332
189 iso_pu_bacteria 2824635225 2824640813 332
190 iso_pu_bacteria 2824644064 2824647965 332
191 iso_pu_bacteria 2824653114 2824655232 332
192 iso_pu_bacteria 2824671348 2824675049 332
193 iso_pu_bacteria 2824687955 2824691784 332
194 iso_pu_bacteria 2824696289 2824701063 332
195 iso_pu_bacteria 2824704595 2824709281 332
196 iso_pu_bacteria 2824714736 2824717978 332
197 iso_pu_bacteria 2824723954 2824728194 332
198 iso_pu_bacteria 2824753945 2824762003 332
199 iso_pu_bacteria 2824763712 2824772370 332
200 iso_pu_bacteria 2824773399 2824775702 332
201 iso_pu_bacteria 2838122688 2838125077 332
202 iso_pu_bacteria 2841941048 2841945815 332
203 iso_pu_bacteria 2841949485 2841956914 332
204 iso_pu_bacteria 2841966195 2841973525 332
205 iso_pu_bacteria 2841974524 2841981996 332
206 iso_pu_bacteria 2841983080 2841989413 332
207 iso_pu_bacteria 2844315083 2844316264 332
208 iso_pu_bacteria 2847930680 2847939424 332
209 iso_pu_bacteria 2847939898 2847941185 332
210 iso_pu_bacteria 2849076700 2849082171 332
211 iso_pu_bacteria 2874628541 2874633394 332
212 iso_pu_bacteria 2879083081 2879087096 332
213 iso_pu_bacteria 2881364244 2881369588 332
214 iso_pu_bacteria 2881665667 2881669694 332
215 iso_pu_bacteria 2885409591 2885418886 332
216 iso_pu_bacteria 2888378607 2888387230 332
217 iso_pu_bacteria 2888419890 2888421180 332
218 iso_pu_bacteria 2903727486 2903728400 332
219 iso_pu_bacteria 2904711408 2904719805 332
220 iso_pu_bacteria 2906602504 2906606541 332
221 iso_pu_bacteria 2906626472 2906631421 332
222 iso_pu_bacteria 2906643746 2906650657 332
223 iso_pu_bacteria 2932794094 2932796038 332
224 iso_pu_bacteria 2932801729 2932807615 332
225 iso_pu_bacteria 2935883170 2935887307 332
226 iso_pu_bacteria 2941531003 2941534578 332
227 iso_pu_bacteria 3005710791 3005711819 332
228 iso_pu_bacteria 3005718088 3005719073 332
229 iso_pu_bacteria 8006926726 8006930187 332
230 iso_pu_bacteria 8016583857 8016585395 332
231 iso_pu_bacteria 8056967851 8056974152 332
232 3300025913 Ga0207695_10402539 Ga0207695_104025392 333
233 iso_pu_bacteria 2508501128 2509148121 333
234 iso_pu_bacteria 2513237096 2513657473 333
235 iso_pu_bacteria 2513237098 2513674951 333
236 iso_pu_bacteria 2513237101 2513696278 333
237 iso_pu_bacteria 2513237137 2513861199 333
238 iso_pu_bacteria 2513237141 2513891600 333
239 iso_pu_bacteria 2513237145 2513916726 333
240 iso_pu_bacteria 2517572143 2517889633 333
241 iso_pu_bacteria 2524023210 2524465267 333
242 iso_pu_bacteria 2524023228 2524533197 333
243 iso_pu_bacteria 2602042107 2603857125 333
244 iso_pu_bacteria 2643221651 2644290486 333
245 iso_pu_bacteria 2667528175 2671119485 333
246 iso_pu_bacteria 2721755755 2723842287 333
247 iso_pu_bacteria 2791355196 2793061530 333
248 iso_pu_bacteria 2791355197 2793070386 333
249 iso_pu_bacteria 2791355199 2793080141 333
250 iso_pu_bacteria 2824679649 2824684446 333
251 iso_pu_bacteria 2857524615 2857530870 333
252 iso_pu_bacteria 2874604998 2874610124 333
253 iso_pu_bacteria 2874620515 2874622488 333
254 iso_pu_bacteria 2879110137 2879116991 333
255 iso_pu_bacteria 2885366525 2885367766 333
256 iso_pu_bacteria 2885374607 2885380886 333
257 iso_pu_bacteria 2889033259 2889036410 333
258 iso_pu_bacteria 2893066018 2893066373 333
259 iso_pu_bacteria 2903748898 2903756086 333
260 iso_pu_bacteria 2903768456 2903774682 333
261 iso_pu_bacteria 2904666416 2904671505 333
262 iso_pu_bacteria 2904690495 2904692069 333
263 iso_pu_bacteria 2904699407 2904707611 333
264 iso_pu_bacteria 2906610324 2906614611 333
265 iso_pu_bacteria 2906635258 2906641980 333
266 iso_pu_bacteria 2906660503 2906660934 333
267 iso_pu_bacteria 2908739725 2908746567 333
268 iso_pu_bacteria 2908756301 2908757349 333
269 iso_pu_bacteria 2922361189 2922366714 333
270 iso_pu_bacteria 2922386360 2922389382 333
271 iso_pu_bacteria 2922393267 2922398498 333
272 iso_pu_bacteria 2922425934 2922426472 333
273 iso_pu_bacteria 2935630451 2935632813 333
274 iso_pu_bacteria 2941507105 2941508523 333
275 iso_pu_bacteria 2941515067 2941516353 333
276 iso_pu_bacteria 2941523033 2941524631 333
277 iso_pu_bacteria 3005474847 3005475814 333
278 iso_pu_bacteria 3005506211 3005510923 333
279 iso_pu_bacteria 8006964411 8006966308 333
280 iso_pu_bacteria 8006984368 8006993122 333
281 iso_pu_bacteria 8006994254 8006996975 333
282 iso_pu_bacteria 8019648815 8019651393 333
283 iso_pu_bacteria 8056673599 8056678162 333
284 iso_pu_bacteria 8056681323 8056683411 333
285 3300025933 Ga0207706_10065562 Ga0207706_100655624 334
286 3300003215 JGI25153J46596_10008046 JGI25153J46596_100080462 335
287 3300003354 JGI25160J50197_1005561 JGI25160J50197_10055612 335
288 3300005262 Ga0065165_1007672 Ga0065165_10076722 335
289 3300005355 Ga0070671_100044664 Ga0070671_1000446641 335
290 3300005455 Ga0070663_100169745 Ga0070663_1001697451 335
291 3300005563 Ga0068855_100218105 Ga0068855_1002181052 335
292 3300005614 Ga0068856_100118565 Ga0068856_1001185652 335
293 3300005616 Ga0068852_100010212 Ga0068852_1000102123 335
294 3300005844 Ga0068862_100137583 Ga0068862_1001375832 335
295 3300006048 Ga0075363_100125154 Ga0075363_1001251542 335
296 3300006178 Ga0075367_10061551 Ga0075367_100615511 335
297 3300009093 Ga0105240_10012243 Ga0105240_100122435 335
298 3300009174 Ga0105241_10043926 Ga0105241_100439263 335
299 3300009174 Ga0105241_10070526 Ga0105241_100705262 335
300 3300013308 Ga0157375_10190888 Ga0157375_101908882 335
301 3300014325 Ga0163163_10150156 Ga0163163_101501562 335
302 3300014325 Ga0163163_10268407 Ga0163163_102684071 335
303 3300021320 Ga0214544_1000011 Ga0214544_1000011120 335
304 3300021321 Ga0214542_1000009 Ga0214542_1000009122 335
305 3300021324 Ga0214545_1000007 Ga0214545_1000007120 335
306 3300021327 Ga0214543_1000020 Ga0214543_1000020122 335
307 3300025253 Ga0209677_102183 Ga0209677_1021833 335
308 3300025254 Ga0209148_1000321 Ga0209148_100032116 335
309 3300025261 Ga0209233_1004336 Ga0209233_10043362 335
310 3300025272 Ga0209455_1000807 Ga0209455_10008073 335
311 3300025297 Ga0209758_1000206 Ga0209758_10002068 335
312 3300025297 Ga0209758_1002309 Ga0209758_10023099 335
313 3300025299 Ga0209256_1011364 Ga0209256_10113642 335
314 3300025302 Ga0207426_1003444 Ga0207426_10034443 335
315 3300025303 Ga0209051_1048370 Ga0209051_10483701 335
316 3300025304 Ga0209257_1000394 Ga0209257_10003948 335
317 3300025304 Ga0209257_1011695 Ga0209257_10116953 335
318 3300025304 Ga0209257_1034598 Ga0209257_10345982 335
319 3300025911 Ga0207654_10048569 Ga0207654_100485692 335
320 3300025913 Ga0207695_10000006 Ga0207695_10000006583 335
321 3300025914 Ga0207671_10021063 Ga0207671_100210633 335
322 3300025949 Ga0207667_10119463 Ga0207667_101194632 335
323 3300026067 Ga0207678_10038686 Ga0207678_100386863 335
324 3300026078 Ga0207702_10610005 Ga0207702_106100051 335
325 3300044683 Ga0466965_0022945 Ga0466965_0022945_768_1781 335
326 3300044901 Ga0466960_0009796 Ga0466960_0009796_2623_3636 335
327 3300044901 Ga0466960_0041081 Ga0466960_0041081_570_1583 335
328 3300045049 Ga0466959_0181687 Ga0466959_0181687_237_1250 335
329 3300046460 Ga0495638_0022001 Ga0495638_0022001_508_1521 335
330 3300046524 Ga0495648_0130331 Ga0495648_0130331_309_1322 335
331 3300046538 Ga0495609_0026332 Ga0495609_0026332_330_1343 335
332 3300046542 Ga0495597_0028026 Ga0495597_0028026_1186_2199 335
333 3300047443 Ga0495687_046825 Ga0495687_046825_30_1043 335
334 3300048904 Ga0496101_0146965 Ga0496101_0146965_174_1190 335
335 3300048905 Ga0496102_0007923 Ga0496102_0007923_6599_7612 335
336 3300048907 Ga0496104_0069177 Ga0496104_0069177_280_1293 335
337 3300048908 Ga0496105_0322725 Ga0496105_0322725_211_1224 335
338 3300048915 Ga0496112_0042235 Ga0496112_0042235_463_1476 335
339 3300048915 Ga0496112_0218968 Ga0496112_0218968_594_1607 335
340 3300048919 Ga0496116_0040127 Ga0496116_0040127_313_1326 335
341 3300048920 Ga0496117_0153103 Ga0496117_0153103_25_1038 335
342 3300048921 Ga0496118_0093022 Ga0496118_0093022_892_1905 335
343 3300048923 Ga0496120_0018821 Ga0496120_0018821_2136_3149 335
344 3300048924 Ga0496121_0022584 Ga0496121_0022584_361_1374 335
345 3300048924 Ga0496121_0050936 Ga0496121_0050936_1684_2697 335
346 3300048924 Ga0496121_0055607 Ga0496121_0055607_845_1858 335
347 3300048929 Ga0496126_0285803 Ga0496126_0285803_67_1080 335
348 3300050491 nmdc:mga00v17_215349_c1 nmdc:mga00v17_215349_c1_48_1061 335
349 3300050492 nmdc:mga0yw44_91521_c1 nmdc:mga0yw44_91521_c1_159_1172 335
350 3300050494 nmdc:mga06z11_30068_c1 nmdc:mga06z11_30068_c1_1511_2524 335
351 3300053085 Ga0495619_0217529 Ga0495619_0217529_105_1118 335
352 3300053094 Ga0500566_0015378 Ga0500566_0015378_1908_2921 335
353 3300053156 Ga0500622_0008137 Ga0500622_0008137_1546_2559 335
354 3300053736 Ga0500599_000651 Ga0500599_000651_2684_3697 335
355 3300003354 JGI25160J50197_1007198 JGI25160J50197_10071983 336
356 3300003354 JGI25160J50197_1015110 JGI25160J50197_10151102 336
357 3300004625 Ga0055543_1005993 Ga0055543_10059932 336
358 3300005262 Ga0065165_1000982 Ga0065165_10009824 336
359 3300005262 Ga0065165_1008445 Ga0065165_10084452 336
360 3300005455 Ga0070663_100028428 Ga0070663_1000284283 336
361 3300005843 Ga0068860_100468621 Ga0068860_1004686211 336
362 3300005844 Ga0068862_100315305 Ga0068862_1003153051 336
363 3300005983 Ga0081540_1051055 Ga0081540_10510552 336
364 3300006186 Ga0075369_10132724 Ga0075369_101327241 336
365 3300009174 Ga0105241_10081915 Ga0105241_100819152 336
366 3300010375 Ga0105239_10211117 Ga0105239_102111171 336
367 3300025261 Ga0209233_1008907 Ga0209233_10089072 336
368 3300025297 Ga0209758_1001539 Ga0209758_100153913 336
369 3300025297 Ga0209758_1001550 Ga0209758_100155012 336
370 3300025302 Ga0207426_1000773 Ga0207426_100077314 336
371 3300025302 Ga0207426_1000990 Ga0207426_100099020 336
372 3300027296 Ga0209389_1000034 Ga0209389_1000034113 336
373 3300027296 Ga0209389_1000039 Ga0209389_1000039112 336
374 3300027357 Ga0209589_1000038 Ga0209589_10000387 336
375 3300027361 Ga0209489_100023 Ga0209489_100023186 336
376 3300027361 Ga0209489_100087 Ga0209489_100087112 336
377 3300027363 Ga0209700_100090 Ga0209700_1000904 336
378 3300028380 Ga0268265_10461022 Ga0268265_104610221 336
379 3300031616 Ga0307508_10210862 Ga0307508_102108621 336
380 3300037418 Ga0395900_0001496 Ga0395900_0001496_20806_21822 336
381 3300037466 Ga0395898_0019947 Ga0395898_0019947_182_1198 336
382 3300037471 Ga0395905_0032236 Ga0395905_0032236_2317_3333 336
383 3300037471 Ga0395905_0124402 Ga0395905_0124402_1206_2222 336
384 3300038443 Ga0395901_0064055 Ga0395901_0064055_2296_3312 336
385 3300039437 Ga0436365_0344664 Ga0436365_0344664_214_1230 336
386 3300039437 Ga0436365_0389593 Ga0436365_0389593_263_1279 336
387 3300044684 Ga0466966_0003788 Ga0466966_0003788_4878_5894 336
388 3300044693 Ga0466961_0000227 Ga0466961_0000227_24320_25336 336
389 3300044694 Ga0466963_0018798 Ga0466963_0018798_3019_4035 336
390 3300044842 Ga0466957_0148709 Ga0466957_0148709_92_1108 336
391 3300045049 Ga0466959_0000605 Ga0466959_0000605_916_1932 336
392 3300045976 Ga0466967_0157884 Ga0466967_0157884_464_1480 336
393 3300046463 Ga0495653_0080356 Ga0495653_0080356_134_1150 336
394 3300046475 Ga0495639_0055478 Ga0495639_0055478_550_1566 336
395 3300046477 Ga0495664_0015540 Ga0495664_0015540_1344_2360 336
396 3300046511 Ga0495608_0139318 Ga0495608_0139318_349_1365 336
397 3300046514 Ga0495618_0081584 Ga0495618_0081584_955_1971 336
398 3300046514 Ga0495618_0184896 Ga0495618_0184896_96_1112 336
399 3300046516 Ga0495628_0032806 Ga0495628_0032806_3131_4147 336
400 3300046522 Ga0495643_0121212 Ga0495643_0121212_242_1258 336
401 3300046529 Ga0495652_0033885 Ga0495652_0033885_871_1887 336
402 3300046529 Ga0495652_0076325 Ga0495652_0076325_767_1783 336
403 3300046529 Ga0495652_0103067 Ga0495652_0103067_118_1134 336
404 3300046533 Ga0495640_0058195 Ga0495640_0058195_1528_2544 336
405 3300046536 Ga0495587_0028742 Ga0495587_0028742_2338_3354 336
406 3300046543 Ga0495645_0018632 Ga0495645_0018632_2187_3203 336
407 3300046642 Ga0495634_0015671 Ga0495634_0015671_136_1152 336
408 3300046663 Ga0495635_0059745 Ga0495635_0059745_408_1424 336
409 3300046663 Ga0495635_0059871 Ga0495635_0059871_281_1297 336
410 3300046675 Ga0495657_0005912 Ga0495657_0005912_1346_2362 336
411 3300046675 Ga0495657_0022986 Ga0495657_0022986_311_1327 336
412 3300046680 Ga0495646_0014985 Ga0495646_0014985_1082_2098 336
413 3300046809 Ga0495600_0227209 Ga0495600_0227209_79_1095 336
414 3300047317 Ga0495604_0012567 Ga0495604_0012567_2719_3735 336
415 3300047317 Ga0495604_0100106 Ga0495604_0100106_431_1447 336
416 3300047319 Ga0495674_0036232 Ga0495674_0036232_2311_3327 336
417 3300047319 Ga0495674_0106388 Ga0495674_0106388_1183_2199 336
418 3300047321 Ga0495676_0066520 Ga0495676_0066520_122_1138 336
419 3300047322 Ga0495680_0001308 Ga0495680_0001308_12010_13026 336
420 3300047323 Ga0495683_0074363 Ga0495683_0074363_120_1136 336
421 3300047472 Ga0495686_0126470 Ga0495686_0126470_157_1170 336
422 3300047673 Ga0495593_0124049 Ga0495593_0124049_162_1178 336
423 3300048088 Ga0495602_0028623 Ga0495602_0028623_2999_4015 336
424 3300048088 Ga0495602_0146601 Ga0495602_0146601_725_1741 336
425 3300048907 Ga0496104_0168040 Ga0496104_0168040_460_1476 336
426 3300048908 Ga0496105_0026827 Ga0496105_0026827_756_1772 336
427 3300048916 Ga0496113_0061050 Ga0496113_0061050_1691_2707 336
428 3300048918 Ga0496115_0142236 Ga0496115_0142236_265_1281 336
429 3300048921 Ga0496118_0100783 Ga0496118_0100783_136_1152 336
430 3300048922 Ga0496119_0007315 Ga0496119_0007315_2216_3232 336
431 3300048923 Ga0496120_0002476 Ga0496120_0002476_13579_14595 336
432 3300048928 Ga0496125_0056873 Ga0496125_0056873_1851_2867 336
433 3300048929 Ga0496126_0007864 Ga0496126_0007864_9924_10940 336
434 3300048929 Ga0496126_0292181 Ga0496126_0292181_51_1076 336
435 3300049460 Ga0495682_0051142 Ga0495682_0051142_343_1359 336
436 3300050496 nmdc:mga07m45_69423_c1 nmdc:mga07m45_69423_c1_24_1040 336
437 3300053079 Ga0500610_0097521 Ga0500610_0097521_465_1481 336
438 3300053080 Ga0500635_0044597 Ga0500635_0044597_61_1077 336
439 3300053087 Ga0500643_000168 Ga0500643_000168_62409_63422 336
440 3300053092 Ga0500583_0012288 Ga0500583_0012288_1488_2501 336
441 3300053093 Ga0500651_0127566 Ga0500651_0127566_155_1171 336
442 3300053103 Ga0500555_003167 Ga0500555_003167_2506_3519 336
443 3300053130 Ga0500642_0000183 Ga0500642_0000183_16841_17857 336
444 3300053130 Ga0500642_0030123 Ga0500642_0030123_1071_2084 336
445 3300053136 Ga0500559_0004871 Ga0500559_0004871_2312_3328 336
446 3300053139 Ga0500568_0030179 Ga0500568_0030179_287_1300 336
447 3300053151 Ga0500604_0008009 Ga0500604_0008009_1622_2635 336
448 3300053154 Ga0500619_025645 Ga0500619_025645_393_1409 336
449 3300053158 Ga0500627_0022514 Ga0500627_0022514_1019_2032 336
450 3300053177 Ga0500636_0000592 Ga0500636_0000592_3898_4914 336
451 3300053729 Ga0500625_000232 Ga0500625_000232_2418_3434 336
452 3300053731 Ga0500609_009508 Ga0500609_009508_105_1121 336
453 3300053737 Ga0500601_000888 Ga0500601_000888_52_1071 336
454 3300001979 JGI24740J21852_10005937 JGI24740J21852_100059372 337
455 3300003203 JGI25406J46586_10000012 JGI25406J46586_1000001250 337
456 3300003203 JGI25406J46586_10038146 JGI25406J46586_100381462 337
457 3300003215 JGI25153J46596_10019332 JGI25153J46596_100193322 337
458 3300003659 JGI25404J52841_10006703 JGI25404J52841_100067031 337
459 3300003659 JGI25404J52841_10010612 JGI25404J52841_100106122 337
460 3300005331 Ga0070670_100068271 Ga0070670_1000682711 337
461 3300005334 Ga0068869_100023869 Ga0068869_1000238692 337
462 3300005336 Ga0070680_100016577 Ga0070680_1000165776 337
463 3300005336 Ga0070680_100064099 Ga0070680_1000640992 337
464 3300005336 Ga0070680_100367073 Ga0070680_1003670731 337
465 3300005338 Ga0068868_100071269 Ga0068868_1000712692 337
466 3300005339 Ga0070660_100238356 Ga0070660_1002383561 337
467 3300005344 Ga0070661_100310121 Ga0070661_1003101211 337
468 3300005347 Ga0070668_100041152 Ga0070668_1000411523 337
469 3300005347 Ga0070668_100087155 Ga0070668_1000871552 337
470 3300005347 Ga0070668_100137630 Ga0070668_1001376302 337
471 3300005356 Ga0070674_100096396 Ga0070674_1000963961 337
472 3300005365 Ga0070688_100166279 Ga0070688_1001662791 337
473 3300005434 Ga0070709_10002283 Ga0070709_100022834 337
474 3300005435 Ga0070714_100022105 Ga0070714_1000221054 337
475 3300005435 Ga0070714_100039738 Ga0070714_1000397383 337
476 3300005436 Ga0070713_100022749 Ga0070713_1000227494 337
477 3300005436 Ga0070713_100060987 Ga0070713_1000609873 337
478 3300005437 Ga0070710_10018697 Ga0070710_100186974 337
479 3300005445 Ga0070708_100387090 Ga0070708_1003870901 337
480 3300005456 Ga0070678_100178156 Ga0070678_1001781561 337
481 3300005456 Ga0070678_100279634 Ga0070678_1002796342 337
482 3300005457 Ga0070662_100185930 Ga0070662_1001859302 337
483 3300005457 Ga0070662_100367923 Ga0070662_1003679231 337
484 3300005458 Ga0070681_10187131 Ga0070681_101871312 337
485 3300005458 Ga0070681_10419787 Ga0070681_104197871 337
486 3300005467 Ga0070706_100133515 Ga0070706_1001335151 337
487 3300005468 Ga0070707_100054763 Ga0070707_1000547633 337
488 3300005468 Ga0070707_100433063 Ga0070707_1004330631 337
489 3300005471 Ga0070698_100047957 Ga0070698_1000479575 337
490 3300005530 Ga0070679_100270231 Ga0070679_1002702312 337
491 3300005535 Ga0070684_100065197 Ga0070684_1000651972 337
492 3300005535 Ga0070684_100115278 Ga0070684_1001152781 337
493 3300005535 Ga0070684_100213839 Ga0070684_1002138391 337
494 3300005539 Ga0068853_100032830 Ga0068853_1000328303 337
495 3300005539 Ga0068853_100040910 Ga0068853_1000409102 337
496 3300005539 Ga0068853_100109745 Ga0068853_1001097451 337
497 3300005543 Ga0070672_100185134 Ga0070672_1001851341 337
498 3300005544 Ga0070686_100183444 Ga0070686_1001834442 337
499 3300005548 Ga0070665_100012864 Ga0070665_1000128646 337
500 3300005548 Ga0070665_100058353 Ga0070665_1000583533 337
501 3300005563 Ga0068855_100154127 Ga0068855_1001541272 337
502 3300005563 Ga0068855_100358675 Ga0068855_1003586752 337
503 3300005577 Ga0068857_100023618 Ga0068857_1000236182 337
504 3300005578 Ga0068854_100072638 Ga0068854_1000726382 337
505 3300005614 Ga0068856_100000137 Ga0068856_10000013757 337
506 3300005614 Ga0068856_100063543 Ga0068856_1000635434 337
507 3300005614 Ga0068856_100540575 Ga0068856_1005405752 337
508 3300005616 Ga0068852_100448392 Ga0068852_1004483921 337
509 3300005834 Ga0068851_10003838 Ga0068851_100038381 337
510 3300005834 Ga0068851_10061017 Ga0068851_100610172 337
511 3300005843 Ga0068860_100274052 Ga0068860_1002740522 337
512 3300005844 Ga0068862_100249676 Ga0068862_1002496762 337
513 3300005937 Ga0081455_10008940 Ga0081455_100089407 337
514 3300005937 Ga0081455_10011276 Ga0081455_100112765 337
515 3300005937 Ga0081455_10013423 Ga0081455_100134236 337
516 3300005937 Ga0081455_10032605 Ga0081455_100326054 337
517 3300005981 Ga0081538_10037995 Ga0081538_100379952 337
518 3300005983 Ga0081540_1002034 Ga0081540_10020348 337
519 3300005983 Ga0081540_1007800 Ga0081540_10078003 337
520 3300005983 Ga0081540_1008423 Ga0081540_10084235 337
521 3300005983 Ga0081540_1012078 Ga0081540_10120783 337
522 3300005983 Ga0081540_1020975 Ga0081540_10209753 337
523 3300005983 Ga0081540_1023647 Ga0081540_10236472 337
524 3300005983 Ga0081540_1065713 Ga0081540_10657132 337
525 3300005983 Ga0081540_1068142 Ga0081540_10681421 337
526 3300005985 Ga0081539_10000040 Ga0081539_10000040215 337
527 3300005985 Ga0081539_10000157 Ga0081539_1000015716 337
528 3300005985 Ga0081539_10006006 Ga0081539_100060068 337
529 3300005985 Ga0081539_10063904 Ga0081539_100639042 337
530 3300005985 Ga0081539_10105346 Ga0081539_101053461 337
531 3300006028 Ga0070717_10017655 Ga0070717_100176554 337
532 3300006038 Ga0075365_10043977 Ga0075365_100439773 337
533 3300006038 Ga0075365_10110776 Ga0075365_101107763 337
534 3300006042 Ga0075368_10016127 Ga0075368_100161271 337
535 3300006048 Ga0075363_100115619 Ga0075363_1001156191 337
536 3300006173 Ga0070716_100014843 Ga0070716_1000148432 337
537 3300006173 Ga0070716_100021483 Ga0070716_1000214834 337
538 3300006173 Ga0070716_100114369 Ga0070716_1001143691 337
539 3300006178 Ga0075367_10121060 Ga0075367_101210601 337
540 3300006186 Ga0075369_10010149 Ga0075369_100101492 337
541 3300006195 Ga0075366_10023825 Ga0075366_100238251 337
542 3300007265 Ga0099794_10005590 Ga0099794_100055901 337
543 3300009093 Ga0105240_10015437 Ga0105240_100154372 337
544 3300009093 Ga0105240_10069358 Ga0105240_100693583 337
545 3300009093 Ga0105240_10135717 Ga0105240_101357172 337
546 3300009094 Ga0111539_10347138 Ga0111539_103471381 337
547 3300009094 Ga0111539_10351823 Ga0111539_103518232 337
548 3300009098 Ga0105245_10148468 Ga0105245_101484682 337
549 3300009148 Ga0105243_10224948 Ga0105243_102249482 337
550 3300009174 Ga0105241_10001280 Ga0105241_100012809 337
551 3300009177 Ga0105248_10036476 Ga0105248_100364763 337
552 3300009177 Ga0105248_10497588 Ga0105248_104975881 337
553 3300009545 Ga0105237_10044776 Ga0105237_100447763 337
554 3300009545 Ga0105237_10140850 Ga0105237_101408502 337
555 3300009551 Ga0105238_10044002 Ga0105238_100440022 337
556 3300009551 Ga0105238_10079710 Ga0105238_100797102 337
557 3300010159 Ga0099796_10019249 Ga0099796_100192492 337
558 3300010375 Ga0105239_10054114 Ga0105239_100541143 337
559 3300010375 Ga0105239_10187359 Ga0105239_101873593 337
560 3300010375 Ga0105239_10267778 Ga0105239_102677781 337
561 3300011119 Ga0105246_10111990 Ga0105246_101119902 337
562 3300013104 Ga0157370_10040880 Ga0157370_100408803 337
563 3300013296 Ga0157374_10134006 Ga0157374_101340062 337
564 3300013297 Ga0157378_10074226 Ga0157378_100742263 337
565 3300013297 Ga0157378_10078348 Ga0157378_100783483 337
566 3300013297 Ga0157378_10544548 Ga0157378_105445481 337
567 3300013306 Ga0163162_10654083 Ga0163162_106540831 337
568 3300013307 Ga0157372_10100045 Ga0157372_101000453 337
569 3300013308 Ga0157375_10055890 Ga0157375_100558902 337
570 3300014325 Ga0163163_10222436 Ga0163163_102224361 337
571 3300014969 Ga0157376_10022471 Ga0157376_100224714 337
572 3300014969 Ga0157376_10240448 Ga0157376_102404481 337
573 3300021441 Ga0213871_10033779 Ga0213871_100337791 337
574 3300025297 Ga0209758_1000536 Ga0209758_10005367 337
575 3300025321 Ga0207656_10005846 Ga0207656_100058463 337
576 3300025898 Ga0207692_10008172 Ga0207692_100081722 337
577 3300025898 Ga0207692_10010497 Ga0207692_100104973 337
578 3300025900 Ga0207710_10035205 Ga0207710_100352052 337
579 3300025904 Ga0207647_10005671 Ga0207647_100056713 337
580 3300025906 Ga0207699_10003146 Ga0207699_100031463 337
581 3300025906 Ga0207699_10221479 Ga0207699_102214792 337
582 3300025908 Ga0207643_10008642 Ga0207643_100086424 337
583 3300025909 Ga0207705_10124422 Ga0207705_101244222 337
584 3300025910 Ga0207684_10037662 Ga0207684_100376623 337
585 3300025911 Ga0207654_10000153 Ga0207654_100001532 337
586 3300025911 Ga0207654_10039326 Ga0207654_100393263 337
587 3300025912 Ga0207707_10002207 Ga0207707_100022073 337
588 3300025913 Ga0207695_10000506 Ga0207695_1000050676 337
589 3300025913 Ga0207695_10051564 Ga0207695_100515642 337
590 3300025914 Ga0207671_10110521 Ga0207671_101105212 337
591 3300025914 Ga0207671_10313295 Ga0207671_103132951 337
592 3300025915 Ga0207693_10004906 Ga0207693_100049061 337
593 3300025915 Ga0207693_10068086 Ga0207693_100680863 337
594 3300025916 Ga0207663_10000161 Ga0207663_100001613 337
595 3300025916 Ga0207663_10209013 Ga0207663_102090131 337
596 3300025917 Ga0207660_10243940 Ga0207660_102439401 337
597 3300025918 Ga0207662_10099985 Ga0207662_100999851 337
598 3300025919 Ga0207657_10033356 Ga0207657_100333563 337
599 3300025921 Ga0207652_10047975 Ga0207652_100479751 337
600 3300025921 Ga0207652_10373220 Ga0207652_103732201 337
601 3300025922 Ga0207646_10050177 Ga0207646_100501771 337
602 3300025923 Ga0207681_10275586 Ga0207681_102755861 337
603 3300025924 Ga0207694_10003910 Ga0207694_100039105 337
604 3300025924 Ga0207694_10034184 Ga0207694_100341842 337
605 3300025924 Ga0207694_10081906 Ga0207694_100819063 337
606 3300025924 Ga0207694_10219491 Ga0207694_102194911 337
607 3300025927 Ga0207687_10009895 Ga0207687_100098953 337
608 3300025927 Ga0207687_10029818 Ga0207687_100298182 337
609 3300025927 Ga0207687_10274318 Ga0207687_102743182 337
610 3300025928 Ga0207700_10045317 Ga0207700_100453173 337
611 3300025928 Ga0207700_10057556 Ga0207700_100575562 337
612 3300025929 Ga0207664_10021734 Ga0207664_100217343 337
613 3300025933 Ga0207706_10312768 Ga0207706_103127682 337
614 3300025937 Ga0207669_10029132 Ga0207669_100291322 337
615 3300025939 Ga0207665_10000183 Ga0207665_1000018337 337
616 3300025939 Ga0207665_10171674 Ga0207665_101716741 337
617 3300025939 Ga0207665_10175312 Ga0207665_101753122 337
618 3300025940 Ga0207691_10049861 Ga0207691_100498612 337
619 3300025940 Ga0207691_10274416 Ga0207691_102744161 337
620 3300025941 Ga0207711_10033479 Ga0207711_100334792 337
621 3300025942 Ga0207689_10046436 Ga0207689_100464362 337
622 3300025942 Ga0207689_10093199 Ga0207689_100931992 337
623 3300025942 Ga0207689_10104918 Ga0207689_101049182 337
624 3300025944 Ga0207661_10000828 Ga0207661_100008283 337
625 3300025949 Ga0207667_10087422 Ga0207667_100874223 337
626 3300025949 Ga0207667_10114421 Ga0207667_101144212 337
627 3300025949 Ga0207667_10244025 Ga0207667_102440252 337
628 3300025949 Ga0207667_10271534 Ga0207667_102715342 337
629 3300025961 Ga0207712_10128647 Ga0207712_101286472 337
630 3300025972 Ga0207668_10104398 Ga0207668_101043982 337
631 3300025972 Ga0207668_10118457 Ga0207668_101184571 337
632 3300025972 Ga0207668_10366631 Ga0207668_103666311 337
633 3300026023 Ga0207677_10175196 Ga0207677_101751961 337
634 3300026041 Ga0207639_10007981 Ga0207639_100079811 337
635 3300026041 Ga0207639_10042056 Ga0207639_100420563 337
636 3300026041 Ga0207639_10346164 Ga0207639_103461641 337
637 3300026067 Ga0207678_10065333 Ga0207678_100653332 337
638 3300026067 Ga0207678_10086765 Ga0207678_100867652 337
639 3300026067 Ga0207678_10174584 Ga0207678_101745841 337
640 3300026067 Ga0207678_10426764 Ga0207678_104267641 337
641 3300026078 Ga0207702_10000006 Ga0207702_10000006289 337
642 3300026078 Ga0207702_10000063 Ga0207702_1000006354 337
643 3300026089 Ga0207648_10285701 Ga0207648_102857011 337
644 3300026095 Ga0207676_10089134 Ga0207676_100891342 337
645 3300026116 Ga0207674_10048571 Ga0207674_100485713 337
646 3300026116 Ga0207674_10048718 Ga0207674_100487182 337
647 3300026116 Ga0207674_10130837 Ga0207674_101308372 337
648 3300026118 Ga0207675_100236199 Ga0207675_1002361991 337
649 3300026121 Ga0207683_10121878 Ga0207683_101218782 337
650 3300026121 Ga0207683_10174513 Ga0207683_101745132 337
651 3300026121 Ga0207683_10308371 Ga0207683_103083711 337
652 3300026121 Ga0207683_10375902 Ga0207683_103759021 337
653 3300026142 Ga0207698_10045959 Ga0207698_100459592 337
654 3300026142 Ga0207698_10420215 Ga0207698_104202151 337
655 3300026142 Ga0207698_10427495 Ga0207698_104274952 337
656 3300027671 Ga0209588_1005208 Ga0209588_10052083 337
657 3300028379 Ga0268266_10034894 Ga0268266_100348944 337
658 3300028379 Ga0268266_10053634 Ga0268266_100536343 337
659 3300028379 Ga0268266_10163006 Ga0268266_101630062 337
660 3300028379 Ga0268266_10187728 Ga0268266_101877282 337
661 3300028379 Ga0268266_10497615 Ga0268266_104976151 337
662 3300028380 Ga0268265_10277711 Ga0268265_102777111 337
663 3300028381 Ga0268264_10066486 Ga0268264_100664863 337
664 3300028786 Ga0307517_10050575 Ga0307517_100505751 337
665 3300028794 Ga0307515_10046793 Ga0307515_100467933 337
666 3300028794 Ga0307515_10063600 Ga0307515_100636001 337
667 3300030763 Ga0265763_1002954 Ga0265763_10029542 337
668 3300031235 Ga0265330_10072948 Ga0265330_100729482 337
669 3300031247 Ga0265340_10052128 Ga0265340_100521282 337
670 3300031249 Ga0265339_10000281 Ga0265339_1000028136 337
671 3300031456 Ga0307513_10139543 Ga0307513_101395431 337
672 3300031507 Ga0307509_10053131 Ga0307509_100531313 337
673 3300031616 Ga0307508_10000012 Ga0307508_1000001243 337
674 3300031616 Ga0307508_10033210 Ga0307508_100332102 337
675 3300031616 Ga0307508_10078988 Ga0307508_100789882 337
676 3300031616 Ga0307508_10217175 Ga0307508_102171752 337
677 3300031711 Ga0265314_10011033 Ga0265314_100110334 337
678 3300031712 Ga0265342_10049510 Ga0265342_100495102 337
679 3300031730 Ga0307516_10068943 Ga0307516_100689434 337
680 3300031731 Ga0307405_10223239 Ga0307405_102232392 337
681 3300031911 Ga0307412_10029996 Ga0307412_100299963 337
682 3300032005 Ga0307411_10210904 Ga0307411_102109041 337
683 3300033180 Ga0307510_10022874 Ga0307510_100228743 337
684 3300033180 Ga0307510_10037361 Ga0307510_100373613 337
685 3300035089 Ga0373944_0021553 Ga0373944_0021553_715_1734 337
686 3300035089 Ga0373944_0026026 Ga0373944_0026026_422_1441 337
687 3300035111 Ga0373923_0065718 Ga0373923_0065718_434_1453 337
688 3300035113 Ga0373936_0114188 Ga0373936_0114188_66_1085 337
689 3300035117 Ga0373953_0001704 Ga0373953_0001704_2236_3255 337
690 3300035117 Ga0373953_0002691 Ga0373953_0002691_2995_4014 337
691 3300035118 Ga0373954_0007407 Ga0373954_0007407_2428_3447 337
692 3300035118 Ga0373954_0037173 Ga0373954_0037173_250_1269 337
693 3300035119 Ga0373956_0012937 Ga0373956_0012937_200_1219 337
694 3300035120 Ga0373957_0012302 Ga0373957_0012302_1471_2490 337
695 3300035170 Ga0373943_0002235 Ga0373943_0002235_821_1840 337
696 3300035171 Ga0373946_0126793 Ga0373946_0126793_54_1073 337
697 3300035172 Ga0373955_0027684 Ga0373955_0027684_1064_2083 337
698 3300035172 Ga0373955_0154980 Ga0373955_0154980_267_1286 337
699 3300035410 Ga0373924_0069573 Ga0373924_0069573_391_1410 337
700 3300035692 Ga0373935_0003730 Ga0373935_0003730_4682_5701 337
701 3300035692 Ga0373935_0048374 Ga0373935_0048374_1426_2445 337
702 3300035695 Ga0373927_0001492 Ga0373927_0001492_15028_16047 337
703 3300035695 Ga0373927_0001793 Ga0373927_0001793_12865_13890 337
704 3300035695 Ga0373927_0033848 Ga0373927_0033848_1300_2319 337
705 3300035695 Ga0373927_0140989 Ga0373927_0140989_61_1080 337
706 3300035724 Ga0373933_0000267 Ga0373933_0000267_21715_22734 337
707 3300035725 Ga0373947_0001861 Ga0373947_0001861_4099_5118 337
708 3300035725 Ga0373947_0133714 Ga0373947_0133714_332_1357 337
709 3300036401 Ga0373937_0034261 Ga0373937_0034261_3521_4540 337
710 3300036401 Ga0373937_0051137 Ga0373937_0051137_375_1394 337
711 3300036401 Ga0373937_0057297 Ga0373937_0057297_853_1872 337
712 3300036459 Ga0372808_013234 Ga0372808_013234_136_1155 337
713 3300037068 Ga0373925_0013546 Ga0373925_0013546_2435_3454 337
714 3300037068 Ga0373925_0058364 Ga0373925_0058364_1645_2709 337
715 3300037068 Ga0373925_0114613 Ga0373925_0114613_765_1784 337
716 3300037466 Ga0395898_0070389 Ga0395898_0070389_1549_2565 337
717 3300037471 Ga0395905_0004165 Ga0395905_0004165_8369_9385 337
718 3300038443 Ga0395901_0231437 Ga0395901_0231437_656_1672 337
719 3300039438 Ga0436360_0441680 Ga0436360_0441680_79_1098 337
720 3300039438 Ga0436360_0560055 Ga0436360_0560055_171_1190 337
721 3300039438 Ga0436360_0600621 Ga0436360_0600621_3072_4118 337
722 3300039447 Ga0436361_1065603 Ga0436361_1065603_301_1320 337
723 3300039450 Ga0436363_0135082 Ga0436363_0135082_1615_2670 337
724 3300039450 Ga0436363_0460586 Ga0436363_0460586_1660_2679 337
725 3300044693 Ga0466961_0059356 Ga0466961_0059356_173_1330 337
726 3300044901 Ga0466960_0113129 Ga0466960_0113129_328_1344 337
727 3300045049 Ga0466959_0024944 Ga0466959_0024944_1869_3026 337
728 3300045049 Ga0466959_0061469 Ga0466959_0061469_1462_2490 337
729 3300046452 Ga0495617_013424 Ga0495617_013424_124_1143 337
730 3300046454 Ga0495592_0002227 Ga0495592_0002227_5443_6462 337
731 3300046454 Ga0495592_0041547 Ga0495592_0041547_276_1295 337
732 3300046454 Ga0495592_0060638 Ga0495592_0060638_1209_2228 337
733 3300046455 Ga0495603_0000036 Ga0495603_0000036_52880_53899 337
734 3300046455 Ga0495603_0008447 Ga0495603_0008447_2387_3406 337
735 3300046455 Ga0495603_0015690 Ga0495603_0015690_3554_4573 337
736 3300046459 Ga0495629_0000148 Ga0495629_0000148_7627_8646 337
737 3300046459 Ga0495629_0000331 Ga0495629_0000331_11136_12155 337
738 3300046459 Ga0495629_0049085 Ga0495629_0049085_817_1836 337
739 3300046459 Ga0495629_0242116 Ga0495629_0242116_137_1156 337
740 3300046460 Ga0495638_0032248 Ga0495638_0032248_1860_2876 337
741 3300046460 Ga0495638_0033836 Ga0495638_0033836_58_1077 337
742 3300046461 Ga0495641_0008477 Ga0495641_0008477_4126_5145 337
743 3300046461 Ga0495641_0121183 Ga0495641_0121183_112_1131 337
744 3300046462 Ga0495651_0015094 Ga0495651_0015094_4246_5265 337
745 3300046462 Ga0495651_0016761 Ga0495651_0016761_1629_2648 337
746 3300046463 Ga0495653_0000697 Ga0495653_0000697_13336_14355 337
747 3300046463 Ga0495653_0033411 Ga0495653_0033411_1840_2859 337
748 3300046463 Ga0495653_0228582 Ga0495653_0228582_55_1074 337
749 3300046472 Ga0495580_0000705 Ga0495580_0000705_4155_5174 337
750 3300046473 Ga0495582_0002450 Ga0495582_0002450_7661_8680 337
751 3300046475 Ga0495639_0000135 Ga0495639_0000135_8094_9113 337
752 3300046475 Ga0495639_0004541 Ga0495639_0004541_1426_2445 337
753 3300046476 Ga0495662_0000811 Ga0495662_0000811_6663_7682 337
754 3300046491 Ga0495584_0137167 Ga0495584_0137167_42_1061 337
755 3300046492 Ga0495585_0049604 Ga0495585_0049604_991_2010 337
756 3300046499 Ga0495594_0001252 Ga0495594_0001252_7789_8808 337
757 3300046499 Ga0495594_0016885 Ga0495594_0016885_454_1473 337
758 3300046501 Ga0495607_0035604 Ga0495607_0035604_885_1901 337
759 3300046507 Ga0495606_0001350 Ga0495606_0001350_22718_23737 337
760 3300046511 Ga0495608_0038216 Ga0495608_0038216_250_1269 337
761 3300046511 Ga0495608_0130635 Ga0495608_0130635_389_1408 337
762 3300046511 Ga0495608_0183184 Ga0495608_0183184_269_1288 337
763 3300046512 Ga0495610_0039906 Ga0495610_0039906_313_1329 337
764 3300046513 Ga0495616_0132872 Ga0495616_0132872_89_1108 337
765 3300046514 Ga0495618_0149881 Ga0495618_0149881_344_1363 337
766 3300046515 Ga0495620_0013412 Ga0495620_0013412_2840_3856 337
767 3300046516 Ga0495628_0028014 Ga0495628_0028014_2756_3775 337
768 3300046516 Ga0495628_0037061 Ga0495628_0037061_753_1772 337
769 3300046516 Ga0495628_0211900 Ga0495628_0211900_341_1360 337
770 3300046518 Ga0495631_0070222 Ga0495631_0070222_159_1175 337
771 3300046522 Ga0495643_0037685 Ga0495643_0037685_883_1899 337
772 3300046524 Ga0495648_0000310 Ga0495648_0000310_28350_29369 337
773 3300046524 Ga0495648_0004337 Ga0495648_0004337_10461_11477 337
774 3300046526 Ga0495666_0118010 Ga0495666_0118010_159_1178 337
775 3300046529 Ga0495652_0025648 Ga0495652_0025648_2563_3582 337
776 3300046529 Ga0495652_0174301 Ga0495652_0174301_161_1180 337
777 3300046531 Ga0495665_0000118 Ga0495665_0000118_7801_8820 337
778 3300046533 Ga0495640_0032839 Ga0495640_0032839_661_1680 337
779 3300046533 Ga0495640_0045231 Ga0495640_0045231_775_1794 337
780 3300046536 Ga0495587_0021863 Ga0495587_0021863_1820_2839 337
781 3300046543 Ga0495645_0162202 Ga0495645_0162202_206_1225 337
782 3300046557 Ga0495622_0002977 Ga0495622_0002977_6810_7829 337
783 3300046559 Ga0495667_0000379 Ga0495667_0000379_8974_9993 337
784 3300046559 Ga0495667_0092297 Ga0495667_0092297_594_1613 337
785 3300046615 Ga0495656_0021970 Ga0495656_0021970_1156_2175 337
786 3300046642 Ga0495634_0000969 Ga0495634_0000969_2009_3028 337
787 3300046642 Ga0495634_0018562 Ga0495634_0018562_3680_4699 337
788 3300046642 Ga0495634_0044526 Ga0495634_0044526_1005_2024 337
789 3300046660 Ga0495625_0053068 Ga0495625_0053068_261_1280 337
790 3300046660 Ga0495625_0283918 Ga0495625_0283918_22_1041 337
791 3300046663 Ga0495635_0000434 Ga0495635_0000434_1071_2090 337
792 3300046663 Ga0495635_0025444 Ga0495635_0025444_434_1453 337
793 3300046665 Ga0495661_0016991 Ga0495661_0016991_3224_4240 337
794 3300046674 Ga0495588_0063025 Ga0495588_0063025_540_1556 337
795 3300046674 Ga0495588_0073316 Ga0495588_0073316_613_1632 337
796 3300046675 Ga0495657_0007977 Ga0495657_0007977_5015_6034 337
797 3300046678 Ga0495599_0002117 Ga0495599_0002117_1023_2042 337
798 3300046678 Ga0495599_0062858 Ga0495599_0062858_1120_2139 337
799 3300046678 Ga0495599_0129549 Ga0495599_0129549_227_1246 337
800 3300046679 Ga0495623_0022452 Ga0495623_0022452_79_1098 337
801 3300046679 Ga0495623_0064649 Ga0495623_0064649_317_1336 337
802 3300046680 Ga0495646_0021600 Ga0495646_0021600_2886_3905 337
803 3300046680 Ga0495646_0027263 Ga0495646_0027263_1491_2510 337
804 3300046680 Ga0495646_0141558 Ga0495646_0141558_259_1278 337
805 3300046681 Ga0495647_0000360 Ga0495647_0000360_1938_2957 337
806 3300046683 Ga0495658_0009177 Ga0495658_0009177_1992_3011 337
807 3300046683 Ga0495658_0020094 Ga0495658_0020094_2060_3079 337
808 3300046683 Ga0495658_0109479 Ga0495658_0109479_16_1035 337
809 3300046689 Ga0495613_0030595 Ga0495613_0030595_188_1207 337
810 3300046689 Ga0495613_0031204 Ga0495613_0031204_2842_3861 337
811 3300046690 Ga0495624_0000445 Ga0495624_0000445_7645_8664 337
812 3300046690 Ga0495624_0105050 Ga0495624_0105050_356_1420 337
813 3300046691 Ga0495670_0041658 Ga0495670_0041658_849_1868 337
814 3300046692 Ga0495671_0156236 Ga0495671_0156236_63_1079 337
815 3300046809 Ga0495600_0003883 Ga0495600_0003883_2487_3506 337
816 3300046809 Ga0495600_0015470 Ga0495600_0015470_387_1406 337
817 3300047315 Ga0495581_0001178 Ga0495581_0001178_8763_9782 337
818 3300047315 Ga0495581_0039724 Ga0495581_0039724_1634_2653 337
819 3300047315 Ga0495581_0164853 Ga0495581_0164853_256_1275 337
820 3300047317 Ga0495604_0043465 Ga0495604_0043465_2447_3466 337
821 3300047317 Ga0495604_0175565 Ga0495604_0175565_145_1164 337
822 3300047319 Ga0495674_0000443 Ga0495674_0000443_32239_33258 337
823 3300047319 Ga0495674_0010317 Ga0495674_0010317_2670_3689 337
824 3300047319 Ga0495674_0038574 Ga0495674_0038574_1618_2637 337
825 3300047319 Ga0495674_0171479 Ga0495674_0171479_506_1525 337
826 3300047320 Ga0495672_0006462 Ga0495672_0006462_384_1403 337
827 3300047321 Ga0495676_0144347 Ga0495676_0144347_75_1091 337
828 3300047322 Ga0495680_0042578 Ga0495680_0042578_946_1965 337
829 3300047322 Ga0495680_0076152 Ga0495680_0076152_567_1586 337
830 3300047444 Ga0495675_0068237 Ga0495675_0068237_170_1189 337
831 3300047447 Ga0495685_063973 Ga0495685_063973_120_1139 337
832 3300047469 Ga0495673_0013330 Ga0495673_0013330_2048_3067 337
833 3300047471 Ga0495684_0002730 Ga0495684_0002730_6302_7321 337
834 3300047471 Ga0495684_0054251 Ga0495684_0054251_1996_3015 337
835 3300047471 Ga0495684_0105859 Ga0495684_0105859_321_1340 337
836 3300047471 Ga0495684_0127653 Ga0495684_0127653_312_1331 337
837 3300047673 Ga0495593_0000495 Ga0495593_0000495_38_1057 337
838 3300047673 Ga0495593_0001203 Ga0495593_0001203_1906_2925 337
839 3300047673 Ga0495593_0022477 Ga0495593_0022477_1677_2696 337
840 3300048088 Ga0495602_0049654 Ga0495602_0049654_2487_3506 337
841 3300048088 Ga0495602_0055132 Ga0495602_0055132_559_1578 337
842 3300048903 Ga0496100_0011667 Ga0496100_0011667_2061_3080 337
843 3300048904 Ga0496101_0003579 Ga0496101_0003579_3206_4225 337
844 3300048904 Ga0496101_0052485 Ga0496101_0052485_1848_2867 337
845 3300048904 Ga0496101_0183960 Ga0496101_0183960_566_1585 337
846 3300048905 Ga0496102_0139950 Ga0496102_0139950_668_1687 337
847 3300048906 Ga0496103_0121183 Ga0496103_0121183_322_1341 337
848 3300048906 Ga0496103_0161673 Ga0496103_0161673_52_1071 337
849 3300048907 Ga0496104_0237482 Ga0496104_0237482_583_1602 337
850 3300048908 Ga0496105_0016857 Ga0496105_0016857_4403_5422 337
851 3300048908 Ga0496105_0258754 Ga0496105_0258754_123_1142 337
852 3300048909 Ga0496106_0104052 Ga0496106_0104052_923_1942 337
853 3300048910 Ga0496107_0033299 Ga0496107_0033299_202_1221 337
854 3300048910 Ga0496107_0066411 Ga0496107_0066411_1080_2099 337
855 3300048910 Ga0496107_0096532 Ga0496107_0096532_745_1764 337
856 3300048910 Ga0496107_0140661 Ga0496107_0140661_745_1761 337
857 3300048910 Ga0496107_0230720 Ga0496107_0230720_221_1240 337
858 3300048911 Ga0496108_0074802 Ga0496108_0074802_150_1169 337
859 3300048912 Ga0496109_0017997 Ga0496109_0017997_73_1092 337
860 3300048912 Ga0496109_0116893 Ga0496109_0116893_1063_2082 337
861 3300048913 Ga0496110_0067181 Ga0496110_0067181_1668_2687 337
862 3300048915 Ga0496112_0000029 Ga0496112_0000029_15443_16462 337
863 3300048915 Ga0496112_0074363 Ga0496112_0074363_407_1426 337
864 3300048915 Ga0496112_0173866 Ga0496112_0173866_82_1101 337
865 3300048915 Ga0496112_0197092 Ga0496112_0197092_324_1340 337
866 3300048915 Ga0496112_0396022 Ga0496112_0396022_209_1228 337
867 3300048916 Ga0496113_0182878 Ga0496113_0182878_596_1615 337
868 3300048916 Ga0496113_0207468 Ga0496113_0207468_341_1360 337
869 3300048917 Ga0496114_0011325 Ga0496114_0011325_5615_6634 337
870 3300048917 Ga0496114_0056814 Ga0496114_0056814_448_1467 337
871 3300048918 Ga0496115_0000295 Ga0496115_0000295_7333_8352 337
872 3300048918 Ga0496115_0018198 Ga0496115_0018198_1447_2466 337
873 3300048918 Ga0496115_0076474 Ga0496115_0076474_1544_2563 337
874 3300048918 Ga0496115_0079903 Ga0496115_0079903_1249_2268 337
875 3300048919 Ga0496116_0002462 Ga0496116_0002462_18156_19172 337
876 3300048920 Ga0496117_0086744 Ga0496117_0086744_398_1414 337
877 3300048921 Ga0496118_0037848 Ga0496118_0037848_2281_3297 337
878 3300048921 Ga0496118_0128456 Ga0496118_0128456_68_1084 337
879 3300048923 Ga0496120_0126979 Ga0496120_0126979_69_1085 337
880 3300048924 Ga0496121_0001687 Ga0496121_0001687_14754_15773 337
881 3300048924 Ga0496121_0036588 Ga0496121_0036588_1993_3009 337
882 3300048924 Ga0496121_0041193 Ga0496121_0041193_384_1400 337
883 3300048924 Ga0496121_0063679 Ga0496121_0063679_475_1494 337
884 3300048924 Ga0496121_0155941 Ga0496121_0155941_166_1185 337
885 3300048924 Ga0496121_0158418 Ga0496121_0158418_461_1480 337
886 3300048927 Ga0496124_0134256 Ga0496124_0134256_62_1078 337
887 3300048927 Ga0496124_0165185 Ga0496124_0165185_128_1147 337
888 3300048928 Ga0496125_0000154 Ga0496125_0000154_20024_21040 337
889 3300048928 Ga0496125_0004393 Ga0496125_0004393_10092_11108 337
890 3300048929 Ga0496126_0005939 Ga0496126_0005939_3017_4036 337
891 3300048929 Ga0496126_0007926 Ga0496126_0007926_5514_6533 337
892 3300048929 Ga0496126_0010008 Ga0496126_0010008_2085_3104 337
893 3300048929 Ga0496126_0082697 Ga0496126_0082697_817_1836 337
894 3300048929 Ga0496126_0258306 Ga0496126_0258306_67_1086 337
895 3300048929 Ga0496126_0290432 Ga0496126_0290432_232_1248 337
896 3300049568 Ga0501031_0003990 Ga0501031_0003990_8391_9407 337
897 3300049569 Ga0501032_0000073 Ga0501032_0000073_47734_48750 337
898 3300049570 Ga0501033_0000136 Ga0501033_0000136_9759_10775 337
899 3300049571 Ga0501034_0000251 Ga0501034_0000251_28310_29326 337
900 3300049571 Ga0501034_0116531 Ga0501034_0116531_61_1080 337
901 3300049572 Ga0501036_0000036 Ga0501036_0000036_60188_61204 337
902 3300049572 Ga0501036_0202301 Ga0501036_0202301_279_1298 337
903 3300049573 Ga0501037_0000040 Ga0501037_0000040_24672_25688 337
904 3300049574 Ga0501038_0000150 Ga0501038_0000150_34471_35487 337
905 3300049574 Ga0501038_0368549 Ga0501038_0368549_59_1078 337
906 3300049575 Ga0501039_0003418 Ga0501039_0003418_3329_4345 337
907 3300049576 Ga0501040_0300295 Ga0501040_0300295_42_1058 337
908 3300049578 Ga0501042_0008136 Ga0501042_0008136_2900_3916 337
909 3300049579 Ga0501043_0000464 Ga0501043_0000464_14564_15580 337
910 3300049579 Ga0501043_0191031 Ga0501043_0191031_103_1122 337
911 3300049580 Ga0501046_0000398 Ga0501046_0000398_27844_28860 337
912 3300049580 Ga0501046_0223674 Ga0501046_0223674_304_1323 337
913 3300049581 Ga0501047_0000656 Ga0501047_0000656_28080_29096 337
914 3300049581 Ga0501047_0294580 Ga0501047_0294580_437_1456 337
915 3300049582 Ga0501048_0000906 Ga0501048_0000906_10964_11980 337
916 3300049583 Ga0501067_0000192 Ga0501067_0000192_19925_20941 337
917 3300049583 Ga0501067_0035211 Ga0501067_0035211_363_1382 337
918 3300049584 Ga0501068_0002765 Ga0501068_0002765_3245_4261 337
919 3300049585 Ga0501069_0014897 Ga0501069_0014897_2398_3414 337
920 3300049586 Ga0501070_0037271 Ga0501070_0037271_2822_3841 337
921 3300049586 Ga0501070_0076207 Ga0501070_0076207_383_1399 337
922 3300049586 Ga0501070_0179220 Ga0501070_0179220_505_1524 337
923 3300049586 Ga0501070_0203936 Ga0501070_0203936_503_1519 337
924 3300049587 Ga0501071_0053825 Ga0501071_0053825_1462_2478 337
925 3300049588 Ga0501072_0002128 Ga0501072_0002128_10200_11216 337
926 3300049589 Ga0501073_0000037 Ga0501073_0000037_26069_27085 337
927 3300049590 Ga0501074_0000133 Ga0501074_0000133_36746_37762 337
928 3300049741 Ga0501079_0024353 Ga0501079_0024353_3478_4494 337
929 3300049742 Ga0501080_0000054 Ga0501080_0000054_33663_34679 337
930 3300049742 Ga0501080_0005201 Ga0501080_0005201_5656_6675 337
931 3300049744 Ga0501083_0001153 Ga0501083_0001153_282_1298 337
932 3300049822 Ga0501035_0000142 Ga0501035_0000142_58236_59252 337
933 3300049822 Ga0501035_0278135 Ga0501035_0278135_283_1302 337
934 3300049823 Ga0501044_0000985 Ga0501044_0000985_28310_29326 337
935 3300049823 Ga0501044_0102936 Ga0501044_0102936_44_1063 337
936 3300049824 Ga0501045_0019721 Ga0501045_0019721_3045_4061 337
937 3300050489 nmdc:mga03683_17647_c1 nmdc:mga03683_17647_c1_1303_2367 337
938 3300050491 nmdc:mga00v17_20486_c1 nmdc:mga00v17_20486_c1_226_1242 337
939 3300050492 nmdc:mga0yw44_942_c1 nmdc:mga0yw44_942_c1_9589_10653 337
940 3300050494 nmdc:mga06z11_14027_c1 nmdc:mga06z11_14027_c1_1994_3013 337
941 3300050496 nmdc:mga07m45_6998_c1 nmdc:mga07m45_6998_c1_2893_3912 337
942 3300050512 nmdc:mga0n895_115792_c1 nmdc:mga0n895_115792_c1_899_1918 337
943 3300050512 nmdc:mga0n895_30146_c1 nmdc:mga0n895_30146_c1_3808_4827 337
944 3300050516 nmdc:mga0sz30_9846_c1 nmdc:mga0sz30_9846_c1_331_1347 337
945 3300053077 Ga0495601_0013434 Ga0495601_0013434_3591_4610 337
946 3300053077 Ga0495601_0083775 Ga0495601_0083775_331_1350 337
947 3300053078 Ga0495612_0062530 Ga0495612_0062530_165_1184 337
948 3300053084 Ga0495595_0000758 Ga0495595_0000758_9771_10790 337
949 3300053085 Ga0495619_0000617 Ga0495619_0000617_17237_18256 337
950 3300053089 Ga0500581_052116 Ga0500581_052116_978_1994 337
951 3300053090 Ga0500646_0035013 Ga0500646_0035013_167_1183 337
952 3300053093 Ga0500651_0026339 Ga0500651_0026339_1681_2694 337
953 3300053093 Ga0500651_0098104 Ga0500651_0098104_737_1753 337
954 3300053094 Ga0500566_0000822 Ga0500566_0000822_2570_3583 337
955 3300053094 Ga0500566_0003799 Ga0500566_0003799_1216_2238 337
956 3300053096 Ga0500641_0016085 Ga0500641_0016085_636_1655 337
957 3300053096 Ga0500641_0039404 Ga0500641_0039404_656_1672 337
958 3300053098 Ga0500650_0006577 Ga0500650_0006577_2867_3883 337
959 3300053104 Ga0500556_0000047 Ga0500556_0000047_10108_11124 337
960 3300053119 Ga0500595_003841 Ga0500595_003841_363_1385 337
961 3300053119 Ga0500595_023858 Ga0500595_023858_779_1798 337
962 3300053122 Ga0500608_015167 Ga0500608_015167_464_1477 337
963 3300053125 Ga0500618_011635 Ga0500618_011635_90_1103 337
964 3300053130 Ga0500642_0000142 Ga0500642_0000142_5411_6427 337
965 3300053131 Ga0500652_001628 Ga0500652_001628_5326_6342 337
966 3300053136 Ga0500559_0000105 Ga0500559_0000105_27639_28652 337
967 3300053136 Ga0500559_0001644 Ga0500559_0001644_9401_10471 337
968 3300053139 Ga0500568_0010399 Ga0500568_0010399_2291_3307 337
969 3300053142 Ga0500577_0000991 Ga0500577_0000991_5801_6817 337
970 3300053150 Ga0500603_000576 Ga0500603_000576_2552_3571 337
971 3300053151 Ga0500604_0002170 Ga0500604_0002170_2960_3976 337
972 3300053153 Ga0500616_0000784 Ga0500616_0000784_25269_26285 337
973 3300053156 Ga0500622_0002394 Ga0500622_0002394_11480_12496 337
974 3300053158 Ga0500627_0098195 Ga0500627_0098195_158_1174 337
975 3300053162 Ga0500638_000230 Ga0500638_000230_7819_8841 337
976 3300053177 Ga0500636_0003094 Ga0500636_0003094_7453_8466 337
977 3300053177 Ga0500636_0104233 Ga0500636_0104233_126_1145 337
978 3300053178 Ga0500637_0001711 Ga0500637_0001711_8189_9208 337
979 3300053178 Ga0500637_0003917 Ga0500637_0003917_2470_3492 337
980 3300053730 Ga0500645_007739 Ga0500645_007739_1322_2341 337
981 3300053735 Ga0500596_003966 Ga0500596_003966_1481_2551 337
982 3300054114 Ga0501084_0008150 Ga0501084_0008150_3877_4893 337
983 3300055283 Ga0500661_000294 Ga0500661_000294_6511_7533 337
984 3300060353 Ga0501082_0005663 Ga0501082_0005663_2936_3952 337
985 3300061734 Ga0530510_0214055 Ga0530510_0214055_401_1420 337
986 iso_pu_bacteria 8019565922 8019571604 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

2

185

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9176 1 334
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.9176 2 334
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9113 1 334
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9096 1 334
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9034 1 334
ID Description Score Start End Superfamily
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9164 1 334 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9162 1 330 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9083 1 334 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9056 1 330 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8972 2 332 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1H4ZNQ5-F1-model_v4 Luciferase family oxidoreductase, group 1 0.9752 1 337 GO:0005829
GO:0016705
AF-A0A1H4ZNQ5-F1-model_v4 Luciferase family oxidoreductase, group 1 0.9723 1 337 GO:0005829
GO:0016705
AF-A0A7C9RFL3-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.962 68 332 GO:0005829
GO:0016705
AF-A0A537S3K2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9615 65 334 GO:0005829
GO:0016705
AF-A0A401U2I4-F1-model_v4 Luciferase-like domain-containing protein 0.9613 208 337 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
90.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map