F487523

General Info

Members Datasets Scaffolds Average Seq Length
986 371 984 141

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10278835|Ga0105251_102788352
Length 142
Sequence MFKLDSTQLWVHDQDEALAFYTEKLGLELREDVTVPELGNFRWLTVGPVGQDISIVLMAISGAPVLDEDSNRQIHELMGKGYAGTVFLTTDDCRASYEDLKARGVEFTTAPEEMPYGIDSGFRDPSGNSIRLTQVTQQFAAL

Samples

Sample ID Description Type Environment
1 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
2 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
141 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
215 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
230 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 2.13
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 6.29
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1041088 3300001904 Bacteria 711
2 JGI24737J22298_10189957 3300001990 Bacteria 606
3 JGI24737J22298_10267160 3300001990 Bacteria 506
4 JGI24743J22301_10026714 3300001991 Bacteria 1125
5 JGI24750J21931_1036962 3300002070 Bacteria 732
6 JGI24738J21930_10029403 3300002075 Bacteria 1123
7 JGI24034J26672_10052795 3300002239 Bacteria 702
8 Ga0006778J45830_1037705 3300003162 Bacteria 510
9 Ga0006759J45824_1024331 3300003163 Bacteria 516
10 JGI25406J46586_10009040 3300003203 Bacteria 4479
11 JGI25407J50210_10085528 3300003373 Bacteria 782
12 Ga0006781J51513_1023272 3300003568 Bacteria 500
13 Ga0007409J51694_1021205 3300003575 Bacteria 507
14 Ga0007416J51690_1022293 3300003577 Bacteria 542
15 Ga0007416J51690_1113228 3300003577 Bacteria 582
16 Ga0007429J51699_1059757 3300003579 Bacteria 538
17 Ga0070658_10037074 3300005327 Bacteria 3929
18 Ga0070683_100003913 3300005329 Bacteria 12172
19 Ga0070683_100020290 3300005329 Bacteria 5913
20 Ga0070683_100088509 3300005329 Bacteria 2905
21 Ga0070683_101010823 3300005329 Bacteria 798
22 Ga0070683_101230263 3300005329 Bacteria 720
23 Ga0070670_100338572 3300005331 Bacteria 1320
24 Ga0070670_101185308 3300005331 Bacteria 698
25 Ga0068869_100053839 3300005334 Unclassified 2927
26 Ga0068869_100123788 3300005334 Bacteria 1981
27 Ga0068869_100808870 3300005334 Bacteria 806
28 Ga0070666_10436761 3300005335 Bacteria 944
29 Ga0070680_100161146 3300005336 Bacteria 1885
30 Ga0070680_100177968 3300005336 Bacteria 1791
31 Ga0070680_100681746 3300005336 Bacteria 884
32 Ga0070682_100108542 3300005337 Bacteria 1845
33 Ga0070682_100237601 3300005337 Unclassified 1306
34 Ga0068868_100056769 3300005338 Unclassified 3092
35 Ga0068868_100073458 3300005338 Bacteria 2731
36 Ga0068868_100082636 3300005338 Bacteria 2576
37 Ga0068868_100620860 3300005338 Bacteria 960
38 Ga0070689_100933550 3300005340 Bacteria 769
39 Ga0070689_101351009 3300005340 Bacteria 643
40 Ga0070691_10097784 3300005341 Bacteria 1455
41 Ga0070691_10473765 3300005341 Bacteria 719
42 Ga0070687_100549177 3300005343 Bacteria 786
43 Ga0070687_100629975 3300005343 Bacteria 741
44 Ga0070692_10106039 3300005345 Bacteria 1548
45 Ga0070668_100215138 3300005347 Bacteria 1582
46 Ga0070668_100613627 3300005347 Bacteria 953
47 Ga0070669_100446973 3300005353 Bacteria 1065
48 Ga0070675_100233043 3300005354 Bacteria 1607
49 Ga0070674_100301402 3300005356 Bacteria 1278
50 Ga0070674_100589477 3300005356 Bacteria 938
51 Ga0070674_100757986 3300005356 Bacteria 835
52 Ga0070674_100855681 3300005356 Bacteria 789
53 Ga0070688_100383407 3300005365 Bacteria 1037
54 Ga0070688_101065150 3300005365 Bacteria 645
55 Ga0070659_100018508 3300005366 Bacteria 5255
56 Ga0070659_100042790 3300005366 Bacteria 3542
57 Ga0070659_100229300 3300005366 Bacteria 1535
58 Ga0070659_100433650 3300005366 Bacteria 1112
59 Ga0070667_100257367 3300005367 Bacteria 1562
60 Ga0070667_100307010 3300005367 Bacteria 1429
61 Ga0070667_100429102 3300005367 Bacteria 1206
62 Ga0070709_10368780 3300005434 Bacteria 1065
63 Ga0070709_10438903 3300005434 Unclassified 981
64 Ga0070714_100170478 3300005435 Bacteria 1975
65 Ga0070714_100188355 3300005435 Unclassified 1881
66 Ga0070714_100266527 3300005435 Bacteria 1587
67 Ga0070714_100540607 3300005435 Bacteria 1114
68 Ga0070714_101633332 3300005435 Bacteria 629
69 Ga0070713_100153684 3300005436 Bacteria 2049
70 Ga0070713_100202563 3300005436 Bacteria 1793
71 Ga0070713_100471014 3300005436 Bacteria 1182
72 Ga0070710_10000019 3300005437 Bacteria 88049
73 Ga0070710_10034496 3300005437 Bacteria 2753
74 Ga0070710_10162633 3300005437 Bacteria 1385
75 Ga0070710_10262668 3300005437 Bacteria 1114
76 Ga0070701_10119402 3300005438 Bacteria 1483
77 Ga0070711_100014408 3300005439 Bacteria 4983
78 Ga0070711_100021474 3300005439 Bacteria 4175
79 Ga0070711_100137214 3300005439 Bacteria 1830
80 Ga0070705_100071930 3300005440 Bacteria 2093
81 Ga0070705_100110338 3300005440 Bacteria 1756
82 Ga0070705_100130894 3300005440 Bacteria 1636
83 Ga0070705_100212022 3300005440 Bacteria 1336
84 Ga0070700_100034090 3300005441 Bacteria 3072
85 Ga0070700_100109985 3300005441 Bacteria 1830
86 Ga0070700_100161571 3300005441 Bacteria 1542
87 Ga0070700_100565106 3300005441 Bacteria 886
88 Ga0070700_101251638 3300005441 Bacteria 622
89 Ga0070694_100043447 3300005444 Bacteria 3005
90 Ga0070694_100050878 3300005444 Bacteria 2794
91 Ga0070694_101452139 3300005444 Bacteria 580
92 Ga0070708_100701475 3300005445 Bacteria 952
93 Ga0070662_100092602 3300005457 Bacteria 2272
94 Ga0070662_100214271 3300005457 Bacteria 1534
95 Ga0070662_101894371 3300005457 Bacteria 515
96 Ga0070681_10127450 3300005458 Bacteria 2478
97 Ga0068867_100108050 3300005459 Bacteria 2133
98 Ga0068867_100524032 3300005459 Bacteria 1022
99 Ga0068867_100627217 3300005459 Bacteria 941
100 Ga0068867_101296678 3300005459 Bacteria 672
101 Ga0070685_10176308 3300005466 Bacteria 1373
102 Ga0070685_10711560 3300005466 Bacteria 733
103 Ga0070706_100316554 3300005467 Bacteria 1455
104 Ga0070707_100108509 3300005468 Bacteria 2692
105 Ga0070707_100790285 3300005468 Bacteria 913
106 Ga0070699_100161522 3300005518 Bacteria 1983
107 Ga0070699_100581108 3300005518 Bacteria 1021
108 Ga0070679_101349529 3300005530 Bacteria 659
109 Ga0070684_100004742 3300005535 Bacteria 10386
110 Ga0070684_100095395 3300005535 Bacteria 2650
111 Ga0070684_100681263 3300005535 Bacteria 958
112 Ga0070697_100303359 3300005536 Bacteria 1373
113 Ga0070697_100369743 3300005536 Bacteria 1240
114 Ga0070697_101266823 3300005536 Bacteria 657
115 Ga0068853_100085414 3300005539 Bacteria 2766
116 Ga0070672_100143012 3300005543 Bacteria 1975
117 Ga0070672_100801033 3300005543 Bacteria 829
118 Ga0070686_100046501 3300005544 Bacteria 2739
119 Ga0070686_100653189 3300005544 Bacteria 834
120 Ga0070695_100020842 3300005545 Bacteria 4005
121 Ga0070695_100123996 3300005545 Bacteria 1771
122 Ga0070695_100156209 3300005545 Bacteria 1596
123 Ga0070696_100098041 3300005546 Bacteria 2097
124 Ga0070696_100414364 3300005546 Unclassified 1056
125 Ga0070693_100035424 3300005547 Bacteria 2768
126 Ga0070693_100062472 3300005547 Bacteria 2168
127 Ga0070665_100000040 3300005548 Bacteria 305480
128 Ga0070665_100062446 3300005548 Bacteria 3735
129 Ga0070665_100343462 3300005548 Unclassified 1498
130 Ga0070665_100407376 3300005548 Bacteria 1368
131 Ga0070704_100051941 3300005549 Bacteria 2889
132 Ga0070704_100113095 3300005549 Bacteria 2069
133 Ga0070704_100180507 3300005549 Bacteria 1688
134 Ga0070704_100475194 3300005549 Bacteria 1081
135 Ga0068855_100001116 3300005563 Bacteria 33381
136 Ga0068855_100016543 3300005563 Bacteria 8871
137 Ga0068855_100288270 3300005563 Bacteria 1821
138 Ga0068855_100868502 3300005563 Bacteria 955
139 Ga0070664_100217248 3300005564 Unclassified 1710
140 Ga0070664_100313891 3300005564 Bacteria 1419
141 Ga0070664_101371155 3300005564 Unclassified 668
142 Ga0068857_100001344 3300005577 Bacteria 19383
143 Ga0068857_100189725 3300005577 Bacteria 1872
144 Ga0068857_100310535 3300005577 Unclassified 1455
145 Ga0068854_100001227 3300005578 Bacteria 15386
146 Ga0068854_100135944 3300005578 Bacteria 1882
147 Ga0068854_100324301 3300005578 Bacteria 1253
148 Ga0068854_100419112 3300005578 Bacteria 1112
149 Ga0068856_100010650 3300005614 Bacteria 8935
150 Ga0068856_100217421 3300005614 Bacteria 1926
151 Ga0068856_101870390 3300005614 Bacteria 611
152 Ga0070702_100000693 3300005615 Bacteria 12683
153 Ga0070702_100036760 3300005615 Bacteria 2715
154 Ga0070702_100050546 3300005615 Bacteria 2375
155 Ga0070702_100109987 3300005615 Bacteria 1707
156 Ga0070702_100324680 3300005615 Bacteria 1074
157 Ga0068852_100006167 3300005616 Bacteria 8648
158 Ga0068852_100019170 3300005616 Bacteria 5407
159 Ga0068852_100374892 3300005616 Bacteria 1395
160 Ga0068859_100056438 3300005617 Bacteria 3953
161 Ga0068859_100105189 3300005617 Unclassified 2882
162 Ga0068859_100199282 3300005617 Bacteria 2086
163 Ga0068864_100109640 3300005618 Bacteria 2458
164 Ga0068864_100140959 3300005618 Unclassified 2174
165 Ga0068864_102481669 3300005618 Bacteria 525
166 Ga0068866_10022680 3300005718 Bacteria 2908
167 Ga0068866_10046122 3300005718 Bacteria 2190
168 Ga0068866_10476372 3300005718 Bacteria 821
169 Ga0068861_100073271 3300005719 Bacteria 2660
170 Ga0068861_100268095 3300005719 Bacteria 1465
171 Ga0068861_100461245 3300005719 Bacteria 1141
172 Ga0068861_100642077 3300005719 Bacteria 979
173 Ga0068851_10065830 3300005834 Bacteria 1866
174 Ga0068851_10502056 3300005834 Bacteria 727
175 Ga0068870_10188243 3300005840 Bacteria 1244
176 Ga0068863_100185402 3300005841 Bacteria 1998
177 Ga0068858_100000526 3300005842 Bacteria 40242
178 Ga0068858_100035699 3300005842 Bacteria 4610
179 Ga0068858_100737182 3300005842 Bacteria 960
180 Ga0068860_100199633 3300005843 Bacteria 1938
181 Ga0068860_100616232 3300005843 Bacteria 1092
182 Ga0068862_100169176 3300005844 Bacteria 1956
183 Ga0068862_100219017 3300005844 Bacteria 1722
184 Ga0068862_100725446 3300005844 Bacteria 965
185 Ga0081455_10145630 3300005937 Bacteria 1833
186 Ga0081538_10010525 3300005981 Bacteria 7583
187 Ga0081538_10017145 3300005981 Bacteria 5509
188 Ga0081538_10049873 3300005981 Bacteria 2535
189 Ga0081538_10053403 3300005981 Bacteria 2402
190 Ga0081538_10149235 3300005981 Bacteria 1062
191 Ga0081538_10164941 3300005981 Bacteria 977
192 Ga0081538_10194792 3300005981 Bacteria 843
193 Ga0081538_10281361 3300005981 Bacteria 618
194 Ga0081540_1003252 3300005983 Bacteria 12918
195 Ga0081539_10002244 3300005985 Bacteria 28103
196 Ga0081539_10044903 3300005985 Bacteria 2547
197 Ga0070717_10014008 3300006028 Bacteria 6160
198 Ga0070717_10019885 3300006028 Bacteria 5272
199 Ga0070717_10077302 3300006028 Bacteria 2787
200 Ga0070717_10172135 3300006028 Bacteria 1884
201 Ga0075365_10005157 3300006038 Bacteria 7021
202 Ga0075365_10060380 3300006038 Bacteria 2529
203 Ga0075363_100350855 3300006048 Bacteria 862
204 Ga0075364_10045551 3300006051 Bacteria 2855
205 Ga0075432_10107710 3300006058 Bacteria 1036
206 Ga0070715_10004983 3300006163 Bacteria 4399
207 Ga0070715_10373632 3300006163 Bacteria 785
208 Ga0070716_100023088 3300006173 Bacteria 3294
209 Ga0070716_100108640 3300006173 Bacteria 1714
210 Ga0070712_100007865 3300006175 Bacteria 6680
211 Ga0070712_100009456 3300006175 Bacteria 6142
212 Ga0070712_100162301 3300006175 Bacteria 1726
213 Ga0070712_100247362 3300006175 Bacteria 1423
214 Ga0070712_100665268 3300006175 Bacteria 886
215 Ga0097621_100134188 3300006237 Bacteria 2110
216 Ga0097621_100339742 3300006237 Bacteria 1333
217 Ga0097621_100421803 3300006237 Bacteria 1198
218 Ga0097621_100883173 3300006237 Bacteria 832
219 Ga0068871_100095998 3300006358 Bacteria 2476
220 Ga0068871_100232098 3300006358 Unclassified 1602
221 Ga0068871_100342292 3300006358 Bacteria 1321
222 Ga0068871_101882466 3300006358 Bacteria 569
223 Ga0075428_100051095 3300006844 Bacteria 4533
224 Ga0075428_100112498 3300006844 Bacteria 2965
225 Ga0075428_100492253 3300006844 Bacteria 1312
226 Ga0075428_101276631 3300006844 Bacteria 773
227 Ga0075428_101418314 3300006844 Bacteria 729
228 Ga0075430_100015802 3300006846 Bacteria 6428
229 Ga0075430_100209413 3300006846 Bacteria 1618
230 Ga0075430_100488650 3300006846 Bacteria 1016
231 Ga0075431_100000056 3300006847 Bacteria 62721
232 Ga0075431_100005114 3300006847 Bacteria 12905
233 Ga0075431_101251217 3300006847 Bacteria 704
234 Ga0075431_101454432 3300006847 Bacteria 644
235 Ga0075433_10001182 3300006852 Bacteria 18987
236 Ga0075433_10004243 3300006852 Bacteria 11133
237 Ga0075433_10120143 3300006852 Bacteria 2333
238 Ga0075433_10193583 3300006852 Bacteria 1809
239 Ga0075434_100000502 3300006871 Bacteria 29641
240 Ga0075434_100014188 3300006871 Bacteria 7612
241 Ga0075434_100081498 3300006871 Bacteria 3233
242 Ga0075434_100420919 3300006871 Bacteria 1357
243 Ga0075429_100005701 3300006880 Bacteria 10743
244 Ga0068865_100045584 3300006881 Bacteria 3006
245 Ga0068865_100118747 3300006881 Bacteria 1963
246 Ga0068865_100946149 3300006881 Bacteria 752
247 Ga0075436_100019752 3300006914 Bacteria 4620
248 Ga0075436_100042988 3300006914 Bacteria 3115
249 Ga0097620_100056440 3300006931 Bacteria 3953
250 Ga0097620_100105191 3300006931 Unclassified 2882
251 Ga0097620_100199296 3300006931 Bacteria 2086
252 Ga0075435_100024172 3300007076 Bacteria 4711
253 Ga0075435_100024209 3300007076 Bacteria 4708
254 Ga0075435_101301764 3300007076 Bacteria 636
255 Ga0105251_10102314 3300009011 Bacteria 1309
256 Ga0105251_10278835 3300009011 Bacteria 756
257 Ga0105244_10213607 3300009036 Bacteria 907
258 Ga0105244_10290152 3300009036 Bacteria 758
259 Ga0105250_10241255 3300009092 Bacteria 771
260 Ga0105240_10044418 3300009093 Bacteria 5645
261 Ga0105240_11032037 3300009093 Bacteria 878
262 Ga0105240_11914395 3300009093 Bacteria 617
263 Ga0111539_10035210 3300009094 Bacteria 6063
264 Ga0111539_10604528 3300009094 Bacteria 1277
265 Ga0111539_11442083 3300009094 Bacteria 798
266 Ga0111539_11472080 3300009094 Bacteria 790
267 Ga0111539_11515109 3300009094 Bacteria 778
268 Ga0105245_10000310 3300009098 Bacteria 46567
269 Ga0105245_10039338 3300009098 Bacteria 4209
270 Ga0105245_10102221 3300009098 Bacteria 2654
271 Ga0105245_10118493 3300009098 Bacteria 2470
272 Ga0105245_10138126 3300009098 Bacteria 2293
273 Ga0105245_10263653 3300009098 Bacteria 1678
274 Ga0105245_10612336 3300009098 Bacteria 1116
275 Ga0105245_10811186 3300009098 Bacteria 974
276 Ga0105245_11344811 3300009098 Bacteria 764
277 Ga0105245_12679551 3300009098 Bacteria 552
278 Ga0105247_10034222 3300009101 Bacteria 3094
279 Ga0105247_10078979 3300009101 Bacteria 2070
280 Ga0114129_10026448 3300009147 Bacteria 8215
281 Ga0114129_10031528 3300009147 Bacteria 7492
282 Ga0114129_10108772 3300009147 Bacteria 3827
283 Ga0114129_10182955 3300009147 Bacteria 2850
284 Ga0114129_10364248 3300009147 Bacteria 1912
285 Ga0114129_11084960 3300009147 Bacteria 1003
286 Ga0114129_11225138 3300009147 Bacteria 934
287 Ga0114129_11557652 3300009147 Bacteria 810
288 Ga0114129_13070603 3300009147 Bacteria 547
289 Ga0105243_10036928 3300009148 Bacteria 3795
290 Ga0105243_10161469 3300009148 Bacteria 1932
291 Ga0105243_10163828 3300009148 Bacteria 1919
292 Ga0105243_10226522 3300009148 Bacteria 1656
293 Ga0105243_10336663 3300009148 Bacteria 1381
294 Ga0105243_10623382 3300009148 Bacteria 1041
295 Ga0105243_10748148 3300009148 Bacteria 958
296 Ga0105243_11485162 3300009148 Bacteria 701
297 Ga0105241_10000679 3300009174 Bacteria 25627
298 Ga0105241_10660615 3300009174 Bacteria 950
299 Ga0105241_10729215 3300009174 Bacteria 907
300 Ga0105241_11083573 3300009174 Bacteria 753
301 Ga0105241_11230937 3300009174 Bacteria 710
302 Ga0105241_12607157 3300009174 Bacteria 508
303 Ga0105242_10051814 3300009176 Bacteria 3346
304 Ga0105242_10303250 3300009176 Unclassified 1459
305 Ga0105242_10346191 3300009176 Bacteria 1371
306 Ga0105242_10403565 3300009176 Bacteria 1276
307 Ga0105242_11009281 3300009176 Bacteria 840
308 Ga0105248_10572955 3300009177 Bacteria 1274
309 Ga0105248_10593701 3300009177 Bacteria 1249
310 Ga0105248_10812669 3300009177 Bacteria 1055
311 Ga0105237_10021862 3300009545 Bacteria 6570
312 Ga0105237_10298520 3300009545 Bacteria 1614
313 Ga0105237_10485531 3300009545 Bacteria 1242
314 Ga0105238_10007746 3300009551 Bacteria 10740
315 Ga0105238_10192480 3300009551 Bacteria 2015
316 Ga0105238_10767972 3300009551 Bacteria 978
317 Ga0105238_11071342 3300009551 Bacteria 828
318 Ga0105238_11172428 3300009551 Bacteria 792
319 Ga0105249_10010497 3300009553 Bacteria 8138
320 Ga0105249_10040209 3300009553 Bacteria 4247
321 Ga0105249_10054663 3300009553 Bacteria 3652
322 Ga0105249_10201395 3300009553 Bacteria 1948
323 Ga0105249_10307074 3300009553 Bacteria 1593
324 Ga0105249_10606684 3300009553 Bacteria 1149
325 Ga0105249_10908721 3300009553 Bacteria 947
326 Ga0105249_12575738 3300009553 Bacteria 581
327 Ga0105239_10083208 3300010375 Bacteria 3524
328 Ga0105239_10106602 3300010375 Bacteria 3104
329 Ga0105239_10170939 3300010375 Bacteria 2430
330 Ga0105239_11130894 3300010375 Bacteria 902
331 Ga0105239_11966776 3300010375 Bacteria 678
332 Ga0105239_12124458 3300010375 Bacteria 653
333 Ga0105246_10034823 3300011119 Bacteria 3359
334 Ga0105246_11132305 3300011119 Bacteria 716
335 Ga0157373_10552407 3300013100 Bacteria 835
336 Ga0157371_10052919 3300013102 Bacteria 2883
337 Ga0157371_10276356 3300013102 Bacteria 1213
338 Ga0157370_10092263 3300013104 Bacteria 2842
339 Ga0157369_10097074 3300013105 Bacteria 3143
340 Ga0157369_10282664 3300013105 Bacteria 1728
341 Ga0157369_11308463 3300013105 Bacteria 739
342 Ga0157374_10029322 3300013296 Bacteria 4981
343 Ga0157374_10097074 3300013296 Bacteria 2819
344 Ga0157374_10238233 3300013296 Bacteria 1789
345 Ga0157374_11200312 3300013296 Unclassified 780
346 Ga0157378_10015831 3300013297 Bacteria 6603
347 Ga0157378_10126081 3300013297 Unclassified 2365
348 Ga0157378_10205933 3300013297 Bacteria 1863
349 Ga0157378_10391500 3300013297 Bacteria 1367
350 Ga0157378_10644279 3300013297 Bacteria 1075
351 Ga0163162_10264022 3300013306 Bacteria 1853
352 Ga0163162_10266223 3300013306 Bacteria 1845
353 Ga0163162_10539399 3300013306 Bacteria 1295
354 Ga0157372_10790502 3300013307 Bacteria 1103
355 Ga0157372_10944843 3300013307 Bacteria 999
356 Ga0157372_11997687 3300013307 Bacteria 666
357 Ga0157375_10378068 3300013308 Bacteria 1583
358 Ga0157375_10593467 3300013308 Bacteria 1267
359 Ga0157375_10698404 3300013308 Bacteria 1168
360 Ga0157375_10869396 3300013308 Bacteria 1047
361 Ga0157375_11549163 3300013308 Bacteria 783
362 Ga0163163_10047977 3300014325 Bacteria 4198
363 Ga0163163_10220177 3300014325 Bacteria 1947
364 Ga0157380_10363266 3300014326 Bacteria 1359
365 Ga0157380_10547672 3300014326 Unclassified 1134
366 Ga0157380_11085532 3300014326 Bacteria 839
367 Ga0157377_10013230 3300014745 Bacteria 4173
368 Ga0157377_10100441 3300014745 Bacteria 1723
369 Ga0157379_10105162 3300014968 Bacteria 2533
370 Ga0157379_10124071 3300014968 Unclassified 2324
371 Ga0157379_10345836 3300014968 Bacteria 1361
372 Ga0157379_10535650 3300014968 Bacteria 1088
373 Ga0157376_10157513 3300014969 Bacteria 2055
374 Ga0163161_10054622 3300017792 Bacteria 2899
375 Ga0163161_10295209 3300017792 Bacteria 1275
376 Ga0197907_10563192 3300020069 Bacteria 958
377 Ga0206356_10463577 3300020070 Bacteria 845
378 Ga0206349_1547479 3300020075 Bacteria 514
379 Ga0206355_1047451 3300020076 Unclassified 872
380 Ga0206352_10031256 3300020078 Bacteria 504
381 Ga0206352_10282433 3300020078 Bacteria 546
382 Ga0206352_10397907 3300020078 Bacteria 950
383 Ga0206352_11008601 3300020078 Bacteria 724
384 Ga0206354_10533889 3300020081 Bacteria 1410
385 Ga0206353_10343017 3300020082 Bacteria 1272
386 Ga0206353_11951656 3300020082 Unclassified 545
387 Ga0213874_10001344 3300021377 Bacteria 5079
388 Ga0213874_10265885 3300021377 Bacteria 636
389 Ga0213876_10002583 3300021384 Bacteria 10580
390 Ga0213876_10012527 3300021384 Bacteria 4512
391 Ga0213876_10033207 3300021384 Unclassified 2721
392 Ga0213876_10112189 3300021384 Bacteria 1447
393 Ga0213876_10347355 3300021384 Bacteria 789
394 Ga0213875_10120252 3300021388 Bacteria 1227
395 Ga0213875_10402186 3300021388 Bacteria 653
396 Ga0224712_10179060 3300022467 Unclassified 954
397 Ga0224712_10182999 3300022467 Bacteria 945
398 Ga0224712_10187218 3300022467 Bacteria 935
399 Ga0207653_10021070 3300025885 Bacteria 2067
400 Ga0207692_10400697 3300025898 Bacteria 855
401 Ga0207692_10416578 3300025898 Bacteria 840
402 Ga0207642_10073738 3300025899 Bacteria 1633
403 Ga0207642_10183566 3300025899 Bacteria 1142
404 Ga0207642_10265415 3300025899 Bacteria 981
405 Ga0207710_10000198 3300025900 Bacteria 56537
406 Ga0207710_10470070 3300025900 Bacteria 651
407 Ga0207710_10599109 3300025900 Bacteria 576
408 Ga0207688_10005722 3300025901 Bacteria 6763
409 Ga0207688_10007830 3300025901 Bacteria 5814
410 Ga0207688_10029944 3300025901 Bacteria 3001
411 Ga0207688_10551339 3300025901 Bacteria 724
412 Ga0207680_10061579 3300025903 Bacteria 2289
413 Ga0207680_10247046 3300025903 Bacteria 1231
414 Ga0207680_10423829 3300025903 Bacteria 943
415 Ga0207680_10758642 3300025903 Bacteria 695
416 Ga0207647_10004931 3300025904 Bacteria 9838
417 Ga0207647_10048000 3300025904 Bacteria 2653
418 Ga0207685_10134202 3300025905 Bacteria 1102
419 Ga0207685_10251288 3300025905 Bacteria 855
420 Ga0207699_10067578 3300025906 Bacteria 2173
421 Ga0207699_10176175 3300025906 Bacteria 1434
422 Ga0207643_10161042 3300025908 Bacteria 1350
423 Ga0207643_10234172 3300025908 Bacteria 1127
424 Ga0207643_10316848 3300025908 Bacteria 973
425 Ga0207654_10002912 3300025911 Bacteria 8677
426 Ga0207654_10053277 3300025911 Bacteria 2335
427 Ga0207707_10145773 3300025912 Bacteria 2070
428 Ga0207695_10001784 3300025913 Bacteria 33946
429 Ga0207695_10933768 3300025913 Bacteria 747
430 Ga0207671_10000197 3300025914 Bacteria 93773
431 Ga0207671_10195635 3300025914 Bacteria 1578
432 Ga0207671_10464031 3300025914 Bacteria 1009
433 Ga0207693_10002971 3300025915 Bacteria 14681
434 Ga0207693_10003330 3300025915 Bacteria 13751
435 Ga0207693_10003815 3300025915 Bacteria 12833
436 Ga0207693_10010007 3300025915 Bacteria 7707
437 Ga0207693_10022277 3300025915 Bacteria 5035
438 Ga0207693_10200204 3300025915 Bacteria 1571
439 Ga0207663_10034129 3300025916 Bacteria 3039
440 Ga0207663_10037526 3300025916 Bacteria 2921
441 Ga0207663_10104496 3300025916 Bacteria 1910
442 Ga0207663_10785958 3300025916 Bacteria 757
443 Ga0207660_10148428 3300025917 Bacteria 1799
444 Ga0207660_10380778 3300025917 Unclassified 1134
445 Ga0207662_10010673 3300025918 Bacteria 5079
446 Ga0207662_10021797 3300025918 Bacteria 3666
447 Ga0207662_10041129 3300025918 Bacteria 2720
448 Ga0207662_10175993 3300025918 Bacteria 1375
449 Ga0207657_10026284 3300025919 Bacteria 5352
450 Ga0207657_10060948 3300025919 Bacteria 3237
451 Ga0207657_10263096 3300025919 Bacteria 1372
452 Ga0207657_10350054 3300025919 Bacteria 1165
453 Ga0207649_10283682 3300025920 Bacteria 1205
454 Ga0207652_10103685 3300025921 Bacteria 2515
455 Ga0207652_10509028 3300025921 Bacteria 1083
456 Ga0207646_10094519 3300025922 Bacteria 2677
457 Ga0207646_10573095 3300025922 Bacteria 1014
458 Ga0207694_10001211 3300025924 Bacteria 22390
459 Ga0207694_10257383 3300025924 Bacteria 1429
460 Ga0207694_10269548 3300025924 Bacteria 1396
461 Ga0207694_10612435 3300025924 Bacteria 916
462 Ga0207650_10167172 3300025925 Bacteria 1746
463 Ga0207650_10947562 3300025925 Bacteria 731
464 Ga0207659_10767205 3300025926 Bacteria 828
465 Ga0207659_11439575 3300025926 Bacteria 590
466 Ga0207687_10000079 3300025927 Bacteria 70683
467 Ga0207687_10028547 3300025927 Bacteria 3748
468 Ga0207687_10064043 3300025927 Bacteria 2605
469 Ga0207687_10827316 3300025927 Bacteria 790
470 Ga0207687_10934629 3300025927 Bacteria 743
471 Ga0207700_10093377 3300025928 Bacteria 2381
472 Ga0207700_10146896 3300025928 Bacteria 1944
473 Ga0207700_11406593 3300025928 Bacteria 620
474 Ga0207664_10001134 3300025929 Bacteria 17735
475 Ga0207664_10172999 3300025929 Unclassified 1849
476 Ga0207664_10187607 3300025929 Bacteria 1778
477 Ga0207644_11780051 3300025931 Bacteria 516
478 Ga0207690_10111464 3300025932 Bacteria 1971
479 Ga0207690_10233820 3300025932 Bacteria 1412
480 Ga0207690_10300422 3300025932 Bacteria 1256
481 Ga0207706_10237778 3300025933 Bacteria 1592
482 Ga0207706_10545729 3300025933 Bacteria 998
483 Ga0207706_10550866 3300025933 Bacteria 993
484 Ga0207706_10732224 3300025933 Bacteria 843
485 Ga0207686_10127646 3300025934 Bacteria 1740
486 Ga0207686_10189397 3300025934 Unclassified 1465
487 Ga0207686_10215931 3300025934 Bacteria 1382
488 Ga0207686_10699581 3300025934 Bacteria 805
489 Ga0207709_10012033 3300025935 Bacteria 4772
490 Ga0207709_10097723 3300025935 Bacteria 1935
491 Ga0207709_10434716 3300025935 Bacteria 1011
492 Ga0207709_10603842 3300025935 Bacteria 869
493 Ga0207670_10306170 3300025936 Bacteria 1246
494 Ga0207670_10321206 3300025936 Bacteria 1218
495 Ga0207669_10080936 3300025937 Bacteria 2079
496 Ga0207669_10325418 3300025937 Bacteria 1178
497 Ga0207669_10763840 3300025937 Bacteria 799
498 Ga0207704_10016079 3300025938 Bacteria 3835
499 Ga0207704_10358788 3300025938 Bacteria 1137
500 Ga0207665_10015801 3300025939 Bacteria 4954
501 Ga0207665_10018884 3300025939 Bacteria 4530
502 Ga0207665_10056454 3300025939 Bacteria 2650
503 Ga0207691_10105655 3300025940 Unclassified 2508
504 Ga0207691_10290253 3300025940 Bacteria 1407
505 Ga0207711_10416876 3300025941 Bacteria 1249
506 Ga0207711_10676800 3300025941 Bacteria 962
507 Ga0207711_10902765 3300025941 Bacteria 821
508 Ga0207711_11097845 3300025941 Bacteria 736
509 Ga0207689_10023351 3300025942 Bacteria 5192
510 Ga0207689_10057511 3300025942 Bacteria 3199
511 Ga0207661_10000564 3300025944 Bacteria 23651
512 Ga0207661_10009112 3300025944 Bacteria 7115
513 Ga0207661_10181895 3300025944 Bacteria 1837
514 Ga0207661_11410492 3300025944 Bacteria 639
515 Ga0207679_10284669 3300025945 Bacteria 1419
516 Ga0207667_10087198 3300025949 Bacteria 3229
517 Ga0207667_10204827 3300025949 Bacteria 2023
518 Ga0207667_10553328 3300025949 Bacteria 1163
519 Ga0207651_10277711 3300025960 Unclassified 1383
520 Ga0207712_10027026 3300025961 Bacteria 3829
521 Ga0207712_10107784 3300025961 Bacteria 2084
522 Ga0207712_10191122 3300025961 Bacteria 1616
523 Ga0207712_10434010 3300025961 Bacteria 1111
524 Ga0207712_10567584 3300025961 Bacteria 978
525 Ga0207712_11743226 3300025961 Bacteria 558
526 Ga0207668_10151458 3300025972 Bacteria 1796
527 Ga0207668_10191013 3300025972 Bacteria 1623
528 Ga0207668_10255127 3300025972 Bacteria 1426
529 Ga0207668_12171724 3300025972 Bacteria 500
530 Ga0207640_10027434 3300025981 Bacteria 3469
531 Ga0207640_10042302 3300025981 Bacteria 2904
532 Ga0207640_10194880 3300025981 Bacteria 1530
533 Ga0207640_10483998 3300025981 Bacteria 1027
534 Ga0207658_10230510 3300025986 Bacteria 1563
535 Ga0207658_10472869 3300025986 Bacteria 1113
536 Ga0207677_10326251 3300026023 Bacteria 1278
537 Ga0207677_10366816 3300026023 Bacteria 1211
538 Ga0207677_10487650 3300026023 Bacteria 1063
539 Ga0207677_10547071 3300026023 Bacteria 1008
540 Ga0207703_10000170 3300026035 Bacteria 75814
541 Ga0207703_10178393 3300026035 Bacteria 1873
542 Ga0207703_10197493 3300026035 Bacteria 1786
543 Ga0207703_10372024 3300026035 Bacteria 1320
544 Ga0207703_11413064 3300026035 Bacteria 669
545 Ga0207639_10088912 3300026041 Bacteria 2467
546 Ga0207639_11948937 3300026041 Bacteria 548
547 Ga0207678_10022495 3300026067 Bacteria 5521
548 Ga0207708_10042361 3300026075 Bacteria 3471
549 Ga0207708_10046014 3300026075 Bacteria 3324
550 Ga0207708_10055556 3300026075 Bacteria 3019
551 Ga0207708_10311288 3300026075 Bacteria 1283
552 Ga0207702_10022327 3300026078 Bacteria 5246
553 Ga0207702_10033845 3300026078 Bacteria 4271
554 Ga0207702_10129722 3300026078 Bacteria 2267
555 Ga0207702_10151986 3300026078 Bacteria 2107
556 Ga0207702_10406603 3300026078 Unclassified 1314
557 Ga0207648_10046171 3300026089 Bacteria 3819
558 Ga0207648_10160471 3300026089 Bacteria 1985
559 Ga0207648_10614167 3300026089 Bacteria 1003
560 Ga0207648_10960925 3300026089 Bacteria 799
561 Ga0207648_11325630 3300026089 Bacteria 676
562 Ga0207676_10118766 3300026095 Bacteria 2226
563 Ga0207676_10385006 3300026095 Bacteria 1306
564 Ga0207676_10886352 3300026095 Bacteria 874
565 Ga0207674_10005739 3300026116 Bacteria 14722
566 Ga0207674_10052087 3300026116 Bacteria 4175
567 Ga0207674_10379638 3300026116 Bacteria 1366
568 Ga0207674_10590502 3300026116 Bacteria 1073
569 Ga0207674_11357181 3300026116 Bacteria 680
570 Ga0207675_100001665 3300026118 Bacteria 22230
571 Ga0207675_100020645 3300026118 Bacteria 6140
572 Ga0207675_100048217 3300026118 Bacteria 3977
573 Ga0207675_100100450 3300026118 Bacteria 2725
574 Ga0207683_10023905 3300026121 Bacteria 5258
575 Ga0207683_10062369 3300026121 Bacteria 3283
576 Ga0207698_10464099 3300026142 Bacteria 1225
577 Ga0207698_10634378 3300026142 Bacteria 1057
578 Ga0207698_10916071 3300026142 Bacteria 884
579 Ga0207428_10064344 3300027907 Bacteria 2895
580 Ga0207428_10489767 3300027907 Bacteria 894
581 Ga0207428_10560449 3300027907 Bacteria 826
582 Ga0207428_10580101 3300027907 Bacteria 809
583 Ga0268266_10000045 3300028379 Bacteria 312955
584 Ga0268266_10421124 3300028379 Bacteria 1265
585 Ga0268266_10893774 3300028379 Bacteria 859
586 Ga0268266_11420310 3300028379 Bacteria 670
587 Ga0268265_10314556 3300028380 Bacteria 1415
588 Ga0268265_12522392 3300028380 Bacteria 520
589 Ga0268264_10255556 3300028381 Bacteria 1630
590 Ga0268264_10371931 3300028381 Bacteria 1366
591 Ga0268264_10468765 3300028381 Bacteria 1223
592 Ga0307408_100203358 3300031548 Bacteria 1605
593 Ga0307408_100897731 3300031548 Bacteria 811
594 Ga0307408_101005343 3300031548 Bacteria 769
595 Ga0307408_101316756 3300031548 Bacteria 677
596 Ga0307408_102376551 3300031548 Bacteria 514
597 Ga0316575_10039497 3300031665 Bacteria 1863
598 Ga0316579_10034002 3300031691 Bacteria 2343
599 Ga0316578_10045634 3300031728 Bacteria 2551
600 Ga0307405_10105944 3300031731 Bacteria 1895
601 Ga0307405_11858490 3300031731 Bacteria 536
602 Ga0316577_10011008 3300031733 Bacteria 4893
603 Ga0307413_11022810 3300031824 Bacteria 709
604 Ga0307410_10129466 3300031852 Bacteria 1852
605 Ga0307410_10218813 3300031852 Bacteria 1464
606 Ga0307410_10299039 3300031852 Bacteria 1269
607 Ga0307406_10071107 3300031901 Bacteria 2280
608 Ga0307406_10096765 3300031901 Bacteria 2001
609 Ga0307406_10179602 3300031901 Bacteria 1540
610 Ga0307406_10326082 3300031901 Bacteria 1190
611 Ga0307406_10574233 3300031901 Bacteria 926
612 Ga0307407_10087221 3300031903 Bacteria 1903
613 Ga0307407_10258911 3300031903 Bacteria 1196
614 Ga0307407_10449929 3300031903 Bacteria 934
615 Ga0307407_10953362 3300031903 Bacteria 661
616 Ga0307412_10349085 3300031911 Bacteria 1187
617 Ga0307412_11244143 3300031911 Bacteria 668
618 Ga0307409_100061030 3300031995 Bacteria 2944
619 Ga0307409_100805285 3300031995 Bacteria 947
620 Ga0307409_101284014 3300031995 Bacteria 757
621 Ga0307416_100005048 3300032002 Bacteria 8043
622 Ga0307416_100351876 3300032002 Bacteria 1491
623 Ga0307416_101184855 3300032002 Bacteria 869
624 Ga0307411_10133181 3300032005 Bacteria 1820
625 Ga0307411_10697593 3300032005 Bacteria 884
626 Ga0307415_100003774 3300032126 Bacteria 7765
627 Ga0307415_100254358 3300032126 Bacteria 1429
628 Ga0307415_100271791 3300032126 Bacteria 1389
629 Ga0307415_100541053 3300032126 Bacteria 1026
630 Ga0307415_100675805 3300032126 Bacteria 929
631 Ga0307415_100981448 3300032126 Bacteria 784
632 Ga0316583_10096512 3300032133 Bacteria 1031
633 Ga0316585_10033830 3300032137 Bacteria 1613
634 Ga0316580_10003048 3300032139 Bacteria 4716
635 Ga0307507_10000002 3300033179 Bacteria 388650
636 Ga0373930_0028490 3300034816 Bacteria 1137
637 Ga0373958_0063457 3300034819 Bacteria 805
638 Ga0373938_0017421 3300034957 Bacteria 1415
639 Ga0373928_0009209 3300035084 Bacteria 1926
640 Ga0373928_0020131 3300035084 Bacteria 1397
641 Ga0373940_0009586 3300035088 Unclassified 2254
642 Ga0373949_0005837 3300035090 Bacteria 2737
643 Ga0373949_0017956 3300035090 Bacteria 1599
644 Ga0373951_0001215 3300035091 Bacteria 6806
645 Ga0373951_0094636 3300035091 Bacteria 787
646 Ga0373952_0011729 3300035092 Bacteria 1714
647 Ga0373952_0044120 3300035092 Bacteria 1041
648 Ga0373932_0037699 3300035112 Bacteria 1379
649 Ga0373932_0185023 3300035112 Bacteria 733
650 Ga0373939_0172897 3300035114 Bacteria 801
651 Ga0373941_0012534 3300035115 Bacteria 2220
652 Ga0373941_0020385 3300035115 Bacteria 1858
653 Ga0373960_0022869 3300035121 Bacteria 1679
654 Ga0373960_0159378 3300035121 Bacteria 776
655 Ga0373961_0022802 3300035241 Unclassified 1678
656 Ga0373961_0030109 3300035241 Bacteria 1508
657 Ga0373961_0059451 3300035241 Bacteria 1156
658 Ga0373962_0005923 3300035242 Bacteria 2953
659 Ga0373962_0008566 3300035242 Bacteria 2518
660 Ga0316574_0031022 3300035398 Bacteria 3240
661 Ga0373931_0007664 3300035691 Bacteria 5092
662 Ga0373931_0018020 3300035691 Bacteria 3503
663 Ga0316582_0001763 3300036647 Bacteria 9750
664 Ga0316584_0003336 3300036712 Bacteria 10405
665 Ga0395899_0005234 3300037312 Bacteria 10084
666 Ga0395899_0044539 3300037312 Bacteria 3306
667 Ga0395899_0123030 3300037312 Bacteria 1857
668 Ga0395899_0259225 3300037312 Bacteria 1190
669 Ga0395900_0028444 3300037418 Bacteria 5725
670 Ga0395900_0108875 3300037418 Bacteria 2846
671 Ga0395900_0143644 3300037418 Bacteria 2442
672 Ga0395900_0455341 3300037418 Bacteria 1235
673 Ga0395900_0629335 3300037418 Bacteria 1011
674 Ga0395900_0656347 3300037418 Bacteria 985
675 Ga0395900_1134867 3300037418 Bacteria 698
676 Ga0395898_0002122 3300037466 Bacteria 24478
677 Ga0395898_0006483 3300037466 Bacteria 12498
678 Ga0395898_0051456 3300037466 Bacteria 4028
679 Ga0395898_0056060 3300037466 Bacteria 3843
680 Ga0395898_0117207 3300037466 Bacteria 2551
681 Ga0395898_0206145 3300037466 Bacteria 1876
682 Ga0395898_0396966 3300037466 Bacteria 1315
683 Ga0395905_0014338 3300037471 Bacteria 7573
684 Ga0395905_0018000 3300037471 Bacteria 6708
685 Ga0395905_0021206 3300037471 Bacteria 6149
686 Ga0395905_0039441 3300037471 Bacteria 4431
687 Ga0395905_1025689 3300037471 Bacteria 728
688 Ga0316581_0091007 3300037588 Bacteria 939
689 Ga0436364_0294314 3300037853 Bacteria 5626
690 Ga0436364_0474541 3300037853 Bacteria 1060
691 Ga0436364_0648428 3300037853 Bacteria 15392
692 Ga0436364_0914577 3300037853 Bacteria 2100
693 Ga0436364_1093687 3300037853 Bacteria 2294
694 Ga0395901_0003904 3300038443 Bacteria 14998
695 Ga0395901_0011202 3300038443 Bacteria 9088
696 Ga0395901_0018541 3300038443 Bacteria 7105
697 Ga0395901_0175644 3300038443 Bacteria 2247
698 Ga0395901_0223750 3300038443 Bacteria 1966
699 Ga0395901_0282958 3300038443 Bacteria 1722
700 Ga0395901_0364051 3300038443 Bacteria 1490
701 Ga0395901_1462651 3300038443 Bacteria 640
702 Ga0436365_1685267 3300039437 Unclassified 3210
703 Ga0436365_1737094 3300039437 Bacteria 9743
704 Ga0436365_1837010 3300039437 Bacteria 19470
705 Ga0436365_1935346 3300039437 Bacteria 1412
706 Ga0436360_0816047 3300039438 Bacteria 576
707 Ga0436363_0425661 3300039450 Bacteria 9513
708 Ga0436363_0508323 3300039450 Bacteria 1427
709 Ga0436363_0548952 3300039450 Bacteria 5887
710 Ga0436363_0582583 3300039450 Bacteria 947
711 Ga0436363_1224953 3300039450 Bacteria 1552
712 Ga0436363_1227349 3300039450 Bacteria 10928
713 Ga0436363_1526926 3300039450 Bacteria 2008
714 Ga0436362_0105352 3300039453 Bacteria 2859
715 Ga0436362_0417099 3300039453 Bacteria 1138
716 Ga0436362_0453746 3300039453 Bacteria 573
717 Ga0436362_0677777 3300039453 Bacteria 1137
718 Ga0451847_0966993 3300041503 Bacteria 595
719 Ga0451853_3052387 3300041512 Bacteria 835
720 Ga0466969_0004337 3300044656 Bacteria 7548
721 Ga0466966_0151446 3300044684 Bacteria 1414
722 Ga0466966_0190198 3300044684 Bacteria 1244
723 Ga0466966_0305458 3300044684 Bacteria 956
724 Ga0466961_0015171 3300044693 Bacteria 4948
725 Ga0466963_0085114 3300044694 Bacteria 2146
726 Ga0466963_0382562 3300044694 Bacteria 992
727 Ga0466964_0563794 3300044706 Bacteria 620
728 Ga0466971_0008645 3300044719 Bacteria 4443
729 Ga0466971_0129877 3300044719 Bacteria 1169
730 Ga0466968_0186668 3300044735 Bacteria 966
731 Ga0466970_0050036 3300044765 Bacteria 2228
732 Ga0466970_0070176 3300044765 Bacteria 1884
733 Ga0466970_0431974 3300044765 Bacteria 754
734 Ga0466957_0173590 3300044842 Bacteria 1405
735 Ga0466957_0576643 3300044842 Bacteria 786
736 Ga0466960_0583923 3300044901 Bacteria 662
737 Ga0466959_0004011 3300045049 Bacteria 9781
738 Ga0466959_0813471 3300045049 Bacteria 624
739 Ga0466958_0060469 3300045836 Bacteria 2306
740 Ga0466958_0342416 3300045836 Bacteria 962
741 Ga0466967_0039980 3300045976 Bacteria 4035
742 Ga0466967_0064780 3300045976 Bacteria 3251
743 Ga0466967_0733819 3300045976 Bacteria 979
744 Ga0466967_0987569 3300045976 Bacteria 838
745 Ga0466967_2361735 3300045976 Bacteria 527
746 Ga0495592_0045230 3300046454 Bacteria 3286
747 Ga0495592_0391808 3300046454 Bacteria 882
748 Ga0495629_0150571 3300046459 Bacteria 1617
749 Ga0495641_0043173 3300046461 Bacteria 2086
750 Ga0495651_0069980 3300046462 Bacteria 2670
751 Ga0495651_0357113 3300046462 Bacteria 964
752 Ga0495653_0460022 3300046463 Bacteria 799
753 Ga0495608_0377856 3300046511 Bacteria 869
754 Ga0495608_0866219 3300046511 Bacteria 530
755 Ga0495628_0004295 3300046516 Bacteria 12674
756 Ga0495628_0061217 3300046516 Bacteria 2952
757 Ga0495628_0081217 3300046516 Bacteria 2518
758 Ga0495628_0134693 3300046516 Bacteria 1889
759 Ga0495630_0034398 3300046517 Bacteria 3784
760 Ga0495630_0154488 3300046517 Bacteria 1747
761 Ga0495630_0384798 3300046517 Bacteria 1075
762 Ga0495663_0031588 3300046525 Bacteria 1574
763 Ga0495663_0201365 3300046525 Bacteria 695
764 Ga0495642_0068526 3300046528 Bacteria 1481
765 Ga0495652_0014337 3300046529 Bacteria 7115
766 Ga0495652_0805147 3300046529 Bacteria 625
767 Ga0495665_0149217 3300046531 Bacteria 1221
768 Ga0495665_0222202 3300046531 Bacteria 976
769 Ga0495586_0005249 3300046535 Bacteria 6932
770 Ga0495645_0089874 3300046543 Bacteria 2196
771 Ga0495656_0354407 3300046615 Unclassified 761
772 Ga0495668_0635748 3300046616 Bacteria 590
773 Ga0495634_0034600 3300046642 Bacteria 3466
774 Ga0495634_0040347 3300046642 Bacteria 3176
775 Ga0495634_0096587 3300046642 Bacteria 1913
776 Ga0495635_0000005 3300046663 Bacteria 302178
777 Ga0495588_0711142 3300046674 Bacteria 525
778 Ga0495657_0230042 3300046675 Bacteria 1122
779 Ga0495647_0045025 3300046681 Bacteria 1694
780 Ga0495658_0291760 3300046683 Bacteria 1031
781 Ga0495658_0416370 3300046683 Bacteria 857
782 Ga0495613_0037674 3300046689 Bacteria 3585
783 Ga0495624_0002016 3300046690 Bacteria 15463
784 Ga0495624_0102063 3300046690 Bacteria 1766
785 Ga0495600_0012189 3300046809 Bacteria 5369
786 Ga0495581_0139150 3300047315 Bacteria 1416
787 Ga0495581_0208110 3300047315 Bacteria 1144
788 Ga0495604_0336120 3300047317 Bacteria 1006
789 Ga0495674_0033720 3300047319 Bacteria 4634
790 Ga0495674_0208861 3300047319 Bacteria 1618
791 Ga0495674_0252195 3300047319 Bacteria 1452
792 Ga0495674_0725982 3300047319 Bacteria 778
793 Ga0495676_0000136 3300047321 Bacteria 55706
794 Ga0495676_0327823 3300047321 Bacteria 1027
795 Ga0495676_0646898 3300047321 Bacteria 686
796 Ga0495676_0821062 3300047321 Bacteria 598
797 Ga0495680_0647797 3300047322 Bacteria 702
798 Ga0495679_016258 3300047446 Bacteria 2695
799 Ga0495593_0499949 3300047673 Bacteria 610
800 Ga0496100_0042568 3300048903 Bacteria 2901
801 Ga0496100_0080228 3300048903 Bacteria 2201
802 Ga0496100_0403775 3300048903 Bacteria 1041
803 Ga0496100_0432692 3300048903 Unclassified 1006
804 Ga0496100_0476741 3300048903 Bacteria 959
805 Ga0496100_0971654 3300048903 Bacteria 668
806 Ga0496101_0005933 3300048904 Bacteria 7823
807 Ga0496101_0056678 3300048904 Bacteria 2833
808 Ga0496101_0141285 3300048904 Unclassified 1835
809 Ga0496102_0205350 3300048905 Bacteria 1857
810 Ga0496102_0304057 3300048905 Bacteria 1503
811 Ga0496102_0329515 3300048905 Bacteria 1438
812 Ga0496102_0579830 3300048905 Bacteria 1044
813 Ga0496102_1811239 3300048905 Bacteria 528
814 Ga0496103_0201261 3300048906 Bacteria 1281
815 Ga0496103_0406440 3300048906 Bacteria 874
816 Ga0496104_0088482 3300048907 Bacteria 2958
817 Ga0496104_0189414 3300048907 Bacteria 1968
818 Ga0496104_0760045 3300048907 Bacteria 876
819 Ga0496105_0017290 3300048908 Bacteria 5778
820 Ga0496105_0120596 3300048908 Bacteria 2163
821 Ga0496106_0000213 3300048909 Bacteria 40340
822 Ga0496106_0055456 3300048909 Bacteria 2995
823 Ga0496106_0074836 3300048909 Bacteria 2593
824 Ga0496106_0120148 3300048909 Bacteria 2053
825 Ga0496106_0170226 3300048909 Bacteria 1726
826 Ga0496106_0384634 3300048909 Bacteria 1127
827 Ga0496106_0759287 3300048909 Unclassified 771
828 Ga0496106_1504486 3300048909 Bacteria 518
829 Ga0496107_0001404 3300048910 Bacteria 14850
830 Ga0496107_0036340 3300048910 Bacteria 3533
831 Ga0496107_0336749 3300048910 Bacteria 1123
832 Ga0496108_0150278 3300048911 Unclassified 2009
833 Ga0496108_0402559 3300048911 Bacteria 1195
834 Ga0496109_0049019 3300048912 Bacteria 3843
835 Ga0496109_0296704 3300048912 Bacteria 1524
836 Ga0496110_0014477 3300048913 Bacteria 6552
837 Ga0496110_0092653 3300048913 Bacteria 2704
838 Ga0496110_0423954 3300048913 Bacteria 1213
839 Ga0496110_0631529 3300048913 Bacteria 970
840 Ga0496110_1162168 3300048913 Bacteria 680
841 Ga0496111_0045429 3300048914 Bacteria 3160
842 Ga0496111_0406305 3300048914 Bacteria 1006
843 Ga0496111_0701046 3300048914 Bacteria 736
844 Ga0496112_0002387 3300048915 Bacteria 15114
845 Ga0496112_0049744 3300048915 Bacteria 4108
846 Ga0496112_0947823 3300048915 Bacteria 782
847 Ga0496113_0009663 3300048916 Bacteria 6335
848 Ga0496113_0245309 3300048916 Unclassified 1429
849 Ga0496113_0450781 3300048916 Bacteria 1034
850 Ga0496114_0012601 3300048917 Bacteria 6774
851 Ga0496114_0042230 3300048917 Bacteria 3779
852 Ga0496114_0079435 3300048917 Bacteria 2769
853 Ga0496114_0121422 3300048917 Bacteria 2247
854 Ga0496114_0144350 3300048917 Bacteria 2063
855 Ga0496114_0318219 3300048917 Unclassified 1375
856 Ga0496114_0341453 3300048917 Bacteria 1324
857 Ga0496114_0458920 3300048917 Bacteria 1128
858 Ga0496115_0022365 3300048918 Bacteria 4898
859 Ga0496115_0175981 3300048918 Bacteria 1769
860 Ga0496115_0214482 3300048918 Bacteria 1590
861 Ga0496115_0302392 3300048918 Bacteria 1311
862 Ga0501031_0123449 3300049568 Bacteria 1692
863 Ga0501031_0137907 3300049568 Bacteria 1594
864 Ga0501031_0151920 3300049568 Bacteria 1513
865 Ga0501031_0860493 3300049568 Bacteria 581
866 Ga0501032_0110255 3300049569 Bacteria 1822
867 Ga0501033_0566997 3300049570 Bacteria 781
868 Ga0501036_0096010 3300049572 Bacteria 2506
869 Ga0501036_0721948 3300049572 Bacteria 823
870 Ga0501036_0945355 3300049572 Bacteria 706
871 Ga0501036_1220961 3300049572 Bacteria 612
872 Ga0501038_0266755 3300049574 Bacteria 1351
873 Ga0501038_0275395 3300049574 Bacteria 1326
874 Ga0501039_0066495 3300049575 Bacteria 2798
875 Ga0501039_0113816 3300049575 Bacteria 2116
876 Ga0501039_0117549 3300049575 Bacteria 2082
877 Ga0501039_0168537 3300049575 Bacteria 1722
878 Ga0501039_0397987 3300049575 Bacteria 1082
879 Ga0501040_0193015 3300049576 Bacteria 1445
880 Ga0501040_0216483 3300049576 Bacteria 1362
881 Ga0501040_0914186 3300049576 Bacteria 636
882 Ga0501041_0074856 3300049577 Bacteria 2081
883 Ga0501041_0097444 3300049577 Bacteria 1818
884 Ga0501041_0264073 3300049577 Bacteria 1083
885 Ga0501042_0005727 3300049578 Bacteria 8025
886 Ga0501042_0301221 3300049578 Bacteria 1158
887 Ga0501043_0189747 3300049579 Bacteria 1599
888 Ga0501048_0026899 3300049582 Bacteria 4186
889 Ga0501048_0135923 3300049582 Bacteria 1737
890 Ga0501048_0168593 3300049582 Bacteria 1550
891 Ga0501067_0093129 3300049583 Bacteria 1673
892 Ga0501068_0262277 3300049584 Bacteria 1102
893 Ga0501068_0611954 3300049584 Bacteria 710
894 Ga0501068_0964927 3300049584 Bacteria 562
895 Ga0501069_0069661 3300049585 Bacteria 1970
896 Ga0501069_0133542 3300049585 Bacteria 1422
897 Ga0501070_0549504 3300049586 Bacteria 925
898 Ga0501071_0021891 3300049587 Bacteria 4456
899 Ga0501071_0053460 3300049587 Bacteria 2913
900 Ga0501071_0070893 3300049587 Bacteria 2540
901 Ga0501071_0230683 3300049587 Bacteria 1394
902 Ga0501071_0809641 3300049587 Bacteria 722
903 Ga0501071_0836806 3300049587 Bacteria 710
904 Ga0501072_0097560 3300049588 Bacteria 2336
905 Ga0501072_1045610 3300049588 Bacteria 636
906 Ga0501073_0260436 3300049589 Bacteria 1197
907 Ga0501074_0244437 3300049590 Bacteria 1276
908 Ga0501075_0016548 3300049591 Bacteria 5315
909 Ga0501075_0155262 3300049591 Bacteria 1745
910 Ga0501075_0161603 3300049591 Bacteria 1709
911 Ga0501075_0242516 3300049591 Bacteria 1374
912 Ga0501076_0224520 3300049592 Bacteria 1535
913 Ga0501076_0354302 3300049592 Bacteria 1205
914 Ga0501076_0723694 3300049592 Bacteria 821
915 Ga0501076_1747897 3300049592 Bacteria 510
916 Ga0501077_0126880 3300049593 Bacteria 1617
917 Ga0501077_0412975 3300049593 Bacteria 863
918 Ga0501079_0166751 3300049741 Bacteria 1718
919 Ga0501079_0319978 3300049741 Bacteria 1214
920 Ga0501079_1390002 3300049741 Bacteria 552
921 Ga0501080_0155468 3300049742 Bacteria 2113
922 Ga0501081_0017956 3300049743 Bacteria 4693
923 Ga0501081_0201203 3300049743 Bacteria 1444
924 Ga0501081_0502458 3300049743 Bacteria 903
925 Ga0501081_0554384 3300049743 Bacteria 859
926 Ga0501081_1366133 3300049743 Bacteria 537
927 Ga0501083_1144332 3300049744 Bacteria 506
928 Ga0501035_0307264 3300049822 Bacteria 1335
929 Ga0501035_0328002 3300049822 Bacteria 1285
930 Ga0501035_0859177 3300049822 Bacteria 721
931 Ga0501045_0035562 3300049824 Bacteria 3617
932 Ga0501045_0191916 3300049824 Bacteria 1522
933 nmdc:mga03n38_948547_c1 3300050490 Bacteria 508
934 nmdc:mga00v17_42532_c1 3300050491 Bacteria 2733
935 nmdc:mga0yw44_15003_c1 3300050492 Bacteria 4135
936 nmdc:mga0yw44_71939_c1 3300050492 Bacteria 2148
937 nmdc:mga05p37_1051843_c1 3300050507 Bacteria 858
938 nmdc:mga05p37_167370_c1 3300050507 Bacteria 2682
939 nmdc:mga05p37_221507_c1 3300050507 Bacteria 2283
940 nmdc:mga05p37_478075_c1 3300050507 Bacteria 1436
941 nmdc:mga05p37_589934_c1 3300050507 Bacteria 1256
942 nmdc:mga05p37_624888_c1 3300050507 Bacteria 1211
943 nmdc:mga05p37_720290_c1 3300050507 Bacteria 1105
944 nmdc:mga09592_12330_c1 3300050508 Bacteria 6962
945 nmdc:mga0qj67_1126029_c1 3300050509 Bacteria 612
946 nmdc:mga0qj67_144767_c1 3300050509 Bacteria 1927
947 nmdc:mga0qj67_217_c1 3300050509 Bacteria 39240
948 nmdc:mga0qj67_921500_c1 3300050509 Bacteria 688
949 nmdc:mga06r32_1054043_c1 3300050510 Bacteria 764
950 nmdc:mga06r32_179012_c1 3300050510 Bacteria 2105
951 nmdc:mga06r32_663_c1 3300050510 Bacteria 29946
952 nmdc:mga06r32_86831_c1 3300050510 Bacteria 3052
953 nmdc:mga08y16_23659_c1 3300050511 Bacteria 6486
954 nmdc:mga08y16_700307_c1 3300050511 Bacteria 1013
955 nmdc:mga0n895_389188_c1 3300050512 Bacteria 1410
956 nmdc:mga0n895_493823_c1 3300050512 Bacteria 1234
957 nmdc:mga0n895_72056_c1 3300050512 Bacteria 3427
958 nmdc:mga0n895_74803_c1 3300050512 Bacteria 3366
959 nmdc:mga0n895_850388_c1 3300050512 Bacteria 900
960 nmdc:mga0n895_85184_c1 3300050512 Bacteria 3155
961 nmdc:mga0rr50_28153_c1 3300050513 Bacteria 3947
962 nmdc:mga0rr50_311382_c1 3300050513 Bacteria 1319
963 nmdc:mga08x19_37117_c1 3300050514 Bacteria 3091
964 nmdc:mga08x19_52241_c2 3300050514 Unclassified 1386
965 nmdc:mga0a205_133071_c1 3300050515 Bacteria 2387
966 nmdc:mga0a205_142625_c1 3300050515 Bacteria 2296
967 nmdc:mga0a205_5874_c1 3300050515 Bacteria 11053
968 nmdc:mga0a205_667237_c1 3300050515 Bacteria 890
969 Ga0495601_0000104 3300053077 Bacteria 46045
970 Ga0495601_0218446 3300053077 Bacteria 1245
971 Ga0495612_0317482 3300053078 Bacteria 700
972 Ga0495595_0260679 3300053084 Bacteria 869
973 Ga0495619_0724011 3300053085 Bacteria 676
974 Ga0501084_0054244 3300054114 Bacteria 3353
975 Ga0501084_0058728 3300054114 Bacteria 3219
976 Ga0501084_0425627 3300054114 Bacteria 1122
977 Ga0590077_172427 3300059426 Bacteria 521
978 Ga0501082_0041155 3300060353 Bacteria 3984
979 Ga0501082_0090239 3300060353 Bacteria 2646
980 Ga0501082_0257460 3300060353 Bacteria 1518
981 Ga0501082_0454712 3300060353 Bacteria 1119
982 Ga0466962_0089357 3300061719 Bacteria 1475
983 Ga0530510_0008481 3300061734 Bacteria 7166
984 Ga0530510_0123967 3300061734 Bacteria 1898

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10614167 Ga0207648_106141672 135
2 iso_pu_bacteria 2870782633 2870783516 135
3 iso_pu_bacteria 2818991472 2819746502 136
4 3300005441 Ga0070700_100034090 Ga0070700_1000340903 137
5 3300005983 Ga0081540_1003252 Ga0081540_10032523 137
6 3300006237 Ga0097621_100883173 Ga0097621_1008831732 137
7 3300009174 Ga0105241_11230937 Ga0105241_112309371 137
8 3300025908 Ga0207643_10234172 Ga0207643_102341723 137
9 3300025931 Ga0207644_11780051 Ga0207644_117800511 137
10 3300025972 Ga0207668_12171724 Ga0207668_121717241 137
11 3300031548 Ga0307408_100897731 Ga0307408_1008977312 137
12 3300049585 Ga0501069_0133542 Ga0501069_0133542_730_1149 137
13 3300049586 Ga0501070_0549504 Ga0501070_0549504_26_445 137
14 3300001990 JGI24737J22298_10189957 JGI24737J22298_101899571 138
15 3300002070 JGI24750J21931_1036962 JGI24750J21931_10369621 138
16 3300005329 Ga0070683_100020290 Ga0070683_1000202906 138
17 3300005331 Ga0070670_101185308 Ga0070670_1011853082 138
18 3300005334 Ga0068869_100123788 Ga0068869_1001237883 138
19 3300005334 Ga0068869_100808870 Ga0068869_1008088702 138
20 3300005336 Ga0070680_100681746 Ga0070680_1006817462 138
21 3300005338 Ga0068868_100620860 Ga0068868_1006208602 138
22 3300005343 Ga0070687_100629975 Ga0070687_1006299752 138
23 3300005345 Ga0070692_10106039 Ga0070692_101060392 138
24 3300005347 Ga0070668_100613627 Ga0070668_1006136271 138
25 3300005353 Ga0070669_100446973 Ga0070669_1004469732 138
26 3300005356 Ga0070674_100589477 Ga0070674_1005894771 138
27 3300005365 Ga0070688_100383407 Ga0070688_1003834071 138
28 3300005366 Ga0070659_100042790 Ga0070659_1000427903 138
29 3300005366 Ga0070659_100229300 Ga0070659_1002293002 138
30 3300005367 Ga0070667_100257367 Ga0070667_1002573672 138
31 3300005367 Ga0070667_100429102 Ga0070667_1004291021 138
32 3300005435 Ga0070714_100188355 Ga0070714_1001883552 138
33 3300005437 Ga0070710_10262668 Ga0070710_102626682 138
34 3300005439 Ga0070711_100014408 Ga0070711_1000144081 138
35 3300005441 Ga0070700_100109985 Ga0070700_1001099854 138
36 3300005444 Ga0070694_101452139 Ga0070694_1014521391 138
37 3300005458 Ga0070681_10127450 Ga0070681_101274503 138
38 3300005459 Ga0068867_100524032 Ga0068867_1005240321 138
39 3300005459 Ga0068867_100627217 Ga0068867_1006272172 138
40 3300005543 Ga0070672_100143012 Ga0070672_1001430124 138
41 3300005547 Ga0070693_100062472 Ga0070693_1000624724 138
42 3300005548 Ga0070665_100000040 Ga0070665_10000004088 138
43 3300005548 Ga0070665_100407376 Ga0070665_1004073763 138
44 3300005549 Ga0070704_100180507 Ga0070704_1001805073 138
45 3300005563 Ga0068855_100868502 Ga0068855_1008685022 138
46 3300005578 Ga0068854_100419112 Ga0068854_1004191122 138
47 3300005614 Ga0068856_101870390 Ga0068856_1018703901 138
48 3300005615 Ga0070702_100036760 Ga0070702_1000367604 138
49 3300005617 Ga0068859_100199282 Ga0068859_1001992821 138
50 3300005618 Ga0068864_102481669 Ga0068864_1024816691 138
51 3300005718 Ga0068866_10046122 Ga0068866_100461223 138
52 3300005719 Ga0068861_100073271 Ga0068861_1000732714 138
53 3300005840 Ga0068870_10188243 Ga0068870_101882432 138
54 3300005842 Ga0068858_100000526 Ga0068858_10000052630 138
55 3300005843 Ga0068860_100199633 Ga0068860_1001996334 138
56 3300005844 Ga0068862_100219017 Ga0068862_1002190173 138
57 3300005981 Ga0081538_10053403 Ga0081538_100534035 138
58 3300006028 Ga0070717_10014008 Ga0070717_100140085 138
59 3300006028 Ga0070717_10077302 Ga0070717_100773023 138
60 3300006048 Ga0075363_100350855 Ga0075363_1003508552 138
61 3300006051 Ga0075364_10045551 Ga0075364_100455514 138
62 3300006163 Ga0070715_10373632 Ga0070715_103736321 138
63 3300006175 Ga0070712_100665268 Ga0070712_1006652682 138
64 3300006237 Ga0097621_100134188 Ga0097621_1001341881 138
65 3300006358 Ga0068871_100095998 Ga0068871_1000959982 138
66 3300006358 Ga0068871_101882466 Ga0068871_1018824661 138
67 3300006844 Ga0075428_101276631 Ga0075428_1012766312 138
68 3300006846 Ga0075430_100488650 Ga0075430_1004886502 138
69 3300006852 Ga0075433_10193583 Ga0075433_101935834 138
70 3300006871 Ga0075434_100420919 Ga0075434_1004209192 138
71 3300006881 Ga0068865_100118747 Ga0068865_1001187474 138
72 3300006931 Ga0097620_100199296 Ga0097620_1001992961 138
73 3300009011 Ga0105251_10278835 Ga0105251_102788352 138
74 3300009098 Ga0105245_10000310 Ga0105245_1000031028 138
75 3300009147 Ga0114129_11225138 Ga0114129_112251381 138
76 3300009148 Ga0105243_10163828 Ga0105243_101638284 138
77 3300009148 Ga0105243_11485162 Ga0105243_114851621 138
78 3300009174 Ga0105241_10660615 Ga0105241_106606152 138
79 3300009176 Ga0105242_10051814 Ga0105242_100518145 138
80 3300009177 Ga0105248_10812669 Ga0105248_108126692 138
81 3300009545 Ga0105237_10298520 Ga0105237_102985202 138
82 3300009553 Ga0105249_10040209 Ga0105249_100402094 138
83 3300009553 Ga0105249_10054663 Ga0105249_100546632 138
84 3300010375 Ga0105239_10170939 Ga0105239_101709391 138
85 3300013102 Ga0157371_10276356 Ga0157371_102763562 138
86 3300013105 Ga0157369_10282664 Ga0157369_102826642 138
87 3300013297 Ga0157378_10015831 Ga0157378_100158319 138
88 3300013297 Ga0157378_10205933 Ga0157378_102059333 138
89 3300013306 Ga0163162_10539399 Ga0163162_105393992 138
90 3300013307 Ga0157372_10790502 Ga0157372_107905022 138
91 3300013308 Ga0157375_10378068 Ga0157375_103780683 138
92 3300014325 Ga0163163_10220177 Ga0163163_102201772 138
93 3300014968 Ga0157379_10105162 Ga0157379_101051624 138
94 3300017792 Ga0163161_10295209 Ga0163161_102952092 138
95 3300020069 Ga0197907_10563192 Ga0197907_105631922 138
96 3300020078 Ga0206352_10282433 Ga0206352_102824331 138
97 3300020078 Ga0206352_10397907 Ga0206352_103979072 138
98 3300020078 Ga0206352_11008601 Ga0206352_110086011 138
99 3300022467 Ga0224712_10182999 Ga0224712_101829992 138
100 3300025898 Ga0207692_10416578 Ga0207692_104165782 138
101 3300025899 Ga0207642_10183566 Ga0207642_101835662 138
102 3300025900 Ga0207710_10000198 Ga0207710_1000019819 138
103 3300025900 Ga0207710_10470070 Ga0207710_104700701 138
104 3300025901 Ga0207688_10007830 Ga0207688_100078308 138
105 3300025901 Ga0207688_10551339 Ga0207688_105513391 138
106 3300025903 Ga0207680_10247046 Ga0207680_102470463 138
107 3300025905 Ga0207685_10251288 Ga0207685_102512881 138
108 3300025912 Ga0207707_10145773 Ga0207707_101457733 138
109 3300025914 Ga0207671_10464031 Ga0207671_104640312 138
110 3300025915 Ga0207693_10002971 Ga0207693_1000297118 138
111 3300025915 Ga0207693_10022277 Ga0207693_100222771 138
112 3300025916 Ga0207663_10104496 Ga0207663_101044961 138
113 3300025916 Ga0207663_10785958 Ga0207663_107859581 138
114 3300025918 Ga0207662_10041129 Ga0207662_100411293 138
115 3300025919 Ga0207657_10060948 Ga0207657_100609485 138
116 3300025919 Ga0207657_10263096 Ga0207657_102630962 138
117 3300025920 Ga0207649_10283682 Ga0207649_102836821 138
118 3300025921 Ga0207652_10103685 Ga0207652_101036853 138
119 3300025925 Ga0207650_10947562 Ga0207650_109475621 138
120 3300025927 Ga0207687_10000079 Ga0207687_1000007928 138
121 3300025927 Ga0207687_10934629 Ga0207687_109346291 138
122 3300025929 Ga0207664_10172999 Ga0207664_101729992 138
123 3300025932 Ga0207690_10233820 Ga0207690_102338203 138
124 3300025934 Ga0207686_10215931 Ga0207686_102159313 138
125 3300025934 Ga0207686_10699581 Ga0207686_106995811 138
126 3300025935 Ga0207709_10434716 Ga0207709_104347161 138
127 3300025935 Ga0207709_10603842 Ga0207709_106038421 138
128 3300025936 Ga0207670_10321206 Ga0207670_103212061 138
129 3300025937 Ga0207669_10325418 Ga0207669_103254182 138
130 3300025937 Ga0207669_10763840 Ga0207669_107638401 138
131 3300025938 Ga0207704_10358788 Ga0207704_103587883 138
132 3300025940 Ga0207691_10290253 Ga0207691_102902532 138
133 3300025942 Ga0207689_10023351 Ga0207689_100233514 138
134 3300025944 Ga0207661_10009112 Ga0207661_100091125 138
135 3300025961 Ga0207712_10107784 Ga0207712_101077842 138
136 3300025972 Ga0207668_10151458 Ga0207668_101514583 138
137 3300025981 Ga0207640_10027434 Ga0207640_100274342 138
138 3300025986 Ga0207658_10230510 Ga0207658_102305103 138
139 3300025986 Ga0207658_10472869 Ga0207658_104728693 138
140 3300026023 Ga0207677_10366816 Ga0207677_103668162 138
141 3300026035 Ga0207703_10000170 Ga0207703_1000017067 138
142 3300026035 Ga0207703_10178393 Ga0207703_101783934 138
143 3300026035 Ga0207703_11413064 Ga0207703_114130641 138
144 3300026075 Ga0207708_10311288 Ga0207708_103112882 138
145 3300026078 Ga0207702_10022327 Ga0207702_100223277 138
146 3300026089 Ga0207648_10046171 Ga0207648_100461715 138
147 3300026089 Ga0207648_10960925 Ga0207648_109609251 138
148 3300026118 Ga0207675_100048217 Ga0207675_1000482175 138
149 3300026121 Ga0207683_10062369 Ga0207683_100623693 138
150 3300026142 Ga0207698_10464099 Ga0207698_104640991 138
151 3300028379 Ga0268266_10000045 Ga0268266_1000004591 138
152 3300028379 Ga0268266_10893774 Ga0268266_108937742 138
153 3300028379 Ga0268266_11420310 Ga0268266_114203101 138
154 3300028380 Ga0268265_10314556 Ga0268265_103145562 138
155 3300028381 Ga0268264_10255556 Ga0268264_102555561 138
156 3300031548 Ga0307408_101316756 Ga0307408_1013167561 138
157 3300032126 Ga0307415_100541053 Ga0307415_1005410532 138
158 3300033179 Ga0307507_10000002 Ga0307507_10000002342 138
159 3300035114 Ga0373939_0172897 Ga0373939_0172897_306_731 138
160 3300035121 Ga0373960_0159378 Ga0373960_0159378_186_611 138
161 3300037312 Ga0395899_0123030 Ga0395899_0123030_1412_1834 138
162 3300037418 Ga0395900_0629335 Ga0395900_0629335_517_939 138
163 3300037466 Ga0395898_0006483 Ga0395898_0006483_585_1007 138
164 3300037466 Ga0395898_0206145 Ga0395898_0206145_444_872 138
165 3300037471 Ga0395905_0021206 Ga0395905_0021206_4817_5239 138
166 3300038443 Ga0395901_0364051 Ga0395901_0364051_141_563 138
167 3300039438 Ga0436360_0816047 Ga0436360_0816047_141_560 138
168 3300044656 Ga0466969_0004337 Ga0466969_0004337_6448_6873 138
169 3300044684 Ga0466966_0151446 Ga0466966_0151446_19_444 138
170 3300044693 Ga0466961_0015171 Ga0466961_0015171_54_479 138
171 3300044694 Ga0466963_0085114 Ga0466963_0085114_1634_2059 138
172 3300044719 Ga0466971_0008645 Ga0466971_0008645_564_989 138
173 3300044765 Ga0466970_0070176 Ga0466970_0070176_30_455 138
174 3300044842 Ga0466957_0576643 Ga0466957_0576643_266_691 138
175 3300045049 Ga0466959_0004011 Ga0466959_0004011_6876_7301 138
176 3300045836 Ga0466958_0060469 Ga0466958_0060469_54_479 138
177 3300045976 Ga0466967_2361735 Ga0466967_2361735_77_496 138
178 3300046463 Ga0495653_0460022 Ga0495653_0460022_93_518 138
179 3300046516 Ga0495628_0004295 Ga0495628_0004295_2284_2712 138
180 3300046516 Ga0495628_0061217 Ga0495628_0061217_1493_1921 138
181 3300046516 Ga0495628_0134693 Ga0495628_0134693_295_720 138
182 3300046517 Ga0495630_0384798 Ga0495630_0384798_459_887 138
183 3300046531 Ga0495665_0149217 Ga0495665_0149217_508_945 138
184 3300046642 Ga0495634_0096587 Ga0495634_0096587_1382_1810 138
185 3300046663 Ga0495635_0000005 Ga0495635_0000005_217344_217772 138
186 3300046674 Ga0495588_0711142 Ga0495588_0711142_82_507 138
187 3300046681 Ga0495647_0045025 Ga0495647_0045025_666_1091 138
188 3300046690 Ga0495624_0002016 Ga0495624_0002016_2311_2739 138
189 3300047315 Ga0495581_0139150 Ga0495581_0139150_478_903 138
190 3300047321 Ga0495676_0000136 Ga0495676_0000136_50249_50677 138
191 3300047321 Ga0495676_0327823 Ga0495676_0327823_28_453 138
192 3300047446 Ga0495679_016258 Ga0495679_016258_591_1019 138
193 3300048903 Ga0496100_0403775 Ga0496100_0403775_598_1023 138
194 3300048903 Ga0496100_0476741 Ga0496100_0476741_310_732 138
195 3300048903 Ga0496100_0971654 Ga0496100_0971654_151_576 138
196 3300048904 Ga0496101_0056678 Ga0496101_0056678_349_771 138
197 3300048905 Ga0496102_0304057 Ga0496102_0304057_251_673 138
198 3300048909 Ga0496106_0000213 Ga0496106_0000213_10021_10446 138
199 3300048909 Ga0496106_0759287 Ga0496106_0759287_91_516 138
200 3300048910 Ga0496107_0036340 Ga0496107_0036340_1563_1985 138
201 3300048917 Ga0496114_0012601 Ga0496114_0012601_4888_5313 138
202 3300048917 Ga0496114_0144350 Ga0496114_0144350_668_1087 138
203 3300048917 Ga0496114_0318219 Ga0496114_0318219_732_1157 138
204 3300048918 Ga0496115_0214482 Ga0496115_0214482_35_460 138
205 3300048918 Ga0496115_0302392 Ga0496115_0302392_785_1210 138
206 3300049572 Ga0501036_1220961 Ga0501036_1220961_39_461 138
207 3300049575 Ga0501039_0168537 Ga0501039_0168537_674_1096 138
208 3300049576 Ga0501040_0914186 Ga0501040_0914186_175_597 138
209 3300049578 Ga0501042_0301221 Ga0501042_0301221_216_638 138
210 3300049587 Ga0501071_0809641 Ga0501071_0809641_132_554 138
211 3300049592 Ga0501076_1747897 Ga0501076_1747897_75_497 138
212 3300049741 Ga0501079_1390002 Ga0501079_1390002_22_444 138
213 3300049743 Ga0501081_0554384 Ga0501081_0554384_239_661 138
214 3300050491 nmdc:mga00v17_42532_c1 nmdc:mga00v17_42532_c1_312_737 138
215 3300050509 nmdc:mga0qj67_921500_c1 nmdc:mga0qj67_921500_c1_208_636 138
216 3300050512 nmdc:mga0n895_389188_c1 nmdc:mga0n895_389188_c1_201_626 138
217 3300053077 Ga0495601_0000104 Ga0495601_0000104_37865_38293 138
218 3300053078 Ga0495612_0317482 Ga0495612_0317482_204_629 138
219 3300053085 Ga0495619_0724011 Ga0495619_0724011_84_509 138
220 3300061719 Ga0466962_0089357 Ga0466962_0089357_107_532 138
221 3300001990 JGI24737J22298_10267160 JGI24737J22298_102671601 139
222 3300001991 JGI24743J22301_10026714 JGI24743J22301_100267141 139
223 3300002075 JGI24738J21930_10029403 JGI24738J21930_100294032 139
224 3300002239 JGI24034J26672_10052795 JGI24034J26672_100527951 139
225 3300003162 Ga0006778J45830_1037705 Ga0006778J45830_10377051 139
226 3300003163 Ga0006759J45824_1024331 Ga0006759J45824_10243311 139
227 3300003203 JGI25406J46586_10009040 JGI25406J46586_100090403 139
228 3300003373 JGI25407J50210_10085528 JGI25407J50210_100855282 139
229 3300003568 Ga0006781J51513_1023272 Ga0006781J51513_10232721 139
230 3300003575 Ga0007409J51694_1021205 Ga0007409J51694_10212051 139
231 3300003577 Ga0007416J51690_1022293 Ga0007416J51690_10222931 139
232 3300003577 Ga0007416J51690_1113228 Ga0007416J51690_11132281 139
233 3300003579 Ga0007429J51699_1059757 Ga0007429J51699_10597571 139
234 3300005329 Ga0070683_100003913 Ga0070683_10000391310 139
235 3300005329 Ga0070683_100088509 Ga0070683_1000885092 139
236 3300005329 Ga0070683_101230263 Ga0070683_1012302631 139
237 3300005331 Ga0070670_100338572 Ga0070670_1003385722 139
238 3300005334 Ga0068869_100053839 Ga0068869_1000538393 139
239 3300005335 Ga0070666_10436761 Ga0070666_104367611 139
240 3300005336 Ga0070680_100161146 Ga0070680_1001611462 139
241 3300005336 Ga0070680_100177968 Ga0070680_1001779681 139
242 3300005337 Ga0070682_100108542 Ga0070682_1001085421 139
243 3300005337 Ga0070682_100237601 Ga0070682_1002376012 139
244 3300005338 Ga0068868_100056769 Ga0068868_1000567693 139
245 3300005338 Ga0068868_100073458 Ga0068868_1000734583 139
246 3300005338 Ga0068868_100082636 Ga0068868_1000826362 139
247 3300005340 Ga0070689_100933550 Ga0070689_1009335502 139
248 3300005340 Ga0070689_101351009 Ga0070689_1013510091 139
249 3300005341 Ga0070691_10097784 Ga0070691_100977843 139
250 3300005341 Ga0070691_10473765 Ga0070691_104737652 139
251 3300005343 Ga0070687_100549177 Ga0070687_1005491771 139
252 3300005347 Ga0070668_100215138 Ga0070668_1002151381 139
253 3300005354 Ga0070675_100233043 Ga0070675_1002330434 139
254 3300005356 Ga0070674_100301402 Ga0070674_1003014022 139
255 3300005356 Ga0070674_100757986 Ga0070674_1007579861 139
256 3300005356 Ga0070674_100855681 Ga0070674_1008556812 139
257 3300005365 Ga0070688_101065150 Ga0070688_1010651501 139
258 3300005366 Ga0070659_100018508 Ga0070659_1000185085 139
259 3300005366 Ga0070659_100433650 Ga0070659_1004336502 139
260 3300005367 Ga0070667_100307010 Ga0070667_1003070102 139
261 3300005434 Ga0070709_10368780 Ga0070709_103687801 139
262 3300005434 Ga0070709_10438903 Ga0070709_104389031 139
263 3300005435 Ga0070714_100170478 Ga0070714_1001704783 139
264 3300005435 Ga0070714_100266527 Ga0070714_1002665273 139
265 3300005435 Ga0070714_100540607 Ga0070714_1005406072 139
266 3300005435 Ga0070714_101633332 Ga0070714_1016333321 139
267 3300005436 Ga0070713_100153684 Ga0070713_1001536841 139
268 3300005436 Ga0070713_100202563 Ga0070713_1002025632 139
269 3300005436 Ga0070713_100471014 Ga0070713_1004710142 139
270 3300005437 Ga0070710_10000019 Ga0070710_1000001954 139
271 3300005437 Ga0070710_10034496 Ga0070710_100344965 139
272 3300005437 Ga0070710_10162633 Ga0070710_101626332 139
273 3300005438 Ga0070701_10119402 Ga0070701_101194021 139
274 3300005439 Ga0070711_100021474 Ga0070711_1000214742 139
275 3300005439 Ga0070711_100137214 Ga0070711_1001372143 139
276 3300005440 Ga0070705_100071930 Ga0070705_1000719302 139
277 3300005440 Ga0070705_100110338 Ga0070705_1001103382 139
278 3300005440 Ga0070705_100130894 Ga0070705_1001308944 139
279 3300005440 Ga0070705_100212022 Ga0070705_1002120221 139
280 3300005441 Ga0070700_100161571 Ga0070700_1001615712 139
281 3300005441 Ga0070700_100565106 Ga0070700_1005651061 139
282 3300005441 Ga0070700_101251638 Ga0070700_1012516381 139
283 3300005444 Ga0070694_100043447 Ga0070694_1000434474 139
284 3300005444 Ga0070694_100050878 Ga0070694_1000508784 139
285 3300005445 Ga0070708_100701475 Ga0070708_1007014752 139
286 3300005457 Ga0070662_100092602 Ga0070662_1000926021 139
287 3300005457 Ga0070662_100214271 Ga0070662_1002142713 139
288 3300005457 Ga0070662_101894371 Ga0070662_1018943711 139
289 3300005459 Ga0068867_100108050 Ga0068867_1001080502 139
290 3300005459 Ga0068867_101296678 Ga0068867_1012966782 139
291 3300005466 Ga0070685_10176308 Ga0070685_101763082 139
292 3300005466 Ga0070685_10711560 Ga0070685_107115601 139
293 3300005467 Ga0070706_100316554 Ga0070706_1003165543 139
294 3300005468 Ga0070707_100108509 Ga0070707_1001085094 139
295 3300005468 Ga0070707_100790285 Ga0070707_1007902852 139
296 3300005518 Ga0070699_100161522 Ga0070699_1001615221 139
297 3300005518 Ga0070699_100581108 Ga0070699_1005811082 139
298 3300005530 Ga0070679_101349529 Ga0070679_1013495291 139
299 3300005535 Ga0070684_100004742 Ga0070684_1000047427 139
300 3300005535 Ga0070684_100095395 Ga0070684_1000953952 139
301 3300005535 Ga0070684_100681263 Ga0070684_1006812632 139
302 3300005536 Ga0070697_100303359 Ga0070697_1003033593 139
303 3300005536 Ga0070697_100369743 Ga0070697_1003697431 139
304 3300005536 Ga0070697_101266823 Ga0070697_1012668232 139
305 3300005539 Ga0068853_100085414 Ga0068853_1000854142 139
306 3300005543 Ga0070672_100801033 Ga0070672_1008010332 139
307 3300005544 Ga0070686_100046501 Ga0070686_1000465011 139
308 3300005544 Ga0070686_100653189 Ga0070686_1006531892 139
309 3300005545 Ga0070695_100020842 Ga0070695_1000208426 139
310 3300005545 Ga0070695_100123996 Ga0070695_1001239961 139
311 3300005545 Ga0070695_100156209 Ga0070695_1001562092 139
312 3300005546 Ga0070696_100098041 Ga0070696_1000980414 139
313 3300005546 Ga0070696_100414364 Ga0070696_1004143642 139
314 3300005547 Ga0070693_100035424 Ga0070693_1000354244 139
315 3300005548 Ga0070665_100343462 Ga0070665_1003434623 139
316 3300005549 Ga0070704_100051941 Ga0070704_1000519412 139
317 3300005549 Ga0070704_100113095 Ga0070704_1001130951 139
318 3300005549 Ga0070704_100475194 Ga0070704_1004751942 139
319 3300005563 Ga0068855_100016543 Ga0068855_1000165438 139
320 3300005563 Ga0068855_100288270 Ga0068855_1002882702 139
321 3300005564 Ga0070664_100217248 Ga0070664_1002172482 139
322 3300005564 Ga0070664_100313891 Ga0070664_1003138913 139
323 3300005564 Ga0070664_101371155 Ga0070664_1013711551 139
324 3300005577 Ga0068857_100001344 Ga0068857_10000134422 139
325 3300005577 Ga0068857_100189725 Ga0068857_1001897251 139
326 3300005577 Ga0068857_100310535 Ga0068857_1003105351 139
327 3300005578 Ga0068854_100135944 Ga0068854_1001359442 139
328 3300005578 Ga0068854_100324301 Ga0068854_1003243011 139
329 3300005614 Ga0068856_100217421 Ga0068856_1002174213 139
330 3300005615 Ga0070702_100000693 Ga0070702_1000006932 139
331 3300005615 Ga0070702_100050546 Ga0070702_1000505462 139
332 3300005615 Ga0070702_100109987 Ga0070702_1001099872 139
333 3300005615 Ga0070702_100324680 Ga0070702_1003246802 139
334 3300005616 Ga0068852_100019170 Ga0068852_1000191705 139
335 3300005616 Ga0068852_100374892 Ga0068852_1003748923 139
336 3300005617 Ga0068859_100056438 Ga0068859_1000564382 139
337 3300005617 Ga0068859_100105189 Ga0068859_1001051895 139
338 3300005618 Ga0068864_100109640 Ga0068864_1001096403 139
339 3300005618 Ga0068864_100140959 Ga0068864_1001409592 139
340 3300005718 Ga0068866_10022680 Ga0068866_100226804 139
341 3300005718 Ga0068866_10476372 Ga0068866_104763721 139
342 3300005719 Ga0068861_100268095 Ga0068861_1002680952 139
343 3300005719 Ga0068861_100461245 Ga0068861_1004612452 139
344 3300005719 Ga0068861_100642077 Ga0068861_1006420772 139
345 3300005834 Ga0068851_10065830 Ga0068851_100658303 139
346 3300005834 Ga0068851_10502056 Ga0068851_105020562 139
347 3300005841 Ga0068863_100185402 Ga0068863_1001854022 139
348 3300005842 Ga0068858_100035699 Ga0068858_1000356993 139
349 3300005842 Ga0068858_100737182 Ga0068858_1007371822 139
350 3300005843 Ga0068860_100616232 Ga0068860_1006162322 139
351 3300005844 Ga0068862_100169176 Ga0068862_1001691762 139
352 3300005844 Ga0068862_100725446 Ga0068862_1007254461 139
353 3300005937 Ga0081455_10145630 Ga0081455_101456301 139
354 3300005981 Ga0081538_10010525 Ga0081538_100105255 139
355 3300005981 Ga0081538_10017145 Ga0081538_100171456 139
356 3300005981 Ga0081538_10049873 Ga0081538_100498734 139
357 3300005981 Ga0081538_10149235 Ga0081538_101492352 139
358 3300005981 Ga0081538_10164941 Ga0081538_101649412 139
359 3300005981 Ga0081538_10194792 Ga0081538_101947921 139
360 3300005981 Ga0081538_10281361 Ga0081538_102813611 139
361 3300005985 Ga0081539_10002244 Ga0081539_100022443 139
362 3300005985 Ga0081539_10044903 Ga0081539_100449033 139
363 3300006028 Ga0070717_10019885 Ga0070717_100198853 139
364 3300006028 Ga0070717_10172135 Ga0070717_101721352 139
365 3300006038 Ga0075365_10005157 Ga0075365_100051578 139
366 3300006038 Ga0075365_10060380 Ga0075365_100603803 139
367 3300006058 Ga0075432_10107710 Ga0075432_101077102 139
368 3300006163 Ga0070715_10004983 Ga0070715_100049838 139
369 3300006173 Ga0070716_100023088 Ga0070716_1000230883 139
370 3300006173 Ga0070716_100108640 Ga0070716_1001086402 139
371 3300006175 Ga0070712_100007865 Ga0070712_1000078654 139
372 3300006175 Ga0070712_100009456 Ga0070712_1000094564 139
373 3300006175 Ga0070712_100162301 Ga0070712_1001623014 139
374 3300006175 Ga0070712_100247362 Ga0070712_1002473621 139
375 3300006237 Ga0097621_100339742 Ga0097621_1003397422 139
376 3300006237 Ga0097621_100421803 Ga0097621_1004218032 139
377 3300006358 Ga0068871_100232098 Ga0068871_1002320982 139
378 3300006358 Ga0068871_100342292 Ga0068871_1003422922 139
379 3300006844 Ga0075428_100051095 Ga0075428_1000510955 139
380 3300006844 Ga0075428_100112498 Ga0075428_1001124983 139
381 3300006844 Ga0075428_100492253 Ga0075428_1004922532 139
382 3300006844 Ga0075428_101418314 Ga0075428_1014183142 139
383 3300006846 Ga0075430_100015802 Ga0075430_1000158025 139
384 3300006846 Ga0075430_100209413 Ga0075430_1002094133 139
385 3300006847 Ga0075431_100000056 Ga0075431_10000005630 139
386 3300006847 Ga0075431_100005114 Ga0075431_1000051147 139
387 3300006847 Ga0075431_101251217 Ga0075431_1012512172 139
388 3300006847 Ga0075431_101454432 Ga0075431_1014544322 139
389 3300006852 Ga0075433_10001182 Ga0075433_1000118213 139
390 3300006852 Ga0075433_10004243 Ga0075433_1000424312 139
391 3300006852 Ga0075433_10120143 Ga0075433_101201433 139
392 3300006871 Ga0075434_100000502 Ga0075434_10000050231 139
393 3300006871 Ga0075434_100014188 Ga0075434_1000141883 139
394 3300006871 Ga0075434_100081498 Ga0075434_1000814983 139
395 3300006880 Ga0075429_100005701 Ga0075429_1000057013 139
396 3300006881 Ga0068865_100045584 Ga0068865_1000455844 139
397 3300006881 Ga0068865_100946149 Ga0068865_1009461492 139
398 3300006914 Ga0075436_100019752 Ga0075436_1000197527 139
399 3300006914 Ga0075436_100042988 Ga0075436_1000429885 139
400 3300006931 Ga0097620_100056440 Ga0097620_1000564402 139
401 3300006931 Ga0097620_100105191 Ga0097620_1001051915 139
402 3300007076 Ga0075435_100024172 Ga0075435_1000241727 139
403 3300007076 Ga0075435_100024209 Ga0075435_10002420910 139
404 3300007076 Ga0075435_101301764 Ga0075435_1013017641 139
405 3300009011 Ga0105251_10102314 Ga0105251_101023143 139
406 3300009036 Ga0105244_10213607 Ga0105244_102136071 139
407 3300009036 Ga0105244_10290152 Ga0105244_102901522 139
408 3300009092 Ga0105250_10241255 Ga0105250_102412552 139
409 3300009093 Ga0105240_11032037 Ga0105240_110320371 139
410 3300009093 Ga0105240_11914395 Ga0105240_119143951 139
411 3300009094 Ga0111539_10035210 Ga0111539_100352104 139
412 3300009094 Ga0111539_10604528 Ga0111539_106045282 139
413 3300009094 Ga0111539_11442083 Ga0111539_114420832 139
414 3300009094 Ga0111539_11472080 Ga0111539_114720802 139
415 3300009094 Ga0111539_11515109 Ga0111539_115151091 139
416 3300009098 Ga0105245_10039338 Ga0105245_100393381 139
417 3300009098 Ga0105245_10102221 Ga0105245_101022214 139
418 3300009098 Ga0105245_10118493 Ga0105245_101184934 139
419 3300009098 Ga0105245_10138126 Ga0105245_101381263 139
420 3300009098 Ga0105245_10263653 Ga0105245_102636532 139
421 3300009098 Ga0105245_10612336 Ga0105245_106123362 139
422 3300009098 Ga0105245_10811186 Ga0105245_108111861 139
423 3300009098 Ga0105245_11344811 Ga0105245_113448111 139
424 3300009098 Ga0105245_12679551 Ga0105245_126795511 139
425 3300009101 Ga0105247_10034222 Ga0105247_100342225 139
426 3300009101 Ga0105247_10078979 Ga0105247_100789793 139
427 3300009147 Ga0114129_10026448 Ga0114129_1002644812 139
428 3300009147 Ga0114129_10031528 Ga0114129_100315281 139
429 3300009147 Ga0114129_10108772 Ga0114129_101087725 139
430 3300009147 Ga0114129_10182955 Ga0114129_101829553 139
431 3300009147 Ga0114129_10364248 Ga0114129_103642482 139
432 3300009147 Ga0114129_11084960 Ga0114129_110849602 139
433 3300009147 Ga0114129_11557652 Ga0114129_115576522 139
434 3300009147 Ga0114129_13070603 Ga0114129_130706031 139
435 3300009148 Ga0105243_10036928 Ga0105243_100369282 139
436 3300009148 Ga0105243_10161469 Ga0105243_101614693 139
437 3300009148 Ga0105243_10226522 Ga0105243_102265223 139
438 3300009148 Ga0105243_10336663 Ga0105243_103366632 139
439 3300009148 Ga0105243_10623382 Ga0105243_106233822 139
440 3300009148 Ga0105243_10748148 Ga0105243_107481481 139
441 3300009174 Ga0105241_10729215 Ga0105241_107292152 139
442 3300009174 Ga0105241_11083573 Ga0105241_110835731 139
443 3300009174 Ga0105241_12607157 Ga0105241_126071571 139
444 3300009176 Ga0105242_10303250 Ga0105242_103032503 139
445 3300009176 Ga0105242_10346191 Ga0105242_103461913 139
446 3300009176 Ga0105242_10403565 Ga0105242_104035653 139
447 3300009176 Ga0105242_11009281 Ga0105242_110092811 139
448 3300009177 Ga0105248_10572955 Ga0105248_105729553 139
449 3300009177 Ga0105248_10593701 Ga0105248_105937012 139
450 3300009545 Ga0105237_10485531 Ga0105237_104855312 139
451 3300009551 Ga0105238_10192480 Ga0105238_101924802 139
452 3300009551 Ga0105238_10767972 Ga0105238_107679722 139
453 3300009551 Ga0105238_11071342 Ga0105238_110713421 139
454 3300009551 Ga0105238_11172428 Ga0105238_111724282 139
455 3300009553 Ga0105249_10010497 Ga0105249_100104975 139
456 3300009553 Ga0105249_10201395 Ga0105249_102013952 139
457 3300009553 Ga0105249_10307074 Ga0105249_103070742 139
458 3300009553 Ga0105249_10606684 Ga0105249_106066841 139
459 3300009553 Ga0105249_10908721 Ga0105249_109087212 139
460 3300009553 Ga0105249_12575738 Ga0105249_125757382 139
461 3300010375 Ga0105239_10106602 Ga0105239_101066026 139
462 3300010375 Ga0105239_11130894 Ga0105239_111308942 139
463 3300010375 Ga0105239_11966776 Ga0105239_119667761 139
464 3300010375 Ga0105239_12124458 Ga0105239_121244582 139
465 3300011119 Ga0105246_10034823 Ga0105246_100348234 139
466 3300011119 Ga0105246_11132305 Ga0105246_111323052 139
467 3300013100 Ga0157373_10552407 Ga0157373_105524072 139
468 3300013102 Ga0157371_10052919 Ga0157371_100529192 139
469 3300013104 Ga0157370_10092263 Ga0157370_100922634 139
470 3300013105 Ga0157369_10097074 Ga0157369_100970745 139
471 3300013296 Ga0157374_10097074 Ga0157374_100970743 139
472 3300013296 Ga0157374_10238233 Ga0157374_102382332 139
473 3300013296 Ga0157374_11200312 Ga0157374_112003121 139
474 3300013297 Ga0157378_10126081 Ga0157378_101260812 139
475 3300013297 Ga0157378_10391500 Ga0157378_103915001 139
476 3300013297 Ga0157378_10644279 Ga0157378_106442792 139
477 3300013306 Ga0163162_10264022 Ga0163162_102640222 139
478 3300013306 Ga0163162_10266223 Ga0163162_102662233 139
479 3300013307 Ga0157372_10944843 Ga0157372_109448432 139
480 3300013307 Ga0157372_11997687 Ga0157372_119976871 139
481 3300013308 Ga0157375_10593467 Ga0157375_105934672 139
482 3300013308 Ga0157375_10698404 Ga0157375_106984042 139
483 3300013308 Ga0157375_10869396 Ga0157375_108693961 139
484 3300013308 Ga0157375_11549163 Ga0157375_115491632 139
485 3300014325 Ga0163163_10047977 Ga0163163_100479772 139
486 3300014326 Ga0157380_10363266 Ga0157380_103632663 139
487 3300014326 Ga0157380_10547672 Ga0157380_105476722 139
488 3300014326 Ga0157380_11085532 Ga0157380_110855322 139
489 3300014745 Ga0157377_10013230 Ga0157377_100132302 139
490 3300014745 Ga0157377_10100441 Ga0157377_101004414 139
491 3300014968 Ga0157379_10124071 Ga0157379_101240714 139
492 3300014968 Ga0157379_10345836 Ga0157379_103458363 139
493 3300014968 Ga0157379_10535650 Ga0157379_105356502 139
494 3300014969 Ga0157376_10157513 Ga0157376_101575132 139
495 3300017792 Ga0163161_10054622 Ga0163161_100546222 139
496 3300020070 Ga0206356_10463577 Ga0206356_104635772 139
497 3300020075 Ga0206349_1547479 Ga0206349_15474791 139
498 3300020076 Ga0206355_1047451 Ga0206355_10474511 139
499 3300020078 Ga0206352_10031256 Ga0206352_100312561 139
500 3300020081 Ga0206354_10533889 Ga0206354_105338892 139
501 3300020082 Ga0206353_10343017 Ga0206353_103430172 139
502 3300020082 Ga0206353_11951656 Ga0206353_119516561 139
503 3300021377 Ga0213874_10001344 Ga0213874_100013444 139
504 3300021377 Ga0213874_10265885 Ga0213874_102658851 139
505 3300021384 Ga0213876_10002583 Ga0213876_100025836 139
506 3300021384 Ga0213876_10012527 Ga0213876_100125273 139
507 3300021384 Ga0213876_10033207 Ga0213876_100332073 139
508 3300021384 Ga0213876_10112189 Ga0213876_101121892 139
509 3300021384 Ga0213876_10347355 Ga0213876_103473551 139
510 3300021388 Ga0213875_10120252 Ga0213875_101202521 139
511 3300021388 Ga0213875_10402186 Ga0213875_104021861 139
512 3300022467 Ga0224712_10179060 Ga0224712_101790601 139
513 3300022467 Ga0224712_10187218 Ga0224712_101872182 139
514 3300025885 Ga0207653_10021070 Ga0207653_100210703 139
515 3300025898 Ga0207692_10400697 Ga0207692_104006972 139
516 3300025899 Ga0207642_10073738 Ga0207642_100737383 139
517 3300025899 Ga0207642_10265415 Ga0207642_102654152 139
518 3300025900 Ga0207710_10599109 Ga0207710_105991091 139
519 3300025901 Ga0207688_10005722 Ga0207688_100057227 139
520 3300025901 Ga0207688_10029944 Ga0207688_100299444 139
521 3300025903 Ga0207680_10061579 Ga0207680_100615794 139
522 3300025903 Ga0207680_10423829 Ga0207680_104238291 139
523 3300025903 Ga0207680_10758642 Ga0207680_107586421 139
524 3300025904 Ga0207647_10048000 Ga0207647_100480003 139
525 3300025905 Ga0207685_10134202 Ga0207685_101342023 139
526 3300025906 Ga0207699_10067578 Ga0207699_100675781 139
527 3300025906 Ga0207699_10176175 Ga0207699_101761751 139
528 3300025908 Ga0207643_10161042 Ga0207643_101610422 139
529 3300025908 Ga0207643_10316848 Ga0207643_103168481 139
530 3300025911 Ga0207654_10053277 Ga0207654_100532775 139
531 3300025913 Ga0207695_10933768 Ga0207695_109337681 139
532 3300025914 Ga0207671_10195635 Ga0207671_101956353 139
533 3300025915 Ga0207693_10003330 Ga0207693_1000333011 139
534 3300025915 Ga0207693_10003815 Ga0207693_1000381511 139
535 3300025915 Ga0207693_10010007 Ga0207693_100100079 139
536 3300025915 Ga0207693_10200204 Ga0207693_102002043 139
537 3300025916 Ga0207663_10034129 Ga0207663_100341295 139
538 3300025916 Ga0207663_10037526 Ga0207663_100375265 139
539 3300025917 Ga0207660_10148428 Ga0207660_101484284 139
540 3300025917 Ga0207660_10380778 Ga0207660_103807782 139
541 3300025918 Ga0207662_10010673 Ga0207662_100106733 139
542 3300025918 Ga0207662_10021797 Ga0207662_100217974 139
543 3300025918 Ga0207662_10175993 Ga0207662_101759933 139
544 3300025919 Ga0207657_10026284 Ga0207657_100262845 139
545 3300025921 Ga0207652_10509028 Ga0207652_105090282 139
546 3300025922 Ga0207646_10094519 Ga0207646_100945195 139
547 3300025922 Ga0207646_10573095 Ga0207646_105730952 139
548 3300025924 Ga0207694_10257383 Ga0207694_102573831 139
549 3300025924 Ga0207694_10269548 Ga0207694_102695481 139
550 3300025924 Ga0207694_10612435 Ga0207694_106124351 139
551 3300025925 Ga0207650_10167172 Ga0207650_101671722 139
552 3300025926 Ga0207659_10767205 Ga0207659_107672052 139
553 3300025926 Ga0207659_11439575 Ga0207659_114395751 139
554 3300025927 Ga0207687_10028547 Ga0207687_100285475 139
555 3300025927 Ga0207687_10064043 Ga0207687_100640433 139
556 3300025927 Ga0207687_10827316 Ga0207687_108273162 139
557 3300025928 Ga0207700_10093377 Ga0207700_100933772 139
558 3300025928 Ga0207700_10146896 Ga0207700_101468961 139
559 3300025928 Ga0207700_11406593 Ga0207700_114065931 139
560 3300025929 Ga0207664_10001134 Ga0207664_100011343 139
561 3300025929 Ga0207664_10187607 Ga0207664_101876072 139
562 3300025932 Ga0207690_10111464 Ga0207690_101114642 139
563 3300025932 Ga0207690_10300422 Ga0207690_103004222 139
564 3300025933 Ga0207706_10237778 Ga0207706_102377782 139
565 3300025933 Ga0207706_10545729 Ga0207706_105457292 139
566 3300025933 Ga0207706_10550866 Ga0207706_105508662 139
567 3300025933 Ga0207706_10732224 Ga0207706_107322241 139
568 3300025934 Ga0207686_10127646 Ga0207686_101276462 139
569 3300025934 Ga0207686_10189397 Ga0207686_101893972 139
570 3300025935 Ga0207709_10012033 Ga0207709_100120333 139
571 3300025935 Ga0207709_10097723 Ga0207709_100977233 139
572 3300025936 Ga0207670_10306170 Ga0207670_103061702 139
573 3300025937 Ga0207669_10080936 Ga0207669_100809363 139
574 3300025938 Ga0207704_10016079 Ga0207704_100160795 139
575 3300025939 Ga0207665_10015801 Ga0207665_100158017 139
576 3300025939 Ga0207665_10018884 Ga0207665_100188843 139
577 3300025939 Ga0207665_10056454 Ga0207665_100564542 139
578 3300025940 Ga0207691_10105655 Ga0207691_101056553 139
579 3300025941 Ga0207711_10416876 Ga0207711_104168762 139
580 3300025941 Ga0207711_10676800 Ga0207711_106768001 139
581 3300025941 Ga0207711_10902765 Ga0207711_109027651 139
582 3300025941 Ga0207711_11097845 Ga0207711_110978451 139
583 3300025942 Ga0207689_10057511 Ga0207689_100575115 139
584 3300025944 Ga0207661_10000564 Ga0207661_1000056411 139
585 3300025944 Ga0207661_10181895 Ga0207661_101818952 139
586 3300025944 Ga0207661_11410492 Ga0207661_114104922 139
587 3300025945 Ga0207679_10284669 Ga0207679_102846692 139
588 3300025949 Ga0207667_10087198 Ga0207667_100871981 139
589 3300025949 Ga0207667_10553328 Ga0207667_105533282 139
590 3300025960 Ga0207651_10277711 Ga0207651_102777112 139
591 3300025961 Ga0207712_10027026 Ga0207712_100270263 139
592 3300025961 Ga0207712_10191122 Ga0207712_101911222 139
593 3300025961 Ga0207712_10434010 Ga0207712_104340101 139
594 3300025961 Ga0207712_10567584 Ga0207712_105675842 139
595 3300025961 Ga0207712_11743226 Ga0207712_117432261 139
596 3300025972 Ga0207668_10191013 Ga0207668_101910131 139
597 3300025972 Ga0207668_10255127 Ga0207668_102551271 139
598 3300025981 Ga0207640_10042302 Ga0207640_100423025 139
599 3300025981 Ga0207640_10194880 Ga0207640_101948802 139
600 3300025981 Ga0207640_10483998 Ga0207640_104839982 139
601 3300026023 Ga0207677_10326251 Ga0207677_103262511 139
602 3300026023 Ga0207677_10487650 Ga0207677_104876502 139
603 3300026023 Ga0207677_10547071 Ga0207677_105470712 139
604 3300026035 Ga0207703_10197493 Ga0207703_101974932 139
605 3300026035 Ga0207703_10372024 Ga0207703_103720241 139
606 3300026041 Ga0207639_11948937 Ga0207639_119489371 139
607 3300026067 Ga0207678_10022495 Ga0207678_100224952 139
608 3300026075 Ga0207708_10042361 Ga0207708_100423614 139
609 3300026075 Ga0207708_10046014 Ga0207708_100460143 139
610 3300026075 Ga0207708_10055556 Ga0207708_100555561 139
611 3300026078 Ga0207702_10033845 Ga0207702_100338453 139
612 3300026078 Ga0207702_10151986 Ga0207702_101519862 139
613 3300026078 Ga0207702_10406603 Ga0207702_104066032 139
614 3300026089 Ga0207648_10160471 Ga0207648_101604711 139
615 3300026089 Ga0207648_11325630 Ga0207648_113256301 139
616 3300026095 Ga0207676_10118766 Ga0207676_101187662 139
617 3300026095 Ga0207676_10385006 Ga0207676_103850062 139
618 3300026095 Ga0207676_10886352 Ga0207676_108863522 139
619 3300026116 Ga0207674_10005739 Ga0207674_100057395 139
620 3300026116 Ga0207674_10052087 Ga0207674_100520874 139
621 3300026116 Ga0207674_10379638 Ga0207674_103796382 139
622 3300026118 Ga0207675_100001665 Ga0207675_1000016652 139
623 3300026118 Ga0207675_100020645 Ga0207675_1000206455 139
624 3300026118 Ga0207675_100100450 Ga0207675_1001004502 139
625 3300026121 Ga0207683_10023905 Ga0207683_100239052 139
626 3300026142 Ga0207698_10634378 Ga0207698_106343782 139
627 3300027907 Ga0207428_10064344 Ga0207428_100643443 139
628 3300027907 Ga0207428_10489767 Ga0207428_104897672 139
629 3300027907 Ga0207428_10560449 Ga0207428_105604492 139
630 3300027907 Ga0207428_10580101 Ga0207428_105801011 139
631 3300028380 Ga0268265_12522392 Ga0268265_125223921 139
632 3300028381 Ga0268264_10371931 Ga0268264_103719312 139
633 3300028381 Ga0268264_10468765 Ga0268264_104687652 139
634 3300031548 Ga0307408_100203358 Ga0307408_1002033581 139
635 3300031548 Ga0307408_101005343 Ga0307408_1010053432 139
636 3300031548 Ga0307408_102376551 Ga0307408_1023765511 139
637 3300031665 Ga0316575_10039497 Ga0316575_100394972 139
638 3300031691 Ga0316579_10034002 Ga0316579_100340023 139
639 3300031728 Ga0316578_10045634 Ga0316578_100456342 139
640 3300031731 Ga0307405_10105944 Ga0307405_101059442 139
641 3300031731 Ga0307405_11858490 Ga0307405_118584901 139
642 3300031733 Ga0316577_10011008 Ga0316577_100110085 139
643 3300031824 Ga0307413_11022810 Ga0307413_110228102 139
644 3300031852 Ga0307410_10129466 Ga0307410_101294662 139
645 3300031852 Ga0307410_10218813 Ga0307410_102188132 139
646 3300031852 Ga0307410_10299039 Ga0307410_102990391 139
647 3300031901 Ga0307406_10071107 Ga0307406_100711072 139
648 3300031901 Ga0307406_10096765 Ga0307406_100967651 139
649 3300031901 Ga0307406_10179602 Ga0307406_101796023 139
650 3300031901 Ga0307406_10326082 Ga0307406_103260822 139
651 3300031901 Ga0307406_10574233 Ga0307406_105742332 139
652 3300031903 Ga0307407_10087221 Ga0307407_100872212 139
653 3300031903 Ga0307407_10258911 Ga0307407_102589112 139
654 3300031903 Ga0307407_10449929 Ga0307407_104499292 139
655 3300031903 Ga0307407_10953362 Ga0307407_109533621 139
656 3300031911 Ga0307412_10349085 Ga0307412_103490852 139
657 3300031911 Ga0307412_11244143 Ga0307412_112441431 139
658 3300031995 Ga0307409_100061030 Ga0307409_1000610301 139
659 3300031995 Ga0307409_100805285 Ga0307409_1008052852 139
660 3300031995 Ga0307409_101284014 Ga0307409_1012840141 139
661 3300032002 Ga0307416_100005048 Ga0307416_1000050489 139
662 3300032002 Ga0307416_100351876 Ga0307416_1003518763 139
663 3300032002 Ga0307416_101184855 Ga0307416_1011848552 139
664 3300032005 Ga0307411_10133181 Ga0307411_101331813 139
665 3300032005 Ga0307411_10697593 Ga0307411_106975932 139
666 3300032126 Ga0307415_100003774 Ga0307415_1000037743 139
667 3300032126 Ga0307415_100254358 Ga0307415_1002543582 139
668 3300032126 Ga0307415_100271791 Ga0307415_1002717911 139
669 3300032126 Ga0307415_100675805 Ga0307415_1006758052 139
670 3300032126 Ga0307415_100981448 Ga0307415_1009814482 139
671 3300032133 Ga0316583_10096512 Ga0316583_100965122 139
672 3300032137 Ga0316585_10033830 Ga0316585_100338302 139
673 3300032139 Ga0316580_10003048 Ga0316580_100030485 139
674 3300034816 Ga0373930_0028490 Ga0373930_0028490_241_663 139
675 3300034819 Ga0373958_0063457 Ga0373958_0063457_63_491 139
676 3300034957 Ga0373938_0017421 Ga0373938_0017421_954_1382 139
677 3300035084 Ga0373928_0009209 Ga0373928_0009209_420_842 139
678 3300035084 Ga0373928_0020131 Ga0373928_0020131_822_1250 139
679 3300035088 Ga0373940_0009586 Ga0373940_0009586_1102_1524 139
680 3300035090 Ga0373949_0005837 Ga0373949_0005837_1909_2337 139
681 3300035090 Ga0373949_0017956 Ga0373949_0017956_401_823 139
682 3300035091 Ga0373951_0001215 Ga0373951_0001215_2596_3024 139
683 3300035091 Ga0373951_0094636 Ga0373951_0094636_113_535 139
684 3300035092 Ga0373952_0011729 Ga0373952_0011729_706_1128 139
685 3300035092 Ga0373952_0044120 Ga0373952_0044120_141_569 139
686 3300035112 Ga0373932_0037699 Ga0373932_0037699_922_1344 139
687 3300035112 Ga0373932_0185023 Ga0373932_0185023_47_475 139
688 3300035115 Ga0373941_0012534 Ga0373941_0012534_72_494 139
689 3300035115 Ga0373941_0020385 Ga0373941_0020385_174_602 139
690 3300035121 Ga0373960_0022869 Ga0373960_0022869_852_1274 139
691 3300035241 Ga0373961_0022802 Ga0373961_0022802_1161_1583 139
692 3300035241 Ga0373961_0030109 Ga0373961_0030109_660_1091 139
693 3300035241 Ga0373961_0059451 Ga0373961_0059451_710_1138 139
694 3300035242 Ga0373962_0005923 Ga0373962_0005923_1368_1790 139
695 3300035242 Ga0373962_0008566 Ga0373962_0008566_1920_2348 139
696 3300035398 Ga0316574_0031022 Ga0316574_0031022_946_1371 139
697 3300035691 Ga0373931_0007664 Ga0373931_0007664_2371_2793 139
698 3300035691 Ga0373931_0018020 Ga0373931_0018020_90_518 139
699 3300036647 Ga0316582_0001763 Ga0316582_0001763_4778_5203 139
700 3300036712 Ga0316584_0003336 Ga0316584_0003336_5750_6175 139
701 3300037312 Ga0395899_0005234 Ga0395899_0005234_6310_6738 139
702 3300037312 Ga0395899_0044539 Ga0395899_0044539_1122_1553 139
703 3300037312 Ga0395899_0259225 Ga0395899_0259225_420_848 139
704 3300037418 Ga0395900_0028444 Ga0395900_0028444_2965_3393 139
705 3300037418 Ga0395900_0108875 Ga0395900_0108875_1378_1806 139
706 3300037418 Ga0395900_0143644 Ga0395900_0143644_1915_2346 139
707 3300037418 Ga0395900_0455341 Ga0395900_0455341_583_1011 139
708 3300037418 Ga0395900_0656347 Ga0395900_0656347_85_510 139
709 3300037418 Ga0395900_1134867 Ga0395900_1134867_214_642 139
710 3300037466 Ga0395898_0002122 Ga0395898_0002122_16265_16693 139
711 3300037466 Ga0395898_0051456 Ga0395898_0051456_3256_3684 139
712 3300037466 Ga0395898_0056060 Ga0395898_0056060_3170_3595 139
713 3300037466 Ga0395898_0117207 Ga0395898_0117207_999_1430 139
714 3300037466 Ga0395898_0396966 Ga0395898_0396966_643_1071 139
715 3300037471 Ga0395905_0014338 Ga0395905_0014338_3286_3714 139
716 3300037471 Ga0395905_0018000 Ga0395905_0018000_5677_6108 139
717 3300037471 Ga0395905_0039441 Ga0395905_0039441_2809_3237 139
718 3300037471 Ga0395905_1025689 Ga0395905_1025689_253_681 139
719 3300037588 Ga0316581_0091007 Ga0316581_0091007_89_514 139
720 3300037853 Ga0436364_0294314 Ga0436364_0294314_3272_3700 139
721 3300037853 Ga0436364_0474541 Ga0436364_0474541_157_591 139
722 3300037853 Ga0436364_0648428 Ga0436364_0648428_8831_9259 139
723 3300037853 Ga0436364_0914577 Ga0436364_0914577_818_1246 139
724 3300037853 Ga0436364_1093687 Ga0436364_1093687_1041_1469 139
725 3300038443 Ga0395901_0003904 Ga0395901_0003904_2198_2626 139
726 3300038443 Ga0395901_0011202 Ga0395901_0011202_41_466 139
727 3300038443 Ga0395901_0018541 Ga0395901_0018541_4308_4736 139
728 3300038443 Ga0395901_0175644 Ga0395901_0175644_1431_1859 139
729 3300038443 Ga0395901_0223750 Ga0395901_0223750_77_505 139
730 3300038443 Ga0395901_0282958 Ga0395901_0282958_994_1425 139
731 3300038443 Ga0395901_1462651 Ga0395901_1462651_178_606 139
732 3300039437 Ga0436365_1685267 Ga0436365_1685267_586_1014 139
733 3300039437 Ga0436365_1737094 Ga0436365_1737094_3990_4424 139
734 3300039437 Ga0436365_1837010 Ga0436365_1837010_7070_7498 139
735 3300039437 Ga0436365_1935346 Ga0436365_1935346_740_1168 139
736 3300039450 Ga0436363_0425661 Ga0436363_0425661_1919_2347 139
737 3300039450 Ga0436363_0508323 Ga0436363_0508323_282_710 139
738 3300039450 Ga0436363_0548952 Ga0436363_0548952_3558_3986 139
739 3300039450 Ga0436363_0582583 Ga0436363_0582583_341_769 139
740 3300039450 Ga0436363_1224953 Ga0436363_1224953_621_1049 139
741 3300039450 Ga0436363_1227349 Ga0436363_1227349_1652_2080 139
742 3300039450 Ga0436363_1526926 Ga0436363_1526926_664_1092 139
743 3300039453 Ga0436362_0105352 Ga0436362_0105352_1376_1810 139
744 3300039453 Ga0436362_0417099 Ga0436362_0417099_317_745 139
745 3300039453 Ga0436362_0453746 Ga0436362_0453746_30_458 139
746 3300039453 Ga0436362_0677777 Ga0436362_0677777_460_888 139
747 3300041503 Ga0451847_0966993 Ga0451847_0966993_87_515 139
748 3300041512 Ga0451853_3052387 Ga0451853_3052387_213_644 139
749 3300044684 Ga0466966_0190198 Ga0466966_0190198_292_720 139
750 3300044684 Ga0466966_0305458 Ga0466966_0305458_235_669 139
751 3300044694 Ga0466963_0382562 Ga0466963_0382562_33_461 139
752 3300044706 Ga0466964_0563794 Ga0466964_0563794_55_483 139
753 3300044719 Ga0466971_0129877 Ga0466971_0129877_147_575 139
754 3300044735 Ga0466968_0186668 Ga0466968_0186668_457_885 139
755 3300044765 Ga0466970_0431974 Ga0466970_0431974_273_701 139
756 3300044842 Ga0466957_0173590 Ga0466957_0173590_525_953 139
757 3300044901 Ga0466960_0583923 Ga0466960_0583923_206_637 139
758 3300045976 Ga0466967_0039980 Ga0466967_0039980_652_1080 139
759 3300045976 Ga0466967_0064780 Ga0466967_0064780_954_1382 139
760 3300045976 Ga0466967_0733819 Ga0466967_0733819_162_590 139
761 3300045976 Ga0466967_0987569 Ga0466967_0987569_360_788 139
762 3300046454 Ga0495592_0391808 Ga0495592_0391808_211_639 139
763 3300046459 Ga0495629_0150571 Ga0495629_0150571_873_1301 139
764 3300046461 Ga0495641_0043173 Ga0495641_0043173_113_547 139
765 3300046462 Ga0495651_0357113 Ga0495651_0357113_460_885 139
766 3300046511 Ga0495608_0377856 Ga0495608_0377856_53_481 139
767 3300046511 Ga0495608_0866219 Ga0495608_0866219_30_461 139
768 3300046517 Ga0495630_0034398 Ga0495630_0034398_2841_3269 139
769 3300046517 Ga0495630_0154488 Ga0495630_0154488_314_745 139
770 3300046525 Ga0495663_0031588 Ga0495663_0031588_667_1095 139
771 3300046525 Ga0495663_0201365 Ga0495663_0201365_227_658 139
772 3300046528 Ga0495642_0068526 Ga0495642_0068526_290_718 139
773 3300046529 Ga0495652_0805147 Ga0495652_0805147_142_573 139
774 3300046531 Ga0495665_0222202 Ga0495665_0222202_507_935 139
775 3300046535 Ga0495586_0005249 Ga0495586_0005249_4579_5007 139
776 3300046615 Ga0495656_0354407 Ga0495656_0354407_308_730 139
777 3300046616 Ga0495668_0635748 Ga0495668_0635748_134_562 139
778 3300046642 Ga0495634_0034600 Ga0495634_0034600_268_696 139
779 3300046642 Ga0495634_0040347 Ga0495634_0040347_2374_2805 139
780 3300046683 Ga0495658_0291760 Ga0495658_0291760_11_433 139
781 3300046683 Ga0495658_0416370 Ga0495658_0416370_414_836 139
782 3300046689 Ga0495613_0037674 Ga0495613_0037674_2057_2485 139
783 3300046690 Ga0495624_0102063 Ga0495624_0102063_715_1137 139
784 3300047319 Ga0495674_0033720 Ga0495674_0033720_2998_3426 139
785 3300047319 Ga0495674_0252195 Ga0495674_0252195_815_1246 139
786 3300047319 Ga0495674_0725982 Ga0495674_0725982_273_701 139
787 3300047321 Ga0495676_0646898 Ga0495676_0646898_61_489 139
788 3300047321 Ga0495676_0821062 Ga0495676_0821062_134_562 139
789 3300047322 Ga0495680_0647797 Ga0495680_0647797_143_571 139
790 3300047673 Ga0495593_0499949 Ga0495593_0499949_32_466 139
791 3300048903 Ga0496100_0042568 Ga0496100_0042568_904_1332 139
792 3300048903 Ga0496100_0080228 Ga0496100_0080228_46_474 139
793 3300048903 Ga0496100_0432692 Ga0496100_0432692_472_894 139
794 3300048904 Ga0496101_0005933 Ga0496101_0005933_50_478 139
795 3300048904 Ga0496101_0141285 Ga0496101_0141285_1188_1610 139
796 3300048905 Ga0496102_0205350 Ga0496102_0205350_836_1258 139
797 3300048905 Ga0496102_0329515 Ga0496102_0329515_105_536 139
798 3300048905 Ga0496102_0579830 Ga0496102_0579830_36_464 139
799 3300048905 Ga0496102_1811239 Ga0496102_1811239_87_515 139
800 3300048906 Ga0496103_0201261 Ga0496103_0201261_359_790 139
801 3300048906 Ga0496103_0406440 Ga0496103_0406440_370_798 139
802 3300048907 Ga0496104_0088482 Ga0496104_0088482_421_843 139
803 3300048907 Ga0496104_0189414 Ga0496104_0189414_752_1180 139
804 3300048907 Ga0496104_0760045 Ga0496104_0760045_39_467 139
805 3300048908 Ga0496105_0017290 Ga0496105_0017290_1351_1773 139
806 3300048908 Ga0496105_0120596 Ga0496105_0120596_816_1244 139
807 3300048909 Ga0496106_0055456 Ga0496106_0055456_635_1057 139
808 3300048909 Ga0496106_0074836 Ga0496106_0074836_967_1395 139
809 3300048909 Ga0496106_0120148 Ga0496106_0120148_222_650 139
810 3300048909 Ga0496106_0170226 Ga0496106_0170226_303_734 139
811 3300048909 Ga0496106_0384634 Ga0496106_0384634_175_603 139
812 3300048909 Ga0496106_1504486 Ga0496106_1504486_41_472 139
813 3300048910 Ga0496107_0001404 Ga0496107_0001404_10431_10859 139
814 3300048910 Ga0496107_0336749 Ga0496107_0336749_29_457 139
815 3300048911 Ga0496108_0150278 Ga0496108_0150278_1208_1630 139
816 3300048911 Ga0496108_0402559 Ga0496108_0402559_604_1032 139
817 3300048912 Ga0496109_0049019 Ga0496109_0049019_2724_3152 139
818 3300048912 Ga0496109_0296704 Ga0496109_0296704_407_841 139
819 3300048913 Ga0496110_0014477 Ga0496110_0014477_3128_3550 139
820 3300048913 Ga0496110_0092653 Ga0496110_0092653_1188_1616 139
821 3300048913 Ga0496110_0423954 Ga0496110_0423954_92_520 139
822 3300048913 Ga0496110_0631529 Ga0496110_0631529_253_687 139
823 3300048913 Ga0496110_1162168 Ga0496110_1162168_125_553 139
824 3300048914 Ga0496111_0045429 Ga0496111_0045429_651_1073 139
825 3300048914 Ga0496111_0406305 Ga0496111_0406305_289_720 139
826 3300048914 Ga0496111_0701046 Ga0496111_0701046_111_539 139
827 3300048915 Ga0496112_0002387 Ga0496112_0002387_13551_13979 139
828 3300048915 Ga0496112_0049744 Ga0496112_0049744_934_1356 139
829 3300048915 Ga0496112_0947823 Ga0496112_0947823_41_469 139
830 3300048916 Ga0496113_0009663 Ga0496113_0009663_1738_2166 139
831 3300048916 Ga0496113_0245309 Ga0496113_0245309_538_960 139
832 3300048916 Ga0496113_0450781 Ga0496113_0450781_576_1004 139
833 3300048917 Ga0496114_0042230 Ga0496114_0042230_3007_3429 139
834 3300048917 Ga0496114_0079435 Ga0496114_0079435_2301_2729 139
835 3300048917 Ga0496114_0121422 Ga0496114_0121422_191_625 139
836 3300048917 Ga0496114_0341453 Ga0496114_0341453_238_672 139
837 3300048917 Ga0496114_0458920 Ga0496114_0458920_417_848 139
838 3300048918 Ga0496115_0022365 Ga0496115_0022365_2381_2803 139
839 3300048918 Ga0496115_0175981 Ga0496115_0175981_1314_1742 139
840 3300049568 Ga0501031_0123449 Ga0501031_0123449_41_472 139
841 3300049568 Ga0501031_0137907 Ga0501031_0137907_888_1316 139
842 3300049568 Ga0501031_0151920 Ga0501031_0151920_444_875 139
843 3300049568 Ga0501031_0860493 Ga0501031_0860493_15_449 139
844 3300049569 Ga0501032_0110255 Ga0501032_0110255_702_1133 139
845 3300049570 Ga0501033_0566997 Ga0501033_0566997_333_764 139
846 3300049572 Ga0501036_0096010 Ga0501036_0096010_283_714 139
847 3300049572 Ga0501036_0721948 Ga0501036_0721948_331_756 139
848 3300049572 Ga0501036_0945355 Ga0501036_0945355_149_580 139
849 3300049574 Ga0501038_0266755 Ga0501038_0266755_436_867 139
850 3300049574 Ga0501038_0275395 Ga0501038_0275395_532_957 139
851 3300049575 Ga0501039_0066495 Ga0501039_0066495_19_450 139
852 3300049575 Ga0501039_0113816 Ga0501039_0113816_1036_1467 139
853 3300049575 Ga0501039_0117549 Ga0501039_0117549_1590_2021 139
854 3300049575 Ga0501039_0397987 Ga0501039_0397987_227_652 139
855 3300049576 Ga0501040_0193015 Ga0501040_0193015_423_854 139
856 3300049576 Ga0501040_0216483 Ga0501040_0216483_711_1136 139
857 3300049577 Ga0501041_0074856 Ga0501041_0074856_1322_1753 139
858 3300049577 Ga0501041_0097444 Ga0501041_0097444_252_683 139
859 3300049577 Ga0501041_0264073 Ga0501041_0264073_594_1022 139
860 3300049578 Ga0501042_0005727 Ga0501042_0005727_4166_4597 139
861 3300049579 Ga0501043_0189747 Ga0501043_0189747_562_993 139
862 3300049582 Ga0501048_0026899 Ga0501048_0026899_523_954 139
863 3300049582 Ga0501048_0135923 Ga0501048_0135923_104_535 139
864 3300049582 Ga0501048_0168593 Ga0501048_0168593_179_607 139
865 3300049583 Ga0501067_0093129 Ga0501067_0093129_304_735 139
866 3300049584 Ga0501068_0262277 Ga0501068_0262277_156_584 139
867 3300049584 Ga0501068_0611954 Ga0501068_0611954_255_686 139
868 3300049584 Ga0501068_0964927 Ga0501068_0964927_80_508 139
869 3300049585 Ga0501069_0069661 Ga0501069_0069661_767_1198 139
870 3300049587 Ga0501071_0021891 Ga0501071_0021891_3330_3761 139
871 3300049587 Ga0501071_0053460 Ga0501071_0053460_1067_1498 139
872 3300049587 Ga0501071_0070893 Ga0501071_0070893_1864_2289 139
873 3300049587 Ga0501071_0230683 Ga0501071_0230683_924_1352 139
874 3300049587 Ga0501071_0836806 Ga0501071_0836806_55_486 139
875 3300049588 Ga0501072_0097560 Ga0501072_0097560_1141_1572 139
876 3300049588 Ga0501072_1045610 Ga0501072_1045610_55_486 139
877 3300049589 Ga0501073_0260436 Ga0501073_0260436_738_1169 139
878 3300049590 Ga0501074_0244437 Ga0501074_0244437_104_535 139
879 3300049591 Ga0501075_0016548 Ga0501075_0016548_1985_2416 139
880 3300049591 Ga0501075_0155262 Ga0501075_0155262_828_1256 139
881 3300049591 Ga0501075_0161603 Ga0501075_0161603_800_1231 139
882 3300049591 Ga0501075_0242516 Ga0501075_0242516_71_499 139
883 3300049592 Ga0501076_0224520 Ga0501076_0224520_331_756 139
884 3300049592 Ga0501076_0354302 Ga0501076_0354302_170_601 139
885 3300049592 Ga0501076_0723694 Ga0501076_0723694_76_507 139
886 3300049593 Ga0501077_0126880 Ga0501077_0126880_679_1110 139
887 3300049593 Ga0501077_0412975 Ga0501077_0412975_416_841 139
888 3300049741 Ga0501079_0166751 Ga0501079_0166751_389_814 139
889 3300049741 Ga0501079_0319978 Ga0501079_0319978_321_752 139
890 3300049742 Ga0501080_0155468 Ga0501080_0155468_598_1029 139
891 3300049743 Ga0501081_0017956 Ga0501081_0017956_3048_3476 139
892 3300049743 Ga0501081_0201203 Ga0501081_0201203_440_871 139
893 3300049743 Ga0501081_0502458 Ga0501081_0502458_16_447 139
894 3300049743 Ga0501081_1366133 Ga0501081_1366133_88_513 139
895 3300049744 Ga0501083_1144332 Ga0501083_1144332_36_461 139
896 3300049822 Ga0501035_0307264 Ga0501035_0307264_275_700 139
897 3300049822 Ga0501035_0328002 Ga0501035_0328002_82_513 139
898 3300049822 Ga0501035_0859177 Ga0501035_0859177_24_455 139
899 3300049824 Ga0501045_0035562 Ga0501045_0035562_1284_1712 139
900 3300049824 Ga0501045_0191916 Ga0501045_0191916_976_1407 139
901 3300050490 nmdc:mga03n38_948547_c1 nmdc:mga03n38_948547_c1_32_457 139
902 3300050492 nmdc:mga0yw44_15003_c1 nmdc:mga0yw44_15003_c1_1342_1770 139
903 3300050492 nmdc:mga0yw44_71939_c1 nmdc:mga0yw44_71939_c1_475_903 139
904 3300050507 nmdc:mga05p37_1051843_c1 nmdc:mga05p37_1051843_c1_401_829 139
905 3300050507 nmdc:mga05p37_167370_c1 nmdc:mga05p37_167370_c1_171_596 139
906 3300050507 nmdc:mga05p37_221507_c1 nmdc:mga05p37_221507_c1_669_1097 139
907 3300050507 nmdc:mga05p37_478075_c1 nmdc:mga05p37_478075_c1_292_720 139
908 3300050507 nmdc:mga05p37_589934_c1 nmdc:mga05p37_589934_c1_568_1014 139
909 3300050507 nmdc:mga05p37_624888_c1 nmdc:mga05p37_624888_c1_486_914 139
910 3300050507 nmdc:mga05p37_720290_c1 nmdc:mga05p37_720290_c1_479_910 139
911 3300050508 nmdc:mga09592_12330_c1 nmdc:mga09592_12330_c1_4373_4801 139
912 3300050509 nmdc:mga0qj67_1126029_c1 nmdc:mga0qj67_1126029_c1_140_571 139
913 3300050509 nmdc:mga0qj67_144767_c1 nmdc:mga0qj67_144767_c1_482_910 139
914 3300050509 nmdc:mga0qj67_217_c1 nmdc:mga0qj67_217_c1_14474_14902 139
915 3300050510 nmdc:mga06r32_1054043_c1 nmdc:mga06r32_1054043_c1_17_445 139
916 3300050510 nmdc:mga06r32_179012_c1 nmdc:mga06r32_179012_c1_1533_1967 139
917 3300050510 nmdc:mga06r32_663_c1 nmdc:mga06r32_663_c1_15143_15571 139
918 3300050510 nmdc:mga06r32_86831_c1 nmdc:mga06r32_86831_c1_2188_2613 139
919 3300050511 nmdc:mga08y16_23659_c1 nmdc:mga08y16_23659_c1_2081_2506 139
920 3300050511 nmdc:mga08y16_700307_c1 nmdc:mga08y16_700307_c1_173_595 139
921 3300050512 nmdc:mga0n895_493823_c1 nmdc:mga0n895_493823_c1_525_953 139
922 3300050512 nmdc:mga0n895_72056_c1 nmdc:mga0n895_72056_c1_2104_2529 139
923 3300050512 nmdc:mga0n895_74803_c1 nmdc:mga0n895_74803_c1_1384_1806 139
924 3300050512 nmdc:mga0n895_850388_c1 nmdc:mga0n895_850388_c1_445_876 139
925 3300050512 nmdc:mga0n895_85184_c1 nmdc:mga0n895_85184_c1_1063_1491 139
926 3300050513 nmdc:mga0rr50_28153_c1 nmdc:mga0rr50_28153_c1_2425_2853 139
927 3300050513 nmdc:mga0rr50_311382_c1 nmdc:mga0rr50_311382_c1_790_1218 139
928 3300050514 nmdc:mga08x19_37117_c1 nmdc:mga08x19_37117_c1_246_674 139
929 3300050514 nmdc:mga08x19_52241_c2 nmdc:mga08x19_52241_c2_191_613 139
930 3300050515 nmdc:mga0a205_133071_c1 nmdc:mga0a205_133071_c1_1135_1560 139
931 3300050515 nmdc:mga0a205_142625_c1 nmdc:mga0a205_142625_c1_1471_1899 139
932 3300050515 nmdc:mga0a205_5874_c1 nmdc:mga0a205_5874_c1_6774_7202 139
933 3300050515 nmdc:mga0a205_667237_c1 nmdc:mga0a205_667237_c1_296_724 139
934 3300053077 Ga0495601_0218446 Ga0495601_0218446_317_745 139
935 3300053084 Ga0495595_0260679 Ga0495595_0260679_340_774 139
936 3300054114 Ga0501084_0054244 Ga0501084_0054244_1297_1728 139
937 3300054114 Ga0501084_0058728 Ga0501084_0058728_991_1419 139
938 3300054114 Ga0501084_0425627 Ga0501084_0425627_639_1070 139
939 3300059426 Ga0590077_172427 Ga0590077_172427_77_508 139
940 3300060353 Ga0501082_0041155 Ga0501082_0041155_778_1209 139
941 3300060353 Ga0501082_0090239 Ga0501082_0090239_1887_2318 139
942 3300060353 Ga0501082_0257460 Ga0501082_0257460_52_477 139
943 3300060353 Ga0501082_0454712 Ga0501082_0454712_517_945 139
944 3300061734 Ga0530510_0008481 Ga0530510_0008481_1084_1515 139
945 3300061734 Ga0530510_0123967 Ga0530510_0123967_1151_1582 139
946 3300001904 JGI24736J21556_1041088 JGI24736J21556_10410882 140
947 3300005327 Ga0070658_10037074 Ga0070658_100370744 140
948 3300005329 Ga0070683_101010823 Ga0070683_1010108232 140
949 3300005548 Ga0070665_100062446 Ga0070665_1000624464 140
950 3300005563 Ga0068855_100001116 Ga0068855_10000111610 140
951 3300005578 Ga0068854_100001227 Ga0068854_1000012278 140
952 3300005614 Ga0068856_100010650 Ga0068856_1000106503 140
953 3300005616 Ga0068852_100006167 Ga0068852_1000061674 140
954 3300009093 Ga0105240_10044418 Ga0105240_100444186 140
955 3300009174 Ga0105241_10000679 Ga0105241_1000067923 140
956 3300009545 Ga0105237_10021862 Ga0105237_100218626 140
957 3300009551 Ga0105238_10007746 Ga0105238_100077462 140
958 3300010375 Ga0105239_10083208 Ga0105239_100832083 140
959 3300013105 Ga0157369_11308463 Ga0157369_113084631 140
960 3300013296 Ga0157374_10029322 Ga0157374_100293224 140
961 3300025904 Ga0207647_10004931 Ga0207647_100049319 140
962 3300025911 Ga0207654_10002912 Ga0207654_100029125 140
963 3300025913 Ga0207695_10001784 Ga0207695_100017843 140
964 3300025914 Ga0207671_10000197 Ga0207671_1000019710 140
965 3300025919 Ga0207657_10350054 Ga0207657_103500542 140
966 3300025924 Ga0207694_10001211 Ga0207694_1000121112 140
967 3300025949 Ga0207667_10204827 Ga0207667_102048272 140
968 3300026041 Ga0207639_10088912 Ga0207639_100889122 140
969 3300026078 Ga0207702_10129722 Ga0207702_101297222 140
970 3300026116 Ga0207674_10590502 Ga0207674_105905021 140
971 3300026116 Ga0207674_11357181 Ga0207674_113571811 140
972 3300026142 Ga0207698_10916071 Ga0207698_109160712 140
973 3300028379 Ga0268266_10421124 Ga0268266_104211242 140
974 3300044765 Ga0466970_0050036 Ga0466970_0050036_200_622 140
975 3300045049 Ga0466959_0813471 Ga0466959_0813471_47_469 140
976 3300045836 Ga0466958_0342416 Ga0466958_0342416_347_769 140
977 3300046454 Ga0495592_0045230 Ga0495592_0045230_1546_1968 140
978 3300046462 Ga0495651_0069980 Ga0495651_0069980_1630_2052 140
979 3300046516 Ga0495628_0081217 Ga0495628_0081217_678_1100 140
980 3300046529 Ga0495652_0014337 Ga0495652_0014337_1367_1789 140
981 3300046543 Ga0495645_0089874 Ga0495645_0089874_1241_1663 140
982 3300046675 Ga0495657_0230042 Ga0495657_0230042_521_943 140
983 3300046809 Ga0495600_0012189 Ga0495600_0012189_4095_4517 140
984 3300047315 Ga0495581_0208110 Ga0495581_0208110_423_845 140
985 3300047317 Ga0495604_0336120 Ga0495604_0336120_86_508 140
986 3300047319 Ga0495674_0208861 Ga0495674_0208861_383_805 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

132

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9367 2 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9334 1 137
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.926 1 134
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9202 1 137
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9095 2 135
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9198 85 135 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8869 85 135 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8695 85 137 3.30.720.110
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8533 6 133 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.828 85 137 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4Q2SS95-F1-model_v4 VOC family protein 0.987 61 138
AF-A0A538K6I0-F1-model_v4 VOC family protein 0.9822 1 137
AF-A0A7Z0A2P2-F1-model_v4 deleted 0.9728 85 138
AF-A0A1G7N9Q5-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9726 85 137 GO:0051213
AF-D6BDL2-F1-model_v4 S-D-lactoylglutathione methylglyoxal lyase 0.969 86 135 GO:0016829

Feature Viewer

pLDDT pTM Quality
92.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map