F487523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 371 | 984 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10278835|Ga0105251_102788352 |
| Length | 142 |
| Sequence | MFKLDSTQLWVHDQDEALAFYTEKLGLELREDVTVPELGNFRWLTVGPVGQDISIVLMAISGAPVLDEDSNRQIHELMGKGYAGTVFLTTDDCRASYEDLKARGVEFTTAPEEMPYGIDSGFRDPSGNSIRLTQVTQQFAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 2 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 141 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 215 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 230 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 2.13 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.81 |
| Nodule | 0 |
| Rhizoplane | 6.29 |
| Rhizosphere | 89.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1041088 | 3300001904 | Bacteria | 711 |
| 2 | JGI24737J22298_10189957 | 3300001990 | Bacteria | 606 |
| 3 | JGI24737J22298_10267160 | 3300001990 | Bacteria | 506 |
| 4 | JGI24743J22301_10026714 | 3300001991 | Bacteria | 1125 |
| 5 | JGI24750J21931_1036962 | 3300002070 | Bacteria | 732 |
| 6 | JGI24738J21930_10029403 | 3300002075 | Bacteria | 1123 |
| 7 | JGI24034J26672_10052795 | 3300002239 | Bacteria | 702 |
| 8 | Ga0006778J45830_1037705 | 3300003162 | Bacteria | 510 |
| 9 | Ga0006759J45824_1024331 | 3300003163 | Bacteria | 516 |
| 10 | JGI25406J46586_10009040 | 3300003203 | Bacteria | 4479 |
| 11 | JGI25407J50210_10085528 | 3300003373 | Bacteria | 782 |
| 12 | Ga0006781J51513_1023272 | 3300003568 | Bacteria | 500 |
| 13 | Ga0007409J51694_1021205 | 3300003575 | Bacteria | 507 |
| 14 | Ga0007416J51690_1022293 | 3300003577 | Bacteria | 542 |
| 15 | Ga0007416J51690_1113228 | 3300003577 | Bacteria | 582 |
| 16 | Ga0007429J51699_1059757 | 3300003579 | Bacteria | 538 |
| 17 | Ga0070658_10037074 | 3300005327 | Bacteria | 3929 |
| 18 | Ga0070683_100003913 | 3300005329 | Bacteria | 12172 |
| 19 | Ga0070683_100020290 | 3300005329 | Bacteria | 5913 |
| 20 | Ga0070683_100088509 | 3300005329 | Bacteria | 2905 |
| 21 | Ga0070683_101010823 | 3300005329 | Bacteria | 798 |
| 22 | Ga0070683_101230263 | 3300005329 | Bacteria | 720 |
| 23 | Ga0070670_100338572 | 3300005331 | Bacteria | 1320 |
| 24 | Ga0070670_101185308 | 3300005331 | Bacteria | 698 |
| 25 | Ga0068869_100053839 | 3300005334 | Unclassified | 2927 |
| 26 | Ga0068869_100123788 | 3300005334 | Bacteria | 1981 |
| 27 | Ga0068869_100808870 | 3300005334 | Bacteria | 806 |
| 28 | Ga0070666_10436761 | 3300005335 | Bacteria | 944 |
| 29 | Ga0070680_100161146 | 3300005336 | Bacteria | 1885 |
| 30 | Ga0070680_100177968 | 3300005336 | Bacteria | 1791 |
| 31 | Ga0070680_100681746 | 3300005336 | Bacteria | 884 |
| 32 | Ga0070682_100108542 | 3300005337 | Bacteria | 1845 |
| 33 | Ga0070682_100237601 | 3300005337 | Unclassified | 1306 |
| 34 | Ga0068868_100056769 | 3300005338 | Unclassified | 3092 |
| 35 | Ga0068868_100073458 | 3300005338 | Bacteria | 2731 |
| 36 | Ga0068868_100082636 | 3300005338 | Bacteria | 2576 |
| 37 | Ga0068868_100620860 | 3300005338 | Bacteria | 960 |
| 38 | Ga0070689_100933550 | 3300005340 | Bacteria | 769 |
| 39 | Ga0070689_101351009 | 3300005340 | Bacteria | 643 |
| 40 | Ga0070691_10097784 | 3300005341 | Bacteria | 1455 |
| 41 | Ga0070691_10473765 | 3300005341 | Bacteria | 719 |
| 42 | Ga0070687_100549177 | 3300005343 | Bacteria | 786 |
| 43 | Ga0070687_100629975 | 3300005343 | Bacteria | 741 |
| 44 | Ga0070692_10106039 | 3300005345 | Bacteria | 1548 |
| 45 | Ga0070668_100215138 | 3300005347 | Bacteria | 1582 |
| 46 | Ga0070668_100613627 | 3300005347 | Bacteria | 953 |
| 47 | Ga0070669_100446973 | 3300005353 | Bacteria | 1065 |
| 48 | Ga0070675_100233043 | 3300005354 | Bacteria | 1607 |
| 49 | Ga0070674_100301402 | 3300005356 | Bacteria | 1278 |
| 50 | Ga0070674_100589477 | 3300005356 | Bacteria | 938 |
| 51 | Ga0070674_100757986 | 3300005356 | Bacteria | 835 |
| 52 | Ga0070674_100855681 | 3300005356 | Bacteria | 789 |
| 53 | Ga0070688_100383407 | 3300005365 | Bacteria | 1037 |
| 54 | Ga0070688_101065150 | 3300005365 | Bacteria | 645 |
| 55 | Ga0070659_100018508 | 3300005366 | Bacteria | 5255 |
| 56 | Ga0070659_100042790 | 3300005366 | Bacteria | 3542 |
| 57 | Ga0070659_100229300 | 3300005366 | Bacteria | 1535 |
| 58 | Ga0070659_100433650 | 3300005366 | Bacteria | 1112 |
| 59 | Ga0070667_100257367 | 3300005367 | Bacteria | 1562 |
| 60 | Ga0070667_100307010 | 3300005367 | Bacteria | 1429 |
| 61 | Ga0070667_100429102 | 3300005367 | Bacteria | 1206 |
| 62 | Ga0070709_10368780 | 3300005434 | Bacteria | 1065 |
| 63 | Ga0070709_10438903 | 3300005434 | Unclassified | 981 |
| 64 | Ga0070714_100170478 | 3300005435 | Bacteria | 1975 |
| 65 | Ga0070714_100188355 | 3300005435 | Unclassified | 1881 |
| 66 | Ga0070714_100266527 | 3300005435 | Bacteria | 1587 |
| 67 | Ga0070714_100540607 | 3300005435 | Bacteria | 1114 |
| 68 | Ga0070714_101633332 | 3300005435 | Bacteria | 629 |
| 69 | Ga0070713_100153684 | 3300005436 | Bacteria | 2049 |
| 70 | Ga0070713_100202563 | 3300005436 | Bacteria | 1793 |
| 71 | Ga0070713_100471014 | 3300005436 | Bacteria | 1182 |
| 72 | Ga0070710_10000019 | 3300005437 | Bacteria | 88049 |
| 73 | Ga0070710_10034496 | 3300005437 | Bacteria | 2753 |
| 74 | Ga0070710_10162633 | 3300005437 | Bacteria | 1385 |
| 75 | Ga0070710_10262668 | 3300005437 | Bacteria | 1114 |
| 76 | Ga0070701_10119402 | 3300005438 | Bacteria | 1483 |
| 77 | Ga0070711_100014408 | 3300005439 | Bacteria | 4983 |
| 78 | Ga0070711_100021474 | 3300005439 | Bacteria | 4175 |
| 79 | Ga0070711_100137214 | 3300005439 | Bacteria | 1830 |
| 80 | Ga0070705_100071930 | 3300005440 | Bacteria | 2093 |
| 81 | Ga0070705_100110338 | 3300005440 | Bacteria | 1756 |
| 82 | Ga0070705_100130894 | 3300005440 | Bacteria | 1636 |
| 83 | Ga0070705_100212022 | 3300005440 | Bacteria | 1336 |
| 84 | Ga0070700_100034090 | 3300005441 | Bacteria | 3072 |
| 85 | Ga0070700_100109985 | 3300005441 | Bacteria | 1830 |
| 86 | Ga0070700_100161571 | 3300005441 | Bacteria | 1542 |
| 87 | Ga0070700_100565106 | 3300005441 | Bacteria | 886 |
| 88 | Ga0070700_101251638 | 3300005441 | Bacteria | 622 |
| 89 | Ga0070694_100043447 | 3300005444 | Bacteria | 3005 |
| 90 | Ga0070694_100050878 | 3300005444 | Bacteria | 2794 |
| 91 | Ga0070694_101452139 | 3300005444 | Bacteria | 580 |
| 92 | Ga0070708_100701475 | 3300005445 | Bacteria | 952 |
| 93 | Ga0070662_100092602 | 3300005457 | Bacteria | 2272 |
| 94 | Ga0070662_100214271 | 3300005457 | Bacteria | 1534 |
| 95 | Ga0070662_101894371 | 3300005457 | Bacteria | 515 |
| 96 | Ga0070681_10127450 | 3300005458 | Bacteria | 2478 |
| 97 | Ga0068867_100108050 | 3300005459 | Bacteria | 2133 |
| 98 | Ga0068867_100524032 | 3300005459 | Bacteria | 1022 |
| 99 | Ga0068867_100627217 | 3300005459 | Bacteria | 941 |
| 100 | Ga0068867_101296678 | 3300005459 | Bacteria | 672 |
| 101 | Ga0070685_10176308 | 3300005466 | Bacteria | 1373 |
| 102 | Ga0070685_10711560 | 3300005466 | Bacteria | 733 |
| 103 | Ga0070706_100316554 | 3300005467 | Bacteria | 1455 |
| 104 | Ga0070707_100108509 | 3300005468 | Bacteria | 2692 |
| 105 | Ga0070707_100790285 | 3300005468 | Bacteria | 913 |
| 106 | Ga0070699_100161522 | 3300005518 | Bacteria | 1983 |
| 107 | Ga0070699_100581108 | 3300005518 | Bacteria | 1021 |
| 108 | Ga0070679_101349529 | 3300005530 | Bacteria | 659 |
| 109 | Ga0070684_100004742 | 3300005535 | Bacteria | 10386 |
| 110 | Ga0070684_100095395 | 3300005535 | Bacteria | 2650 |
| 111 | Ga0070684_100681263 | 3300005535 | Bacteria | 958 |
| 112 | Ga0070697_100303359 | 3300005536 | Bacteria | 1373 |
| 113 | Ga0070697_100369743 | 3300005536 | Bacteria | 1240 |
| 114 | Ga0070697_101266823 | 3300005536 | Bacteria | 657 |
| 115 | Ga0068853_100085414 | 3300005539 | Bacteria | 2766 |
| 116 | Ga0070672_100143012 | 3300005543 | Bacteria | 1975 |
| 117 | Ga0070672_100801033 | 3300005543 | Bacteria | 829 |
| 118 | Ga0070686_100046501 | 3300005544 | Bacteria | 2739 |
| 119 | Ga0070686_100653189 | 3300005544 | Bacteria | 834 |
| 120 | Ga0070695_100020842 | 3300005545 | Bacteria | 4005 |
| 121 | Ga0070695_100123996 | 3300005545 | Bacteria | 1771 |
| 122 | Ga0070695_100156209 | 3300005545 | Bacteria | 1596 |
| 123 | Ga0070696_100098041 | 3300005546 | Bacteria | 2097 |
| 124 | Ga0070696_100414364 | 3300005546 | Unclassified | 1056 |
| 125 | Ga0070693_100035424 | 3300005547 | Bacteria | 2768 |
| 126 | Ga0070693_100062472 | 3300005547 | Bacteria | 2168 |
| 127 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 128 | Ga0070665_100062446 | 3300005548 | Bacteria | 3735 |
| 129 | Ga0070665_100343462 | 3300005548 | Unclassified | 1498 |
| 130 | Ga0070665_100407376 | 3300005548 | Bacteria | 1368 |
| 131 | Ga0070704_100051941 | 3300005549 | Bacteria | 2889 |
| 132 | Ga0070704_100113095 | 3300005549 | Bacteria | 2069 |
| 133 | Ga0070704_100180507 | 3300005549 | Bacteria | 1688 |
| 134 | Ga0070704_100475194 | 3300005549 | Bacteria | 1081 |
| 135 | Ga0068855_100001116 | 3300005563 | Bacteria | 33381 |
| 136 | Ga0068855_100016543 | 3300005563 | Bacteria | 8871 |
| 137 | Ga0068855_100288270 | 3300005563 | Bacteria | 1821 |
| 138 | Ga0068855_100868502 | 3300005563 | Bacteria | 955 |
| 139 | Ga0070664_100217248 | 3300005564 | Unclassified | 1710 |
| 140 | Ga0070664_100313891 | 3300005564 | Bacteria | 1419 |
| 141 | Ga0070664_101371155 | 3300005564 | Unclassified | 668 |
| 142 | Ga0068857_100001344 | 3300005577 | Bacteria | 19383 |
| 143 | Ga0068857_100189725 | 3300005577 | Bacteria | 1872 |
| 144 | Ga0068857_100310535 | 3300005577 | Unclassified | 1455 |
| 145 | Ga0068854_100001227 | 3300005578 | Bacteria | 15386 |
| 146 | Ga0068854_100135944 | 3300005578 | Bacteria | 1882 |
| 147 | Ga0068854_100324301 | 3300005578 | Bacteria | 1253 |
| 148 | Ga0068854_100419112 | 3300005578 | Bacteria | 1112 |
| 149 | Ga0068856_100010650 | 3300005614 | Bacteria | 8935 |
| 150 | Ga0068856_100217421 | 3300005614 | Bacteria | 1926 |
| 151 | Ga0068856_101870390 | 3300005614 | Bacteria | 611 |
| 152 | Ga0070702_100000693 | 3300005615 | Bacteria | 12683 |
| 153 | Ga0070702_100036760 | 3300005615 | Bacteria | 2715 |
| 154 | Ga0070702_100050546 | 3300005615 | Bacteria | 2375 |
| 155 | Ga0070702_100109987 | 3300005615 | Bacteria | 1707 |
| 156 | Ga0070702_100324680 | 3300005615 | Bacteria | 1074 |
| 157 | Ga0068852_100006167 | 3300005616 | Bacteria | 8648 |
| 158 | Ga0068852_100019170 | 3300005616 | Bacteria | 5407 |
| 159 | Ga0068852_100374892 | 3300005616 | Bacteria | 1395 |
| 160 | Ga0068859_100056438 | 3300005617 | Bacteria | 3953 |
| 161 | Ga0068859_100105189 | 3300005617 | Unclassified | 2882 |
| 162 | Ga0068859_100199282 | 3300005617 | Bacteria | 2086 |
| 163 | Ga0068864_100109640 | 3300005618 | Bacteria | 2458 |
| 164 | Ga0068864_100140959 | 3300005618 | Unclassified | 2174 |
| 165 | Ga0068864_102481669 | 3300005618 | Bacteria | 525 |
| 166 | Ga0068866_10022680 | 3300005718 | Bacteria | 2908 |
| 167 | Ga0068866_10046122 | 3300005718 | Bacteria | 2190 |
| 168 | Ga0068866_10476372 | 3300005718 | Bacteria | 821 |
| 169 | Ga0068861_100073271 | 3300005719 | Bacteria | 2660 |
| 170 | Ga0068861_100268095 | 3300005719 | Bacteria | 1465 |
| 171 | Ga0068861_100461245 | 3300005719 | Bacteria | 1141 |
| 172 | Ga0068861_100642077 | 3300005719 | Bacteria | 979 |
| 173 | Ga0068851_10065830 | 3300005834 | Bacteria | 1866 |
| 174 | Ga0068851_10502056 | 3300005834 | Bacteria | 727 |
| 175 | Ga0068870_10188243 | 3300005840 | Bacteria | 1244 |
| 176 | Ga0068863_100185402 | 3300005841 | Bacteria | 1998 |
| 177 | Ga0068858_100000526 | 3300005842 | Bacteria | 40242 |
| 178 | Ga0068858_100035699 | 3300005842 | Bacteria | 4610 |
| 179 | Ga0068858_100737182 | 3300005842 | Bacteria | 960 |
| 180 | Ga0068860_100199633 | 3300005843 | Bacteria | 1938 |
| 181 | Ga0068860_100616232 | 3300005843 | Bacteria | 1092 |
| 182 | Ga0068862_100169176 | 3300005844 | Bacteria | 1956 |
| 183 | Ga0068862_100219017 | 3300005844 | Bacteria | 1722 |
| 184 | Ga0068862_100725446 | 3300005844 | Bacteria | 965 |
| 185 | Ga0081455_10145630 | 3300005937 | Bacteria | 1833 |
| 186 | Ga0081538_10010525 | 3300005981 | Bacteria | 7583 |
| 187 | Ga0081538_10017145 | 3300005981 | Bacteria | 5509 |
| 188 | Ga0081538_10049873 | 3300005981 | Bacteria | 2535 |
| 189 | Ga0081538_10053403 | 3300005981 | Bacteria | 2402 |
| 190 | Ga0081538_10149235 | 3300005981 | Bacteria | 1062 |
| 191 | Ga0081538_10164941 | 3300005981 | Bacteria | 977 |
| 192 | Ga0081538_10194792 | 3300005981 | Bacteria | 843 |
| 193 | Ga0081538_10281361 | 3300005981 | Bacteria | 618 |
| 194 | Ga0081540_1003252 | 3300005983 | Bacteria | 12918 |
| 195 | Ga0081539_10002244 | 3300005985 | Bacteria | 28103 |
| 196 | Ga0081539_10044903 | 3300005985 | Bacteria | 2547 |
| 197 | Ga0070717_10014008 | 3300006028 | Bacteria | 6160 |
| 198 | Ga0070717_10019885 | 3300006028 | Bacteria | 5272 |
| 199 | Ga0070717_10077302 | 3300006028 | Bacteria | 2787 |
| 200 | Ga0070717_10172135 | 3300006028 | Bacteria | 1884 |
| 201 | Ga0075365_10005157 | 3300006038 | Bacteria | 7021 |
| 202 | Ga0075365_10060380 | 3300006038 | Bacteria | 2529 |
| 203 | Ga0075363_100350855 | 3300006048 | Bacteria | 862 |
| 204 | Ga0075364_10045551 | 3300006051 | Bacteria | 2855 |
| 205 | Ga0075432_10107710 | 3300006058 | Bacteria | 1036 |
| 206 | Ga0070715_10004983 | 3300006163 | Bacteria | 4399 |
| 207 | Ga0070715_10373632 | 3300006163 | Bacteria | 785 |
| 208 | Ga0070716_100023088 | 3300006173 | Bacteria | 3294 |
| 209 | Ga0070716_100108640 | 3300006173 | Bacteria | 1714 |
| 210 | Ga0070712_100007865 | 3300006175 | Bacteria | 6680 |
| 211 | Ga0070712_100009456 | 3300006175 | Bacteria | 6142 |
| 212 | Ga0070712_100162301 | 3300006175 | Bacteria | 1726 |
| 213 | Ga0070712_100247362 | 3300006175 | Bacteria | 1423 |
| 214 | Ga0070712_100665268 | 3300006175 | Bacteria | 886 |
| 215 | Ga0097621_100134188 | 3300006237 | Bacteria | 2110 |
| 216 | Ga0097621_100339742 | 3300006237 | Bacteria | 1333 |
| 217 | Ga0097621_100421803 | 3300006237 | Bacteria | 1198 |
| 218 | Ga0097621_100883173 | 3300006237 | Bacteria | 832 |
| 219 | Ga0068871_100095998 | 3300006358 | Bacteria | 2476 |
| 220 | Ga0068871_100232098 | 3300006358 | Unclassified | 1602 |
| 221 | Ga0068871_100342292 | 3300006358 | Bacteria | 1321 |
| 222 | Ga0068871_101882466 | 3300006358 | Bacteria | 569 |
| 223 | Ga0075428_100051095 | 3300006844 | Bacteria | 4533 |
| 224 | Ga0075428_100112498 | 3300006844 | Bacteria | 2965 |
| 225 | Ga0075428_100492253 | 3300006844 | Bacteria | 1312 |
| 226 | Ga0075428_101276631 | 3300006844 | Bacteria | 773 |
| 227 | Ga0075428_101418314 | 3300006844 | Bacteria | 729 |
| 228 | Ga0075430_100015802 | 3300006846 | Bacteria | 6428 |
| 229 | Ga0075430_100209413 | 3300006846 | Bacteria | 1618 |
| 230 | Ga0075430_100488650 | 3300006846 | Bacteria | 1016 |
| 231 | Ga0075431_100000056 | 3300006847 | Bacteria | 62721 |
| 232 | Ga0075431_100005114 | 3300006847 | Bacteria | 12905 |
| 233 | Ga0075431_101251217 | 3300006847 | Bacteria | 704 |
| 234 | Ga0075431_101454432 | 3300006847 | Bacteria | 644 |
| 235 | Ga0075433_10001182 | 3300006852 | Bacteria | 18987 |
| 236 | Ga0075433_10004243 | 3300006852 | Bacteria | 11133 |
| 237 | Ga0075433_10120143 | 3300006852 | Bacteria | 2333 |
| 238 | Ga0075433_10193583 | 3300006852 | Bacteria | 1809 |
| 239 | Ga0075434_100000502 | 3300006871 | Bacteria | 29641 |
| 240 | Ga0075434_100014188 | 3300006871 | Bacteria | 7612 |
| 241 | Ga0075434_100081498 | 3300006871 | Bacteria | 3233 |
| 242 | Ga0075434_100420919 | 3300006871 | Bacteria | 1357 |
| 243 | Ga0075429_100005701 | 3300006880 | Bacteria | 10743 |
| 244 | Ga0068865_100045584 | 3300006881 | Bacteria | 3006 |
| 245 | Ga0068865_100118747 | 3300006881 | Bacteria | 1963 |
| 246 | Ga0068865_100946149 | 3300006881 | Bacteria | 752 |
| 247 | Ga0075436_100019752 | 3300006914 | Bacteria | 4620 |
| 248 | Ga0075436_100042988 | 3300006914 | Bacteria | 3115 |
| 249 | Ga0097620_100056440 | 3300006931 | Bacteria | 3953 |
| 250 | Ga0097620_100105191 | 3300006931 | Unclassified | 2882 |
| 251 | Ga0097620_100199296 | 3300006931 | Bacteria | 2086 |
| 252 | Ga0075435_100024172 | 3300007076 | Bacteria | 4711 |
| 253 | Ga0075435_100024209 | 3300007076 | Bacteria | 4708 |
| 254 | Ga0075435_101301764 | 3300007076 | Bacteria | 636 |
| 255 | Ga0105251_10102314 | 3300009011 | Bacteria | 1309 |
| 256 | Ga0105251_10278835 | 3300009011 | Bacteria | 756 |
| 257 | Ga0105244_10213607 | 3300009036 | Bacteria | 907 |
| 258 | Ga0105244_10290152 | 3300009036 | Bacteria | 758 |
| 259 | Ga0105250_10241255 | 3300009092 | Bacteria | 771 |
| 260 | Ga0105240_10044418 | 3300009093 | Bacteria | 5645 |
| 261 | Ga0105240_11032037 | 3300009093 | Bacteria | 878 |
| 262 | Ga0105240_11914395 | 3300009093 | Bacteria | 617 |
| 263 | Ga0111539_10035210 | 3300009094 | Bacteria | 6063 |
| 264 | Ga0111539_10604528 | 3300009094 | Bacteria | 1277 |
| 265 | Ga0111539_11442083 | 3300009094 | Bacteria | 798 |
| 266 | Ga0111539_11472080 | 3300009094 | Bacteria | 790 |
| 267 | Ga0111539_11515109 | 3300009094 | Bacteria | 778 |
| 268 | Ga0105245_10000310 | 3300009098 | Bacteria | 46567 |
| 269 | Ga0105245_10039338 | 3300009098 | Bacteria | 4209 |
| 270 | Ga0105245_10102221 | 3300009098 | Bacteria | 2654 |
| 271 | Ga0105245_10118493 | 3300009098 | Bacteria | 2470 |
| 272 | Ga0105245_10138126 | 3300009098 | Bacteria | 2293 |
| 273 | Ga0105245_10263653 | 3300009098 | Bacteria | 1678 |
| 274 | Ga0105245_10612336 | 3300009098 | Bacteria | 1116 |
| 275 | Ga0105245_10811186 | 3300009098 | Bacteria | 974 |
| 276 | Ga0105245_11344811 | 3300009098 | Bacteria | 764 |
| 277 | Ga0105245_12679551 | 3300009098 | Bacteria | 552 |
| 278 | Ga0105247_10034222 | 3300009101 | Bacteria | 3094 |
| 279 | Ga0105247_10078979 | 3300009101 | Bacteria | 2070 |
| 280 | Ga0114129_10026448 | 3300009147 | Bacteria | 8215 |
| 281 | Ga0114129_10031528 | 3300009147 | Bacteria | 7492 |
| 282 | Ga0114129_10108772 | 3300009147 | Bacteria | 3827 |
| 283 | Ga0114129_10182955 | 3300009147 | Bacteria | 2850 |
| 284 | Ga0114129_10364248 | 3300009147 | Bacteria | 1912 |
| 285 | Ga0114129_11084960 | 3300009147 | Bacteria | 1003 |
| 286 | Ga0114129_11225138 | 3300009147 | Bacteria | 934 |
| 287 | Ga0114129_11557652 | 3300009147 | Bacteria | 810 |
| 288 | Ga0114129_13070603 | 3300009147 | Bacteria | 547 |
| 289 | Ga0105243_10036928 | 3300009148 | Bacteria | 3795 |
| 290 | Ga0105243_10161469 | 3300009148 | Bacteria | 1932 |
| 291 | Ga0105243_10163828 | 3300009148 | Bacteria | 1919 |
| 292 | Ga0105243_10226522 | 3300009148 | Bacteria | 1656 |
| 293 | Ga0105243_10336663 | 3300009148 | Bacteria | 1381 |
| 294 | Ga0105243_10623382 | 3300009148 | Bacteria | 1041 |
| 295 | Ga0105243_10748148 | 3300009148 | Bacteria | 958 |
| 296 | Ga0105243_11485162 | 3300009148 | Bacteria | 701 |
| 297 | Ga0105241_10000679 | 3300009174 | Bacteria | 25627 |
| 298 | Ga0105241_10660615 | 3300009174 | Bacteria | 950 |
| 299 | Ga0105241_10729215 | 3300009174 | Bacteria | 907 |
| 300 | Ga0105241_11083573 | 3300009174 | Bacteria | 753 |
| 301 | Ga0105241_11230937 | 3300009174 | Bacteria | 710 |
| 302 | Ga0105241_12607157 | 3300009174 | Bacteria | 508 |
| 303 | Ga0105242_10051814 | 3300009176 | Bacteria | 3346 |
| 304 | Ga0105242_10303250 | 3300009176 | Unclassified | 1459 |
| 305 | Ga0105242_10346191 | 3300009176 | Bacteria | 1371 |
| 306 | Ga0105242_10403565 | 3300009176 | Bacteria | 1276 |
| 307 | Ga0105242_11009281 | 3300009176 | Bacteria | 840 |
| 308 | Ga0105248_10572955 | 3300009177 | Bacteria | 1274 |
| 309 | Ga0105248_10593701 | 3300009177 | Bacteria | 1249 |
| 310 | Ga0105248_10812669 | 3300009177 | Bacteria | 1055 |
| 311 | Ga0105237_10021862 | 3300009545 | Bacteria | 6570 |
| 312 | Ga0105237_10298520 | 3300009545 | Bacteria | 1614 |
| 313 | Ga0105237_10485531 | 3300009545 | Bacteria | 1242 |
| 314 | Ga0105238_10007746 | 3300009551 | Bacteria | 10740 |
| 315 | Ga0105238_10192480 | 3300009551 | Bacteria | 2015 |
| 316 | Ga0105238_10767972 | 3300009551 | Bacteria | 978 |
| 317 | Ga0105238_11071342 | 3300009551 | Bacteria | 828 |
| 318 | Ga0105238_11172428 | 3300009551 | Bacteria | 792 |
| 319 | Ga0105249_10010497 | 3300009553 | Bacteria | 8138 |
| 320 | Ga0105249_10040209 | 3300009553 | Bacteria | 4247 |
| 321 | Ga0105249_10054663 | 3300009553 | Bacteria | 3652 |
| 322 | Ga0105249_10201395 | 3300009553 | Bacteria | 1948 |
| 323 | Ga0105249_10307074 | 3300009553 | Bacteria | 1593 |
| 324 | Ga0105249_10606684 | 3300009553 | Bacteria | 1149 |
| 325 | Ga0105249_10908721 | 3300009553 | Bacteria | 947 |
| 326 | Ga0105249_12575738 | 3300009553 | Bacteria | 581 |
| 327 | Ga0105239_10083208 | 3300010375 | Bacteria | 3524 |
| 328 | Ga0105239_10106602 | 3300010375 | Bacteria | 3104 |
| 329 | Ga0105239_10170939 | 3300010375 | Bacteria | 2430 |
| 330 | Ga0105239_11130894 | 3300010375 | Bacteria | 902 |
| 331 | Ga0105239_11966776 | 3300010375 | Bacteria | 678 |
| 332 | Ga0105239_12124458 | 3300010375 | Bacteria | 653 |
| 333 | Ga0105246_10034823 | 3300011119 | Bacteria | 3359 |
| 334 | Ga0105246_11132305 | 3300011119 | Bacteria | 716 |
| 335 | Ga0157373_10552407 | 3300013100 | Bacteria | 835 |
| 336 | Ga0157371_10052919 | 3300013102 | Bacteria | 2883 |
| 337 | Ga0157371_10276356 | 3300013102 | Bacteria | 1213 |
| 338 | Ga0157370_10092263 | 3300013104 | Bacteria | 2842 |
| 339 | Ga0157369_10097074 | 3300013105 | Bacteria | 3143 |
| 340 | Ga0157369_10282664 | 3300013105 | Bacteria | 1728 |
| 341 | Ga0157369_11308463 | 3300013105 | Bacteria | 739 |
| 342 | Ga0157374_10029322 | 3300013296 | Bacteria | 4981 |
| 343 | Ga0157374_10097074 | 3300013296 | Bacteria | 2819 |
| 344 | Ga0157374_10238233 | 3300013296 | Bacteria | 1789 |
| 345 | Ga0157374_11200312 | 3300013296 | Unclassified | 780 |
| 346 | Ga0157378_10015831 | 3300013297 | Bacteria | 6603 |
| 347 | Ga0157378_10126081 | 3300013297 | Unclassified | 2365 |
| 348 | Ga0157378_10205933 | 3300013297 | Bacteria | 1863 |
| 349 | Ga0157378_10391500 | 3300013297 | Bacteria | 1367 |
| 350 | Ga0157378_10644279 | 3300013297 | Bacteria | 1075 |
| 351 | Ga0163162_10264022 | 3300013306 | Bacteria | 1853 |
| 352 | Ga0163162_10266223 | 3300013306 | Bacteria | 1845 |
| 353 | Ga0163162_10539399 | 3300013306 | Bacteria | 1295 |
| 354 | Ga0157372_10790502 | 3300013307 | Bacteria | 1103 |
| 355 | Ga0157372_10944843 | 3300013307 | Bacteria | 999 |
| 356 | Ga0157372_11997687 | 3300013307 | Bacteria | 666 |
| 357 | Ga0157375_10378068 | 3300013308 | Bacteria | 1583 |
| 358 | Ga0157375_10593467 | 3300013308 | Bacteria | 1267 |
| 359 | Ga0157375_10698404 | 3300013308 | Bacteria | 1168 |
| 360 | Ga0157375_10869396 | 3300013308 | Bacteria | 1047 |
| 361 | Ga0157375_11549163 | 3300013308 | Bacteria | 783 |
| 362 | Ga0163163_10047977 | 3300014325 | Bacteria | 4198 |
| 363 | Ga0163163_10220177 | 3300014325 | Bacteria | 1947 |
| 364 | Ga0157380_10363266 | 3300014326 | Bacteria | 1359 |
| 365 | Ga0157380_10547672 | 3300014326 | Unclassified | 1134 |
| 366 | Ga0157380_11085532 | 3300014326 | Bacteria | 839 |
| 367 | Ga0157377_10013230 | 3300014745 | Bacteria | 4173 |
| 368 | Ga0157377_10100441 | 3300014745 | Bacteria | 1723 |
| 369 | Ga0157379_10105162 | 3300014968 | Bacteria | 2533 |
| 370 | Ga0157379_10124071 | 3300014968 | Unclassified | 2324 |
| 371 | Ga0157379_10345836 | 3300014968 | Bacteria | 1361 |
| 372 | Ga0157379_10535650 | 3300014968 | Bacteria | 1088 |
| 373 | Ga0157376_10157513 | 3300014969 | Bacteria | 2055 |
| 374 | Ga0163161_10054622 | 3300017792 | Bacteria | 2899 |
| 375 | Ga0163161_10295209 | 3300017792 | Bacteria | 1275 |
| 376 | Ga0197907_10563192 | 3300020069 | Bacteria | 958 |
| 377 | Ga0206356_10463577 | 3300020070 | Bacteria | 845 |
| 378 | Ga0206349_1547479 | 3300020075 | Bacteria | 514 |
| 379 | Ga0206355_1047451 | 3300020076 | Unclassified | 872 |
| 380 | Ga0206352_10031256 | 3300020078 | Bacteria | 504 |
| 381 | Ga0206352_10282433 | 3300020078 | Bacteria | 546 |
| 382 | Ga0206352_10397907 | 3300020078 | Bacteria | 950 |
| 383 | Ga0206352_11008601 | 3300020078 | Bacteria | 724 |
| 384 | Ga0206354_10533889 | 3300020081 | Bacteria | 1410 |
| 385 | Ga0206353_10343017 | 3300020082 | Bacteria | 1272 |
| 386 | Ga0206353_11951656 | 3300020082 | Unclassified | 545 |
| 387 | Ga0213874_10001344 | 3300021377 | Bacteria | 5079 |
| 388 | Ga0213874_10265885 | 3300021377 | Bacteria | 636 |
| 389 | Ga0213876_10002583 | 3300021384 | Bacteria | 10580 |
| 390 | Ga0213876_10012527 | 3300021384 | Bacteria | 4512 |
| 391 | Ga0213876_10033207 | 3300021384 | Unclassified | 2721 |
| 392 | Ga0213876_10112189 | 3300021384 | Bacteria | 1447 |
| 393 | Ga0213876_10347355 | 3300021384 | Bacteria | 789 |
| 394 | Ga0213875_10120252 | 3300021388 | Bacteria | 1227 |
| 395 | Ga0213875_10402186 | 3300021388 | Bacteria | 653 |
| 396 | Ga0224712_10179060 | 3300022467 | Unclassified | 954 |
| 397 | Ga0224712_10182999 | 3300022467 | Bacteria | 945 |
| 398 | Ga0224712_10187218 | 3300022467 | Bacteria | 935 |
| 399 | Ga0207653_10021070 | 3300025885 | Bacteria | 2067 |
| 400 | Ga0207692_10400697 | 3300025898 | Bacteria | 855 |
| 401 | Ga0207692_10416578 | 3300025898 | Bacteria | 840 |
| 402 | Ga0207642_10073738 | 3300025899 | Bacteria | 1633 |
| 403 | Ga0207642_10183566 | 3300025899 | Bacteria | 1142 |
| 404 | Ga0207642_10265415 | 3300025899 | Bacteria | 981 |
| 405 | Ga0207710_10000198 | 3300025900 | Bacteria | 56537 |
| 406 | Ga0207710_10470070 | 3300025900 | Bacteria | 651 |
| 407 | Ga0207710_10599109 | 3300025900 | Bacteria | 576 |
| 408 | Ga0207688_10005722 | 3300025901 | Bacteria | 6763 |
| 409 | Ga0207688_10007830 | 3300025901 | Bacteria | 5814 |
| 410 | Ga0207688_10029944 | 3300025901 | Bacteria | 3001 |
| 411 | Ga0207688_10551339 | 3300025901 | Bacteria | 724 |
| 412 | Ga0207680_10061579 | 3300025903 | Bacteria | 2289 |
| 413 | Ga0207680_10247046 | 3300025903 | Bacteria | 1231 |
| 414 | Ga0207680_10423829 | 3300025903 | Bacteria | 943 |
| 415 | Ga0207680_10758642 | 3300025903 | Bacteria | 695 |
| 416 | Ga0207647_10004931 | 3300025904 | Bacteria | 9838 |
| 417 | Ga0207647_10048000 | 3300025904 | Bacteria | 2653 |
| 418 | Ga0207685_10134202 | 3300025905 | Bacteria | 1102 |
| 419 | Ga0207685_10251288 | 3300025905 | Bacteria | 855 |
| 420 | Ga0207699_10067578 | 3300025906 | Bacteria | 2173 |
| 421 | Ga0207699_10176175 | 3300025906 | Bacteria | 1434 |
| 422 | Ga0207643_10161042 | 3300025908 | Bacteria | 1350 |
| 423 | Ga0207643_10234172 | 3300025908 | Bacteria | 1127 |
| 424 | Ga0207643_10316848 | 3300025908 | Bacteria | 973 |
| 425 | Ga0207654_10002912 | 3300025911 | Bacteria | 8677 |
| 426 | Ga0207654_10053277 | 3300025911 | Bacteria | 2335 |
| 427 | Ga0207707_10145773 | 3300025912 | Bacteria | 2070 |
| 428 | Ga0207695_10001784 | 3300025913 | Bacteria | 33946 |
| 429 | Ga0207695_10933768 | 3300025913 | Bacteria | 747 |
| 430 | Ga0207671_10000197 | 3300025914 | Bacteria | 93773 |
| 431 | Ga0207671_10195635 | 3300025914 | Bacteria | 1578 |
| 432 | Ga0207671_10464031 | 3300025914 | Bacteria | 1009 |
| 433 | Ga0207693_10002971 | 3300025915 | Bacteria | 14681 |
| 434 | Ga0207693_10003330 | 3300025915 | Bacteria | 13751 |
| 435 | Ga0207693_10003815 | 3300025915 | Bacteria | 12833 |
| 436 | Ga0207693_10010007 | 3300025915 | Bacteria | 7707 |
| 437 | Ga0207693_10022277 | 3300025915 | Bacteria | 5035 |
| 438 | Ga0207693_10200204 | 3300025915 | Bacteria | 1571 |
| 439 | Ga0207663_10034129 | 3300025916 | Bacteria | 3039 |
| 440 | Ga0207663_10037526 | 3300025916 | Bacteria | 2921 |
| 441 | Ga0207663_10104496 | 3300025916 | Bacteria | 1910 |
| 442 | Ga0207663_10785958 | 3300025916 | Bacteria | 757 |
| 443 | Ga0207660_10148428 | 3300025917 | Bacteria | 1799 |
| 444 | Ga0207660_10380778 | 3300025917 | Unclassified | 1134 |
| 445 | Ga0207662_10010673 | 3300025918 | Bacteria | 5079 |
| 446 | Ga0207662_10021797 | 3300025918 | Bacteria | 3666 |
| 447 | Ga0207662_10041129 | 3300025918 | Bacteria | 2720 |
| 448 | Ga0207662_10175993 | 3300025918 | Bacteria | 1375 |
| 449 | Ga0207657_10026284 | 3300025919 | Bacteria | 5352 |
| 450 | Ga0207657_10060948 | 3300025919 | Bacteria | 3237 |
| 451 | Ga0207657_10263096 | 3300025919 | Bacteria | 1372 |
| 452 | Ga0207657_10350054 | 3300025919 | Bacteria | 1165 |
| 453 | Ga0207649_10283682 | 3300025920 | Bacteria | 1205 |
| 454 | Ga0207652_10103685 | 3300025921 | Bacteria | 2515 |
| 455 | Ga0207652_10509028 | 3300025921 | Bacteria | 1083 |
| 456 | Ga0207646_10094519 | 3300025922 | Bacteria | 2677 |
| 457 | Ga0207646_10573095 | 3300025922 | Bacteria | 1014 |
| 458 | Ga0207694_10001211 | 3300025924 | Bacteria | 22390 |
| 459 | Ga0207694_10257383 | 3300025924 | Bacteria | 1429 |
| 460 | Ga0207694_10269548 | 3300025924 | Bacteria | 1396 |
| 461 | Ga0207694_10612435 | 3300025924 | Bacteria | 916 |
| 462 | Ga0207650_10167172 | 3300025925 | Bacteria | 1746 |
| 463 | Ga0207650_10947562 | 3300025925 | Bacteria | 731 |
| 464 | Ga0207659_10767205 | 3300025926 | Bacteria | 828 |
| 465 | Ga0207659_11439575 | 3300025926 | Bacteria | 590 |
| 466 | Ga0207687_10000079 | 3300025927 | Bacteria | 70683 |
| 467 | Ga0207687_10028547 | 3300025927 | Bacteria | 3748 |
| 468 | Ga0207687_10064043 | 3300025927 | Bacteria | 2605 |
| 469 | Ga0207687_10827316 | 3300025927 | Bacteria | 790 |
| 470 | Ga0207687_10934629 | 3300025927 | Bacteria | 743 |
| 471 | Ga0207700_10093377 | 3300025928 | Bacteria | 2381 |
| 472 | Ga0207700_10146896 | 3300025928 | Bacteria | 1944 |
| 473 | Ga0207700_11406593 | 3300025928 | Bacteria | 620 |
| 474 | Ga0207664_10001134 | 3300025929 | Bacteria | 17735 |
| 475 | Ga0207664_10172999 | 3300025929 | Unclassified | 1849 |
| 476 | Ga0207664_10187607 | 3300025929 | Bacteria | 1778 |
| 477 | Ga0207644_11780051 | 3300025931 | Bacteria | 516 |
| 478 | Ga0207690_10111464 | 3300025932 | Bacteria | 1971 |
| 479 | Ga0207690_10233820 | 3300025932 | Bacteria | 1412 |
| 480 | Ga0207690_10300422 | 3300025932 | Bacteria | 1256 |
| 481 | Ga0207706_10237778 | 3300025933 | Bacteria | 1592 |
| 482 | Ga0207706_10545729 | 3300025933 | Bacteria | 998 |
| 483 | Ga0207706_10550866 | 3300025933 | Bacteria | 993 |
| 484 | Ga0207706_10732224 | 3300025933 | Bacteria | 843 |
| 485 | Ga0207686_10127646 | 3300025934 | Bacteria | 1740 |
| 486 | Ga0207686_10189397 | 3300025934 | Unclassified | 1465 |
| 487 | Ga0207686_10215931 | 3300025934 | Bacteria | 1382 |
| 488 | Ga0207686_10699581 | 3300025934 | Bacteria | 805 |
| 489 | Ga0207709_10012033 | 3300025935 | Bacteria | 4772 |
| 490 | Ga0207709_10097723 | 3300025935 | Bacteria | 1935 |
| 491 | Ga0207709_10434716 | 3300025935 | Bacteria | 1011 |
| 492 | Ga0207709_10603842 | 3300025935 | Bacteria | 869 |
| 493 | Ga0207670_10306170 | 3300025936 | Bacteria | 1246 |
| 494 | Ga0207670_10321206 | 3300025936 | Bacteria | 1218 |
| 495 | Ga0207669_10080936 | 3300025937 | Bacteria | 2079 |
| 496 | Ga0207669_10325418 | 3300025937 | Bacteria | 1178 |
| 497 | Ga0207669_10763840 | 3300025937 | Bacteria | 799 |
| 498 | Ga0207704_10016079 | 3300025938 | Bacteria | 3835 |
| 499 | Ga0207704_10358788 | 3300025938 | Bacteria | 1137 |
| 500 | Ga0207665_10015801 | 3300025939 | Bacteria | 4954 |
| 501 | Ga0207665_10018884 | 3300025939 | Bacteria | 4530 |
| 502 | Ga0207665_10056454 | 3300025939 | Bacteria | 2650 |
| 503 | Ga0207691_10105655 | 3300025940 | Unclassified | 2508 |
| 504 | Ga0207691_10290253 | 3300025940 | Bacteria | 1407 |
| 505 | Ga0207711_10416876 | 3300025941 | Bacteria | 1249 |
| 506 | Ga0207711_10676800 | 3300025941 | Bacteria | 962 |
| 507 | Ga0207711_10902765 | 3300025941 | Bacteria | 821 |
| 508 | Ga0207711_11097845 | 3300025941 | Bacteria | 736 |
| 509 | Ga0207689_10023351 | 3300025942 | Bacteria | 5192 |
| 510 | Ga0207689_10057511 | 3300025942 | Bacteria | 3199 |
| 511 | Ga0207661_10000564 | 3300025944 | Bacteria | 23651 |
| 512 | Ga0207661_10009112 | 3300025944 | Bacteria | 7115 |
| 513 | Ga0207661_10181895 | 3300025944 | Bacteria | 1837 |
| 514 | Ga0207661_11410492 | 3300025944 | Bacteria | 639 |
| 515 | Ga0207679_10284669 | 3300025945 | Bacteria | 1419 |
| 516 | Ga0207667_10087198 | 3300025949 | Bacteria | 3229 |
| 517 | Ga0207667_10204827 | 3300025949 | Bacteria | 2023 |
| 518 | Ga0207667_10553328 | 3300025949 | Bacteria | 1163 |
| 519 | Ga0207651_10277711 | 3300025960 | Unclassified | 1383 |
| 520 | Ga0207712_10027026 | 3300025961 | Bacteria | 3829 |
| 521 | Ga0207712_10107784 | 3300025961 | Bacteria | 2084 |
| 522 | Ga0207712_10191122 | 3300025961 | Bacteria | 1616 |
| 523 | Ga0207712_10434010 | 3300025961 | Bacteria | 1111 |
| 524 | Ga0207712_10567584 | 3300025961 | Bacteria | 978 |
| 525 | Ga0207712_11743226 | 3300025961 | Bacteria | 558 |
| 526 | Ga0207668_10151458 | 3300025972 | Bacteria | 1796 |
| 527 | Ga0207668_10191013 | 3300025972 | Bacteria | 1623 |
| 528 | Ga0207668_10255127 | 3300025972 | Bacteria | 1426 |
| 529 | Ga0207668_12171724 | 3300025972 | Bacteria | 500 |
| 530 | Ga0207640_10027434 | 3300025981 | Bacteria | 3469 |
| 531 | Ga0207640_10042302 | 3300025981 | Bacteria | 2904 |
| 532 | Ga0207640_10194880 | 3300025981 | Bacteria | 1530 |
| 533 | Ga0207640_10483998 | 3300025981 | Bacteria | 1027 |
| 534 | Ga0207658_10230510 | 3300025986 | Bacteria | 1563 |
| 535 | Ga0207658_10472869 | 3300025986 | Bacteria | 1113 |
| 536 | Ga0207677_10326251 | 3300026023 | Bacteria | 1278 |
| 537 | Ga0207677_10366816 | 3300026023 | Bacteria | 1211 |
| 538 | Ga0207677_10487650 | 3300026023 | Bacteria | 1063 |
| 539 | Ga0207677_10547071 | 3300026023 | Bacteria | 1008 |
| 540 | Ga0207703_10000170 | 3300026035 | Bacteria | 75814 |
| 541 | Ga0207703_10178393 | 3300026035 | Bacteria | 1873 |
| 542 | Ga0207703_10197493 | 3300026035 | Bacteria | 1786 |
| 543 | Ga0207703_10372024 | 3300026035 | Bacteria | 1320 |
| 544 | Ga0207703_11413064 | 3300026035 | Bacteria | 669 |
| 545 | Ga0207639_10088912 | 3300026041 | Bacteria | 2467 |
| 546 | Ga0207639_11948937 | 3300026041 | Bacteria | 548 |
| 547 | Ga0207678_10022495 | 3300026067 | Bacteria | 5521 |
| 548 | Ga0207708_10042361 | 3300026075 | Bacteria | 3471 |
| 549 | Ga0207708_10046014 | 3300026075 | Bacteria | 3324 |
| 550 | Ga0207708_10055556 | 3300026075 | Bacteria | 3019 |
| 551 | Ga0207708_10311288 | 3300026075 | Bacteria | 1283 |
| 552 | Ga0207702_10022327 | 3300026078 | Bacteria | 5246 |
| 553 | Ga0207702_10033845 | 3300026078 | Bacteria | 4271 |
| 554 | Ga0207702_10129722 | 3300026078 | Bacteria | 2267 |
| 555 | Ga0207702_10151986 | 3300026078 | Bacteria | 2107 |
| 556 | Ga0207702_10406603 | 3300026078 | Unclassified | 1314 |
| 557 | Ga0207648_10046171 | 3300026089 | Bacteria | 3819 |
| 558 | Ga0207648_10160471 | 3300026089 | Bacteria | 1985 |
| 559 | Ga0207648_10614167 | 3300026089 | Bacteria | 1003 |
| 560 | Ga0207648_10960925 | 3300026089 | Bacteria | 799 |
| 561 | Ga0207648_11325630 | 3300026089 | Bacteria | 676 |
| 562 | Ga0207676_10118766 | 3300026095 | Bacteria | 2226 |
| 563 | Ga0207676_10385006 | 3300026095 | Bacteria | 1306 |
| 564 | Ga0207676_10886352 | 3300026095 | Bacteria | 874 |
| 565 | Ga0207674_10005739 | 3300026116 | Bacteria | 14722 |
| 566 | Ga0207674_10052087 | 3300026116 | Bacteria | 4175 |
| 567 | Ga0207674_10379638 | 3300026116 | Bacteria | 1366 |
| 568 | Ga0207674_10590502 | 3300026116 | Bacteria | 1073 |
| 569 | Ga0207674_11357181 | 3300026116 | Bacteria | 680 |
| 570 | Ga0207675_100001665 | 3300026118 | Bacteria | 22230 |
| 571 | Ga0207675_100020645 | 3300026118 | Bacteria | 6140 |
| 572 | Ga0207675_100048217 | 3300026118 | Bacteria | 3977 |
| 573 | Ga0207675_100100450 | 3300026118 | Bacteria | 2725 |
| 574 | Ga0207683_10023905 | 3300026121 | Bacteria | 5258 |
| 575 | Ga0207683_10062369 | 3300026121 | Bacteria | 3283 |
| 576 | Ga0207698_10464099 | 3300026142 | Bacteria | 1225 |
| 577 | Ga0207698_10634378 | 3300026142 | Bacteria | 1057 |
| 578 | Ga0207698_10916071 | 3300026142 | Bacteria | 884 |
| 579 | Ga0207428_10064344 | 3300027907 | Bacteria | 2895 |
| 580 | Ga0207428_10489767 | 3300027907 | Bacteria | 894 |
| 581 | Ga0207428_10560449 | 3300027907 | Bacteria | 826 |
| 582 | Ga0207428_10580101 | 3300027907 | Bacteria | 809 |
| 583 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 584 | Ga0268266_10421124 | 3300028379 | Bacteria | 1265 |
| 585 | Ga0268266_10893774 | 3300028379 | Bacteria | 859 |
| 586 | Ga0268266_11420310 | 3300028379 | Bacteria | 670 |
| 587 | Ga0268265_10314556 | 3300028380 | Bacteria | 1415 |
| 588 | Ga0268265_12522392 | 3300028380 | Bacteria | 520 |
| 589 | Ga0268264_10255556 | 3300028381 | Bacteria | 1630 |
| 590 | Ga0268264_10371931 | 3300028381 | Bacteria | 1366 |
| 591 | Ga0268264_10468765 | 3300028381 | Bacteria | 1223 |
| 592 | Ga0307408_100203358 | 3300031548 | Bacteria | 1605 |
| 593 | Ga0307408_100897731 | 3300031548 | Bacteria | 811 |
| 594 | Ga0307408_101005343 | 3300031548 | Bacteria | 769 |
| 595 | Ga0307408_101316756 | 3300031548 | Bacteria | 677 |
| 596 | Ga0307408_102376551 | 3300031548 | Bacteria | 514 |
| 597 | Ga0316575_10039497 | 3300031665 | Bacteria | 1863 |
| 598 | Ga0316579_10034002 | 3300031691 | Bacteria | 2343 |
| 599 | Ga0316578_10045634 | 3300031728 | Bacteria | 2551 |
| 600 | Ga0307405_10105944 | 3300031731 | Bacteria | 1895 |
| 601 | Ga0307405_11858490 | 3300031731 | Bacteria | 536 |
| 602 | Ga0316577_10011008 | 3300031733 | Bacteria | 4893 |
| 603 | Ga0307413_11022810 | 3300031824 | Bacteria | 709 |
| 604 | Ga0307410_10129466 | 3300031852 | Bacteria | 1852 |
| 605 | Ga0307410_10218813 | 3300031852 | Bacteria | 1464 |
| 606 | Ga0307410_10299039 | 3300031852 | Bacteria | 1269 |
| 607 | Ga0307406_10071107 | 3300031901 | Bacteria | 2280 |
| 608 | Ga0307406_10096765 | 3300031901 | Bacteria | 2001 |
| 609 | Ga0307406_10179602 | 3300031901 | Bacteria | 1540 |
| 610 | Ga0307406_10326082 | 3300031901 | Bacteria | 1190 |
| 611 | Ga0307406_10574233 | 3300031901 | Bacteria | 926 |
| 612 | Ga0307407_10087221 | 3300031903 | Bacteria | 1903 |
| 613 | Ga0307407_10258911 | 3300031903 | Bacteria | 1196 |
| 614 | Ga0307407_10449929 | 3300031903 | Bacteria | 934 |
| 615 | Ga0307407_10953362 | 3300031903 | Bacteria | 661 |
| 616 | Ga0307412_10349085 | 3300031911 | Bacteria | 1187 |
| 617 | Ga0307412_11244143 | 3300031911 | Bacteria | 668 |
| 618 | Ga0307409_100061030 | 3300031995 | Bacteria | 2944 |
| 619 | Ga0307409_100805285 | 3300031995 | Bacteria | 947 |
| 620 | Ga0307409_101284014 | 3300031995 | Bacteria | 757 |
| 621 | Ga0307416_100005048 | 3300032002 | Bacteria | 8043 |
| 622 | Ga0307416_100351876 | 3300032002 | Bacteria | 1491 |
| 623 | Ga0307416_101184855 | 3300032002 | Bacteria | 869 |
| 624 | Ga0307411_10133181 | 3300032005 | Bacteria | 1820 |
| 625 | Ga0307411_10697593 | 3300032005 | Bacteria | 884 |
| 626 | Ga0307415_100003774 | 3300032126 | Bacteria | 7765 |
| 627 | Ga0307415_100254358 | 3300032126 | Bacteria | 1429 |
| 628 | Ga0307415_100271791 | 3300032126 | Bacteria | 1389 |
| 629 | Ga0307415_100541053 | 3300032126 | Bacteria | 1026 |
| 630 | Ga0307415_100675805 | 3300032126 | Bacteria | 929 |
| 631 | Ga0307415_100981448 | 3300032126 | Bacteria | 784 |
| 632 | Ga0316583_10096512 | 3300032133 | Bacteria | 1031 |
| 633 | Ga0316585_10033830 | 3300032137 | Bacteria | 1613 |
| 634 | Ga0316580_10003048 | 3300032139 | Bacteria | 4716 |
| 635 | Ga0307507_10000002 | 3300033179 | Bacteria | 388650 |
| 636 | Ga0373930_0028490 | 3300034816 | Bacteria | 1137 |
| 637 | Ga0373958_0063457 | 3300034819 | Bacteria | 805 |
| 638 | Ga0373938_0017421 | 3300034957 | Bacteria | 1415 |
| 639 | Ga0373928_0009209 | 3300035084 | Bacteria | 1926 |
| 640 | Ga0373928_0020131 | 3300035084 | Bacteria | 1397 |
| 641 | Ga0373940_0009586 | 3300035088 | Unclassified | 2254 |
| 642 | Ga0373949_0005837 | 3300035090 | Bacteria | 2737 |
| 643 | Ga0373949_0017956 | 3300035090 | Bacteria | 1599 |
| 644 | Ga0373951_0001215 | 3300035091 | Bacteria | 6806 |
| 645 | Ga0373951_0094636 | 3300035091 | Bacteria | 787 |
| 646 | Ga0373952_0011729 | 3300035092 | Bacteria | 1714 |
| 647 | Ga0373952_0044120 | 3300035092 | Bacteria | 1041 |
| 648 | Ga0373932_0037699 | 3300035112 | Bacteria | 1379 |
| 649 | Ga0373932_0185023 | 3300035112 | Bacteria | 733 |
| 650 | Ga0373939_0172897 | 3300035114 | Bacteria | 801 |
| 651 | Ga0373941_0012534 | 3300035115 | Bacteria | 2220 |
| 652 | Ga0373941_0020385 | 3300035115 | Bacteria | 1858 |
| 653 | Ga0373960_0022869 | 3300035121 | Bacteria | 1679 |
| 654 | Ga0373960_0159378 | 3300035121 | Bacteria | 776 |
| 655 | Ga0373961_0022802 | 3300035241 | Unclassified | 1678 |
| 656 | Ga0373961_0030109 | 3300035241 | Bacteria | 1508 |
| 657 | Ga0373961_0059451 | 3300035241 | Bacteria | 1156 |
| 658 | Ga0373962_0005923 | 3300035242 | Bacteria | 2953 |
| 659 | Ga0373962_0008566 | 3300035242 | Bacteria | 2518 |
| 660 | Ga0316574_0031022 | 3300035398 | Bacteria | 3240 |
| 661 | Ga0373931_0007664 | 3300035691 | Bacteria | 5092 |
| 662 | Ga0373931_0018020 | 3300035691 | Bacteria | 3503 |
| 663 | Ga0316582_0001763 | 3300036647 | Bacteria | 9750 |
| 664 | Ga0316584_0003336 | 3300036712 | Bacteria | 10405 |
| 665 | Ga0395899_0005234 | 3300037312 | Bacteria | 10084 |
| 666 | Ga0395899_0044539 | 3300037312 | Bacteria | 3306 |
| 667 | Ga0395899_0123030 | 3300037312 | Bacteria | 1857 |
| 668 | Ga0395899_0259225 | 3300037312 | Bacteria | 1190 |
| 669 | Ga0395900_0028444 | 3300037418 | Bacteria | 5725 |
| 670 | Ga0395900_0108875 | 3300037418 | Bacteria | 2846 |
| 671 | Ga0395900_0143644 | 3300037418 | Bacteria | 2442 |
| 672 | Ga0395900_0455341 | 3300037418 | Bacteria | 1235 |
| 673 | Ga0395900_0629335 | 3300037418 | Bacteria | 1011 |
| 674 | Ga0395900_0656347 | 3300037418 | Bacteria | 985 |
| 675 | Ga0395900_1134867 | 3300037418 | Bacteria | 698 |
| 676 | Ga0395898_0002122 | 3300037466 | Bacteria | 24478 |
| 677 | Ga0395898_0006483 | 3300037466 | Bacteria | 12498 |
| 678 | Ga0395898_0051456 | 3300037466 | Bacteria | 4028 |
| 679 | Ga0395898_0056060 | 3300037466 | Bacteria | 3843 |
| 680 | Ga0395898_0117207 | 3300037466 | Bacteria | 2551 |
| 681 | Ga0395898_0206145 | 3300037466 | Bacteria | 1876 |
| 682 | Ga0395898_0396966 | 3300037466 | Bacteria | 1315 |
| 683 | Ga0395905_0014338 | 3300037471 | Bacteria | 7573 |
| 684 | Ga0395905_0018000 | 3300037471 | Bacteria | 6708 |
| 685 | Ga0395905_0021206 | 3300037471 | Bacteria | 6149 |
| 686 | Ga0395905_0039441 | 3300037471 | Bacteria | 4431 |
| 687 | Ga0395905_1025689 | 3300037471 | Bacteria | 728 |
| 688 | Ga0316581_0091007 | 3300037588 | Bacteria | 939 |
| 689 | Ga0436364_0294314 | 3300037853 | Bacteria | 5626 |
| 690 | Ga0436364_0474541 | 3300037853 | Bacteria | 1060 |
| 691 | Ga0436364_0648428 | 3300037853 | Bacteria | 15392 |
| 692 | Ga0436364_0914577 | 3300037853 | Bacteria | 2100 |
| 693 | Ga0436364_1093687 | 3300037853 | Bacteria | 2294 |
| 694 | Ga0395901_0003904 | 3300038443 | Bacteria | 14998 |
| 695 | Ga0395901_0011202 | 3300038443 | Bacteria | 9088 |
| 696 | Ga0395901_0018541 | 3300038443 | Bacteria | 7105 |
| 697 | Ga0395901_0175644 | 3300038443 | Bacteria | 2247 |
| 698 | Ga0395901_0223750 | 3300038443 | Bacteria | 1966 |
| 699 | Ga0395901_0282958 | 3300038443 | Bacteria | 1722 |
| 700 | Ga0395901_0364051 | 3300038443 | Bacteria | 1490 |
| 701 | Ga0395901_1462651 | 3300038443 | Bacteria | 640 |
| 702 | Ga0436365_1685267 | 3300039437 | Unclassified | 3210 |
| 703 | Ga0436365_1737094 | 3300039437 | Bacteria | 9743 |
| 704 | Ga0436365_1837010 | 3300039437 | Bacteria | 19470 |
| 705 | Ga0436365_1935346 | 3300039437 | Bacteria | 1412 |
| 706 | Ga0436360_0816047 | 3300039438 | Bacteria | 576 |
| 707 | Ga0436363_0425661 | 3300039450 | Bacteria | 9513 |
| 708 | Ga0436363_0508323 | 3300039450 | Bacteria | 1427 |
| 709 | Ga0436363_0548952 | 3300039450 | Bacteria | 5887 |
| 710 | Ga0436363_0582583 | 3300039450 | Bacteria | 947 |
| 711 | Ga0436363_1224953 | 3300039450 | Bacteria | 1552 |
| 712 | Ga0436363_1227349 | 3300039450 | Bacteria | 10928 |
| 713 | Ga0436363_1526926 | 3300039450 | Bacteria | 2008 |
| 714 | Ga0436362_0105352 | 3300039453 | Bacteria | 2859 |
| 715 | Ga0436362_0417099 | 3300039453 | Bacteria | 1138 |
| 716 | Ga0436362_0453746 | 3300039453 | Bacteria | 573 |
| 717 | Ga0436362_0677777 | 3300039453 | Bacteria | 1137 |
| 718 | Ga0451847_0966993 | 3300041503 | Bacteria | 595 |
| 719 | Ga0451853_3052387 | 3300041512 | Bacteria | 835 |
| 720 | Ga0466969_0004337 | 3300044656 | Bacteria | 7548 |
| 721 | Ga0466966_0151446 | 3300044684 | Bacteria | 1414 |
| 722 | Ga0466966_0190198 | 3300044684 | Bacteria | 1244 |
| 723 | Ga0466966_0305458 | 3300044684 | Bacteria | 956 |
| 724 | Ga0466961_0015171 | 3300044693 | Bacteria | 4948 |
| 725 | Ga0466963_0085114 | 3300044694 | Bacteria | 2146 |
| 726 | Ga0466963_0382562 | 3300044694 | Bacteria | 992 |
| 727 | Ga0466964_0563794 | 3300044706 | Bacteria | 620 |
| 728 | Ga0466971_0008645 | 3300044719 | Bacteria | 4443 |
| 729 | Ga0466971_0129877 | 3300044719 | Bacteria | 1169 |
| 730 | Ga0466968_0186668 | 3300044735 | Bacteria | 966 |
| 731 | Ga0466970_0050036 | 3300044765 | Bacteria | 2228 |
| 732 | Ga0466970_0070176 | 3300044765 | Bacteria | 1884 |
| 733 | Ga0466970_0431974 | 3300044765 | Bacteria | 754 |
| 734 | Ga0466957_0173590 | 3300044842 | Bacteria | 1405 |
| 735 | Ga0466957_0576643 | 3300044842 | Bacteria | 786 |
| 736 | Ga0466960_0583923 | 3300044901 | Bacteria | 662 |
| 737 | Ga0466959_0004011 | 3300045049 | Bacteria | 9781 |
| 738 | Ga0466959_0813471 | 3300045049 | Bacteria | 624 |
| 739 | Ga0466958_0060469 | 3300045836 | Bacteria | 2306 |
| 740 | Ga0466958_0342416 | 3300045836 | Bacteria | 962 |
| 741 | Ga0466967_0039980 | 3300045976 | Bacteria | 4035 |
| 742 | Ga0466967_0064780 | 3300045976 | Bacteria | 3251 |
| 743 | Ga0466967_0733819 | 3300045976 | Bacteria | 979 |
| 744 | Ga0466967_0987569 | 3300045976 | Bacteria | 838 |
| 745 | Ga0466967_2361735 | 3300045976 | Bacteria | 527 |
| 746 | Ga0495592_0045230 | 3300046454 | Bacteria | 3286 |
| 747 | Ga0495592_0391808 | 3300046454 | Bacteria | 882 |
| 748 | Ga0495629_0150571 | 3300046459 | Bacteria | 1617 |
| 749 | Ga0495641_0043173 | 3300046461 | Bacteria | 2086 |
| 750 | Ga0495651_0069980 | 3300046462 | Bacteria | 2670 |
| 751 | Ga0495651_0357113 | 3300046462 | Bacteria | 964 |
| 752 | Ga0495653_0460022 | 3300046463 | Bacteria | 799 |
| 753 | Ga0495608_0377856 | 3300046511 | Bacteria | 869 |
| 754 | Ga0495608_0866219 | 3300046511 | Bacteria | 530 |
| 755 | Ga0495628_0004295 | 3300046516 | Bacteria | 12674 |
| 756 | Ga0495628_0061217 | 3300046516 | Bacteria | 2952 |
| 757 | Ga0495628_0081217 | 3300046516 | Bacteria | 2518 |
| 758 | Ga0495628_0134693 | 3300046516 | Bacteria | 1889 |
| 759 | Ga0495630_0034398 | 3300046517 | Bacteria | 3784 |
| 760 | Ga0495630_0154488 | 3300046517 | Bacteria | 1747 |
| 761 | Ga0495630_0384798 | 3300046517 | Bacteria | 1075 |
| 762 | Ga0495663_0031588 | 3300046525 | Bacteria | 1574 |
| 763 | Ga0495663_0201365 | 3300046525 | Bacteria | 695 |
| 764 | Ga0495642_0068526 | 3300046528 | Bacteria | 1481 |
| 765 | Ga0495652_0014337 | 3300046529 | Bacteria | 7115 |
| 766 | Ga0495652_0805147 | 3300046529 | Bacteria | 625 |
| 767 | Ga0495665_0149217 | 3300046531 | Bacteria | 1221 |
| 768 | Ga0495665_0222202 | 3300046531 | Bacteria | 976 |
| 769 | Ga0495586_0005249 | 3300046535 | Bacteria | 6932 |
| 770 | Ga0495645_0089874 | 3300046543 | Bacteria | 2196 |
| 771 | Ga0495656_0354407 | 3300046615 | Unclassified | 761 |
| 772 | Ga0495668_0635748 | 3300046616 | Bacteria | 590 |
| 773 | Ga0495634_0034600 | 3300046642 | Bacteria | 3466 |
| 774 | Ga0495634_0040347 | 3300046642 | Bacteria | 3176 |
| 775 | Ga0495634_0096587 | 3300046642 | Bacteria | 1913 |
| 776 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 777 | Ga0495588_0711142 | 3300046674 | Bacteria | 525 |
| 778 | Ga0495657_0230042 | 3300046675 | Bacteria | 1122 |
| 779 | Ga0495647_0045025 | 3300046681 | Bacteria | 1694 |
| 780 | Ga0495658_0291760 | 3300046683 | Bacteria | 1031 |
| 781 | Ga0495658_0416370 | 3300046683 | Bacteria | 857 |
| 782 | Ga0495613_0037674 | 3300046689 | Bacteria | 3585 |
| 783 | Ga0495624_0002016 | 3300046690 | Bacteria | 15463 |
| 784 | Ga0495624_0102063 | 3300046690 | Bacteria | 1766 |
| 785 | Ga0495600_0012189 | 3300046809 | Bacteria | 5369 |
| 786 | Ga0495581_0139150 | 3300047315 | Bacteria | 1416 |
| 787 | Ga0495581_0208110 | 3300047315 | Bacteria | 1144 |
| 788 | Ga0495604_0336120 | 3300047317 | Bacteria | 1006 |
| 789 | Ga0495674_0033720 | 3300047319 | Bacteria | 4634 |
| 790 | Ga0495674_0208861 | 3300047319 | Bacteria | 1618 |
| 791 | Ga0495674_0252195 | 3300047319 | Bacteria | 1452 |
| 792 | Ga0495674_0725982 | 3300047319 | Bacteria | 778 |
| 793 | Ga0495676_0000136 | 3300047321 | Bacteria | 55706 |
| 794 | Ga0495676_0327823 | 3300047321 | Bacteria | 1027 |
| 795 | Ga0495676_0646898 | 3300047321 | Bacteria | 686 |
| 796 | Ga0495676_0821062 | 3300047321 | Bacteria | 598 |
| 797 | Ga0495680_0647797 | 3300047322 | Bacteria | 702 |
| 798 | Ga0495679_016258 | 3300047446 | Bacteria | 2695 |
| 799 | Ga0495593_0499949 | 3300047673 | Bacteria | 610 |
| 800 | Ga0496100_0042568 | 3300048903 | Bacteria | 2901 |
| 801 | Ga0496100_0080228 | 3300048903 | Bacteria | 2201 |
| 802 | Ga0496100_0403775 | 3300048903 | Bacteria | 1041 |
| 803 | Ga0496100_0432692 | 3300048903 | Unclassified | 1006 |
| 804 | Ga0496100_0476741 | 3300048903 | Bacteria | 959 |
| 805 | Ga0496100_0971654 | 3300048903 | Bacteria | 668 |
| 806 | Ga0496101_0005933 | 3300048904 | Bacteria | 7823 |
| 807 | Ga0496101_0056678 | 3300048904 | Bacteria | 2833 |
| 808 | Ga0496101_0141285 | 3300048904 | Unclassified | 1835 |
| 809 | Ga0496102_0205350 | 3300048905 | Bacteria | 1857 |
| 810 | Ga0496102_0304057 | 3300048905 | Bacteria | 1503 |
| 811 | Ga0496102_0329515 | 3300048905 | Bacteria | 1438 |
| 812 | Ga0496102_0579830 | 3300048905 | Bacteria | 1044 |
| 813 | Ga0496102_1811239 | 3300048905 | Bacteria | 528 |
| 814 | Ga0496103_0201261 | 3300048906 | Bacteria | 1281 |
| 815 | Ga0496103_0406440 | 3300048906 | Bacteria | 874 |
| 816 | Ga0496104_0088482 | 3300048907 | Bacteria | 2958 |
| 817 | Ga0496104_0189414 | 3300048907 | Bacteria | 1968 |
| 818 | Ga0496104_0760045 | 3300048907 | Bacteria | 876 |
| 819 | Ga0496105_0017290 | 3300048908 | Bacteria | 5778 |
| 820 | Ga0496105_0120596 | 3300048908 | Bacteria | 2163 |
| 821 | Ga0496106_0000213 | 3300048909 | Bacteria | 40340 |
| 822 | Ga0496106_0055456 | 3300048909 | Bacteria | 2995 |
| 823 | Ga0496106_0074836 | 3300048909 | Bacteria | 2593 |
| 824 | Ga0496106_0120148 | 3300048909 | Bacteria | 2053 |
| 825 | Ga0496106_0170226 | 3300048909 | Bacteria | 1726 |
| 826 | Ga0496106_0384634 | 3300048909 | Bacteria | 1127 |
| 827 | Ga0496106_0759287 | 3300048909 | Unclassified | 771 |
| 828 | Ga0496106_1504486 | 3300048909 | Bacteria | 518 |
| 829 | Ga0496107_0001404 | 3300048910 | Bacteria | 14850 |
| 830 | Ga0496107_0036340 | 3300048910 | Bacteria | 3533 |
| 831 | Ga0496107_0336749 | 3300048910 | Bacteria | 1123 |
| 832 | Ga0496108_0150278 | 3300048911 | Unclassified | 2009 |
| 833 | Ga0496108_0402559 | 3300048911 | Bacteria | 1195 |
| 834 | Ga0496109_0049019 | 3300048912 | Bacteria | 3843 |
| 835 | Ga0496109_0296704 | 3300048912 | Bacteria | 1524 |
| 836 | Ga0496110_0014477 | 3300048913 | Bacteria | 6552 |
| 837 | Ga0496110_0092653 | 3300048913 | Bacteria | 2704 |
| 838 | Ga0496110_0423954 | 3300048913 | Bacteria | 1213 |
| 839 | Ga0496110_0631529 | 3300048913 | Bacteria | 970 |
| 840 | Ga0496110_1162168 | 3300048913 | Bacteria | 680 |
| 841 | Ga0496111_0045429 | 3300048914 | Bacteria | 3160 |
| 842 | Ga0496111_0406305 | 3300048914 | Bacteria | 1006 |
| 843 | Ga0496111_0701046 | 3300048914 | Bacteria | 736 |
| 844 | Ga0496112_0002387 | 3300048915 | Bacteria | 15114 |
| 845 | Ga0496112_0049744 | 3300048915 | Bacteria | 4108 |
| 846 | Ga0496112_0947823 | 3300048915 | Bacteria | 782 |
| 847 | Ga0496113_0009663 | 3300048916 | Bacteria | 6335 |
| 848 | Ga0496113_0245309 | 3300048916 | Unclassified | 1429 |
| 849 | Ga0496113_0450781 | 3300048916 | Bacteria | 1034 |
| 850 | Ga0496114_0012601 | 3300048917 | Bacteria | 6774 |
| 851 | Ga0496114_0042230 | 3300048917 | Bacteria | 3779 |
| 852 | Ga0496114_0079435 | 3300048917 | Bacteria | 2769 |
| 853 | Ga0496114_0121422 | 3300048917 | Bacteria | 2247 |
| 854 | Ga0496114_0144350 | 3300048917 | Bacteria | 2063 |
| 855 | Ga0496114_0318219 | 3300048917 | Unclassified | 1375 |
| 856 | Ga0496114_0341453 | 3300048917 | Bacteria | 1324 |
| 857 | Ga0496114_0458920 | 3300048917 | Bacteria | 1128 |
| 858 | Ga0496115_0022365 | 3300048918 | Bacteria | 4898 |
| 859 | Ga0496115_0175981 | 3300048918 | Bacteria | 1769 |
| 860 | Ga0496115_0214482 | 3300048918 | Bacteria | 1590 |
| 861 | Ga0496115_0302392 | 3300048918 | Bacteria | 1311 |
| 862 | Ga0501031_0123449 | 3300049568 | Bacteria | 1692 |
| 863 | Ga0501031_0137907 | 3300049568 | Bacteria | 1594 |
| 864 | Ga0501031_0151920 | 3300049568 | Bacteria | 1513 |
| 865 | Ga0501031_0860493 | 3300049568 | Bacteria | 581 |
| 866 | Ga0501032_0110255 | 3300049569 | Bacteria | 1822 |
| 867 | Ga0501033_0566997 | 3300049570 | Bacteria | 781 |
| 868 | Ga0501036_0096010 | 3300049572 | Bacteria | 2506 |
| 869 | Ga0501036_0721948 | 3300049572 | Bacteria | 823 |
| 870 | Ga0501036_0945355 | 3300049572 | Bacteria | 706 |
| 871 | Ga0501036_1220961 | 3300049572 | Bacteria | 612 |
| 872 | Ga0501038_0266755 | 3300049574 | Bacteria | 1351 |
| 873 | Ga0501038_0275395 | 3300049574 | Bacteria | 1326 |
| 874 | Ga0501039_0066495 | 3300049575 | Bacteria | 2798 |
| 875 | Ga0501039_0113816 | 3300049575 | Bacteria | 2116 |
| 876 | Ga0501039_0117549 | 3300049575 | Bacteria | 2082 |
| 877 | Ga0501039_0168537 | 3300049575 | Bacteria | 1722 |
| 878 | Ga0501039_0397987 | 3300049575 | Bacteria | 1082 |
| 879 | Ga0501040_0193015 | 3300049576 | Bacteria | 1445 |
| 880 | Ga0501040_0216483 | 3300049576 | Bacteria | 1362 |
| 881 | Ga0501040_0914186 | 3300049576 | Bacteria | 636 |
| 882 | Ga0501041_0074856 | 3300049577 | Bacteria | 2081 |
| 883 | Ga0501041_0097444 | 3300049577 | Bacteria | 1818 |
| 884 | Ga0501041_0264073 | 3300049577 | Bacteria | 1083 |
| 885 | Ga0501042_0005727 | 3300049578 | Bacteria | 8025 |
| 886 | Ga0501042_0301221 | 3300049578 | Bacteria | 1158 |
| 887 | Ga0501043_0189747 | 3300049579 | Bacteria | 1599 |
| 888 | Ga0501048_0026899 | 3300049582 | Bacteria | 4186 |
| 889 | Ga0501048_0135923 | 3300049582 | Bacteria | 1737 |
| 890 | Ga0501048_0168593 | 3300049582 | Bacteria | 1550 |
| 891 | Ga0501067_0093129 | 3300049583 | Bacteria | 1673 |
| 892 | Ga0501068_0262277 | 3300049584 | Bacteria | 1102 |
| 893 | Ga0501068_0611954 | 3300049584 | Bacteria | 710 |
| 894 | Ga0501068_0964927 | 3300049584 | Bacteria | 562 |
| 895 | Ga0501069_0069661 | 3300049585 | Bacteria | 1970 |
| 896 | Ga0501069_0133542 | 3300049585 | Bacteria | 1422 |
| 897 | Ga0501070_0549504 | 3300049586 | Bacteria | 925 |
| 898 | Ga0501071_0021891 | 3300049587 | Bacteria | 4456 |
| 899 | Ga0501071_0053460 | 3300049587 | Bacteria | 2913 |
| 900 | Ga0501071_0070893 | 3300049587 | Bacteria | 2540 |
| 901 | Ga0501071_0230683 | 3300049587 | Bacteria | 1394 |
| 902 | Ga0501071_0809641 | 3300049587 | Bacteria | 722 |
| 903 | Ga0501071_0836806 | 3300049587 | Bacteria | 710 |
| 904 | Ga0501072_0097560 | 3300049588 | Bacteria | 2336 |
| 905 | Ga0501072_1045610 | 3300049588 | Bacteria | 636 |
| 906 | Ga0501073_0260436 | 3300049589 | Bacteria | 1197 |
| 907 | Ga0501074_0244437 | 3300049590 | Bacteria | 1276 |
| 908 | Ga0501075_0016548 | 3300049591 | Bacteria | 5315 |
| 909 | Ga0501075_0155262 | 3300049591 | Bacteria | 1745 |
| 910 | Ga0501075_0161603 | 3300049591 | Bacteria | 1709 |
| 911 | Ga0501075_0242516 | 3300049591 | Bacteria | 1374 |
| 912 | Ga0501076_0224520 | 3300049592 | Bacteria | 1535 |
| 913 | Ga0501076_0354302 | 3300049592 | Bacteria | 1205 |
| 914 | Ga0501076_0723694 | 3300049592 | Bacteria | 821 |
| 915 | Ga0501076_1747897 | 3300049592 | Bacteria | 510 |
| 916 | Ga0501077_0126880 | 3300049593 | Bacteria | 1617 |
| 917 | Ga0501077_0412975 | 3300049593 | Bacteria | 863 |
| 918 | Ga0501079_0166751 | 3300049741 | Bacteria | 1718 |
| 919 | Ga0501079_0319978 | 3300049741 | Bacteria | 1214 |
| 920 | Ga0501079_1390002 | 3300049741 | Bacteria | 552 |
| 921 | Ga0501080_0155468 | 3300049742 | Bacteria | 2113 |
| 922 | Ga0501081_0017956 | 3300049743 | Bacteria | 4693 |
| 923 | Ga0501081_0201203 | 3300049743 | Bacteria | 1444 |
| 924 | Ga0501081_0502458 | 3300049743 | Bacteria | 903 |
| 925 | Ga0501081_0554384 | 3300049743 | Bacteria | 859 |
| 926 | Ga0501081_1366133 | 3300049743 | Bacteria | 537 |
| 927 | Ga0501083_1144332 | 3300049744 | Bacteria | 506 |
| 928 | Ga0501035_0307264 | 3300049822 | Bacteria | 1335 |
| 929 | Ga0501035_0328002 | 3300049822 | Bacteria | 1285 |
| 930 | Ga0501035_0859177 | 3300049822 | Bacteria | 721 |
| 931 | Ga0501045_0035562 | 3300049824 | Bacteria | 3617 |
| 932 | Ga0501045_0191916 | 3300049824 | Bacteria | 1522 |
| 933 | nmdc:mga03n38_948547_c1 | 3300050490 | Bacteria | 508 |
| 934 | nmdc:mga00v17_42532_c1 | 3300050491 | Bacteria | 2733 |
| 935 | nmdc:mga0yw44_15003_c1 | 3300050492 | Bacteria | 4135 |
| 936 | nmdc:mga0yw44_71939_c1 | 3300050492 | Bacteria | 2148 |
| 937 | nmdc:mga05p37_1051843_c1 | 3300050507 | Bacteria | 858 |
| 938 | nmdc:mga05p37_167370_c1 | 3300050507 | Bacteria | 2682 |
| 939 | nmdc:mga05p37_221507_c1 | 3300050507 | Bacteria | 2283 |
| 940 | nmdc:mga05p37_478075_c1 | 3300050507 | Bacteria | 1436 |
| 941 | nmdc:mga05p37_589934_c1 | 3300050507 | Bacteria | 1256 |
| 942 | nmdc:mga05p37_624888_c1 | 3300050507 | Bacteria | 1211 |
| 943 | nmdc:mga05p37_720290_c1 | 3300050507 | Bacteria | 1105 |
| 944 | nmdc:mga09592_12330_c1 | 3300050508 | Bacteria | 6962 |
| 945 | nmdc:mga0qj67_1126029_c1 | 3300050509 | Bacteria | 612 |
| 946 | nmdc:mga0qj67_144767_c1 | 3300050509 | Bacteria | 1927 |
| 947 | nmdc:mga0qj67_217_c1 | 3300050509 | Bacteria | 39240 |
| 948 | nmdc:mga0qj67_921500_c1 | 3300050509 | Bacteria | 688 |
| 949 | nmdc:mga06r32_1054043_c1 | 3300050510 | Bacteria | 764 |
| 950 | nmdc:mga06r32_179012_c1 | 3300050510 | Bacteria | 2105 |
| 951 | nmdc:mga06r32_663_c1 | 3300050510 | Bacteria | 29946 |
| 952 | nmdc:mga06r32_86831_c1 | 3300050510 | Bacteria | 3052 |
| 953 | nmdc:mga08y16_23659_c1 | 3300050511 | Bacteria | 6486 |
| 954 | nmdc:mga08y16_700307_c1 | 3300050511 | Bacteria | 1013 |
| 955 | nmdc:mga0n895_389188_c1 | 3300050512 | Bacteria | 1410 |
| 956 | nmdc:mga0n895_493823_c1 | 3300050512 | Bacteria | 1234 |
| 957 | nmdc:mga0n895_72056_c1 | 3300050512 | Bacteria | 3427 |
| 958 | nmdc:mga0n895_74803_c1 | 3300050512 | Bacteria | 3366 |
| 959 | nmdc:mga0n895_850388_c1 | 3300050512 | Bacteria | 900 |
| 960 | nmdc:mga0n895_85184_c1 | 3300050512 | Bacteria | 3155 |
| 961 | nmdc:mga0rr50_28153_c1 | 3300050513 | Bacteria | 3947 |
| 962 | nmdc:mga0rr50_311382_c1 | 3300050513 | Bacteria | 1319 |
| 963 | nmdc:mga08x19_37117_c1 | 3300050514 | Bacteria | 3091 |
| 964 | nmdc:mga08x19_52241_c2 | 3300050514 | Unclassified | 1386 |
| 965 | nmdc:mga0a205_133071_c1 | 3300050515 | Bacteria | 2387 |
| 966 | nmdc:mga0a205_142625_c1 | 3300050515 | Bacteria | 2296 |
| 967 | nmdc:mga0a205_5874_c1 | 3300050515 | Bacteria | 11053 |
| 968 | nmdc:mga0a205_667237_c1 | 3300050515 | Bacteria | 890 |
| 969 | Ga0495601_0000104 | 3300053077 | Bacteria | 46045 |
| 970 | Ga0495601_0218446 | 3300053077 | Bacteria | 1245 |
| 971 | Ga0495612_0317482 | 3300053078 | Bacteria | 700 |
| 972 | Ga0495595_0260679 | 3300053084 | Bacteria | 869 |
| 973 | Ga0495619_0724011 | 3300053085 | Bacteria | 676 |
| 974 | Ga0501084_0054244 | 3300054114 | Bacteria | 3353 |
| 975 | Ga0501084_0058728 | 3300054114 | Bacteria | 3219 |
| 976 | Ga0501084_0425627 | 3300054114 | Bacteria | 1122 |
| 977 | Ga0590077_172427 | 3300059426 | Bacteria | 521 |
| 978 | Ga0501082_0041155 | 3300060353 | Bacteria | 3984 |
| 979 | Ga0501082_0090239 | 3300060353 | Bacteria | 2646 |
| 980 | Ga0501082_0257460 | 3300060353 | Bacteria | 1518 |
| 981 | Ga0501082_0454712 | 3300060353 | Bacteria | 1119 |
| 982 | Ga0466962_0089357 | 3300061719 | Bacteria | 1475 |
| 983 | Ga0530510_0008481 | 3300061734 | Bacteria | 7166 |
| 984 | Ga0530510_0123967 | 3300061734 | Bacteria | 1898 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10614167 | Ga0207648_106141672 | 135 |
| 2 | iso_pu_bacteria | 2870782633 | 2870783516 | 135 |
| 3 | iso_pu_bacteria | 2818991472 | 2819746502 | 136 |
| 4 | 3300005441 | Ga0070700_100034090 | Ga0070700_1000340903 | 137 |
| 5 | 3300005983 | Ga0081540_1003252 | Ga0081540_10032523 | 137 |
| 6 | 3300006237 | Ga0097621_100883173 | Ga0097621_1008831732 | 137 |
| 7 | 3300009174 | Ga0105241_11230937 | Ga0105241_112309371 | 137 |
| 8 | 3300025908 | Ga0207643_10234172 | Ga0207643_102341723 | 137 |
| 9 | 3300025931 | Ga0207644_11780051 | Ga0207644_117800511 | 137 |
| 10 | 3300025972 | Ga0207668_12171724 | Ga0207668_121717241 | 137 |
| 11 | 3300031548 | Ga0307408_100897731 | Ga0307408_1008977312 | 137 |
| 12 | 3300049585 | Ga0501069_0133542 | Ga0501069_0133542_730_1149 | 137 |
| 13 | 3300049586 | Ga0501070_0549504 | Ga0501070_0549504_26_445 | 137 |
| 14 | 3300001990 | JGI24737J22298_10189957 | JGI24737J22298_101899571 | 138 |
| 15 | 3300002070 | JGI24750J21931_1036962 | JGI24750J21931_10369621 | 138 |
| 16 | 3300005329 | Ga0070683_100020290 | Ga0070683_1000202906 | 138 |
| 17 | 3300005331 | Ga0070670_101185308 | Ga0070670_1011853082 | 138 |
| 18 | 3300005334 | Ga0068869_100123788 | Ga0068869_1001237883 | 138 |
| 19 | 3300005334 | Ga0068869_100808870 | Ga0068869_1008088702 | 138 |
| 20 | 3300005336 | Ga0070680_100681746 | Ga0070680_1006817462 | 138 |
| 21 | 3300005338 | Ga0068868_100620860 | Ga0068868_1006208602 | 138 |
| 22 | 3300005343 | Ga0070687_100629975 | Ga0070687_1006299752 | 138 |
| 23 | 3300005345 | Ga0070692_10106039 | Ga0070692_101060392 | 138 |
| 24 | 3300005347 | Ga0070668_100613627 | Ga0070668_1006136271 | 138 |
| 25 | 3300005353 | Ga0070669_100446973 | Ga0070669_1004469732 | 138 |
| 26 | 3300005356 | Ga0070674_100589477 | Ga0070674_1005894771 | 138 |
| 27 | 3300005365 | Ga0070688_100383407 | Ga0070688_1003834071 | 138 |
| 28 | 3300005366 | Ga0070659_100042790 | Ga0070659_1000427903 | 138 |
| 29 | 3300005366 | Ga0070659_100229300 | Ga0070659_1002293002 | 138 |
| 30 | 3300005367 | Ga0070667_100257367 | Ga0070667_1002573672 | 138 |
| 31 | 3300005367 | Ga0070667_100429102 | Ga0070667_1004291021 | 138 |
| 32 | 3300005435 | Ga0070714_100188355 | Ga0070714_1001883552 | 138 |
| 33 | 3300005437 | Ga0070710_10262668 | Ga0070710_102626682 | 138 |
| 34 | 3300005439 | Ga0070711_100014408 | Ga0070711_1000144081 | 138 |
| 35 | 3300005441 | Ga0070700_100109985 | Ga0070700_1001099854 | 138 |
| 36 | 3300005444 | Ga0070694_101452139 | Ga0070694_1014521391 | 138 |
| 37 | 3300005458 | Ga0070681_10127450 | Ga0070681_101274503 | 138 |
| 38 | 3300005459 | Ga0068867_100524032 | Ga0068867_1005240321 | 138 |
| 39 | 3300005459 | Ga0068867_100627217 | Ga0068867_1006272172 | 138 |
| 40 | 3300005543 | Ga0070672_100143012 | Ga0070672_1001430124 | 138 |
| 41 | 3300005547 | Ga0070693_100062472 | Ga0070693_1000624724 | 138 |
| 42 | 3300005548 | Ga0070665_100000040 | Ga0070665_10000004088 | 138 |
| 43 | 3300005548 | Ga0070665_100407376 | Ga0070665_1004073763 | 138 |
| 44 | 3300005549 | Ga0070704_100180507 | Ga0070704_1001805073 | 138 |
| 45 | 3300005563 | Ga0068855_100868502 | Ga0068855_1008685022 | 138 |
| 46 | 3300005578 | Ga0068854_100419112 | Ga0068854_1004191122 | 138 |
| 47 | 3300005614 | Ga0068856_101870390 | Ga0068856_1018703901 | 138 |
| 48 | 3300005615 | Ga0070702_100036760 | Ga0070702_1000367604 | 138 |
| 49 | 3300005617 | Ga0068859_100199282 | Ga0068859_1001992821 | 138 |
| 50 | 3300005618 | Ga0068864_102481669 | Ga0068864_1024816691 | 138 |
| 51 | 3300005718 | Ga0068866_10046122 | Ga0068866_100461223 | 138 |
| 52 | 3300005719 | Ga0068861_100073271 | Ga0068861_1000732714 | 138 |
| 53 | 3300005840 | Ga0068870_10188243 | Ga0068870_101882432 | 138 |
| 54 | 3300005842 | Ga0068858_100000526 | Ga0068858_10000052630 | 138 |
| 55 | 3300005843 | Ga0068860_100199633 | Ga0068860_1001996334 | 138 |
| 56 | 3300005844 | Ga0068862_100219017 | Ga0068862_1002190173 | 138 |
| 57 | 3300005981 | Ga0081538_10053403 | Ga0081538_100534035 | 138 |
| 58 | 3300006028 | Ga0070717_10014008 | Ga0070717_100140085 | 138 |
| 59 | 3300006028 | Ga0070717_10077302 | Ga0070717_100773023 | 138 |
| 60 | 3300006048 | Ga0075363_100350855 | Ga0075363_1003508552 | 138 |
| 61 | 3300006051 | Ga0075364_10045551 | Ga0075364_100455514 | 138 |
| 62 | 3300006163 | Ga0070715_10373632 | Ga0070715_103736321 | 138 |
| 63 | 3300006175 | Ga0070712_100665268 | Ga0070712_1006652682 | 138 |
| 64 | 3300006237 | Ga0097621_100134188 | Ga0097621_1001341881 | 138 |
| 65 | 3300006358 | Ga0068871_100095998 | Ga0068871_1000959982 | 138 |
| 66 | 3300006358 | Ga0068871_101882466 | Ga0068871_1018824661 | 138 |
| 67 | 3300006844 | Ga0075428_101276631 | Ga0075428_1012766312 | 138 |
| 68 | 3300006846 | Ga0075430_100488650 | Ga0075430_1004886502 | 138 |
| 69 | 3300006852 | Ga0075433_10193583 | Ga0075433_101935834 | 138 |
| 70 | 3300006871 | Ga0075434_100420919 | Ga0075434_1004209192 | 138 |
| 71 | 3300006881 | Ga0068865_100118747 | Ga0068865_1001187474 | 138 |
| 72 | 3300006931 | Ga0097620_100199296 | Ga0097620_1001992961 | 138 |
| 73 | 3300009011 | Ga0105251_10278835 | Ga0105251_102788352 | 138 |
| 74 | 3300009098 | Ga0105245_10000310 | Ga0105245_1000031028 | 138 |
| 75 | 3300009147 | Ga0114129_11225138 | Ga0114129_112251381 | 138 |
| 76 | 3300009148 | Ga0105243_10163828 | Ga0105243_101638284 | 138 |
| 77 | 3300009148 | Ga0105243_11485162 | Ga0105243_114851621 | 138 |
| 78 | 3300009174 | Ga0105241_10660615 | Ga0105241_106606152 | 138 |
| 79 | 3300009176 | Ga0105242_10051814 | Ga0105242_100518145 | 138 |
| 80 | 3300009177 | Ga0105248_10812669 | Ga0105248_108126692 | 138 |
| 81 | 3300009545 | Ga0105237_10298520 | Ga0105237_102985202 | 138 |
| 82 | 3300009553 | Ga0105249_10040209 | Ga0105249_100402094 | 138 |
| 83 | 3300009553 | Ga0105249_10054663 | Ga0105249_100546632 | 138 |
| 84 | 3300010375 | Ga0105239_10170939 | Ga0105239_101709391 | 138 |
| 85 | 3300013102 | Ga0157371_10276356 | Ga0157371_102763562 | 138 |
| 86 | 3300013105 | Ga0157369_10282664 | Ga0157369_102826642 | 138 |
| 87 | 3300013297 | Ga0157378_10015831 | Ga0157378_100158319 | 138 |
| 88 | 3300013297 | Ga0157378_10205933 | Ga0157378_102059333 | 138 |
| 89 | 3300013306 | Ga0163162_10539399 | Ga0163162_105393992 | 138 |
| 90 | 3300013307 | Ga0157372_10790502 | Ga0157372_107905022 | 138 |
| 91 | 3300013308 | Ga0157375_10378068 | Ga0157375_103780683 | 138 |
| 92 | 3300014325 | Ga0163163_10220177 | Ga0163163_102201772 | 138 |
| 93 | 3300014968 | Ga0157379_10105162 | Ga0157379_101051624 | 138 |
| 94 | 3300017792 | Ga0163161_10295209 | Ga0163161_102952092 | 138 |
| 95 | 3300020069 | Ga0197907_10563192 | Ga0197907_105631922 | 138 |
| 96 | 3300020078 | Ga0206352_10282433 | Ga0206352_102824331 | 138 |
| 97 | 3300020078 | Ga0206352_10397907 | Ga0206352_103979072 | 138 |
| 98 | 3300020078 | Ga0206352_11008601 | Ga0206352_110086011 | 138 |
| 99 | 3300022467 | Ga0224712_10182999 | Ga0224712_101829992 | 138 |
| 100 | 3300025898 | Ga0207692_10416578 | Ga0207692_104165782 | 138 |
| 101 | 3300025899 | Ga0207642_10183566 | Ga0207642_101835662 | 138 |
| 102 | 3300025900 | Ga0207710_10000198 | Ga0207710_1000019819 | 138 |
| 103 | 3300025900 | Ga0207710_10470070 | Ga0207710_104700701 | 138 |
| 104 | 3300025901 | Ga0207688_10007830 | Ga0207688_100078308 | 138 |
| 105 | 3300025901 | Ga0207688_10551339 | Ga0207688_105513391 | 138 |
| 106 | 3300025903 | Ga0207680_10247046 | Ga0207680_102470463 | 138 |
| 107 | 3300025905 | Ga0207685_10251288 | Ga0207685_102512881 | 138 |
| 108 | 3300025912 | Ga0207707_10145773 | Ga0207707_101457733 | 138 |
| 109 | 3300025914 | Ga0207671_10464031 | Ga0207671_104640312 | 138 |
| 110 | 3300025915 | Ga0207693_10002971 | Ga0207693_1000297118 | 138 |
| 111 | 3300025915 | Ga0207693_10022277 | Ga0207693_100222771 | 138 |
| 112 | 3300025916 | Ga0207663_10104496 | Ga0207663_101044961 | 138 |
| 113 | 3300025916 | Ga0207663_10785958 | Ga0207663_107859581 | 138 |
| 114 | 3300025918 | Ga0207662_10041129 | Ga0207662_100411293 | 138 |
| 115 | 3300025919 | Ga0207657_10060948 | Ga0207657_100609485 | 138 |
| 116 | 3300025919 | Ga0207657_10263096 | Ga0207657_102630962 | 138 |
| 117 | 3300025920 | Ga0207649_10283682 | Ga0207649_102836821 | 138 |
| 118 | 3300025921 | Ga0207652_10103685 | Ga0207652_101036853 | 138 |
| 119 | 3300025925 | Ga0207650_10947562 | Ga0207650_109475621 | 138 |
| 120 | 3300025927 | Ga0207687_10000079 | Ga0207687_1000007928 | 138 |
| 121 | 3300025927 | Ga0207687_10934629 | Ga0207687_109346291 | 138 |
| 122 | 3300025929 | Ga0207664_10172999 | Ga0207664_101729992 | 138 |
| 123 | 3300025932 | Ga0207690_10233820 | Ga0207690_102338203 | 138 |
| 124 | 3300025934 | Ga0207686_10215931 | Ga0207686_102159313 | 138 |
| 125 | 3300025934 | Ga0207686_10699581 | Ga0207686_106995811 | 138 |
| 126 | 3300025935 | Ga0207709_10434716 | Ga0207709_104347161 | 138 |
| 127 | 3300025935 | Ga0207709_10603842 | Ga0207709_106038421 | 138 |
| 128 | 3300025936 | Ga0207670_10321206 | Ga0207670_103212061 | 138 |
| 129 | 3300025937 | Ga0207669_10325418 | Ga0207669_103254182 | 138 |
| 130 | 3300025937 | Ga0207669_10763840 | Ga0207669_107638401 | 138 |
| 131 | 3300025938 | Ga0207704_10358788 | Ga0207704_103587883 | 138 |
| 132 | 3300025940 | Ga0207691_10290253 | Ga0207691_102902532 | 138 |
| 133 | 3300025942 | Ga0207689_10023351 | Ga0207689_100233514 | 138 |
| 134 | 3300025944 | Ga0207661_10009112 | Ga0207661_100091125 | 138 |
| 135 | 3300025961 | Ga0207712_10107784 | Ga0207712_101077842 | 138 |
| 136 | 3300025972 | Ga0207668_10151458 | Ga0207668_101514583 | 138 |
| 137 | 3300025981 | Ga0207640_10027434 | Ga0207640_100274342 | 138 |
| 138 | 3300025986 | Ga0207658_10230510 | Ga0207658_102305103 | 138 |
| 139 | 3300025986 | Ga0207658_10472869 | Ga0207658_104728693 | 138 |
| 140 | 3300026023 | Ga0207677_10366816 | Ga0207677_103668162 | 138 |
| 141 | 3300026035 | Ga0207703_10000170 | Ga0207703_1000017067 | 138 |
| 142 | 3300026035 | Ga0207703_10178393 | Ga0207703_101783934 | 138 |
| 143 | 3300026035 | Ga0207703_11413064 | Ga0207703_114130641 | 138 |
| 144 | 3300026075 | Ga0207708_10311288 | Ga0207708_103112882 | 138 |
| 145 | 3300026078 | Ga0207702_10022327 | Ga0207702_100223277 | 138 |
| 146 | 3300026089 | Ga0207648_10046171 | Ga0207648_100461715 | 138 |
| 147 | 3300026089 | Ga0207648_10960925 | Ga0207648_109609251 | 138 |
| 148 | 3300026118 | Ga0207675_100048217 | Ga0207675_1000482175 | 138 |
| 149 | 3300026121 | Ga0207683_10062369 | Ga0207683_100623693 | 138 |
| 150 | 3300026142 | Ga0207698_10464099 | Ga0207698_104640991 | 138 |
| 151 | 3300028379 | Ga0268266_10000045 | Ga0268266_1000004591 | 138 |
| 152 | 3300028379 | Ga0268266_10893774 | Ga0268266_108937742 | 138 |
| 153 | 3300028379 | Ga0268266_11420310 | Ga0268266_114203101 | 138 |
| 154 | 3300028380 | Ga0268265_10314556 | Ga0268265_103145562 | 138 |
| 155 | 3300028381 | Ga0268264_10255556 | Ga0268264_102555561 | 138 |
| 156 | 3300031548 | Ga0307408_101316756 | Ga0307408_1013167561 | 138 |
| 157 | 3300032126 | Ga0307415_100541053 | Ga0307415_1005410532 | 138 |
| 158 | 3300033179 | Ga0307507_10000002 | Ga0307507_10000002342 | 138 |
| 159 | 3300035114 | Ga0373939_0172897 | Ga0373939_0172897_306_731 | 138 |
| 160 | 3300035121 | Ga0373960_0159378 | Ga0373960_0159378_186_611 | 138 |
| 161 | 3300037312 | Ga0395899_0123030 | Ga0395899_0123030_1412_1834 | 138 |
| 162 | 3300037418 | Ga0395900_0629335 | Ga0395900_0629335_517_939 | 138 |
| 163 | 3300037466 | Ga0395898_0006483 | Ga0395898_0006483_585_1007 | 138 |
| 164 | 3300037466 | Ga0395898_0206145 | Ga0395898_0206145_444_872 | 138 |
| 165 | 3300037471 | Ga0395905_0021206 | Ga0395905_0021206_4817_5239 | 138 |
| 166 | 3300038443 | Ga0395901_0364051 | Ga0395901_0364051_141_563 | 138 |
| 167 | 3300039438 | Ga0436360_0816047 | Ga0436360_0816047_141_560 | 138 |
| 168 | 3300044656 | Ga0466969_0004337 | Ga0466969_0004337_6448_6873 | 138 |
| 169 | 3300044684 | Ga0466966_0151446 | Ga0466966_0151446_19_444 | 138 |
| 170 | 3300044693 | Ga0466961_0015171 | Ga0466961_0015171_54_479 | 138 |
| 171 | 3300044694 | Ga0466963_0085114 | Ga0466963_0085114_1634_2059 | 138 |
| 172 | 3300044719 | Ga0466971_0008645 | Ga0466971_0008645_564_989 | 138 |
| 173 | 3300044765 | Ga0466970_0070176 | Ga0466970_0070176_30_455 | 138 |
| 174 | 3300044842 | Ga0466957_0576643 | Ga0466957_0576643_266_691 | 138 |
| 175 | 3300045049 | Ga0466959_0004011 | Ga0466959_0004011_6876_7301 | 138 |
| 176 | 3300045836 | Ga0466958_0060469 | Ga0466958_0060469_54_479 | 138 |
| 177 | 3300045976 | Ga0466967_2361735 | Ga0466967_2361735_77_496 | 138 |
| 178 | 3300046463 | Ga0495653_0460022 | Ga0495653_0460022_93_518 | 138 |
| 179 | 3300046516 | Ga0495628_0004295 | Ga0495628_0004295_2284_2712 | 138 |
| 180 | 3300046516 | Ga0495628_0061217 | Ga0495628_0061217_1493_1921 | 138 |
| 181 | 3300046516 | Ga0495628_0134693 | Ga0495628_0134693_295_720 | 138 |
| 182 | 3300046517 | Ga0495630_0384798 | Ga0495630_0384798_459_887 | 138 |
| 183 | 3300046531 | Ga0495665_0149217 | Ga0495665_0149217_508_945 | 138 |
| 184 | 3300046642 | Ga0495634_0096587 | Ga0495634_0096587_1382_1810 | 138 |
| 185 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_217344_217772 | 138 |
| 186 | 3300046674 | Ga0495588_0711142 | Ga0495588_0711142_82_507 | 138 |
| 187 | 3300046681 | Ga0495647_0045025 | Ga0495647_0045025_666_1091 | 138 |
| 188 | 3300046690 | Ga0495624_0002016 | Ga0495624_0002016_2311_2739 | 138 |
| 189 | 3300047315 | Ga0495581_0139150 | Ga0495581_0139150_478_903 | 138 |
| 190 | 3300047321 | Ga0495676_0000136 | Ga0495676_0000136_50249_50677 | 138 |
| 191 | 3300047321 | Ga0495676_0327823 | Ga0495676_0327823_28_453 | 138 |
| 192 | 3300047446 | Ga0495679_016258 | Ga0495679_016258_591_1019 | 138 |
| 193 | 3300048903 | Ga0496100_0403775 | Ga0496100_0403775_598_1023 | 138 |
| 194 | 3300048903 | Ga0496100_0476741 | Ga0496100_0476741_310_732 | 138 |
| 195 | 3300048903 | Ga0496100_0971654 | Ga0496100_0971654_151_576 | 138 |
| 196 | 3300048904 | Ga0496101_0056678 | Ga0496101_0056678_349_771 | 138 |
| 197 | 3300048905 | Ga0496102_0304057 | Ga0496102_0304057_251_673 | 138 |
| 198 | 3300048909 | Ga0496106_0000213 | Ga0496106_0000213_10021_10446 | 138 |
| 199 | 3300048909 | Ga0496106_0759287 | Ga0496106_0759287_91_516 | 138 |
| 200 | 3300048910 | Ga0496107_0036340 | Ga0496107_0036340_1563_1985 | 138 |
| 201 | 3300048917 | Ga0496114_0012601 | Ga0496114_0012601_4888_5313 | 138 |
| 202 | 3300048917 | Ga0496114_0144350 | Ga0496114_0144350_668_1087 | 138 |
| 203 | 3300048917 | Ga0496114_0318219 | Ga0496114_0318219_732_1157 | 138 |
| 204 | 3300048918 | Ga0496115_0214482 | Ga0496115_0214482_35_460 | 138 |
| 205 | 3300048918 | Ga0496115_0302392 | Ga0496115_0302392_785_1210 | 138 |
| 206 | 3300049572 | Ga0501036_1220961 | Ga0501036_1220961_39_461 | 138 |
| 207 | 3300049575 | Ga0501039_0168537 | Ga0501039_0168537_674_1096 | 138 |
| 208 | 3300049576 | Ga0501040_0914186 | Ga0501040_0914186_175_597 | 138 |
| 209 | 3300049578 | Ga0501042_0301221 | Ga0501042_0301221_216_638 | 138 |
| 210 | 3300049587 | Ga0501071_0809641 | Ga0501071_0809641_132_554 | 138 |
| 211 | 3300049592 | Ga0501076_1747897 | Ga0501076_1747897_75_497 | 138 |
| 212 | 3300049741 | Ga0501079_1390002 | Ga0501079_1390002_22_444 | 138 |
| 213 | 3300049743 | Ga0501081_0554384 | Ga0501081_0554384_239_661 | 138 |
| 214 | 3300050491 | nmdc:mga00v17_42532_c1 | nmdc:mga00v17_42532_c1_312_737 | 138 |
| 215 | 3300050509 | nmdc:mga0qj67_921500_c1 | nmdc:mga0qj67_921500_c1_208_636 | 138 |
| 216 | 3300050512 | nmdc:mga0n895_389188_c1 | nmdc:mga0n895_389188_c1_201_626 | 138 |
| 217 | 3300053077 | Ga0495601_0000104 | Ga0495601_0000104_37865_38293 | 138 |
| 218 | 3300053078 | Ga0495612_0317482 | Ga0495612_0317482_204_629 | 138 |
| 219 | 3300053085 | Ga0495619_0724011 | Ga0495619_0724011_84_509 | 138 |
| 220 | 3300061719 | Ga0466962_0089357 | Ga0466962_0089357_107_532 | 138 |
| 221 | 3300001990 | JGI24737J22298_10267160 | JGI24737J22298_102671601 | 139 |
| 222 | 3300001991 | JGI24743J22301_10026714 | JGI24743J22301_100267141 | 139 |
| 223 | 3300002075 | JGI24738J21930_10029403 | JGI24738J21930_100294032 | 139 |
| 224 | 3300002239 | JGI24034J26672_10052795 | JGI24034J26672_100527951 | 139 |
| 225 | 3300003162 | Ga0006778J45830_1037705 | Ga0006778J45830_10377051 | 139 |
| 226 | 3300003163 | Ga0006759J45824_1024331 | Ga0006759J45824_10243311 | 139 |
| 227 | 3300003203 | JGI25406J46586_10009040 | JGI25406J46586_100090403 | 139 |
| 228 | 3300003373 | JGI25407J50210_10085528 | JGI25407J50210_100855282 | 139 |
| 229 | 3300003568 | Ga0006781J51513_1023272 | Ga0006781J51513_10232721 | 139 |
| 230 | 3300003575 | Ga0007409J51694_1021205 | Ga0007409J51694_10212051 | 139 |
| 231 | 3300003577 | Ga0007416J51690_1022293 | Ga0007416J51690_10222931 | 139 |
| 232 | 3300003577 | Ga0007416J51690_1113228 | Ga0007416J51690_11132281 | 139 |
| 233 | 3300003579 | Ga0007429J51699_1059757 | Ga0007429J51699_10597571 | 139 |
| 234 | 3300005329 | Ga0070683_100003913 | Ga0070683_10000391310 | 139 |
| 235 | 3300005329 | Ga0070683_100088509 | Ga0070683_1000885092 | 139 |
| 236 | 3300005329 | Ga0070683_101230263 | Ga0070683_1012302631 | 139 |
| 237 | 3300005331 | Ga0070670_100338572 | Ga0070670_1003385722 | 139 |
| 238 | 3300005334 | Ga0068869_100053839 | Ga0068869_1000538393 | 139 |
| 239 | 3300005335 | Ga0070666_10436761 | Ga0070666_104367611 | 139 |
| 240 | 3300005336 | Ga0070680_100161146 | Ga0070680_1001611462 | 139 |
| 241 | 3300005336 | Ga0070680_100177968 | Ga0070680_1001779681 | 139 |
| 242 | 3300005337 | Ga0070682_100108542 | Ga0070682_1001085421 | 139 |
| 243 | 3300005337 | Ga0070682_100237601 | Ga0070682_1002376012 | 139 |
| 244 | 3300005338 | Ga0068868_100056769 | Ga0068868_1000567693 | 139 |
| 245 | 3300005338 | Ga0068868_100073458 | Ga0068868_1000734583 | 139 |
| 246 | 3300005338 | Ga0068868_100082636 | Ga0068868_1000826362 | 139 |
| 247 | 3300005340 | Ga0070689_100933550 | Ga0070689_1009335502 | 139 |
| 248 | 3300005340 | Ga0070689_101351009 | Ga0070689_1013510091 | 139 |
| 249 | 3300005341 | Ga0070691_10097784 | Ga0070691_100977843 | 139 |
| 250 | 3300005341 | Ga0070691_10473765 | Ga0070691_104737652 | 139 |
| 251 | 3300005343 | Ga0070687_100549177 | Ga0070687_1005491771 | 139 |
| 252 | 3300005347 | Ga0070668_100215138 | Ga0070668_1002151381 | 139 |
| 253 | 3300005354 | Ga0070675_100233043 | Ga0070675_1002330434 | 139 |
| 254 | 3300005356 | Ga0070674_100301402 | Ga0070674_1003014022 | 139 |
| 255 | 3300005356 | Ga0070674_100757986 | Ga0070674_1007579861 | 139 |
| 256 | 3300005356 | Ga0070674_100855681 | Ga0070674_1008556812 | 139 |
| 257 | 3300005365 | Ga0070688_101065150 | Ga0070688_1010651501 | 139 |
| 258 | 3300005366 | Ga0070659_100018508 | Ga0070659_1000185085 | 139 |
| 259 | 3300005366 | Ga0070659_100433650 | Ga0070659_1004336502 | 139 |
| 260 | 3300005367 | Ga0070667_100307010 | Ga0070667_1003070102 | 139 |
| 261 | 3300005434 | Ga0070709_10368780 | Ga0070709_103687801 | 139 |
| 262 | 3300005434 | Ga0070709_10438903 | Ga0070709_104389031 | 139 |
| 263 | 3300005435 | Ga0070714_100170478 | Ga0070714_1001704783 | 139 |
| 264 | 3300005435 | Ga0070714_100266527 | Ga0070714_1002665273 | 139 |
| 265 | 3300005435 | Ga0070714_100540607 | Ga0070714_1005406072 | 139 |
| 266 | 3300005435 | Ga0070714_101633332 | Ga0070714_1016333321 | 139 |
| 267 | 3300005436 | Ga0070713_100153684 | Ga0070713_1001536841 | 139 |
| 268 | 3300005436 | Ga0070713_100202563 | Ga0070713_1002025632 | 139 |
| 269 | 3300005436 | Ga0070713_100471014 | Ga0070713_1004710142 | 139 |
| 270 | 3300005437 | Ga0070710_10000019 | Ga0070710_1000001954 | 139 |
| 271 | 3300005437 | Ga0070710_10034496 | Ga0070710_100344965 | 139 |
| 272 | 3300005437 | Ga0070710_10162633 | Ga0070710_101626332 | 139 |
| 273 | 3300005438 | Ga0070701_10119402 | Ga0070701_101194021 | 139 |
| 274 | 3300005439 | Ga0070711_100021474 | Ga0070711_1000214742 | 139 |
| 275 | 3300005439 | Ga0070711_100137214 | Ga0070711_1001372143 | 139 |
| 276 | 3300005440 | Ga0070705_100071930 | Ga0070705_1000719302 | 139 |
| 277 | 3300005440 | Ga0070705_100110338 | Ga0070705_1001103382 | 139 |
| 278 | 3300005440 | Ga0070705_100130894 | Ga0070705_1001308944 | 139 |
| 279 | 3300005440 | Ga0070705_100212022 | Ga0070705_1002120221 | 139 |
| 280 | 3300005441 | Ga0070700_100161571 | Ga0070700_1001615712 | 139 |
| 281 | 3300005441 | Ga0070700_100565106 | Ga0070700_1005651061 | 139 |
| 282 | 3300005441 | Ga0070700_101251638 | Ga0070700_1012516381 | 139 |
| 283 | 3300005444 | Ga0070694_100043447 | Ga0070694_1000434474 | 139 |
| 284 | 3300005444 | Ga0070694_100050878 | Ga0070694_1000508784 | 139 |
| 285 | 3300005445 | Ga0070708_100701475 | Ga0070708_1007014752 | 139 |
| 286 | 3300005457 | Ga0070662_100092602 | Ga0070662_1000926021 | 139 |
| 287 | 3300005457 | Ga0070662_100214271 | Ga0070662_1002142713 | 139 |
| 288 | 3300005457 | Ga0070662_101894371 | Ga0070662_1018943711 | 139 |
| 289 | 3300005459 | Ga0068867_100108050 | Ga0068867_1001080502 | 139 |
| 290 | 3300005459 | Ga0068867_101296678 | Ga0068867_1012966782 | 139 |
| 291 | 3300005466 | Ga0070685_10176308 | Ga0070685_101763082 | 139 |
| 292 | 3300005466 | Ga0070685_10711560 | Ga0070685_107115601 | 139 |
| 293 | 3300005467 | Ga0070706_100316554 | Ga0070706_1003165543 | 139 |
| 294 | 3300005468 | Ga0070707_100108509 | Ga0070707_1001085094 | 139 |
| 295 | 3300005468 | Ga0070707_100790285 | Ga0070707_1007902852 | 139 |
| 296 | 3300005518 | Ga0070699_100161522 | Ga0070699_1001615221 | 139 |
| 297 | 3300005518 | Ga0070699_100581108 | Ga0070699_1005811082 | 139 |
| 298 | 3300005530 | Ga0070679_101349529 | Ga0070679_1013495291 | 139 |
| 299 | 3300005535 | Ga0070684_100004742 | Ga0070684_1000047427 | 139 |
| 300 | 3300005535 | Ga0070684_100095395 | Ga0070684_1000953952 | 139 |
| 301 | 3300005535 | Ga0070684_100681263 | Ga0070684_1006812632 | 139 |
| 302 | 3300005536 | Ga0070697_100303359 | Ga0070697_1003033593 | 139 |
| 303 | 3300005536 | Ga0070697_100369743 | Ga0070697_1003697431 | 139 |
| 304 | 3300005536 | Ga0070697_101266823 | Ga0070697_1012668232 | 139 |
| 305 | 3300005539 | Ga0068853_100085414 | Ga0068853_1000854142 | 139 |
| 306 | 3300005543 | Ga0070672_100801033 | Ga0070672_1008010332 | 139 |
| 307 | 3300005544 | Ga0070686_100046501 | Ga0070686_1000465011 | 139 |
| 308 | 3300005544 | Ga0070686_100653189 | Ga0070686_1006531892 | 139 |
| 309 | 3300005545 | Ga0070695_100020842 | Ga0070695_1000208426 | 139 |
| 310 | 3300005545 | Ga0070695_100123996 | Ga0070695_1001239961 | 139 |
| 311 | 3300005545 | Ga0070695_100156209 | Ga0070695_1001562092 | 139 |
| 312 | 3300005546 | Ga0070696_100098041 | Ga0070696_1000980414 | 139 |
| 313 | 3300005546 | Ga0070696_100414364 | Ga0070696_1004143642 | 139 |
| 314 | 3300005547 | Ga0070693_100035424 | Ga0070693_1000354244 | 139 |
| 315 | 3300005548 | Ga0070665_100343462 | Ga0070665_1003434623 | 139 |
| 316 | 3300005549 | Ga0070704_100051941 | Ga0070704_1000519412 | 139 |
| 317 | 3300005549 | Ga0070704_100113095 | Ga0070704_1001130951 | 139 |
| 318 | 3300005549 | Ga0070704_100475194 | Ga0070704_1004751942 | 139 |
| 319 | 3300005563 | Ga0068855_100016543 | Ga0068855_1000165438 | 139 |
| 320 | 3300005563 | Ga0068855_100288270 | Ga0068855_1002882702 | 139 |
| 321 | 3300005564 | Ga0070664_100217248 | Ga0070664_1002172482 | 139 |
| 322 | 3300005564 | Ga0070664_100313891 | Ga0070664_1003138913 | 139 |
| 323 | 3300005564 | Ga0070664_101371155 | Ga0070664_1013711551 | 139 |
| 324 | 3300005577 | Ga0068857_100001344 | Ga0068857_10000134422 | 139 |
| 325 | 3300005577 | Ga0068857_100189725 | Ga0068857_1001897251 | 139 |
| 326 | 3300005577 | Ga0068857_100310535 | Ga0068857_1003105351 | 139 |
| 327 | 3300005578 | Ga0068854_100135944 | Ga0068854_1001359442 | 139 |
| 328 | 3300005578 | Ga0068854_100324301 | Ga0068854_1003243011 | 139 |
| 329 | 3300005614 | Ga0068856_100217421 | Ga0068856_1002174213 | 139 |
| 330 | 3300005615 | Ga0070702_100000693 | Ga0070702_1000006932 | 139 |
| 331 | 3300005615 | Ga0070702_100050546 | Ga0070702_1000505462 | 139 |
| 332 | 3300005615 | Ga0070702_100109987 | Ga0070702_1001099872 | 139 |
| 333 | 3300005615 | Ga0070702_100324680 | Ga0070702_1003246802 | 139 |
| 334 | 3300005616 | Ga0068852_100019170 | Ga0068852_1000191705 | 139 |
| 335 | 3300005616 | Ga0068852_100374892 | Ga0068852_1003748923 | 139 |
| 336 | 3300005617 | Ga0068859_100056438 | Ga0068859_1000564382 | 139 |
| 337 | 3300005617 | Ga0068859_100105189 | Ga0068859_1001051895 | 139 |
| 338 | 3300005618 | Ga0068864_100109640 | Ga0068864_1001096403 | 139 |
| 339 | 3300005618 | Ga0068864_100140959 | Ga0068864_1001409592 | 139 |
| 340 | 3300005718 | Ga0068866_10022680 | Ga0068866_100226804 | 139 |
| 341 | 3300005718 | Ga0068866_10476372 | Ga0068866_104763721 | 139 |
| 342 | 3300005719 | Ga0068861_100268095 | Ga0068861_1002680952 | 139 |
| 343 | 3300005719 | Ga0068861_100461245 | Ga0068861_1004612452 | 139 |
| 344 | 3300005719 | Ga0068861_100642077 | Ga0068861_1006420772 | 139 |
| 345 | 3300005834 | Ga0068851_10065830 | Ga0068851_100658303 | 139 |
| 346 | 3300005834 | Ga0068851_10502056 | Ga0068851_105020562 | 139 |
| 347 | 3300005841 | Ga0068863_100185402 | Ga0068863_1001854022 | 139 |
| 348 | 3300005842 | Ga0068858_100035699 | Ga0068858_1000356993 | 139 |
| 349 | 3300005842 | Ga0068858_100737182 | Ga0068858_1007371822 | 139 |
| 350 | 3300005843 | Ga0068860_100616232 | Ga0068860_1006162322 | 139 |
| 351 | 3300005844 | Ga0068862_100169176 | Ga0068862_1001691762 | 139 |
| 352 | 3300005844 | Ga0068862_100725446 | Ga0068862_1007254461 | 139 |
| 353 | 3300005937 | Ga0081455_10145630 | Ga0081455_101456301 | 139 |
| 354 | 3300005981 | Ga0081538_10010525 | Ga0081538_100105255 | 139 |
| 355 | 3300005981 | Ga0081538_10017145 | Ga0081538_100171456 | 139 |
| 356 | 3300005981 | Ga0081538_10049873 | Ga0081538_100498734 | 139 |
| 357 | 3300005981 | Ga0081538_10149235 | Ga0081538_101492352 | 139 |
| 358 | 3300005981 | Ga0081538_10164941 | Ga0081538_101649412 | 139 |
| 359 | 3300005981 | Ga0081538_10194792 | Ga0081538_101947921 | 139 |
| 360 | 3300005981 | Ga0081538_10281361 | Ga0081538_102813611 | 139 |
| 361 | 3300005985 | Ga0081539_10002244 | Ga0081539_100022443 | 139 |
| 362 | 3300005985 | Ga0081539_10044903 | Ga0081539_100449033 | 139 |
| 363 | 3300006028 | Ga0070717_10019885 | Ga0070717_100198853 | 139 |
| 364 | 3300006028 | Ga0070717_10172135 | Ga0070717_101721352 | 139 |
| 365 | 3300006038 | Ga0075365_10005157 | Ga0075365_100051578 | 139 |
| 366 | 3300006038 | Ga0075365_10060380 | Ga0075365_100603803 | 139 |
| 367 | 3300006058 | Ga0075432_10107710 | Ga0075432_101077102 | 139 |
| 368 | 3300006163 | Ga0070715_10004983 | Ga0070715_100049838 | 139 |
| 369 | 3300006173 | Ga0070716_100023088 | Ga0070716_1000230883 | 139 |
| 370 | 3300006173 | Ga0070716_100108640 | Ga0070716_1001086402 | 139 |
| 371 | 3300006175 | Ga0070712_100007865 | Ga0070712_1000078654 | 139 |
| 372 | 3300006175 | Ga0070712_100009456 | Ga0070712_1000094564 | 139 |
| 373 | 3300006175 | Ga0070712_100162301 | Ga0070712_1001623014 | 139 |
| 374 | 3300006175 | Ga0070712_100247362 | Ga0070712_1002473621 | 139 |
| 375 | 3300006237 | Ga0097621_100339742 | Ga0097621_1003397422 | 139 |
| 376 | 3300006237 | Ga0097621_100421803 | Ga0097621_1004218032 | 139 |
| 377 | 3300006358 | Ga0068871_100232098 | Ga0068871_1002320982 | 139 |
| 378 | 3300006358 | Ga0068871_100342292 | Ga0068871_1003422922 | 139 |
| 379 | 3300006844 | Ga0075428_100051095 | Ga0075428_1000510955 | 139 |
| 380 | 3300006844 | Ga0075428_100112498 | Ga0075428_1001124983 | 139 |
| 381 | 3300006844 | Ga0075428_100492253 | Ga0075428_1004922532 | 139 |
| 382 | 3300006844 | Ga0075428_101418314 | Ga0075428_1014183142 | 139 |
| 383 | 3300006846 | Ga0075430_100015802 | Ga0075430_1000158025 | 139 |
| 384 | 3300006846 | Ga0075430_100209413 | Ga0075430_1002094133 | 139 |
| 385 | 3300006847 | Ga0075431_100000056 | Ga0075431_10000005630 | 139 |
| 386 | 3300006847 | Ga0075431_100005114 | Ga0075431_1000051147 | 139 |
| 387 | 3300006847 | Ga0075431_101251217 | Ga0075431_1012512172 | 139 |
| 388 | 3300006847 | Ga0075431_101454432 | Ga0075431_1014544322 | 139 |
| 389 | 3300006852 | Ga0075433_10001182 | Ga0075433_1000118213 | 139 |
| 390 | 3300006852 | Ga0075433_10004243 | Ga0075433_1000424312 | 139 |
| 391 | 3300006852 | Ga0075433_10120143 | Ga0075433_101201433 | 139 |
| 392 | 3300006871 | Ga0075434_100000502 | Ga0075434_10000050231 | 139 |
| 393 | 3300006871 | Ga0075434_100014188 | Ga0075434_1000141883 | 139 |
| 394 | 3300006871 | Ga0075434_100081498 | Ga0075434_1000814983 | 139 |
| 395 | 3300006880 | Ga0075429_100005701 | Ga0075429_1000057013 | 139 |
| 396 | 3300006881 | Ga0068865_100045584 | Ga0068865_1000455844 | 139 |
| 397 | 3300006881 | Ga0068865_100946149 | Ga0068865_1009461492 | 139 |
| 398 | 3300006914 | Ga0075436_100019752 | Ga0075436_1000197527 | 139 |
| 399 | 3300006914 | Ga0075436_100042988 | Ga0075436_1000429885 | 139 |
| 400 | 3300006931 | Ga0097620_100056440 | Ga0097620_1000564402 | 139 |
| 401 | 3300006931 | Ga0097620_100105191 | Ga0097620_1001051915 | 139 |
| 402 | 3300007076 | Ga0075435_100024172 | Ga0075435_1000241727 | 139 |
| 403 | 3300007076 | Ga0075435_100024209 | Ga0075435_10002420910 | 139 |
| 404 | 3300007076 | Ga0075435_101301764 | Ga0075435_1013017641 | 139 |
| 405 | 3300009011 | Ga0105251_10102314 | Ga0105251_101023143 | 139 |
| 406 | 3300009036 | Ga0105244_10213607 | Ga0105244_102136071 | 139 |
| 407 | 3300009036 | Ga0105244_10290152 | Ga0105244_102901522 | 139 |
| 408 | 3300009092 | Ga0105250_10241255 | Ga0105250_102412552 | 139 |
| 409 | 3300009093 | Ga0105240_11032037 | Ga0105240_110320371 | 139 |
| 410 | 3300009093 | Ga0105240_11914395 | Ga0105240_119143951 | 139 |
| 411 | 3300009094 | Ga0111539_10035210 | Ga0111539_100352104 | 139 |
| 412 | 3300009094 | Ga0111539_10604528 | Ga0111539_106045282 | 139 |
| 413 | 3300009094 | Ga0111539_11442083 | Ga0111539_114420832 | 139 |
| 414 | 3300009094 | Ga0111539_11472080 | Ga0111539_114720802 | 139 |
| 415 | 3300009094 | Ga0111539_11515109 | Ga0111539_115151091 | 139 |
| 416 | 3300009098 | Ga0105245_10039338 | Ga0105245_100393381 | 139 |
| 417 | 3300009098 | Ga0105245_10102221 | Ga0105245_101022214 | 139 |
| 418 | 3300009098 | Ga0105245_10118493 | Ga0105245_101184934 | 139 |
| 419 | 3300009098 | Ga0105245_10138126 | Ga0105245_101381263 | 139 |
| 420 | 3300009098 | Ga0105245_10263653 | Ga0105245_102636532 | 139 |
| 421 | 3300009098 | Ga0105245_10612336 | Ga0105245_106123362 | 139 |
| 422 | 3300009098 | Ga0105245_10811186 | Ga0105245_108111861 | 139 |
| 423 | 3300009098 | Ga0105245_11344811 | Ga0105245_113448111 | 139 |
| 424 | 3300009098 | Ga0105245_12679551 | Ga0105245_126795511 | 139 |
| 425 | 3300009101 | Ga0105247_10034222 | Ga0105247_100342225 | 139 |
| 426 | 3300009101 | Ga0105247_10078979 | Ga0105247_100789793 | 139 |
| 427 | 3300009147 | Ga0114129_10026448 | Ga0114129_1002644812 | 139 |
| 428 | 3300009147 | Ga0114129_10031528 | Ga0114129_100315281 | 139 |
| 429 | 3300009147 | Ga0114129_10108772 | Ga0114129_101087725 | 139 |
| 430 | 3300009147 | Ga0114129_10182955 | Ga0114129_101829553 | 139 |
| 431 | 3300009147 | Ga0114129_10364248 | Ga0114129_103642482 | 139 |
| 432 | 3300009147 | Ga0114129_11084960 | Ga0114129_110849602 | 139 |
| 433 | 3300009147 | Ga0114129_11557652 | Ga0114129_115576522 | 139 |
| 434 | 3300009147 | Ga0114129_13070603 | Ga0114129_130706031 | 139 |
| 435 | 3300009148 | Ga0105243_10036928 | Ga0105243_100369282 | 139 |
| 436 | 3300009148 | Ga0105243_10161469 | Ga0105243_101614693 | 139 |
| 437 | 3300009148 | Ga0105243_10226522 | Ga0105243_102265223 | 139 |
| 438 | 3300009148 | Ga0105243_10336663 | Ga0105243_103366632 | 139 |
| 439 | 3300009148 | Ga0105243_10623382 | Ga0105243_106233822 | 139 |
| 440 | 3300009148 | Ga0105243_10748148 | Ga0105243_107481481 | 139 |
| 441 | 3300009174 | Ga0105241_10729215 | Ga0105241_107292152 | 139 |
| 442 | 3300009174 | Ga0105241_11083573 | Ga0105241_110835731 | 139 |
| 443 | 3300009174 | Ga0105241_12607157 | Ga0105241_126071571 | 139 |
| 444 | 3300009176 | Ga0105242_10303250 | Ga0105242_103032503 | 139 |
| 445 | 3300009176 | Ga0105242_10346191 | Ga0105242_103461913 | 139 |
| 446 | 3300009176 | Ga0105242_10403565 | Ga0105242_104035653 | 139 |
| 447 | 3300009176 | Ga0105242_11009281 | Ga0105242_110092811 | 139 |
| 448 | 3300009177 | Ga0105248_10572955 | Ga0105248_105729553 | 139 |
| 449 | 3300009177 | Ga0105248_10593701 | Ga0105248_105937012 | 139 |
| 450 | 3300009545 | Ga0105237_10485531 | Ga0105237_104855312 | 139 |
| 451 | 3300009551 | Ga0105238_10192480 | Ga0105238_101924802 | 139 |
| 452 | 3300009551 | Ga0105238_10767972 | Ga0105238_107679722 | 139 |
| 453 | 3300009551 | Ga0105238_11071342 | Ga0105238_110713421 | 139 |
| 454 | 3300009551 | Ga0105238_11172428 | Ga0105238_111724282 | 139 |
| 455 | 3300009553 | Ga0105249_10010497 | Ga0105249_100104975 | 139 |
| 456 | 3300009553 | Ga0105249_10201395 | Ga0105249_102013952 | 139 |
| 457 | 3300009553 | Ga0105249_10307074 | Ga0105249_103070742 | 139 |
| 458 | 3300009553 | Ga0105249_10606684 | Ga0105249_106066841 | 139 |
| 459 | 3300009553 | Ga0105249_10908721 | Ga0105249_109087212 | 139 |
| 460 | 3300009553 | Ga0105249_12575738 | Ga0105249_125757382 | 139 |
| 461 | 3300010375 | Ga0105239_10106602 | Ga0105239_101066026 | 139 |
| 462 | 3300010375 | Ga0105239_11130894 | Ga0105239_111308942 | 139 |
| 463 | 3300010375 | Ga0105239_11966776 | Ga0105239_119667761 | 139 |
| 464 | 3300010375 | Ga0105239_12124458 | Ga0105239_121244582 | 139 |
| 465 | 3300011119 | Ga0105246_10034823 | Ga0105246_100348234 | 139 |
| 466 | 3300011119 | Ga0105246_11132305 | Ga0105246_111323052 | 139 |
| 467 | 3300013100 | Ga0157373_10552407 | Ga0157373_105524072 | 139 |
| 468 | 3300013102 | Ga0157371_10052919 | Ga0157371_100529192 | 139 |
| 469 | 3300013104 | Ga0157370_10092263 | Ga0157370_100922634 | 139 |
| 470 | 3300013105 | Ga0157369_10097074 | Ga0157369_100970745 | 139 |
| 471 | 3300013296 | Ga0157374_10097074 | Ga0157374_100970743 | 139 |
| 472 | 3300013296 | Ga0157374_10238233 | Ga0157374_102382332 | 139 |
| 473 | 3300013296 | Ga0157374_11200312 | Ga0157374_112003121 | 139 |
| 474 | 3300013297 | Ga0157378_10126081 | Ga0157378_101260812 | 139 |
| 475 | 3300013297 | Ga0157378_10391500 | Ga0157378_103915001 | 139 |
| 476 | 3300013297 | Ga0157378_10644279 | Ga0157378_106442792 | 139 |
| 477 | 3300013306 | Ga0163162_10264022 | Ga0163162_102640222 | 139 |
| 478 | 3300013306 | Ga0163162_10266223 | Ga0163162_102662233 | 139 |
| 479 | 3300013307 | Ga0157372_10944843 | Ga0157372_109448432 | 139 |
| 480 | 3300013307 | Ga0157372_11997687 | Ga0157372_119976871 | 139 |
| 481 | 3300013308 | Ga0157375_10593467 | Ga0157375_105934672 | 139 |
| 482 | 3300013308 | Ga0157375_10698404 | Ga0157375_106984042 | 139 |
| 483 | 3300013308 | Ga0157375_10869396 | Ga0157375_108693961 | 139 |
| 484 | 3300013308 | Ga0157375_11549163 | Ga0157375_115491632 | 139 |
| 485 | 3300014325 | Ga0163163_10047977 | Ga0163163_100479772 | 139 |
| 486 | 3300014326 | Ga0157380_10363266 | Ga0157380_103632663 | 139 |
| 487 | 3300014326 | Ga0157380_10547672 | Ga0157380_105476722 | 139 |
| 488 | 3300014326 | Ga0157380_11085532 | Ga0157380_110855322 | 139 |
| 489 | 3300014745 | Ga0157377_10013230 | Ga0157377_100132302 | 139 |
| 490 | 3300014745 | Ga0157377_10100441 | Ga0157377_101004414 | 139 |
| 491 | 3300014968 | Ga0157379_10124071 | Ga0157379_101240714 | 139 |
| 492 | 3300014968 | Ga0157379_10345836 | Ga0157379_103458363 | 139 |
| 493 | 3300014968 | Ga0157379_10535650 | Ga0157379_105356502 | 139 |
| 494 | 3300014969 | Ga0157376_10157513 | Ga0157376_101575132 | 139 |
| 495 | 3300017792 | Ga0163161_10054622 | Ga0163161_100546222 | 139 |
| 496 | 3300020070 | Ga0206356_10463577 | Ga0206356_104635772 | 139 |
| 497 | 3300020075 | Ga0206349_1547479 | Ga0206349_15474791 | 139 |
| 498 | 3300020076 | Ga0206355_1047451 | Ga0206355_10474511 | 139 |
| 499 | 3300020078 | Ga0206352_10031256 | Ga0206352_100312561 | 139 |
| 500 | 3300020081 | Ga0206354_10533889 | Ga0206354_105338892 | 139 |
| 501 | 3300020082 | Ga0206353_10343017 | Ga0206353_103430172 | 139 |
| 502 | 3300020082 | Ga0206353_11951656 | Ga0206353_119516561 | 139 |
| 503 | 3300021377 | Ga0213874_10001344 | Ga0213874_100013444 | 139 |
| 504 | 3300021377 | Ga0213874_10265885 | Ga0213874_102658851 | 139 |
| 505 | 3300021384 | Ga0213876_10002583 | Ga0213876_100025836 | 139 |
| 506 | 3300021384 | Ga0213876_10012527 | Ga0213876_100125273 | 139 |
| 507 | 3300021384 | Ga0213876_10033207 | Ga0213876_100332073 | 139 |
| 508 | 3300021384 | Ga0213876_10112189 | Ga0213876_101121892 | 139 |
| 509 | 3300021384 | Ga0213876_10347355 | Ga0213876_103473551 | 139 |
| 510 | 3300021388 | Ga0213875_10120252 | Ga0213875_101202521 | 139 |
| 511 | 3300021388 | Ga0213875_10402186 | Ga0213875_104021861 | 139 |
| 512 | 3300022467 | Ga0224712_10179060 | Ga0224712_101790601 | 139 |
| 513 | 3300022467 | Ga0224712_10187218 | Ga0224712_101872182 | 139 |
| 514 | 3300025885 | Ga0207653_10021070 | Ga0207653_100210703 | 139 |
| 515 | 3300025898 | Ga0207692_10400697 | Ga0207692_104006972 | 139 |
| 516 | 3300025899 | Ga0207642_10073738 | Ga0207642_100737383 | 139 |
| 517 | 3300025899 | Ga0207642_10265415 | Ga0207642_102654152 | 139 |
| 518 | 3300025900 | Ga0207710_10599109 | Ga0207710_105991091 | 139 |
| 519 | 3300025901 | Ga0207688_10005722 | Ga0207688_100057227 | 139 |
| 520 | 3300025901 | Ga0207688_10029944 | Ga0207688_100299444 | 139 |
| 521 | 3300025903 | Ga0207680_10061579 | Ga0207680_100615794 | 139 |
| 522 | 3300025903 | Ga0207680_10423829 | Ga0207680_104238291 | 139 |
| 523 | 3300025903 | Ga0207680_10758642 | Ga0207680_107586421 | 139 |
| 524 | 3300025904 | Ga0207647_10048000 | Ga0207647_100480003 | 139 |
| 525 | 3300025905 | Ga0207685_10134202 | Ga0207685_101342023 | 139 |
| 526 | 3300025906 | Ga0207699_10067578 | Ga0207699_100675781 | 139 |
| 527 | 3300025906 | Ga0207699_10176175 | Ga0207699_101761751 | 139 |
| 528 | 3300025908 | Ga0207643_10161042 | Ga0207643_101610422 | 139 |
| 529 | 3300025908 | Ga0207643_10316848 | Ga0207643_103168481 | 139 |
| 530 | 3300025911 | Ga0207654_10053277 | Ga0207654_100532775 | 139 |
| 531 | 3300025913 | Ga0207695_10933768 | Ga0207695_109337681 | 139 |
| 532 | 3300025914 | Ga0207671_10195635 | Ga0207671_101956353 | 139 |
| 533 | 3300025915 | Ga0207693_10003330 | Ga0207693_1000333011 | 139 |
| 534 | 3300025915 | Ga0207693_10003815 | Ga0207693_1000381511 | 139 |
| 535 | 3300025915 | Ga0207693_10010007 | Ga0207693_100100079 | 139 |
| 536 | 3300025915 | Ga0207693_10200204 | Ga0207693_102002043 | 139 |
| 537 | 3300025916 | Ga0207663_10034129 | Ga0207663_100341295 | 139 |
| 538 | 3300025916 | Ga0207663_10037526 | Ga0207663_100375265 | 139 |
| 539 | 3300025917 | Ga0207660_10148428 | Ga0207660_101484284 | 139 |
| 540 | 3300025917 | Ga0207660_10380778 | Ga0207660_103807782 | 139 |
| 541 | 3300025918 | Ga0207662_10010673 | Ga0207662_100106733 | 139 |
| 542 | 3300025918 | Ga0207662_10021797 | Ga0207662_100217974 | 139 |
| 543 | 3300025918 | Ga0207662_10175993 | Ga0207662_101759933 | 139 |
| 544 | 3300025919 | Ga0207657_10026284 | Ga0207657_100262845 | 139 |
| 545 | 3300025921 | Ga0207652_10509028 | Ga0207652_105090282 | 139 |
| 546 | 3300025922 | Ga0207646_10094519 | Ga0207646_100945195 | 139 |
| 547 | 3300025922 | Ga0207646_10573095 | Ga0207646_105730952 | 139 |
| 548 | 3300025924 | Ga0207694_10257383 | Ga0207694_102573831 | 139 |
| 549 | 3300025924 | Ga0207694_10269548 | Ga0207694_102695481 | 139 |
| 550 | 3300025924 | Ga0207694_10612435 | Ga0207694_106124351 | 139 |
| 551 | 3300025925 | Ga0207650_10167172 | Ga0207650_101671722 | 139 |
| 552 | 3300025926 | Ga0207659_10767205 | Ga0207659_107672052 | 139 |
| 553 | 3300025926 | Ga0207659_11439575 | Ga0207659_114395751 | 139 |
| 554 | 3300025927 | Ga0207687_10028547 | Ga0207687_100285475 | 139 |
| 555 | 3300025927 | Ga0207687_10064043 | Ga0207687_100640433 | 139 |
| 556 | 3300025927 | Ga0207687_10827316 | Ga0207687_108273162 | 139 |
| 557 | 3300025928 | Ga0207700_10093377 | Ga0207700_100933772 | 139 |
| 558 | 3300025928 | Ga0207700_10146896 | Ga0207700_101468961 | 139 |
| 559 | 3300025928 | Ga0207700_11406593 | Ga0207700_114065931 | 139 |
| 560 | 3300025929 | Ga0207664_10001134 | Ga0207664_100011343 | 139 |
| 561 | 3300025929 | Ga0207664_10187607 | Ga0207664_101876072 | 139 |
| 562 | 3300025932 | Ga0207690_10111464 | Ga0207690_101114642 | 139 |
| 563 | 3300025932 | Ga0207690_10300422 | Ga0207690_103004222 | 139 |
| 564 | 3300025933 | Ga0207706_10237778 | Ga0207706_102377782 | 139 |
| 565 | 3300025933 | Ga0207706_10545729 | Ga0207706_105457292 | 139 |
| 566 | 3300025933 | Ga0207706_10550866 | Ga0207706_105508662 | 139 |
| 567 | 3300025933 | Ga0207706_10732224 | Ga0207706_107322241 | 139 |
| 568 | 3300025934 | Ga0207686_10127646 | Ga0207686_101276462 | 139 |
| 569 | 3300025934 | Ga0207686_10189397 | Ga0207686_101893972 | 139 |
| 570 | 3300025935 | Ga0207709_10012033 | Ga0207709_100120333 | 139 |
| 571 | 3300025935 | Ga0207709_10097723 | Ga0207709_100977233 | 139 |
| 572 | 3300025936 | Ga0207670_10306170 | Ga0207670_103061702 | 139 |
| 573 | 3300025937 | Ga0207669_10080936 | Ga0207669_100809363 | 139 |
| 574 | 3300025938 | Ga0207704_10016079 | Ga0207704_100160795 | 139 |
| 575 | 3300025939 | Ga0207665_10015801 | Ga0207665_100158017 | 139 |
| 576 | 3300025939 | Ga0207665_10018884 | Ga0207665_100188843 | 139 |
| 577 | 3300025939 | Ga0207665_10056454 | Ga0207665_100564542 | 139 |
| 578 | 3300025940 | Ga0207691_10105655 | Ga0207691_101056553 | 139 |
| 579 | 3300025941 | Ga0207711_10416876 | Ga0207711_104168762 | 139 |
| 580 | 3300025941 | Ga0207711_10676800 | Ga0207711_106768001 | 139 |
| 581 | 3300025941 | Ga0207711_10902765 | Ga0207711_109027651 | 139 |
| 582 | 3300025941 | Ga0207711_11097845 | Ga0207711_110978451 | 139 |
| 583 | 3300025942 | Ga0207689_10057511 | Ga0207689_100575115 | 139 |
| 584 | 3300025944 | Ga0207661_10000564 | Ga0207661_1000056411 | 139 |
| 585 | 3300025944 | Ga0207661_10181895 | Ga0207661_101818952 | 139 |
| 586 | 3300025944 | Ga0207661_11410492 | Ga0207661_114104922 | 139 |
| 587 | 3300025945 | Ga0207679_10284669 | Ga0207679_102846692 | 139 |
| 588 | 3300025949 | Ga0207667_10087198 | Ga0207667_100871981 | 139 |
| 589 | 3300025949 | Ga0207667_10553328 | Ga0207667_105533282 | 139 |
| 590 | 3300025960 | Ga0207651_10277711 | Ga0207651_102777112 | 139 |
| 591 | 3300025961 | Ga0207712_10027026 | Ga0207712_100270263 | 139 |
| 592 | 3300025961 | Ga0207712_10191122 | Ga0207712_101911222 | 139 |
| 593 | 3300025961 | Ga0207712_10434010 | Ga0207712_104340101 | 139 |
| 594 | 3300025961 | Ga0207712_10567584 | Ga0207712_105675842 | 139 |
| 595 | 3300025961 | Ga0207712_11743226 | Ga0207712_117432261 | 139 |
| 596 | 3300025972 | Ga0207668_10191013 | Ga0207668_101910131 | 139 |
| 597 | 3300025972 | Ga0207668_10255127 | Ga0207668_102551271 | 139 |
| 598 | 3300025981 | Ga0207640_10042302 | Ga0207640_100423025 | 139 |
| 599 | 3300025981 | Ga0207640_10194880 | Ga0207640_101948802 | 139 |
| 600 | 3300025981 | Ga0207640_10483998 | Ga0207640_104839982 | 139 |
| 601 | 3300026023 | Ga0207677_10326251 | Ga0207677_103262511 | 139 |
| 602 | 3300026023 | Ga0207677_10487650 | Ga0207677_104876502 | 139 |
| 603 | 3300026023 | Ga0207677_10547071 | Ga0207677_105470712 | 139 |
| 604 | 3300026035 | Ga0207703_10197493 | Ga0207703_101974932 | 139 |
| 605 | 3300026035 | Ga0207703_10372024 | Ga0207703_103720241 | 139 |
| 606 | 3300026041 | Ga0207639_11948937 | Ga0207639_119489371 | 139 |
| 607 | 3300026067 | Ga0207678_10022495 | Ga0207678_100224952 | 139 |
| 608 | 3300026075 | Ga0207708_10042361 | Ga0207708_100423614 | 139 |
| 609 | 3300026075 | Ga0207708_10046014 | Ga0207708_100460143 | 139 |
| 610 | 3300026075 | Ga0207708_10055556 | Ga0207708_100555561 | 139 |
| 611 | 3300026078 | Ga0207702_10033845 | Ga0207702_100338453 | 139 |
| 612 | 3300026078 | Ga0207702_10151986 | Ga0207702_101519862 | 139 |
| 613 | 3300026078 | Ga0207702_10406603 | Ga0207702_104066032 | 139 |
| 614 | 3300026089 | Ga0207648_10160471 | Ga0207648_101604711 | 139 |
| 615 | 3300026089 | Ga0207648_11325630 | Ga0207648_113256301 | 139 |
| 616 | 3300026095 | Ga0207676_10118766 | Ga0207676_101187662 | 139 |
| 617 | 3300026095 | Ga0207676_10385006 | Ga0207676_103850062 | 139 |
| 618 | 3300026095 | Ga0207676_10886352 | Ga0207676_108863522 | 139 |
| 619 | 3300026116 | Ga0207674_10005739 | Ga0207674_100057395 | 139 |
| 620 | 3300026116 | Ga0207674_10052087 | Ga0207674_100520874 | 139 |
| 621 | 3300026116 | Ga0207674_10379638 | Ga0207674_103796382 | 139 |
| 622 | 3300026118 | Ga0207675_100001665 | Ga0207675_1000016652 | 139 |
| 623 | 3300026118 | Ga0207675_100020645 | Ga0207675_1000206455 | 139 |
| 624 | 3300026118 | Ga0207675_100100450 | Ga0207675_1001004502 | 139 |
| 625 | 3300026121 | Ga0207683_10023905 | Ga0207683_100239052 | 139 |
| 626 | 3300026142 | Ga0207698_10634378 | Ga0207698_106343782 | 139 |
| 627 | 3300027907 | Ga0207428_10064344 | Ga0207428_100643443 | 139 |
| 628 | 3300027907 | Ga0207428_10489767 | Ga0207428_104897672 | 139 |
| 629 | 3300027907 | Ga0207428_10560449 | Ga0207428_105604492 | 139 |
| 630 | 3300027907 | Ga0207428_10580101 | Ga0207428_105801011 | 139 |
| 631 | 3300028380 | Ga0268265_12522392 | Ga0268265_125223921 | 139 |
| 632 | 3300028381 | Ga0268264_10371931 | Ga0268264_103719312 | 139 |
| 633 | 3300028381 | Ga0268264_10468765 | Ga0268264_104687652 | 139 |
| 634 | 3300031548 | Ga0307408_100203358 | Ga0307408_1002033581 | 139 |
| 635 | 3300031548 | Ga0307408_101005343 | Ga0307408_1010053432 | 139 |
| 636 | 3300031548 | Ga0307408_102376551 | Ga0307408_1023765511 | 139 |
| 637 | 3300031665 | Ga0316575_10039497 | Ga0316575_100394972 | 139 |
| 638 | 3300031691 | Ga0316579_10034002 | Ga0316579_100340023 | 139 |
| 639 | 3300031728 | Ga0316578_10045634 | Ga0316578_100456342 | 139 |
| 640 | 3300031731 | Ga0307405_10105944 | Ga0307405_101059442 | 139 |
| 641 | 3300031731 | Ga0307405_11858490 | Ga0307405_118584901 | 139 |
| 642 | 3300031733 | Ga0316577_10011008 | Ga0316577_100110085 | 139 |
| 643 | 3300031824 | Ga0307413_11022810 | Ga0307413_110228102 | 139 |
| 644 | 3300031852 | Ga0307410_10129466 | Ga0307410_101294662 | 139 |
| 645 | 3300031852 | Ga0307410_10218813 | Ga0307410_102188132 | 139 |
| 646 | 3300031852 | Ga0307410_10299039 | Ga0307410_102990391 | 139 |
| 647 | 3300031901 | Ga0307406_10071107 | Ga0307406_100711072 | 139 |
| 648 | 3300031901 | Ga0307406_10096765 | Ga0307406_100967651 | 139 |
| 649 | 3300031901 | Ga0307406_10179602 | Ga0307406_101796023 | 139 |
| 650 | 3300031901 | Ga0307406_10326082 | Ga0307406_103260822 | 139 |
| 651 | 3300031901 | Ga0307406_10574233 | Ga0307406_105742332 | 139 |
| 652 | 3300031903 | Ga0307407_10087221 | Ga0307407_100872212 | 139 |
| 653 | 3300031903 | Ga0307407_10258911 | Ga0307407_102589112 | 139 |
| 654 | 3300031903 | Ga0307407_10449929 | Ga0307407_104499292 | 139 |
| 655 | 3300031903 | Ga0307407_10953362 | Ga0307407_109533621 | 139 |
| 656 | 3300031911 | Ga0307412_10349085 | Ga0307412_103490852 | 139 |
| 657 | 3300031911 | Ga0307412_11244143 | Ga0307412_112441431 | 139 |
| 658 | 3300031995 | Ga0307409_100061030 | Ga0307409_1000610301 | 139 |
| 659 | 3300031995 | Ga0307409_100805285 | Ga0307409_1008052852 | 139 |
| 660 | 3300031995 | Ga0307409_101284014 | Ga0307409_1012840141 | 139 |
| 661 | 3300032002 | Ga0307416_100005048 | Ga0307416_1000050489 | 139 |
| 662 | 3300032002 | Ga0307416_100351876 | Ga0307416_1003518763 | 139 |
| 663 | 3300032002 | Ga0307416_101184855 | Ga0307416_1011848552 | 139 |
| 664 | 3300032005 | Ga0307411_10133181 | Ga0307411_101331813 | 139 |
| 665 | 3300032005 | Ga0307411_10697593 | Ga0307411_106975932 | 139 |
| 666 | 3300032126 | Ga0307415_100003774 | Ga0307415_1000037743 | 139 |
| 667 | 3300032126 | Ga0307415_100254358 | Ga0307415_1002543582 | 139 |
| 668 | 3300032126 | Ga0307415_100271791 | Ga0307415_1002717911 | 139 |
| 669 | 3300032126 | Ga0307415_100675805 | Ga0307415_1006758052 | 139 |
| 670 | 3300032126 | Ga0307415_100981448 | Ga0307415_1009814482 | 139 |
| 671 | 3300032133 | Ga0316583_10096512 | Ga0316583_100965122 | 139 |
| 672 | 3300032137 | Ga0316585_10033830 | Ga0316585_100338302 | 139 |
| 673 | 3300032139 | Ga0316580_10003048 | Ga0316580_100030485 | 139 |
| 674 | 3300034816 | Ga0373930_0028490 | Ga0373930_0028490_241_663 | 139 |
| 675 | 3300034819 | Ga0373958_0063457 | Ga0373958_0063457_63_491 | 139 |
| 676 | 3300034957 | Ga0373938_0017421 | Ga0373938_0017421_954_1382 | 139 |
| 677 | 3300035084 | Ga0373928_0009209 | Ga0373928_0009209_420_842 | 139 |
| 678 | 3300035084 | Ga0373928_0020131 | Ga0373928_0020131_822_1250 | 139 |
| 679 | 3300035088 | Ga0373940_0009586 | Ga0373940_0009586_1102_1524 | 139 |
| 680 | 3300035090 | Ga0373949_0005837 | Ga0373949_0005837_1909_2337 | 139 |
| 681 | 3300035090 | Ga0373949_0017956 | Ga0373949_0017956_401_823 | 139 |
| 682 | 3300035091 | Ga0373951_0001215 | Ga0373951_0001215_2596_3024 | 139 |
| 683 | 3300035091 | Ga0373951_0094636 | Ga0373951_0094636_113_535 | 139 |
| 684 | 3300035092 | Ga0373952_0011729 | Ga0373952_0011729_706_1128 | 139 |
| 685 | 3300035092 | Ga0373952_0044120 | Ga0373952_0044120_141_569 | 139 |
| 686 | 3300035112 | Ga0373932_0037699 | Ga0373932_0037699_922_1344 | 139 |
| 687 | 3300035112 | Ga0373932_0185023 | Ga0373932_0185023_47_475 | 139 |
| 688 | 3300035115 | Ga0373941_0012534 | Ga0373941_0012534_72_494 | 139 |
| 689 | 3300035115 | Ga0373941_0020385 | Ga0373941_0020385_174_602 | 139 |
| 690 | 3300035121 | Ga0373960_0022869 | Ga0373960_0022869_852_1274 | 139 |
| 691 | 3300035241 | Ga0373961_0022802 | Ga0373961_0022802_1161_1583 | 139 |
| 692 | 3300035241 | Ga0373961_0030109 | Ga0373961_0030109_660_1091 | 139 |
| 693 | 3300035241 | Ga0373961_0059451 | Ga0373961_0059451_710_1138 | 139 |
| 694 | 3300035242 | Ga0373962_0005923 | Ga0373962_0005923_1368_1790 | 139 |
| 695 | 3300035242 | Ga0373962_0008566 | Ga0373962_0008566_1920_2348 | 139 |
| 696 | 3300035398 | Ga0316574_0031022 | Ga0316574_0031022_946_1371 | 139 |
| 697 | 3300035691 | Ga0373931_0007664 | Ga0373931_0007664_2371_2793 | 139 |
| 698 | 3300035691 | Ga0373931_0018020 | Ga0373931_0018020_90_518 | 139 |
| 699 | 3300036647 | Ga0316582_0001763 | Ga0316582_0001763_4778_5203 | 139 |
| 700 | 3300036712 | Ga0316584_0003336 | Ga0316584_0003336_5750_6175 | 139 |
| 701 | 3300037312 | Ga0395899_0005234 | Ga0395899_0005234_6310_6738 | 139 |
| 702 | 3300037312 | Ga0395899_0044539 | Ga0395899_0044539_1122_1553 | 139 |
| 703 | 3300037312 | Ga0395899_0259225 | Ga0395899_0259225_420_848 | 139 |
| 704 | 3300037418 | Ga0395900_0028444 | Ga0395900_0028444_2965_3393 | 139 |
| 705 | 3300037418 | Ga0395900_0108875 | Ga0395900_0108875_1378_1806 | 139 |
| 706 | 3300037418 | Ga0395900_0143644 | Ga0395900_0143644_1915_2346 | 139 |
| 707 | 3300037418 | Ga0395900_0455341 | Ga0395900_0455341_583_1011 | 139 |
| 708 | 3300037418 | Ga0395900_0656347 | Ga0395900_0656347_85_510 | 139 |
| 709 | 3300037418 | Ga0395900_1134867 | Ga0395900_1134867_214_642 | 139 |
| 710 | 3300037466 | Ga0395898_0002122 | Ga0395898_0002122_16265_16693 | 139 |
| 711 | 3300037466 | Ga0395898_0051456 | Ga0395898_0051456_3256_3684 | 139 |
| 712 | 3300037466 | Ga0395898_0056060 | Ga0395898_0056060_3170_3595 | 139 |
| 713 | 3300037466 | Ga0395898_0117207 | Ga0395898_0117207_999_1430 | 139 |
| 714 | 3300037466 | Ga0395898_0396966 | Ga0395898_0396966_643_1071 | 139 |
| 715 | 3300037471 | Ga0395905_0014338 | Ga0395905_0014338_3286_3714 | 139 |
| 716 | 3300037471 | Ga0395905_0018000 | Ga0395905_0018000_5677_6108 | 139 |
| 717 | 3300037471 | Ga0395905_0039441 | Ga0395905_0039441_2809_3237 | 139 |
| 718 | 3300037471 | Ga0395905_1025689 | Ga0395905_1025689_253_681 | 139 |
| 719 | 3300037588 | Ga0316581_0091007 | Ga0316581_0091007_89_514 | 139 |
| 720 | 3300037853 | Ga0436364_0294314 | Ga0436364_0294314_3272_3700 | 139 |
| 721 | 3300037853 | Ga0436364_0474541 | Ga0436364_0474541_157_591 | 139 |
| 722 | 3300037853 | Ga0436364_0648428 | Ga0436364_0648428_8831_9259 | 139 |
| 723 | 3300037853 | Ga0436364_0914577 | Ga0436364_0914577_818_1246 | 139 |
| 724 | 3300037853 | Ga0436364_1093687 | Ga0436364_1093687_1041_1469 | 139 |
| 725 | 3300038443 | Ga0395901_0003904 | Ga0395901_0003904_2198_2626 | 139 |
| 726 | 3300038443 | Ga0395901_0011202 | Ga0395901_0011202_41_466 | 139 |
| 727 | 3300038443 | Ga0395901_0018541 | Ga0395901_0018541_4308_4736 | 139 |
| 728 | 3300038443 | Ga0395901_0175644 | Ga0395901_0175644_1431_1859 | 139 |
| 729 | 3300038443 | Ga0395901_0223750 | Ga0395901_0223750_77_505 | 139 |
| 730 | 3300038443 | Ga0395901_0282958 | Ga0395901_0282958_994_1425 | 139 |
| 731 | 3300038443 | Ga0395901_1462651 | Ga0395901_1462651_178_606 | 139 |
| 732 | 3300039437 | Ga0436365_1685267 | Ga0436365_1685267_586_1014 | 139 |
| 733 | 3300039437 | Ga0436365_1737094 | Ga0436365_1737094_3990_4424 | 139 |
| 734 | 3300039437 | Ga0436365_1837010 | Ga0436365_1837010_7070_7498 | 139 |
| 735 | 3300039437 | Ga0436365_1935346 | Ga0436365_1935346_740_1168 | 139 |
| 736 | 3300039450 | Ga0436363_0425661 | Ga0436363_0425661_1919_2347 | 139 |
| 737 | 3300039450 | Ga0436363_0508323 | Ga0436363_0508323_282_710 | 139 |
| 738 | 3300039450 | Ga0436363_0548952 | Ga0436363_0548952_3558_3986 | 139 |
| 739 | 3300039450 | Ga0436363_0582583 | Ga0436363_0582583_341_769 | 139 |
| 740 | 3300039450 | Ga0436363_1224953 | Ga0436363_1224953_621_1049 | 139 |
| 741 | 3300039450 | Ga0436363_1227349 | Ga0436363_1227349_1652_2080 | 139 |
| 742 | 3300039450 | Ga0436363_1526926 | Ga0436363_1526926_664_1092 | 139 |
| 743 | 3300039453 | Ga0436362_0105352 | Ga0436362_0105352_1376_1810 | 139 |
| 744 | 3300039453 | Ga0436362_0417099 | Ga0436362_0417099_317_745 | 139 |
| 745 | 3300039453 | Ga0436362_0453746 | Ga0436362_0453746_30_458 | 139 |
| 746 | 3300039453 | Ga0436362_0677777 | Ga0436362_0677777_460_888 | 139 |
| 747 | 3300041503 | Ga0451847_0966993 | Ga0451847_0966993_87_515 | 139 |
| 748 | 3300041512 | Ga0451853_3052387 | Ga0451853_3052387_213_644 | 139 |
| 749 | 3300044684 | Ga0466966_0190198 | Ga0466966_0190198_292_720 | 139 |
| 750 | 3300044684 | Ga0466966_0305458 | Ga0466966_0305458_235_669 | 139 |
| 751 | 3300044694 | Ga0466963_0382562 | Ga0466963_0382562_33_461 | 139 |
| 752 | 3300044706 | Ga0466964_0563794 | Ga0466964_0563794_55_483 | 139 |
| 753 | 3300044719 | Ga0466971_0129877 | Ga0466971_0129877_147_575 | 139 |
| 754 | 3300044735 | Ga0466968_0186668 | Ga0466968_0186668_457_885 | 139 |
| 755 | 3300044765 | Ga0466970_0431974 | Ga0466970_0431974_273_701 | 139 |
| 756 | 3300044842 | Ga0466957_0173590 | Ga0466957_0173590_525_953 | 139 |
| 757 | 3300044901 | Ga0466960_0583923 | Ga0466960_0583923_206_637 | 139 |
| 758 | 3300045976 | Ga0466967_0039980 | Ga0466967_0039980_652_1080 | 139 |
| 759 | 3300045976 | Ga0466967_0064780 | Ga0466967_0064780_954_1382 | 139 |
| 760 | 3300045976 | Ga0466967_0733819 | Ga0466967_0733819_162_590 | 139 |
| 761 | 3300045976 | Ga0466967_0987569 | Ga0466967_0987569_360_788 | 139 |
| 762 | 3300046454 | Ga0495592_0391808 | Ga0495592_0391808_211_639 | 139 |
| 763 | 3300046459 | Ga0495629_0150571 | Ga0495629_0150571_873_1301 | 139 |
| 764 | 3300046461 | Ga0495641_0043173 | Ga0495641_0043173_113_547 | 139 |
| 765 | 3300046462 | Ga0495651_0357113 | Ga0495651_0357113_460_885 | 139 |
| 766 | 3300046511 | Ga0495608_0377856 | Ga0495608_0377856_53_481 | 139 |
| 767 | 3300046511 | Ga0495608_0866219 | Ga0495608_0866219_30_461 | 139 |
| 768 | 3300046517 | Ga0495630_0034398 | Ga0495630_0034398_2841_3269 | 139 |
| 769 | 3300046517 | Ga0495630_0154488 | Ga0495630_0154488_314_745 | 139 |
| 770 | 3300046525 | Ga0495663_0031588 | Ga0495663_0031588_667_1095 | 139 |
| 771 | 3300046525 | Ga0495663_0201365 | Ga0495663_0201365_227_658 | 139 |
| 772 | 3300046528 | Ga0495642_0068526 | Ga0495642_0068526_290_718 | 139 |
| 773 | 3300046529 | Ga0495652_0805147 | Ga0495652_0805147_142_573 | 139 |
| 774 | 3300046531 | Ga0495665_0222202 | Ga0495665_0222202_507_935 | 139 |
| 775 | 3300046535 | Ga0495586_0005249 | Ga0495586_0005249_4579_5007 | 139 |
| 776 | 3300046615 | Ga0495656_0354407 | Ga0495656_0354407_308_730 | 139 |
| 777 | 3300046616 | Ga0495668_0635748 | Ga0495668_0635748_134_562 | 139 |
| 778 | 3300046642 | Ga0495634_0034600 | Ga0495634_0034600_268_696 | 139 |
| 779 | 3300046642 | Ga0495634_0040347 | Ga0495634_0040347_2374_2805 | 139 |
| 780 | 3300046683 | Ga0495658_0291760 | Ga0495658_0291760_11_433 | 139 |
| 781 | 3300046683 | Ga0495658_0416370 | Ga0495658_0416370_414_836 | 139 |
| 782 | 3300046689 | Ga0495613_0037674 | Ga0495613_0037674_2057_2485 | 139 |
| 783 | 3300046690 | Ga0495624_0102063 | Ga0495624_0102063_715_1137 | 139 |
| 784 | 3300047319 | Ga0495674_0033720 | Ga0495674_0033720_2998_3426 | 139 |
| 785 | 3300047319 | Ga0495674_0252195 | Ga0495674_0252195_815_1246 | 139 |
| 786 | 3300047319 | Ga0495674_0725982 | Ga0495674_0725982_273_701 | 139 |
| 787 | 3300047321 | Ga0495676_0646898 | Ga0495676_0646898_61_489 | 139 |
| 788 | 3300047321 | Ga0495676_0821062 | Ga0495676_0821062_134_562 | 139 |
| 789 | 3300047322 | Ga0495680_0647797 | Ga0495680_0647797_143_571 | 139 |
| 790 | 3300047673 | Ga0495593_0499949 | Ga0495593_0499949_32_466 | 139 |
| 791 | 3300048903 | Ga0496100_0042568 | Ga0496100_0042568_904_1332 | 139 |
| 792 | 3300048903 | Ga0496100_0080228 | Ga0496100_0080228_46_474 | 139 |
| 793 | 3300048903 | Ga0496100_0432692 | Ga0496100_0432692_472_894 | 139 |
| 794 | 3300048904 | Ga0496101_0005933 | Ga0496101_0005933_50_478 | 139 |
| 795 | 3300048904 | Ga0496101_0141285 | Ga0496101_0141285_1188_1610 | 139 |
| 796 | 3300048905 | Ga0496102_0205350 | Ga0496102_0205350_836_1258 | 139 |
| 797 | 3300048905 | Ga0496102_0329515 | Ga0496102_0329515_105_536 | 139 |
| 798 | 3300048905 | Ga0496102_0579830 | Ga0496102_0579830_36_464 | 139 |
| 799 | 3300048905 | Ga0496102_1811239 | Ga0496102_1811239_87_515 | 139 |
| 800 | 3300048906 | Ga0496103_0201261 | Ga0496103_0201261_359_790 | 139 |
| 801 | 3300048906 | Ga0496103_0406440 | Ga0496103_0406440_370_798 | 139 |
| 802 | 3300048907 | Ga0496104_0088482 | Ga0496104_0088482_421_843 | 139 |
| 803 | 3300048907 | Ga0496104_0189414 | Ga0496104_0189414_752_1180 | 139 |
| 804 | 3300048907 | Ga0496104_0760045 | Ga0496104_0760045_39_467 | 139 |
| 805 | 3300048908 | Ga0496105_0017290 | Ga0496105_0017290_1351_1773 | 139 |
| 806 | 3300048908 | Ga0496105_0120596 | Ga0496105_0120596_816_1244 | 139 |
| 807 | 3300048909 | Ga0496106_0055456 | Ga0496106_0055456_635_1057 | 139 |
| 808 | 3300048909 | Ga0496106_0074836 | Ga0496106_0074836_967_1395 | 139 |
| 809 | 3300048909 | Ga0496106_0120148 | Ga0496106_0120148_222_650 | 139 |
| 810 | 3300048909 | Ga0496106_0170226 | Ga0496106_0170226_303_734 | 139 |
| 811 | 3300048909 | Ga0496106_0384634 | Ga0496106_0384634_175_603 | 139 |
| 812 | 3300048909 | Ga0496106_1504486 | Ga0496106_1504486_41_472 | 139 |
| 813 | 3300048910 | Ga0496107_0001404 | Ga0496107_0001404_10431_10859 | 139 |
| 814 | 3300048910 | Ga0496107_0336749 | Ga0496107_0336749_29_457 | 139 |
| 815 | 3300048911 | Ga0496108_0150278 | Ga0496108_0150278_1208_1630 | 139 |
| 816 | 3300048911 | Ga0496108_0402559 | Ga0496108_0402559_604_1032 | 139 |
| 817 | 3300048912 | Ga0496109_0049019 | Ga0496109_0049019_2724_3152 | 139 |
| 818 | 3300048912 | Ga0496109_0296704 | Ga0496109_0296704_407_841 | 139 |
| 819 | 3300048913 | Ga0496110_0014477 | Ga0496110_0014477_3128_3550 | 139 |
| 820 | 3300048913 | Ga0496110_0092653 | Ga0496110_0092653_1188_1616 | 139 |
| 821 | 3300048913 | Ga0496110_0423954 | Ga0496110_0423954_92_520 | 139 |
| 822 | 3300048913 | Ga0496110_0631529 | Ga0496110_0631529_253_687 | 139 |
| 823 | 3300048913 | Ga0496110_1162168 | Ga0496110_1162168_125_553 | 139 |
| 824 | 3300048914 | Ga0496111_0045429 | Ga0496111_0045429_651_1073 | 139 |
| 825 | 3300048914 | Ga0496111_0406305 | Ga0496111_0406305_289_720 | 139 |
| 826 | 3300048914 | Ga0496111_0701046 | Ga0496111_0701046_111_539 | 139 |
| 827 | 3300048915 | Ga0496112_0002387 | Ga0496112_0002387_13551_13979 | 139 |
| 828 | 3300048915 | Ga0496112_0049744 | Ga0496112_0049744_934_1356 | 139 |
| 829 | 3300048915 | Ga0496112_0947823 | Ga0496112_0947823_41_469 | 139 |
| 830 | 3300048916 | Ga0496113_0009663 | Ga0496113_0009663_1738_2166 | 139 |
| 831 | 3300048916 | Ga0496113_0245309 | Ga0496113_0245309_538_960 | 139 |
| 832 | 3300048916 | Ga0496113_0450781 | Ga0496113_0450781_576_1004 | 139 |
| 833 | 3300048917 | Ga0496114_0042230 | Ga0496114_0042230_3007_3429 | 139 |
| 834 | 3300048917 | Ga0496114_0079435 | Ga0496114_0079435_2301_2729 | 139 |
| 835 | 3300048917 | Ga0496114_0121422 | Ga0496114_0121422_191_625 | 139 |
| 836 | 3300048917 | Ga0496114_0341453 | Ga0496114_0341453_238_672 | 139 |
| 837 | 3300048917 | Ga0496114_0458920 | Ga0496114_0458920_417_848 | 139 |
| 838 | 3300048918 | Ga0496115_0022365 | Ga0496115_0022365_2381_2803 | 139 |
| 839 | 3300048918 | Ga0496115_0175981 | Ga0496115_0175981_1314_1742 | 139 |
| 840 | 3300049568 | Ga0501031_0123449 | Ga0501031_0123449_41_472 | 139 |
| 841 | 3300049568 | Ga0501031_0137907 | Ga0501031_0137907_888_1316 | 139 |
| 842 | 3300049568 | Ga0501031_0151920 | Ga0501031_0151920_444_875 | 139 |
| 843 | 3300049568 | Ga0501031_0860493 | Ga0501031_0860493_15_449 | 139 |
| 844 | 3300049569 | Ga0501032_0110255 | Ga0501032_0110255_702_1133 | 139 |
| 845 | 3300049570 | Ga0501033_0566997 | Ga0501033_0566997_333_764 | 139 |
| 846 | 3300049572 | Ga0501036_0096010 | Ga0501036_0096010_283_714 | 139 |
| 847 | 3300049572 | Ga0501036_0721948 | Ga0501036_0721948_331_756 | 139 |
| 848 | 3300049572 | Ga0501036_0945355 | Ga0501036_0945355_149_580 | 139 |
| 849 | 3300049574 | Ga0501038_0266755 | Ga0501038_0266755_436_867 | 139 |
| 850 | 3300049574 | Ga0501038_0275395 | Ga0501038_0275395_532_957 | 139 |
| 851 | 3300049575 | Ga0501039_0066495 | Ga0501039_0066495_19_450 | 139 |
| 852 | 3300049575 | Ga0501039_0113816 | Ga0501039_0113816_1036_1467 | 139 |
| 853 | 3300049575 | Ga0501039_0117549 | Ga0501039_0117549_1590_2021 | 139 |
| 854 | 3300049575 | Ga0501039_0397987 | Ga0501039_0397987_227_652 | 139 |
| 855 | 3300049576 | Ga0501040_0193015 | Ga0501040_0193015_423_854 | 139 |
| 856 | 3300049576 | Ga0501040_0216483 | Ga0501040_0216483_711_1136 | 139 |
| 857 | 3300049577 | Ga0501041_0074856 | Ga0501041_0074856_1322_1753 | 139 |
| 858 | 3300049577 | Ga0501041_0097444 | Ga0501041_0097444_252_683 | 139 |
| 859 | 3300049577 | Ga0501041_0264073 | Ga0501041_0264073_594_1022 | 139 |
| 860 | 3300049578 | Ga0501042_0005727 | Ga0501042_0005727_4166_4597 | 139 |
| 861 | 3300049579 | Ga0501043_0189747 | Ga0501043_0189747_562_993 | 139 |
| 862 | 3300049582 | Ga0501048_0026899 | Ga0501048_0026899_523_954 | 139 |
| 863 | 3300049582 | Ga0501048_0135923 | Ga0501048_0135923_104_535 | 139 |
| 864 | 3300049582 | Ga0501048_0168593 | Ga0501048_0168593_179_607 | 139 |
| 865 | 3300049583 | Ga0501067_0093129 | Ga0501067_0093129_304_735 | 139 |
| 866 | 3300049584 | Ga0501068_0262277 | Ga0501068_0262277_156_584 | 139 |
| 867 | 3300049584 | Ga0501068_0611954 | Ga0501068_0611954_255_686 | 139 |
| 868 | 3300049584 | Ga0501068_0964927 | Ga0501068_0964927_80_508 | 139 |
| 869 | 3300049585 | Ga0501069_0069661 | Ga0501069_0069661_767_1198 | 139 |
| 870 | 3300049587 | Ga0501071_0021891 | Ga0501071_0021891_3330_3761 | 139 |
| 871 | 3300049587 | Ga0501071_0053460 | Ga0501071_0053460_1067_1498 | 139 |
| 872 | 3300049587 | Ga0501071_0070893 | Ga0501071_0070893_1864_2289 | 139 |
| 873 | 3300049587 | Ga0501071_0230683 | Ga0501071_0230683_924_1352 | 139 |
| 874 | 3300049587 | Ga0501071_0836806 | Ga0501071_0836806_55_486 | 139 |
| 875 | 3300049588 | Ga0501072_0097560 | Ga0501072_0097560_1141_1572 | 139 |
| 876 | 3300049588 | Ga0501072_1045610 | Ga0501072_1045610_55_486 | 139 |
| 877 | 3300049589 | Ga0501073_0260436 | Ga0501073_0260436_738_1169 | 139 |
| 878 | 3300049590 | Ga0501074_0244437 | Ga0501074_0244437_104_535 | 139 |
| 879 | 3300049591 | Ga0501075_0016548 | Ga0501075_0016548_1985_2416 | 139 |
| 880 | 3300049591 | Ga0501075_0155262 | Ga0501075_0155262_828_1256 | 139 |
| 881 | 3300049591 | Ga0501075_0161603 | Ga0501075_0161603_800_1231 | 139 |
| 882 | 3300049591 | Ga0501075_0242516 | Ga0501075_0242516_71_499 | 139 |
| 883 | 3300049592 | Ga0501076_0224520 | Ga0501076_0224520_331_756 | 139 |
| 884 | 3300049592 | Ga0501076_0354302 | Ga0501076_0354302_170_601 | 139 |
| 885 | 3300049592 | Ga0501076_0723694 | Ga0501076_0723694_76_507 | 139 |
| 886 | 3300049593 | Ga0501077_0126880 | Ga0501077_0126880_679_1110 | 139 |
| 887 | 3300049593 | Ga0501077_0412975 | Ga0501077_0412975_416_841 | 139 |
| 888 | 3300049741 | Ga0501079_0166751 | Ga0501079_0166751_389_814 | 139 |
| 889 | 3300049741 | Ga0501079_0319978 | Ga0501079_0319978_321_752 | 139 |
| 890 | 3300049742 | Ga0501080_0155468 | Ga0501080_0155468_598_1029 | 139 |
| 891 | 3300049743 | Ga0501081_0017956 | Ga0501081_0017956_3048_3476 | 139 |
| 892 | 3300049743 | Ga0501081_0201203 | Ga0501081_0201203_440_871 | 139 |
| 893 | 3300049743 | Ga0501081_0502458 | Ga0501081_0502458_16_447 | 139 |
| 894 | 3300049743 | Ga0501081_1366133 | Ga0501081_1366133_88_513 | 139 |
| 895 | 3300049744 | Ga0501083_1144332 | Ga0501083_1144332_36_461 | 139 |
| 896 | 3300049822 | Ga0501035_0307264 | Ga0501035_0307264_275_700 | 139 |
| 897 | 3300049822 | Ga0501035_0328002 | Ga0501035_0328002_82_513 | 139 |
| 898 | 3300049822 | Ga0501035_0859177 | Ga0501035_0859177_24_455 | 139 |
| 899 | 3300049824 | Ga0501045_0035562 | Ga0501045_0035562_1284_1712 | 139 |
| 900 | 3300049824 | Ga0501045_0191916 | Ga0501045_0191916_976_1407 | 139 |
| 901 | 3300050490 | nmdc:mga03n38_948547_c1 | nmdc:mga03n38_948547_c1_32_457 | 139 |
| 902 | 3300050492 | nmdc:mga0yw44_15003_c1 | nmdc:mga0yw44_15003_c1_1342_1770 | 139 |
| 903 | 3300050492 | nmdc:mga0yw44_71939_c1 | nmdc:mga0yw44_71939_c1_475_903 | 139 |
| 904 | 3300050507 | nmdc:mga05p37_1051843_c1 | nmdc:mga05p37_1051843_c1_401_829 | 139 |
| 905 | 3300050507 | nmdc:mga05p37_167370_c1 | nmdc:mga05p37_167370_c1_171_596 | 139 |
| 906 | 3300050507 | nmdc:mga05p37_221507_c1 | nmdc:mga05p37_221507_c1_669_1097 | 139 |
| 907 | 3300050507 | nmdc:mga05p37_478075_c1 | nmdc:mga05p37_478075_c1_292_720 | 139 |
| 908 | 3300050507 | nmdc:mga05p37_589934_c1 | nmdc:mga05p37_589934_c1_568_1014 | 139 |
| 909 | 3300050507 | nmdc:mga05p37_624888_c1 | nmdc:mga05p37_624888_c1_486_914 | 139 |
| 910 | 3300050507 | nmdc:mga05p37_720290_c1 | nmdc:mga05p37_720290_c1_479_910 | 139 |
| 911 | 3300050508 | nmdc:mga09592_12330_c1 | nmdc:mga09592_12330_c1_4373_4801 | 139 |
| 912 | 3300050509 | nmdc:mga0qj67_1126029_c1 | nmdc:mga0qj67_1126029_c1_140_571 | 139 |
| 913 | 3300050509 | nmdc:mga0qj67_144767_c1 | nmdc:mga0qj67_144767_c1_482_910 | 139 |
| 914 | 3300050509 | nmdc:mga0qj67_217_c1 | nmdc:mga0qj67_217_c1_14474_14902 | 139 |
| 915 | 3300050510 | nmdc:mga06r32_1054043_c1 | nmdc:mga06r32_1054043_c1_17_445 | 139 |
| 916 | 3300050510 | nmdc:mga06r32_179012_c1 | nmdc:mga06r32_179012_c1_1533_1967 | 139 |
| 917 | 3300050510 | nmdc:mga06r32_663_c1 | nmdc:mga06r32_663_c1_15143_15571 | 139 |
| 918 | 3300050510 | nmdc:mga06r32_86831_c1 | nmdc:mga06r32_86831_c1_2188_2613 | 139 |
| 919 | 3300050511 | nmdc:mga08y16_23659_c1 | nmdc:mga08y16_23659_c1_2081_2506 | 139 |
| 920 | 3300050511 | nmdc:mga08y16_700307_c1 | nmdc:mga08y16_700307_c1_173_595 | 139 |
| 921 | 3300050512 | nmdc:mga0n895_493823_c1 | nmdc:mga0n895_493823_c1_525_953 | 139 |
| 922 | 3300050512 | nmdc:mga0n895_72056_c1 | nmdc:mga0n895_72056_c1_2104_2529 | 139 |
| 923 | 3300050512 | nmdc:mga0n895_74803_c1 | nmdc:mga0n895_74803_c1_1384_1806 | 139 |
| 924 | 3300050512 | nmdc:mga0n895_850388_c1 | nmdc:mga0n895_850388_c1_445_876 | 139 |
| 925 | 3300050512 | nmdc:mga0n895_85184_c1 | nmdc:mga0n895_85184_c1_1063_1491 | 139 |
| 926 | 3300050513 | nmdc:mga0rr50_28153_c1 | nmdc:mga0rr50_28153_c1_2425_2853 | 139 |
| 927 | 3300050513 | nmdc:mga0rr50_311382_c1 | nmdc:mga0rr50_311382_c1_790_1218 | 139 |
| 928 | 3300050514 | nmdc:mga08x19_37117_c1 | nmdc:mga08x19_37117_c1_246_674 | 139 |
| 929 | 3300050514 | nmdc:mga08x19_52241_c2 | nmdc:mga08x19_52241_c2_191_613 | 139 |
| 930 | 3300050515 | nmdc:mga0a205_133071_c1 | nmdc:mga0a205_133071_c1_1135_1560 | 139 |
| 931 | 3300050515 | nmdc:mga0a205_142625_c1 | nmdc:mga0a205_142625_c1_1471_1899 | 139 |
| 932 | 3300050515 | nmdc:mga0a205_5874_c1 | nmdc:mga0a205_5874_c1_6774_7202 | 139 |
| 933 | 3300050515 | nmdc:mga0a205_667237_c1 | nmdc:mga0a205_667237_c1_296_724 | 139 |
| 934 | 3300053077 | Ga0495601_0218446 | Ga0495601_0218446_317_745 | 139 |
| 935 | 3300053084 | Ga0495595_0260679 | Ga0495595_0260679_340_774 | 139 |
| 936 | 3300054114 | Ga0501084_0054244 | Ga0501084_0054244_1297_1728 | 139 |
| 937 | 3300054114 | Ga0501084_0058728 | Ga0501084_0058728_991_1419 | 139 |
| 938 | 3300054114 | Ga0501084_0425627 | Ga0501084_0425627_639_1070 | 139 |
| 939 | 3300059426 | Ga0590077_172427 | Ga0590077_172427_77_508 | 139 |
| 940 | 3300060353 | Ga0501082_0041155 | Ga0501082_0041155_778_1209 | 139 |
| 941 | 3300060353 | Ga0501082_0090239 | Ga0501082_0090239_1887_2318 | 139 |
| 942 | 3300060353 | Ga0501082_0257460 | Ga0501082_0257460_52_477 | 139 |
| 943 | 3300060353 | Ga0501082_0454712 | Ga0501082_0454712_517_945 | 139 |
| 944 | 3300061734 | Ga0530510_0008481 | Ga0530510_0008481_1084_1515 | 139 |
| 945 | 3300061734 | Ga0530510_0123967 | Ga0530510_0123967_1151_1582 | 139 |
| 946 | 3300001904 | JGI24736J21556_1041088 | JGI24736J21556_10410882 | 140 |
| 947 | 3300005327 | Ga0070658_10037074 | Ga0070658_100370744 | 140 |
| 948 | 3300005329 | Ga0070683_101010823 | Ga0070683_1010108232 | 140 |
| 949 | 3300005548 | Ga0070665_100062446 | Ga0070665_1000624464 | 140 |
| 950 | 3300005563 | Ga0068855_100001116 | Ga0068855_10000111610 | 140 |
| 951 | 3300005578 | Ga0068854_100001227 | Ga0068854_1000012278 | 140 |
| 952 | 3300005614 | Ga0068856_100010650 | Ga0068856_1000106503 | 140 |
| 953 | 3300005616 | Ga0068852_100006167 | Ga0068852_1000061674 | 140 |
| 954 | 3300009093 | Ga0105240_10044418 | Ga0105240_100444186 | 140 |
| 955 | 3300009174 | Ga0105241_10000679 | Ga0105241_1000067923 | 140 |
| 956 | 3300009545 | Ga0105237_10021862 | Ga0105237_100218626 | 140 |
| 957 | 3300009551 | Ga0105238_10007746 | Ga0105238_100077462 | 140 |
| 958 | 3300010375 | Ga0105239_10083208 | Ga0105239_100832083 | 140 |
| 959 | 3300013105 | Ga0157369_11308463 | Ga0157369_113084631 | 140 |
| 960 | 3300013296 | Ga0157374_10029322 | Ga0157374_100293224 | 140 |
| 961 | 3300025904 | Ga0207647_10004931 | Ga0207647_100049319 | 140 |
| 962 | 3300025911 | Ga0207654_10002912 | Ga0207654_100029125 | 140 |
| 963 | 3300025913 | Ga0207695_10001784 | Ga0207695_100017843 | 140 |
| 964 | 3300025914 | Ga0207671_10000197 | Ga0207671_1000019710 | 140 |
| 965 | 3300025919 | Ga0207657_10350054 | Ga0207657_103500542 | 140 |
| 966 | 3300025924 | Ga0207694_10001211 | Ga0207694_1000121112 | 140 |
| 967 | 3300025949 | Ga0207667_10204827 | Ga0207667_102048272 | 140 |
| 968 | 3300026041 | Ga0207639_10088912 | Ga0207639_100889122 | 140 |
| 969 | 3300026078 | Ga0207702_10129722 | Ga0207702_101297222 | 140 |
| 970 | 3300026116 | Ga0207674_10590502 | Ga0207674_105905021 | 140 |
| 971 | 3300026116 | Ga0207674_11357181 | Ga0207674_113571811 | 140 |
| 972 | 3300026142 | Ga0207698_10916071 | Ga0207698_109160712 | 140 |
| 973 | 3300028379 | Ga0268266_10421124 | Ga0268266_104211242 | 140 |
| 974 | 3300044765 | Ga0466970_0050036 | Ga0466970_0050036_200_622 | 140 |
| 975 | 3300045049 | Ga0466959_0813471 | Ga0466959_0813471_47_469 | 140 |
| 976 | 3300045836 | Ga0466958_0342416 | Ga0466958_0342416_347_769 | 140 |
| 977 | 3300046454 | Ga0495592_0045230 | Ga0495592_0045230_1546_1968 | 140 |
| 978 | 3300046462 | Ga0495651_0069980 | Ga0495651_0069980_1630_2052 | 140 |
| 979 | 3300046516 | Ga0495628_0081217 | Ga0495628_0081217_678_1100 | 140 |
| 980 | 3300046529 | Ga0495652_0014337 | Ga0495652_0014337_1367_1789 | 140 |
| 981 | 3300046543 | Ga0495645_0089874 | Ga0495645_0089874_1241_1663 | 140 |
| 982 | 3300046675 | Ga0495657_0230042 | Ga0495657_0230042_521_943 | 140 |
| 983 | 3300046809 | Ga0495600_0012189 | Ga0495600_0012189_4095_4517 | 140 |
| 984 | 3300047315 | Ga0495581_0208110 | Ga0495581_0208110_423_845 | 140 |
| 985 | 3300047317 | Ga0495604_0336120 | Ga0495604_0336120_86_508 | 140 |
| 986 | 3300047319 | Ga0495674_0208861 | Ga0495674_0208861_383_805 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9367 | 2 | 135 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9334 | 1 | 137 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.926 | 1 | 134 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9202 | 1 | 137 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9095 | 2 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9198 | 85 | 135 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8869 | 85 | 135 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8695 | 85 | 137 | 3.30.720.110 |
| 4g6xA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8533 | 6 | 133 | 3.10.180.10 |
| 2kjzB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.828 | 85 | 137 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2SS95-F1-model_v4 | VOC family protein | 0.987 | 61 | 138 |
|
| AF-A0A538K6I0-F1-model_v4 | VOC family protein | 0.9822 | 1 | 137 |
|
| AF-A0A7Z0A2P2-F1-model_v4 | deleted | 0.9728 | 85 | 138 |
|
| AF-A0A1G7N9Q5-F1-model_v4 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein | 0.9726 | 85 | 137 |
GO:0051213
|
| AF-D6BDL2-F1-model_v4 | S-D-lactoylglutathione methylglyoxal lyase | 0.969 | 86 | 135 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar