F487518
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 986 | 346 | 986 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10018371|Ga0081538_100183716 |
| Length | 356 |
| Sequence | LLVAGAPPGRVPRGAYARGVRDEHGIQAEGLVREFKGGIRAVDGIRLEVRPGEIYGFLGPNGAGKSTTVHMLTTLLPPTAGTACVAGFDVARDGAKVRAAIGAALQEAALDPLLTGREHLRLQTALHGMPKAERRERTEALLERVGLTQAADRKVRTYSGGMKRRLDLALALVHEPSILFLDEPTTGLDPQSRNALWSEVARLSGDEGVTVFLTTQYLEEADVLADRVGIIDHGRIVAEGTPGALKAEIGRPSVEAVPCNSSERAAVAEVLRRFGRPVPGSPKGVTVRLDGGEEALADVVRALETEGLHLDHLQLHSPTLDDVFLAKTGRSLEGAAEEAESRPDAESEGEPEPLRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 155 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 156 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 157 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 158 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 194 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 343 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 344 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.43 |
| Nodule | 0 |
| Rhizoplane | 11.05 |
| Rhizosphere | 85.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10002731 | 3300003373 | Bacteria | 4198 |
| 2 | JGI25407J50210_10003431 | 3300003373 | Bacteria | 3791 |
| 3 | JGI25407J50210_10010599 | 3300003373 | Bacteria | 2347 |
| 4 | Ga0070658_10050495 | 3300005327 | Bacteria | 3371 |
| 5 | Ga0070658_10165550 | 3300005327 | Bacteria | 1856 |
| 6 | Ga0070683_100001714 | 3300005329 | Bacteria | 17052 |
| 7 | Ga0070683_100013143 | 3300005329 | Bacteria | 7208 |
| 8 | Ga0070683_100018473 | 3300005329 | Bacteria | 6176 |
| 9 | Ga0070683_100023359 | 3300005329 | Bacteria | 5530 |
| 10 | Ga0070683_100043303 | 3300005329 | Bacteria | 4149 |
| 11 | Ga0070683_100237672 | 3300005329 | Bacteria | 1732 |
| 12 | Ga0070690_100092170 | 3300005330 | Bacteria | 1998 |
| 13 | Ga0070690_100301662 | 3300005330 | Bacteria | 1149 |
| 14 | Ga0068869_100006717 | 3300005334 | Bacteria | 7312 |
| 15 | Ga0070680_100004037 | 3300005336 | Bacteria | 10977 |
| 16 | Ga0070680_100005608 | 3300005336 | Bacteria | 9506 |
| 17 | Ga0070680_100014559 | 3300005336 | Bacteria | 6152 |
| 18 | Ga0070680_100037693 | 3300005336 | Bacteria | 3907 |
| 19 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 20 | Ga0070682_100030235 | 3300005337 | Bacteria | 3268 |
| 21 | Ga0068868_100000095 | 3300005338 | Bacteria | 54537 |
| 22 | Ga0068868_100220158 | 3300005338 | Bacteria | 1589 |
| 23 | Ga0070660_100001494 | 3300005339 | Bacteria | 16003 |
| 24 | Ga0070660_100003867 | 3300005339 | Bacteria | 10339 |
| 25 | Ga0070660_100065384 | 3300005339 | Bacteria | 2830 |
| 26 | Ga0070660_100136777 | 3300005339 | Bacteria | 1963 |
| 27 | Ga0070660_100284427 | 3300005339 | Bacteria | 1353 |
| 28 | Ga0070660_100305580 | 3300005339 | Bacteria | 1305 |
| 29 | Ga0070689_100057873 | 3300005340 | Bacteria | 3010 |
| 30 | Ga0070691_10008984 | 3300005341 | Bacteria | 4572 |
| 31 | Ga0070691_10013863 | 3300005341 | Bacteria | 3699 |
| 32 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 33 | Ga0070661_100007123 | 3300005344 | Bacteria | 7712 |
| 34 | Ga0070661_100063455 | 3300005344 | Bacteria | 2713 |
| 35 | Ga0070661_100241349 | 3300005344 | Bacteria | 1392 |
| 36 | Ga0070675_100000058 | 3300005354 | Bacteria | 66874 |
| 37 | Ga0070675_100089174 | 3300005354 | Bacteria | 2582 |
| 38 | Ga0070674_100000020 | 3300005356 | Bacteria | 88217 |
| 39 | Ga0070674_100051096 | 3300005356 | Bacteria | 2848 |
| 40 | Ga0070674_100196524 | 3300005356 | Bacteria | 1555 |
| 41 | Ga0070673_100046800 | 3300005364 | Bacteria | 3362 |
| 42 | Ga0070688_100000333 | 3300005365 | Bacteria | 24059 |
| 43 | Ga0070688_100002793 | 3300005365 | Bacteria | 8872 |
| 44 | Ga0070688_100005500 | 3300005365 | Bacteria | 6680 |
| 45 | Ga0070688_100053154 | 3300005365 | Bacteria | 2533 |
| 46 | Ga0070659_100026115 | 3300005366 | Bacteria | 4492 |
| 47 | Ga0070659_100115029 | 3300005366 | Bacteria | 2174 |
| 48 | Ga0070667_100087275 | 3300005367 | Bacteria | 2677 |
| 49 | Ga0070709_10007649 | 3300005434 | Bacteria | 5931 |
| 50 | Ga0070710_10029625 | 3300005437 | Bacteria | 2938 |
| 51 | Ga0070711_100008345 | 3300005439 | Bacteria | 6342 |
| 52 | Ga0070711_100322332 | 3300005439 | Bacteria | 1235 |
| 53 | Ga0070700_100021145 | 3300005441 | Bacteria | 3779 |
| 54 | Ga0070708_100001181 | 3300005445 | Bacteria | 20099 |
| 55 | Ga0070663_100032323 | 3300005455 | Bacteria | 3606 |
| 56 | Ga0070678_100007594 | 3300005456 | Bacteria | 6440 |
| 57 | Ga0070678_100100238 | 3300005456 | Bacteria | 2243 |
| 58 | Ga0070662_100000363 | 3300005457 | Bacteria | 27116 |
| 59 | Ga0070681_10004636 | 3300005458 | Bacteria | 13126 |
| 60 | Ga0070681_10005901 | 3300005458 | Bacteria | 11857 |
| 61 | Ga0070681_10008977 | 3300005458 | Bacteria | 9830 |
| 62 | Ga0070681_10030842 | 3300005458 | Bacteria | 5381 |
| 63 | Ga0070681_10183635 | 3300005458 | Bacteria | 2012 |
| 64 | Ga0070685_10000293 | 3300005466 | Bacteria | 31562 |
| 65 | Ga0070685_10003954 | 3300005466 | Bacteria | 7487 |
| 66 | Ga0070685_10045930 | 3300005466 | Bacteria | 2506 |
| 67 | Ga0070706_100004949 | 3300005467 | Bacteria | 12754 |
| 68 | Ga0070706_100066121 | 3300005467 | Bacteria | 3344 |
| 69 | Ga0070707_100001551 | 3300005468 | Bacteria | 22322 |
| 70 | Ga0070698_100001638 | 3300005471 | Bacteria | 24965 |
| 71 | Ga0070698_100024518 | 3300005471 | Bacteria | 6294 |
| 72 | Ga0070698_100084562 | 3300005471 | Bacteria | 3161 |
| 73 | Ga0070698_100351864 | 3300005471 | Bacteria | 1405 |
| 74 | Ga0070699_100017223 | 3300005518 | Bacteria | 6206 |
| 75 | Ga0070679_100000537 | 3300005530 | Bacteria | 32232 |
| 76 | Ga0070679_100001830 | 3300005530 | Bacteria | 19170 |
| 77 | Ga0070679_100041206 | 3300005530 | Bacteria | 4595 |
| 78 | Ga0070679_100075881 | 3300005530 | Bacteria | 3351 |
| 79 | Ga0070684_100001226 | 3300005535 | Bacteria | 18422 |
| 80 | Ga0070684_100003228 | 3300005535 | Bacteria | 12193 |
| 81 | Ga0070684_100081312 | 3300005535 | Bacteria | 2867 |
| 82 | Ga0070684_100128869 | 3300005535 | Bacteria | 2281 |
| 83 | Ga0070684_100231040 | 3300005535 | Bacteria | 1689 |
| 84 | Ga0068853_100247958 | 3300005539 | Bacteria | 1633 |
| 85 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 86 | Ga0070672_100254547 | 3300005543 | Bacteria | 1480 |
| 87 | Ga0070686_100079214 | 3300005544 | Bacteria | 2171 |
| 88 | Ga0070696_100122600 | 3300005546 | Bacteria | 1883 |
| 89 | Ga0070693_100000833 | 3300005547 | Bacteria | 13687 |
| 90 | Ga0070693_100046964 | 3300005547 | Bacteria | 2454 |
| 91 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 92 | Ga0070665_100032824 | 3300005548 | Bacteria | 5223 |
| 93 | Ga0070704_100076925 | 3300005549 | Bacteria | 2442 |
| 94 | Ga0068855_100014350 | 3300005563 | Bacteria | 9539 |
| 95 | Ga0068855_100056520 | 3300005563 | Bacteria | 4605 |
| 96 | Ga0068855_100211426 | 3300005563 | Bacteria | 2179 |
| 97 | Ga0070664_100375561 | 3300005564 | Bacteria | 1297 |
| 98 | Ga0068857_100001285 | 3300005577 | Bacteria | 19722 |
| 99 | Ga0068857_100006742 | 3300005577 | Bacteria | 9874 |
| 100 | Ga0068857_100115283 | 3300005577 | Bacteria | 2417 |
| 101 | Ga0068854_100115490 | 3300005578 | Bacteria | 2031 |
| 102 | Ga0068854_100142366 | 3300005578 | Bacteria | 1841 |
| 103 | Ga0068856_100018421 | 3300005614 | Bacteria | 6768 |
| 104 | Ga0068856_100023907 | 3300005614 | Bacteria | 5944 |
| 105 | Ga0068856_100042442 | 3300005614 | Bacteria | 4474 |
| 106 | Ga0068856_100073050 | 3300005614 | Bacteria | 3396 |
| 107 | Ga0068856_100240699 | 3300005614 | Bacteria | 1825 |
| 108 | Ga0070702_100010715 | 3300005615 | Bacteria | 4529 |
| 109 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 110 | Ga0068852_100038655 | 3300005616 | Bacteria | 4012 |
| 111 | Ga0068852_100134945 | 3300005616 | Bacteria | 2278 |
| 112 | Ga0068852_100285715 | 3300005616 | Bacteria | 1592 |
| 113 | Ga0068864_100345034 | 3300005618 | Bacteria | 1404 |
| 114 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 115 | Ga0068866_10000019 | 3300005718 | Bacteria | 64778 |
| 116 | Ga0068861_100041642 | 3300005719 | Bacteria | 3441 |
| 117 | Ga0068851_10004367 | 3300005834 | Bacteria | 6365 |
| 118 | Ga0068851_10005192 | 3300005834 | Bacteria | 5912 |
| 119 | Ga0068870_10077016 | 3300005840 | Bacteria | 1833 |
| 120 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 121 | Ga0068863_100170585 | 3300005841 | Bacteria | 2087 |
| 122 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 123 | Ga0068858_100044747 | 3300005842 | Bacteria | 4103 |
| 124 | Ga0068860_100044947 | 3300005843 | Bacteria | 4209 |
| 125 | Ga0068860_100063112 | 3300005843 | Bacteria | 3520 |
| 126 | Ga0081455_10007120 | 3300005937 | Bacteria | 11846 |
| 127 | Ga0081455_10008830 | 3300005937 | Bacteria | 10428 |
| 128 | Ga0081455_10030105 | 3300005937 | Bacteria | 4938 |
| 129 | Ga0081455_10052361 | 3300005937 | Bacteria | 3495 |
| 130 | Ga0081455_10068826 | 3300005937 | Bacteria | 2945 |
| 131 | Ga0081455_10078225 | 3300005937 | Bacteria | 2718 |
| 132 | Ga0081538_10000099 | 3300005981 | Bacteria | 83947 |
| 133 | Ga0081538_10000252 | 3300005981 | Bacteria | 60660 |
| 134 | Ga0081538_10000297 | 3300005981 | Bacteria | 57258 |
| 135 | Ga0081538_10000429 | 3300005981 | Bacteria | 47236 |
| 136 | Ga0081538_10000502 | 3300005981 | Bacteria | 43774 |
| 137 | Ga0081538_10000691 | 3300005981 | Bacteria | 37035 |
| 138 | Ga0081538_10000804 | 3300005981 | Bacteria | 34030 |
| 139 | Ga0081538_10000894 | 3300005981 | Bacteria | 32276 |
| 140 | Ga0081538_10000925 | 3300005981 | Bacteria | 31656 |
| 141 | Ga0081538_10001600 | 3300005981 | Bacteria | 23244 |
| 142 | Ga0081538_10003180 | 3300005981 | Bacteria | 15595 |
| 143 | Ga0081538_10006926 | 3300005981 | Bacteria | 9860 |
| 144 | Ga0081538_10008148 | 3300005981 | Bacteria | 8942 |
| 145 | Ga0081538_10008586 | 3300005981 | Bacteria | 8645 |
| 146 | Ga0081538_10012000 | 3300005981 | Bacteria | 6979 |
| 147 | Ga0081538_10018371 | 3300005981 | Bacteria | 5253 |
| 148 | Ga0081538_10058246 | 3300005981 | Bacteria | 2243 |
| 149 | Ga0081538_10122477 | 3300005981 | Bacteria | 1246 |
| 150 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 151 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 152 | Ga0081539_10002242 | 3300005985 | Bacteria | 28126 |
| 153 | Ga0081539_10060633 | 3300005985 | Bacteria | 2076 |
| 154 | Ga0070717_10096537 | 3300006028 | Bacteria | 2504 |
| 155 | Ga0075365_10000014 | 3300006038 | Bacteria | 79945 |
| 156 | Ga0075365_10016179 | 3300006038 | Bacteria | 4530 |
| 157 | Ga0075365_10023969 | 3300006038 | Bacteria | 3844 |
| 158 | Ga0075365_10062766 | 3300006038 | Bacteria | 2486 |
| 159 | Ga0075365_10086269 | 3300006038 | Bacteria | 2133 |
| 160 | Ga0075365_10160419 | 3300006038 | Bacteria | 1567 |
| 161 | Ga0075365_10172521 | 3300006038 | Bacteria | 1510 |
| 162 | Ga0075365_10243986 | 3300006038 | Bacteria | 1262 |
| 163 | Ga0075364_10093685 | 3300006051 | Bacteria | 1994 |
| 164 | Ga0075364_10159535 | 3300006051 | Bacteria | 1522 |
| 165 | Ga0075364_10164661 | 3300006051 | Bacteria | 1498 |
| 166 | Ga0075364_10215756 | 3300006051 | Bacteria | 1301 |
| 167 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 168 | Ga0070715_10022486 | 3300006163 | Bacteria | 2460 |
| 169 | Ga0070712_100019039 | 3300006175 | Bacteria | 4468 |
| 170 | Ga0070712_100185024 | 3300006175 | Bacteria | 1626 |
| 171 | Ga0097621_100024560 | 3300006237 | Bacteria | 4708 |
| 172 | Ga0068871_100027672 | 3300006358 | Bacteria | 4436 |
| 173 | Ga0075428_100017809 | 3300006844 | Bacteria | 7849 |
| 174 | Ga0075428_100078209 | 3300006844 | Bacteria | 3611 |
| 175 | Ga0075428_100121552 | 3300006844 | Bacteria | 2843 |
| 176 | Ga0075428_100199352 | 3300006844 | Bacteria | 2164 |
| 177 | Ga0075430_100003677 | 3300006846 | Bacteria | 12874 |
| 178 | Ga0075430_100077997 | 3300006846 | Bacteria | 2777 |
| 179 | Ga0075430_100100857 | 3300006846 | Bacteria | 2411 |
| 180 | Ga0075431_100002485 | 3300006847 | Bacteria | 17777 |
| 181 | Ga0075431_100045347 | 3300006847 | Bacteria | 4533 |
| 182 | Ga0075431_100152117 | 3300006847 | Bacteria | 2382 |
| 183 | Ga0075431_100227289 | 3300006847 | Bacteria | 1902 |
| 184 | Ga0075431_100302345 | 3300006847 | Bacteria | 1616 |
| 185 | Ga0075434_100007144 | 3300006871 | Bacteria | 10320 |
| 186 | Ga0075429_100007313 | 3300006880 | Bacteria | 9585 |
| 187 | Ga0075429_100046393 | 3300006880 | Bacteria | 3780 |
| 188 | Ga0075436_100135926 | 3300006914 | Bacteria | 1726 |
| 189 | Ga0105240_10026755 | 3300009093 | Bacteria | 7565 |
| 190 | Ga0105240_10049813 | 3300009093 | Bacteria | 5284 |
| 191 | Ga0111539_10002085 | 3300009094 | Bacteria | 26719 |
| 192 | Ga0111539_10002336 | 3300009094 | Bacteria | 25254 |
| 193 | Ga0111539_10024191 | 3300009094 | Bacteria | 7458 |
| 194 | Ga0105245_10000056 | 3300009098 | Bacteria | 124109 |
| 195 | Ga0105245_10001677 | 3300009098 | Bacteria | 20157 |
| 196 | Ga0105245_10003691 | 3300009098 | Bacteria | 13667 |
| 197 | Ga0105245_10005665 | 3300009098 | Bacteria | 10974 |
| 198 | Ga0105245_10005783 | 3300009098 | Bacteria | 10850 |
| 199 | Ga0105245_10010311 | 3300009098 | Bacteria | 8139 |
| 200 | Ga0105245_10060054 | 3300009098 | Bacteria | 3424 |
| 201 | Ga0105245_10064347 | 3300009098 | Bacteria | 3314 |
| 202 | Ga0105245_10386593 | 3300009098 | Bacteria | 1395 |
| 203 | Ga0114129_10001119 | 3300009147 | Bacteria | 35383 |
| 204 | Ga0114129_10003023 | 3300009147 | Bacteria | 23586 |
| 205 | Ga0114129_10013663 | 3300009147 | Bacteria | 11570 |
| 206 | Ga0114129_10023252 | 3300009147 | Bacteria | 8791 |
| 207 | Ga0114129_10029378 | 3300009147 | Bacteria | 7787 |
| 208 | Ga0105243_10047394 | 3300009148 | Bacteria | 3383 |
| 209 | Ga0105243_10074340 | 3300009148 | Bacteria | 2756 |
| 210 | Ga0105243_10099187 | 3300009148 | Bacteria | 2414 |
| 211 | Ga0105243_10209206 | 3300009148 | Bacteria | 1716 |
| 212 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 213 | Ga0105248_10083797 | 3300009177 | Bacteria | 3586 |
| 214 | Ga0105237_10163908 | 3300009545 | Bacteria | 2222 |
| 215 | Ga0105237_10175697 | 3300009545 | Bacteria | 2142 |
| 216 | Ga0105238_10242128 | 3300009551 | Bacteria | 1781 |
| 217 | Ga0105238_10249005 | 3300009551 | Bacteria | 1755 |
| 218 | Ga0105249_10011189 | 3300009553 | Bacteria | 7881 |
| 219 | Ga0105028_101263 | 3300009993 | Bacteria | 2665 |
| 220 | Ga0105239_10006331 | 3300010375 | Bacteria | 13766 |
| 221 | Ga0105239_10093776 | 3300010375 | Bacteria | 3315 |
| 222 | Ga0105239_10372906 | 3300010375 | Bacteria | 1613 |
| 223 | Ga0105246_10039193 | 3300011119 | Bacteria | 3190 |
| 224 | Ga0157371_10009099 | 3300013102 | Bacteria | 7848 |
| 225 | Ga0157370_10214353 | 3300013104 | Bacteria | 1784 |
| 226 | Ga0157369_10000099 | 3300013105 | Bacteria | 120032 |
| 227 | Ga0157369_10035965 | 3300013105 | Bacteria | 5428 |
| 228 | Ga0157369_10075437 | 3300013105 | Bacteria | 3616 |
| 229 | Ga0157374_10006829 | 3300013296 | Bacteria | 9708 |
| 230 | Ga0157374_10098614 | 3300013296 | Bacteria | 2798 |
| 231 | Ga0157378_10010497 | 3300013297 | Bacteria | 8091 |
| 232 | Ga0157378_10510143 | 3300013297 | Bacteria | 1202 |
| 233 | Ga0157372_10026370 | 3300013307 | Bacteria | 6324 |
| 234 | Ga0157372_10151411 | 3300013307 | Bacteria | 2678 |
| 235 | Ga0157372_10434060 | 3300013307 | Bacteria | 1531 |
| 236 | Ga0157372_10606721 | 3300013307 | Bacteria | 1276 |
| 237 | Ga0157375_10010359 | 3300013308 | Bacteria | 8207 |
| 238 | Ga0157375_10032670 | 3300013308 | Bacteria | 4937 |
| 239 | Ga0157375_10046134 | 3300013308 | Bacteria | 4246 |
| 240 | Ga0157375_10048497 | 3300013308 | Bacteria | 4155 |
| 241 | Ga0157375_10600278 | 3300013308 | Bacteria | 1260 |
| 242 | Ga0163163_10107630 | 3300014325 | Bacteria | 2814 |
| 243 | Ga0157380_10000219 | 3300014326 | Bacteria | 34156 |
| 244 | Ga0157380_10362950 | 3300014326 | Bacteria | 1360 |
| 245 | Ga0157377_10005388 | 3300014745 | Bacteria | 6009 |
| 246 | Ga0157377_10086554 | 3300014745 | Bacteria | 1842 |
| 247 | Ga0157379_10320088 | 3300014968 | Bacteria | 1416 |
| 248 | Ga0157376_10047691 | 3300014969 | Bacteria | 3538 |
| 249 | Ga0157376_10096829 | 3300014969 | Bacteria | 2569 |
| 250 | Ga0157376_10103402 | 3300014969 | Bacteria | 2494 |
| 251 | Ga0157376_10331348 | 3300014969 | Bacteria | 1450 |
| 252 | Ga0182006_1061684 | 3300015261 | Bacteria | 1413 |
| 253 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 254 | Ga0163161_10065977 | 3300017792 | Bacteria | 2642 |
| 255 | Ga0206356_10987891 | 3300020070 | Bacteria | 1988 |
| 256 | Ga0206356_11507257 | 3300020070 | Bacteria | 1649 |
| 257 | Ga0206354_10224168 | 3300020081 | Bacteria | 2296 |
| 258 | Ga0206353_11255590 | 3300020082 | Bacteria | 3314 |
| 259 | Ga0206353_11844079 | 3300020082 | Bacteria | 5443 |
| 260 | Ga0207656_10002305 | 3300025321 | Bacteria | 6410 |
| 261 | Ga0207656_10117373 | 3300025321 | Bacteria | 1236 |
| 262 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 263 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 264 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 265 | Ga0207642_10000017 | 3300025899 | Bacteria | 64774 |
| 266 | Ga0207642_10014374 | 3300025899 | Bacteria | 2919 |
| 267 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 268 | Ga0207699_10027383 | 3300025906 | Bacteria | 3155 |
| 269 | Ga0207707_10003654 | 3300025912 | Bacteria | 13645 |
| 270 | Ga0207707_10011148 | 3300025912 | Bacteria | 7820 |
| 271 | Ga0207707_10012057 | 3300025912 | Bacteria | 7517 |
| 272 | Ga0207707_10157919 | 3300025912 | Bacteria | 1983 |
| 273 | Ga0207693_10001551 | 3300025915 | Bacteria | 20284 |
| 274 | Ga0207693_10013240 | 3300025915 | Bacteria | 6654 |
| 275 | Ga0207693_10271474 | 3300025915 | Bacteria | 1329 |
| 276 | Ga0207663_10014493 | 3300025916 | Bacteria | 4318 |
| 277 | Ga0207663_10066421 | 3300025916 | Bacteria | 2309 |
| 278 | Ga0207663_10108944 | 3300025916 | Bacteria | 1876 |
| 279 | Ga0207660_10005162 | 3300025917 | Bacteria | 8488 |
| 280 | Ga0207660_10018009 | 3300025917 | Bacteria | 4704 |
| 281 | Ga0207660_10047444 | 3300025917 | Bacteria | 3037 |
| 282 | Ga0207660_10061128 | 3300025917 | Bacteria | 2711 |
| 283 | Ga0207657_10001335 | 3300025919 | Bacteria | 26208 |
| 284 | Ga0207657_10002472 | 3300025919 | Bacteria | 19995 |
| 285 | Ga0207657_10003370 | 3300025919 | Bacteria | 17079 |
| 286 | Ga0207657_10014368 | 3300025919 | Bacteria | 7732 |
| 287 | Ga0207657_10029745 | 3300025919 | Bacteria | 4967 |
| 288 | Ga0207657_10271799 | 3300025919 | Bacteria | 1347 |
| 289 | Ga0207649_10016170 | 3300025920 | Bacteria | 4202 |
| 290 | Ga0207649_10030765 | 3300025920 | Bacteria | 3183 |
| 291 | Ga0207649_10320794 | 3300025920 | Bacteria | 1138 |
| 292 | Ga0207652_10000631 | 3300025921 | Bacteria | 34868 |
| 293 | Ga0207652_10001944 | 3300025921 | Bacteria | 17885 |
| 294 | Ga0207652_10116676 | 3300025921 | Bacteria | 2372 |
| 295 | Ga0207646_10009623 | 3300025922 | Bacteria | 9534 |
| 296 | Ga0207650_10025386 | 3300025925 | Bacteria | 4221 |
| 297 | Ga0207650_10152474 | 3300025925 | Bacteria | 1825 |
| 298 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 299 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 300 | Ga0207687_10000646 | 3300025927 | Bacteria | 23464 |
| 301 | Ga0207687_10006484 | 3300025927 | Bacteria | 7727 |
| 302 | Ga0207687_10017967 | 3300025927 | Bacteria | 4665 |
| 303 | Ga0207687_10161060 | 3300025927 | Bacteria | 1722 |
| 304 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 305 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 306 | Ga0207690_10031482 | 3300025932 | Bacteria | 3395 |
| 307 | Ga0207690_10326736 | 3300025932 | Bacteria | 1207 |
| 308 | Ga0207706_10000006 | 3300025933 | Bacteria | 216994 |
| 309 | Ga0207706_10014837 | 3300025933 | Bacteria | 7053 |
| 310 | Ga0207686_10142989 | 3300025934 | Bacteria | 1656 |
| 311 | Ga0207709_10049455 | 3300025935 | Bacteria | 2566 |
| 312 | Ga0207709_10060791 | 3300025935 | Bacteria | 2357 |
| 313 | Ga0207670_10087786 | 3300025936 | Bacteria | 2192 |
| 314 | Ga0207670_10330977 | 3300025936 | Bacteria | 1201 |
| 315 | Ga0207669_10000016 | 3300025937 | Bacteria | 124532 |
| 316 | Ga0207669_10000036 | 3300025937 | Bacteria | 78568 |
| 317 | Ga0207669_10322612 | 3300025937 | Bacteria | 1183 |
| 318 | Ga0207704_10000025 | 3300025938 | Bacteria | 135523 |
| 319 | Ga0207704_10008706 | 3300025938 | Bacteria | 4867 |
| 320 | Ga0207704_10076865 | 3300025938 | Bacteria | 2141 |
| 321 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 322 | Ga0207691_10018612 | 3300025940 | Bacteria | 6582 |
| 323 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 324 | Ga0207711_10134064 | 3300025941 | Bacteria | 2223 |
| 325 | Ga0207689_10025225 | 3300025942 | Bacteria | 4983 |
| 326 | Ga0207689_10093134 | 3300025942 | Bacteria | 2475 |
| 327 | Ga0207661_10001238 | 3300025944 | Bacteria | 17056 |
| 328 | Ga0207661_10001780 | 3300025944 | Bacteria | 14742 |
| 329 | Ga0207661_10001949 | 3300025944 | Bacteria | 14185 |
| 330 | Ga0207661_10008416 | 3300025944 | Bacteria | 7373 |
| 331 | Ga0207661_10030009 | 3300025944 | Bacteria | 4182 |
| 332 | Ga0207661_10151734 | 3300025944 | Bacteria | 2003 |
| 333 | Ga0207679_10308269 | 3300025945 | Bacteria | 1367 |
| 334 | Ga0207667_10215088 | 3300025949 | Bacteria | 1970 |
| 335 | Ga0207651_10111878 | 3300025960 | Bacteria | 2051 |
| 336 | Ga0207651_10220835 | 3300025960 | Bacteria | 1532 |
| 337 | Ga0207640_10000285 | 3300025981 | Bacteria | 33957 |
| 338 | Ga0207640_10060336 | 3300025981 | Bacteria | 2506 |
| 339 | Ga0207640_10083577 | 3300025981 | Bacteria | 2189 |
| 340 | Ga0207640_10206892 | 3300025981 | Bacteria | 1492 |
| 341 | Ga0207640_10245438 | 3300025981 | Bacteria | 1386 |
| 342 | Ga0207677_10001435 | 3300026023 | Bacteria | 12669 |
| 343 | Ga0207677_10018809 | 3300026023 | Bacteria | 4155 |
| 344 | Ga0207677_10052187 | 3300026023 | Bacteria | 2777 |
| 345 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 346 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 347 | Ga0207678_10025503 | 3300026067 | Bacteria | 5161 |
| 348 | Ga0207678_10210895 | 3300026067 | Bacteria | 1661 |
| 349 | Ga0207708_10000757 | 3300026075 | Bacteria | 24232 |
| 350 | Ga0207708_10006689 | 3300026075 | Bacteria | 8525 |
| 351 | Ga0207708_10329542 | 3300026075 | Bacteria | 1248 |
| 352 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 353 | Ga0207702_10003815 | 3300026078 | Bacteria | 13603 |
| 354 | Ga0207702_10014205 | 3300026078 | Bacteria | 6613 |
| 355 | Ga0207702_10016146 | 3300026078 | Bacteria | 6181 |
| 356 | Ga0207702_10016852 | 3300026078 | Bacteria | 6048 |
| 357 | Ga0207702_10033585 | 3300026078 | Bacteria | 4286 |
| 358 | Ga0207702_10178202 | 3300026078 | Bacteria | 1955 |
| 359 | Ga0207702_10302676 | 3300026078 | Bacteria | 1518 |
| 360 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 361 | Ga0207641_10008529 | 3300026088 | Bacteria | 8466 |
| 362 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 363 | Ga0207648_10026646 | 3300026089 | Bacteria | 5135 |
| 364 | Ga0207648_10043290 | 3300026089 | Bacteria | 3952 |
| 365 | Ga0207676_10080307 | 3300026095 | Bacteria | 2647 |
| 366 | Ga0207674_10002949 | 3300026116 | Bacteria | 21132 |
| 367 | Ga0207674_10050544 | 3300026116 | Bacteria | 4247 |
| 368 | Ga0207674_10072073 | 3300026116 | Bacteria | 3471 |
| 369 | Ga0207675_100009465 | 3300026118 | Bacteria | 9119 |
| 370 | Ga0207675_100010716 | 3300026118 | Bacteria | 8586 |
| 371 | Ga0207675_100140748 | 3300026118 | Bacteria | 2292 |
| 372 | Ga0207683_10000740 | 3300026121 | Bacteria | 29707 |
| 373 | Ga0207683_10006404 | 3300026121 | Bacteria | 10083 |
| 374 | Ga0207683_10023702 | 3300026121 | Bacteria | 5280 |
| 375 | Ga0207683_10135986 | 3300026121 | Bacteria | 2212 |
| 376 | Ga0207683_10172253 | 3300026121 | Bacteria | 1961 |
| 377 | Ga0207683_10343832 | 3300026121 | Bacteria | 1368 |
| 378 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 379 | Ga0207698_10009350 | 3300026142 | Bacteria | 6246 |
| 380 | Ga0207428_10191832 | 3300027907 | Bacteria | 1540 |
| 381 | Ga0207428_10235228 | 3300027907 | Bacteria | 1370 |
| 382 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 383 | Ga0268266_10027948 | 3300028379 | Bacteria | 4798 |
| 384 | Ga0268266_10066071 | 3300028379 | Bacteria | 3127 |
| 385 | Ga0268266_10136436 | 3300028379 | Bacteria | 2198 |
| 386 | Ga0268264_10007216 | 3300028381 | Bacteria | 9306 |
| 387 | Ga0265337_1000054 | 3300028556 | Bacteria | 52183 |
| 388 | Ga0265326_10000027 | 3300028558 | Bacteria | 110843 |
| 389 | Ga0265323_10019618 | 3300028653 | Bacteria | 2607 |
| 390 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 391 | Ga0265324_10000103 | 3300029957 | Bacteria | 67507 |
| 392 | Ga0314311_1122819 | 3300030733 | Bacteria | 6045 |
| 393 | Ga0316179_1002117 | 3300030734 | Bacteria | 36853 |
| 394 | Ga0316180_1070555 | 3300030736 | Bacteria | 5463 |
| 395 | Ga0316183_1122503 | 3300030742 | Bacteria | 24386 |
| 396 | Ga0316182_1020791 | 3300030745 | Bacteria | 37858 |
| 397 | Ga0265332_10007198 | 3300031238 | Bacteria | 5035 |
| 398 | Ga0265328_10001275 | 3300031239 | Bacteria | 11625 |
| 399 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 400 | Ga0265329_10002125 | 3300031242 | Bacteria | 9180 |
| 401 | Ga0265331_10001895 | 3300031250 | Bacteria | 14686 |
| 402 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 403 | Ga0265327_10008056 | 3300031251 | Bacteria | 7945 |
| 404 | Ga0265316_10020298 | 3300031344 | Bacteria | 5661 |
| 405 | Ga0307408_100031047 | 3300031548 | Bacteria | 3716 |
| 406 | Ga0307408_100048271 | 3300031548 | Bacteria | 3053 |
| 407 | Ga0307408_100081761 | 3300031548 | Bacteria | 2416 |
| 408 | Ga0307408_100239143 | 3300031548 | Bacteria | 1491 |
| 409 | Ga0265314_10001375 | 3300031711 | Bacteria | 27314 |
| 410 | Ga0316576_10143144 | 3300031727 | Bacteria | 1800 |
| 411 | Ga0316576_10180268 | 3300031727 | Bacteria | 1593 |
| 412 | Ga0307413_10002156 | 3300031824 | Bacteria | 7907 |
| 413 | Ga0307413_10023303 | 3300031824 | Bacteria | 3354 |
| 414 | Ga0307413_10051708 | 3300031824 | Bacteria | 2477 |
| 415 | Ga0307410_10016214 | 3300031852 | Bacteria | 4438 |
| 416 | Ga0307410_10058953 | 3300031852 | Bacteria | 2619 |
| 417 | Ga0307410_10303937 | 3300031852 | Bacteria | 1260 |
| 418 | Ga0307406_10011927 | 3300031901 | Bacteria | 4940 |
| 419 | Ga0307406_10027082 | 3300031901 | Bacteria | 3450 |
| 420 | Ga0307406_10038981 | 3300031901 | Bacteria | 2944 |
| 421 | Ga0307407_10022196 | 3300031903 | Bacteria | 3288 |
| 422 | Ga0307407_10048327 | 3300031903 | Bacteria | 2421 |
| 423 | Ga0307412_10018003 | 3300031911 | Bacteria | 4241 |
| 424 | Ga0307412_10241304 | 3300031911 | Bacteria | 1398 |
| 425 | Ga0307409_100012362 | 3300031995 | Bacteria | 5438 |
| 426 | Ga0307409_100058575 | 3300031995 | Bacteria | 2992 |
| 427 | Ga0307409_100058788 | 3300031995 | Bacteria | 2988 |
| 428 | Ga0307409_100090923 | 3300031995 | Bacteria | 2500 |
| 429 | Ga0307409_100099462 | 3300031995 | Bacteria | 2408 |
| 430 | Ga0307416_100011782 | 3300032002 | Bacteria | 5856 |
| 431 | Ga0307416_100020572 | 3300032002 | Bacteria | 4713 |
| 432 | Ga0307416_100028324 | 3300032002 | Bacteria | 4164 |
| 433 | Ga0307416_100033278 | 3300032002 | Bacteria | 3906 |
| 434 | Ga0307416_100045175 | 3300032002 | Bacteria | 3466 |
| 435 | Ga0307416_100060430 | 3300032002 | Bacteria | 3086 |
| 436 | Ga0307416_100114944 | 3300032002 | Bacteria | 2382 |
| 437 | Ga0307416_100185584 | 3300032002 | Bacteria | 1954 |
| 438 | Ga0307416_100377509 | 3300032002 | Bacteria | 1446 |
| 439 | Ga0307414_10113428 | 3300032004 | Bacteria | 2069 |
| 440 | Ga0307414_10120549 | 3300032004 | Bacteria | 2016 |
| 441 | Ga0307411_10006677 | 3300032005 | Bacteria | 5796 |
| 442 | Ga0307415_100001131 | 3300032126 | Bacteria | 12469 |
| 443 | Ga0307415_100020790 | 3300032126 | Bacteria | 4016 |
| 444 | Ga0307415_100076841 | 3300032126 | Bacteria | 2369 |
| 445 | Ga0307415_100102523 | 3300032126 | Bacteria | 2103 |
| 446 | Ga0307415_100275124 | 3300032126 | Bacteria | 1381 |
| 447 | Ga0373960_0011977 | 3300035121 | Bacteria | 2147 |
| 448 | Ga0373942_0030371 | 3300035207 | Bacteria | 1423 |
| 449 | Ga0373931_0043963 | 3300035691 | Bacteria | 2355 |
| 450 | Ga0373947_0036675 | 3300035725 | Bacteria | 2908 |
| 451 | Ga0373937_0033225 | 3300036401 | Bacteria | 4684 |
| 452 | Ga0373937_0074513 | 3300036401 | Bacteria | 3132 |
| 453 | Ga0316584_0122658 | 3300036712 | Bacteria | 1941 |
| 454 | Ga0373925_0085421 | 3300037068 | Bacteria | 2406 |
| 455 | Ga0395899_0019939 | 3300037312 | Bacteria | 5088 |
| 456 | Ga0395899_0066624 | 3300037312 | Bacteria | 2644 |
| 457 | Ga0395899_0145260 | 3300037312 | Bacteria | 1685 |
| 458 | Ga0395900_0003557 | 3300037418 | Bacteria | 16757 |
| 459 | Ga0395900_0004073 | 3300037418 | Bacteria | 15587 |
| 460 | Ga0395900_0006758 | 3300037418 | Bacteria | 11903 |
| 461 | Ga0395900_0010351 | 3300037418 | Bacteria | 9543 |
| 462 | Ga0395900_0041817 | 3300037418 | Bacteria | 4723 |
| 463 | Ga0395900_0049279 | 3300037418 | Bacteria | 4339 |
| 464 | Ga0395900_0081851 | 3300037418 | Bacteria | 3316 |
| 465 | Ga0395900_0094819 | 3300037418 | Bacteria | 3066 |
| 466 | Ga0395900_0117171 | 3300037418 | Bacteria | 2733 |
| 467 | Ga0395900_0124218 | 3300037418 | Bacteria | 2647 |
| 468 | Ga0395898_0001604 | 3300037466 | Bacteria | 30854 |
| 469 | Ga0395898_0003445 | 3300037466 | Bacteria | 17691 |
| 470 | Ga0395898_0009405 | 3300037466 | Bacteria | 10264 |
| 471 | Ga0395898_0010906 | 3300037466 | Bacteria | 9483 |
| 472 | Ga0395898_0011062 | 3300037466 | Bacteria | 9398 |
| 473 | Ga0395898_0011171 | 3300037466 | Bacteria | 9351 |
| 474 | Ga0395898_0027143 | 3300037466 | Bacteria | 5751 |
| 475 | Ga0395898_0057103 | 3300037466 | Bacteria | 3804 |
| 476 | Ga0395898_0077050 | 3300037466 | Bacteria | 3219 |
| 477 | Ga0395898_0085211 | 3300037466 | Bacteria | 3045 |
| 478 | Ga0395898_0115528 | 3300037466 | Bacteria | 2571 |
| 479 | Ga0395898_0254166 | 3300037466 | Bacteria | 1676 |
| 480 | Ga0395898_0267825 | 3300037466 | Bacteria | 1629 |
| 481 | Ga0395898_0528300 | 3300037466 | Bacteria | 1121 |
| 482 | Ga0395905_0001761 | 3300037471 | Bacteria | 25226 |
| 483 | Ga0395905_0002251 | 3300037471 | Bacteria | 21694 |
| 484 | Ga0395905_0010800 | 3300037471 | Bacteria | 8847 |
| 485 | Ga0395905_0012564 | 3300037471 | Bacteria | 8144 |
| 486 | Ga0395905_0025788 | 3300037471 | Bacteria | 5542 |
| 487 | Ga0395905_0032416 | 3300037471 | Bacteria | 4914 |
| 488 | Ga0395905_0035952 | 3300037471 | Bacteria | 4651 |
| 489 | Ga0395905_0042430 | 3300037471 | Bacteria | 4269 |
| 490 | Ga0395905_0046007 | 3300037471 | Bacteria | 4093 |
| 491 | Ga0395905_0171259 | 3300037471 | Bacteria | 2039 |
| 492 | Ga0395905_0401141 | 3300037471 | Bacteria | 1266 |
| 493 | Ga0395901_0001420 | 3300038443 | Bacteria | 24995 |
| 494 | Ga0395901_0001597 | 3300038443 | Bacteria | 23455 |
| 495 | Ga0395901_0002643 | 3300038443 | Bacteria | 18106 |
| 496 | Ga0395901_0006110 | 3300038443 | Bacteria | 12202 |
| 497 | Ga0395901_0020676 | 3300038443 | Bacteria | 6737 |
| 498 | Ga0395901_0032816 | 3300038443 | Bacteria | 5356 |
| 499 | Ga0395901_0046351 | 3300038443 | Bacteria | 4515 |
| 500 | Ga0395901_0064884 | 3300038443 | Bacteria | 3801 |
| 501 | Ga0395901_0065706 | 3300038443 | Bacteria | 3777 |
| 502 | Ga0395901_0136094 | 3300038443 | Bacteria | 2582 |
| 503 | Ga0395901_0173308 | 3300038443 | Bacteria | 2263 |
| 504 | Ga0395901_0235219 | 3300038443 | Bacteria | 1912 |
| 505 | Ga0451853_2357732 | 3300041512 | Bacteria | 1284 |
| 506 | Ga0439445_0002076 | 3300042004 | Bacteria | 4433 |
| 507 | Ga0439448_0016164 | 3300042005 | Bacteria | 2269 |
| 508 | Ga0439432_006638 | 3300042006 | Bacteria | 4122 |
| 509 | Ga0466965_0057274 | 3300044683 | Bacteria | 1942 |
| 510 | Ga0466966_0232242 | 3300044684 | Bacteria | 1113 |
| 511 | Ga0466961_0026057 | 3300044693 | Bacteria | 3759 |
| 512 | Ga0466961_0114028 | 3300044693 | Bacteria | 1699 |
| 513 | Ga0466963_0025241 | 3300044694 | Bacteria | 3788 |
| 514 | Ga0466963_0043513 | 3300044694 | Bacteria | 2953 |
| 515 | Ga0466963_0130885 | 3300044694 | Bacteria | 1733 |
| 516 | Ga0466964_0000890 | 3300044706 | Bacteria | 9790 |
| 517 | Ga0466964_0010017 | 3300044706 | Bacteria | 3571 |
| 518 | Ga0466968_0046907 | 3300044735 | Bacteria | 1836 |
| 519 | Ga0466957_0003681 | 3300044842 | Bacteria | 8460 |
| 520 | Ga0466957_0124802 | 3300044842 | Bacteria | 1644 |
| 521 | Ga0466960_0022744 | 3300044901 | Bacteria | 2806 |
| 522 | Ga0466959_0002692 | 3300045049 | Bacteria | 11414 |
| 523 | Ga0466959_0055724 | 3300045049 | Bacteria | 2885 |
| 524 | Ga0466958_0005927 | 3300045836 | Bacteria | 6606 |
| 525 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 526 | Ga0466967_0004872 | 3300045976 | Bacteria | 9164 |
| 527 | Ga0466967_0069123 | 3300045976 | Bacteria | 3155 |
| 528 | Ga0466967_0079454 | 3300045976 | Bacteria | 2957 |
| 529 | Ga0466967_0092522 | 3300045976 | Bacteria | 2750 |
| 530 | Ga0466967_0272881 | 3300045976 | Bacteria | 1621 |
| 531 | Ga0466967_0426272 | 3300045976 | Bacteria | 1294 |
| 532 | Ga0495617_006590 | 3300046452 | Bacteria | 4062 |
| 533 | Ga0495627_034218 | 3300046453 | Bacteria | 1588 |
| 534 | Ga0495592_0000621 | 3300046454 | Bacteria | 24971 |
| 535 | Ga0495592_0083460 | 3300046454 | Bacteria | 2307 |
| 536 | Ga0495603_0133104 | 3300046455 | Bacteria | 1447 |
| 537 | Ga0495603_0181746 | 3300046455 | Bacteria | 1217 |
| 538 | Ga0495590_0087496 | 3300046457 | Bacteria | 1101 |
| 539 | Ga0495629_0005520 | 3300046459 | Bacteria | 9437 |
| 540 | Ga0495629_0036832 | 3300046459 | Bacteria | 3451 |
| 541 | Ga0495629_0140175 | 3300046459 | Bacteria | 1683 |
| 542 | Ga0495641_0009756 | 3300046461 | Bacteria | 5666 |
| 543 | Ga0495641_0015104 | 3300046461 | Bacteria | 4144 |
| 544 | Ga0495641_0070282 | 3300046461 | Bacteria | 1573 |
| 545 | Ga0495651_0004887 | 3300046462 | Bacteria | 10251 |
| 546 | Ga0495651_0014023 | 3300046462 | Bacteria | 6199 |
| 547 | Ga0495651_0090570 | 3300046462 | Bacteria | 2294 |
| 548 | Ga0495653_0010741 | 3300046463 | Bacteria | 7498 |
| 549 | Ga0495653_0022048 | 3300046463 | Bacteria | 5155 |
| 550 | Ga0495653_0069968 | 3300046463 | Bacteria | 2627 |
| 551 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 552 | Ga0495582_0027982 | 3300046473 | Bacteria | 3092 |
| 553 | Ga0495582_0038899 | 3300046473 | Bacteria | 2618 |
| 554 | Ga0495605_0066960 | 3300046474 | Bacteria | 1705 |
| 555 | Ga0495639_0047772 | 3300046475 | Bacteria | 1940 |
| 556 | Ga0495664_0045067 | 3300046477 | Bacteria | 2615 |
| 557 | Ga0495584_0028330 | 3300046491 | Bacteria | 2837 |
| 558 | Ga0495584_0037550 | 3300046491 | Bacteria | 2449 |
| 559 | Ga0495584_0076703 | 3300046491 | Bacteria | 1681 |
| 560 | Ga0495594_0000013 | 3300046499 | Bacteria | 103201 |
| 561 | Ga0495594_0021620 | 3300046499 | Bacteria | 3435 |
| 562 | Ga0495596_0070600 | 3300046500 | Bacteria | 1357 |
| 563 | Ga0495596_0097391 | 3300046500 | Bacteria | 1142 |
| 564 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 565 | Ga0495608_0000406 | 3300046511 | Bacteria | 30178 |
| 566 | Ga0495608_0022630 | 3300046511 | Bacteria | 4310 |
| 567 | Ga0495610_0000053 | 3300046512 | Bacteria | 142545 |
| 568 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 569 | Ga0495628_0005324 | 3300046516 | Bacteria | 11286 |
| 570 | Ga0495628_0008805 | 3300046516 | Bacteria | 8638 |
| 571 | Ga0495628_0039578 | 3300046516 | Bacteria | 3770 |
| 572 | Ga0495628_0268974 | 3300046516 | Bacteria | 1268 |
| 573 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 574 | Ga0495630_0032881 | 3300046517 | Bacteria | 3867 |
| 575 | Ga0495630_0100644 | 3300046517 | Bacteria | 2186 |
| 576 | Ga0495631_0056015 | 3300046518 | Bacteria | 1717 |
| 577 | Ga0495644_0033884 | 3300046523 | Bacteria | 1928 |
| 578 | Ga0495652_0011511 | 3300046529 | Bacteria | 8000 |
| 579 | Ga0495640_0001520 | 3300046533 | Bacteria | 18268 |
| 580 | Ga0495640_0041629 | 3300046533 | Bacteria | 3209 |
| 581 | Ga0495640_0047817 | 3300046533 | Bacteria | 2959 |
| 582 | Ga0495640_0233002 | 3300046533 | Bacteria | 1158 |
| 583 | Ga0495586_0000527 | 3300046535 | Bacteria | 22292 |
| 584 | Ga0495586_0000620 | 3300046535 | Bacteria | 20523 |
| 585 | Ga0495586_0031050 | 3300046535 | Bacteria | 2860 |
| 586 | Ga0495598_0000907 | 3300046537 | Bacteria | 5706 |
| 587 | Ga0495598_0040271 | 3300046537 | Bacteria | 1362 |
| 588 | Ga0495597_0042995 | 3300046542 | Bacteria | 2013 |
| 589 | Ga0495645_0048974 | 3300046543 | Bacteria | 3077 |
| 590 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 591 | Ga0495667_0004189 | 3300046559 | Bacteria | 9713 |
| 592 | Ga0495667_0010495 | 3300046559 | Bacteria | 6267 |
| 593 | Ga0495667_0044310 | 3300046559 | Bacteria | 2947 |
| 594 | Ga0495634_0000024 | 3300046642 | Bacteria | 116230 |
| 595 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 596 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 597 | Ga0495635_0112848 | 3300046663 | Bacteria | 1856 |
| 598 | Ga0495635_0180491 | 3300046663 | Bacteria | 1435 |
| 599 | Ga0495659_0006884 | 3300046664 | Bacteria | 3596 |
| 600 | Ga0495588_0000198 | 3300046674 | Bacteria | 60956 |
| 601 | Ga0495588_0058425 | 3300046674 | Bacteria | 1994 |
| 602 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 603 | Ga0495657_0004915 | 3300046675 | Bacteria | 10635 |
| 604 | Ga0495657_0019467 | 3300046675 | Bacteria | 4895 |
| 605 | Ga0495599_0007133 | 3300046678 | Bacteria | 6767 |
| 606 | Ga0495599_0026791 | 3300046678 | Bacteria | 3613 |
| 607 | Ga0495599_0031412 | 3300046678 | Bacteria | 3333 |
| 608 | Ga0495599_0080868 | 3300046678 | Bacteria | 2029 |
| 609 | Ga0495646_0087929 | 3300046680 | Bacteria | 1800 |
| 610 | Ga0495647_0000293 | 3300046681 | Bacteria | 13969 |
| 611 | Ga0495647_0090494 | 3300046681 | Bacteria | 1254 |
| 612 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 613 | Ga0495613_0000249 | 3300046689 | Bacteria | 50975 |
| 614 | Ga0495613_0020894 | 3300046689 | Bacteria | 4880 |
| 615 | Ga0495624_0000028 | 3300046690 | Bacteria | 93474 |
| 616 | Ga0495624_0036177 | 3300046690 | Bacteria | 3185 |
| 617 | Ga0495624_0041230 | 3300046690 | Bacteria | 2954 |
| 618 | Ga0495671_0059350 | 3300046692 | Bacteria | 1891 |
| 619 | Ga0495649_0015920 | 3300046694 | Bacteria | 4271 |
| 620 | Ga0495600_0003314 | 3300046809 | Bacteria | 9451 |
| 621 | Ga0495600_0010047 | 3300046809 | Bacteria | 5867 |
| 622 | Ga0495600_0045091 | 3300046809 | Bacteria | 2876 |
| 623 | Ga0495581_0000983 | 3300047315 | Bacteria | 15316 |
| 624 | Ga0495604_0000056 | 3300047317 | Bacteria | 100110 |
| 625 | Ga0495604_0003466 | 3300047317 | Bacteria | 12570 |
| 626 | Ga0495604_0006459 | 3300047317 | Bacteria | 9300 |
| 627 | Ga0495604_0009004 | 3300047317 | Bacteria | 7895 |
| 628 | Ga0495604_0049521 | 3300047317 | Bacteria | 3264 |
| 629 | Ga0495604_0071262 | 3300047317 | Bacteria | 2629 |
| 630 | Ga0495674_0000042 | 3300047319 | Bacteria | 94820 |
| 631 | Ga0495674_0007533 | 3300047319 | Bacteria | 10396 |
| 632 | Ga0495674_0030284 | 3300047319 | Bacteria | 4922 |
| 633 | Ga0495676_0005250 | 3300047321 | Bacteria | 11854 |
| 634 | Ga0495676_0078076 | 3300047321 | Bacteria | 2522 |
| 635 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 636 | Ga0495680_0000421 | 3300047322 | Bacteria | 47432 |
| 637 | Ga0495680_0003583 | 3300047322 | Bacteria | 15204 |
| 638 | Ga0495680_0005597 | 3300047322 | Bacteria | 11781 |
| 639 | Ga0495680_0021298 | 3300047322 | Bacteria | 5429 |
| 640 | Ga0495675_0000209 | 3300047444 | Bacteria | 42691 |
| 641 | Ga0495675_0065903 | 3300047444 | Bacteria | 2290 |
| 642 | Ga0495675_0171167 | 3300047444 | Bacteria | 1334 |
| 643 | Ga0495679_011414 | 3300047446 | Bacteria | 3429 |
| 644 | Ga0495681_0000015 | 3300047470 | Bacteria | 183538 |
| 645 | Ga0495684_0010019 | 3300047471 | Bacteria | 7327 |
| 646 | Ga0495684_0010791 | 3300047471 | Bacteria | 7061 |
| 647 | Ga0495602_0000228 | 3300048088 | Bacteria | 52649 |
| 648 | Ga0495602_0046294 | 3300048088 | Bacteria | 3930 |
| 649 | Ga0495602_0061923 | 3300048088 | Bacteria | 3249 |
| 650 | Ga0495602_0130113 | 3300048088 | Bacteria | 2009 |
| 651 | Ga0495602_0210737 | 3300048088 | Bacteria | 1475 |
| 652 | Ga0496100_0005985 | 3300048903 | Bacteria | 6599 |
| 653 | Ga0496100_0006019 | 3300048903 | Bacteria | 6584 |
| 654 | Ga0496100_0120231 | 3300048903 | Bacteria | 1836 |
| 655 | Ga0496100_0179643 | 3300048903 | Bacteria | 1530 |
| 656 | Ga0496101_0001626 | 3300048904 | Bacteria | 13507 |
| 657 | Ga0496101_0032186 | 3300048904 | Bacteria | 3689 |
| 658 | Ga0496102_0001674 | 3300048905 | Bacteria | 19466 |
| 659 | Ga0496102_0008240 | 3300048905 | Bacteria | 8924 |
| 660 | Ga0496102_0017155 | 3300048905 | Bacteria | 6340 |
| 661 | Ga0496102_0023784 | 3300048905 | Bacteria | 5444 |
| 662 | Ga0496102_0027850 | 3300048905 | Bacteria | 5047 |
| 663 | Ga0496102_0042632 | 3300048905 | Bacteria | 4112 |
| 664 | Ga0496102_0044639 | 3300048905 | Bacteria | 4023 |
| 665 | Ga0496102_0218064 | 3300048905 | Bacteria | 1798 |
| 666 | Ga0496102_0282216 | 3300048905 | Bacteria | 1565 |
| 667 | Ga0496103_0002323 | 3300048906 | Bacteria | 12016 |
| 668 | Ga0496103_0004839 | 3300048906 | Bacteria | 8133 |
| 669 | Ga0496103_0061251 | 3300048906 | Bacteria | 2340 |
| 670 | Ga0496103_0080885 | 3300048906 | Bacteria | 2043 |
| 671 | Ga0496103_0146001 | 3300048906 | Bacteria | 1514 |
| 672 | Ga0496104_0000576 | 3300048907 | Bacteria | 31360 |
| 673 | Ga0496104_0002883 | 3300048907 | Bacteria | 14819 |
| 674 | Ga0496104_0007540 | 3300048907 | Bacteria | 9621 |
| 675 | Ga0496104_0025674 | 3300048907 | Bacteria | 5434 |
| 676 | Ga0496104_0059650 | 3300048907 | Bacteria | 3612 |
| 677 | Ga0496104_0086342 | 3300048907 | Bacteria | 2995 |
| 678 | Ga0496104_0167800 | 3300048907 | Bacteria | 2105 |
| 679 | Ga0496104_0346090 | 3300048907 | Bacteria | 1399 |
| 680 | Ga0496104_0350863 | 3300048907 | Bacteria | 1388 |
| 681 | Ga0496105_0001400 | 3300048908 | Bacteria | 16942 |
| 682 | Ga0496105_0001452 | 3300048908 | Bacteria | 16682 |
| 683 | Ga0496105_0005013 | 3300048908 | Bacteria | 10024 |
| 684 | Ga0496105_0006590 | 3300048908 | Bacteria | 8939 |
| 685 | Ga0496105_0009052 | 3300048908 | Bacteria | 7768 |
| 686 | Ga0496105_0117228 | 3300048908 | Bacteria | 2196 |
| 687 | Ga0496105_0264236 | 3300048908 | Bacteria | 1391 |
| 688 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 689 | Ga0496107_0022185 | 3300048910 | Bacteria | 4486 |
| 690 | Ga0496107_0026446 | 3300048910 | Bacteria | 4114 |
| 691 | Ga0496107_0052198 | 3300048910 | Bacteria | 2949 |
| 692 | Ga0496107_0057330 | 3300048910 | Bacteria | 2816 |
| 693 | Ga0496107_0106160 | 3300048910 | Bacteria | 2062 |
| 694 | Ga0496107_0174142 | 3300048910 | Bacteria | 1597 |
| 695 | Ga0496107_0338919 | 3300048910 | Bacteria | 1119 |
| 696 | Ga0496108_0000045 | 3300048911 | Bacteria | 137416 |
| 697 | Ga0496108_0000631 | 3300048911 | Bacteria | 27478 |
| 698 | Ga0496108_0001695 | 3300048911 | Bacteria | 17470 |
| 699 | Ga0496108_0002798 | 3300048911 | Bacteria | 13983 |
| 700 | Ga0496108_0008008 | 3300048911 | Bacteria | 8574 |
| 701 | Ga0496108_0010904 | 3300048911 | Bacteria | 7378 |
| 702 | Ga0496108_0020923 | 3300048911 | Bacteria | 5379 |
| 703 | Ga0496108_0026529 | 3300048911 | Bacteria | 4779 |
| 704 | Ga0496108_0041446 | 3300048911 | Bacteria | 3844 |
| 705 | Ga0496109_0000032 | 3300048912 | Bacteria | 162984 |
| 706 | Ga0496109_0000085 | 3300048912 | Bacteria | 95437 |
| 707 | Ga0496109_0001613 | 3300048912 | Bacteria | 18839 |
| 708 | Ga0496109_0002720 | 3300048912 | Bacteria | 14822 |
| 709 | Ga0496109_0003228 | 3300048912 | Bacteria | 13577 |
| 710 | Ga0496109_0028090 | 3300048912 | Bacteria | 5029 |
| 711 | Ga0496109_0035376 | 3300048912 | Bacteria | 4505 |
| 712 | Ga0496109_0180730 | 3300048912 | Bacteria | 1981 |
| 713 | Ga0496109_0230154 | 3300048912 | Bacteria | 1744 |
| 714 | Ga0496109_0280872 | 3300048912 | Bacteria | 1569 |
| 715 | Ga0496109_0412684 | 3300048912 | Bacteria | 1276 |
| 716 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 717 | Ga0496110_0001195 | 3300048913 | Bacteria | 18498 |
| 718 | Ga0496110_0001566 | 3300048913 | Bacteria | 16673 |
| 719 | Ga0496110_0005612 | 3300048913 | Bacteria | 9847 |
| 720 | Ga0496110_0017994 | 3300048913 | Bacteria | 5919 |
| 721 | Ga0496110_0020938 | 3300048913 | Bacteria | 5525 |
| 722 | Ga0496110_0027759 | 3300048913 | Bacteria | 4855 |
| 723 | Ga0496110_0075847 | 3300048913 | Bacteria | 2988 |
| 724 | Ga0496110_0076003 | 3300048913 | Bacteria | 2985 |
| 725 | Ga0496110_0146832 | 3300048913 | Bacteria | 2134 |
| 726 | Ga0496110_0155076 | 3300048913 | Bacteria | 2074 |
| 727 | Ga0496110_0231305 | 3300048913 | Bacteria | 1681 |
| 728 | Ga0496110_0250567 | 3300048913 | Bacteria | 1612 |
| 729 | Ga0496111_0000230 | 3300048914 | Bacteria | 26717 |
| 730 | Ga0496111_0002628 | 3300048914 | Bacteria | 10890 |
| 731 | Ga0496111_0010363 | 3300048914 | Bacteria | 6251 |
| 732 | Ga0496111_0013018 | 3300048914 | Bacteria | 5648 |
| 733 | Ga0496111_0017713 | 3300048914 | Bacteria | 4926 |
| 734 | Ga0496111_0043856 | 3300048914 | Bacteria | 3216 |
| 735 | Ga0496111_0051808 | 3300048914 | Bacteria | 2964 |
| 736 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 737 | Ga0496112_0001529 | 3300048915 | Bacteria | 17832 |
| 738 | Ga0496112_0017217 | 3300048915 | Bacteria | 6785 |
| 739 | Ga0496112_0046356 | 3300048915 | Bacteria | 4263 |
| 740 | Ga0496113_0000007 | 3300048916 | Bacteria | 95884 |
| 741 | Ga0496113_0002837 | 3300048916 | Bacteria | 10193 |
| 742 | Ga0496113_0009418 | 3300048916 | Bacteria | 6407 |
| 743 | Ga0496113_0046175 | 3300048916 | Bacteria | 3233 |
| 744 | Ga0496113_0121550 | 3300048916 | Bacteria | 2042 |
| 745 | Ga0496113_0216946 | 3300048916 | Bacteria | 1524 |
| 746 | Ga0496114_0000184 | 3300048917 | Bacteria | 44982 |
| 747 | Ga0496114_0000466 | 3300048917 | Bacteria | 29601 |
| 748 | Ga0496114_0001692 | 3300048917 | Bacteria | 16754 |
| 749 | Ga0496114_0009498 | 3300048917 | Bacteria | 7719 |
| 750 | Ga0496114_0012600 | 3300048917 | Bacteria | 6774 |
| 751 | Ga0496114_0060025 | 3300048917 | Bacteria | 3178 |
| 752 | Ga0496114_0071057 | 3300048917 | Bacteria | 2924 |
| 753 | Ga0496114_0072956 | 3300048917 | Bacteria | 2888 |
| 754 | Ga0496114_0157537 | 3300048917 | Bacteria | 1972 |
| 755 | Ga0496115_0000001 | 3300048918 | Bacteria | 367230 |
| 756 | Ga0496115_0005218 | 3300048918 | Bacteria | 9445 |
| 757 | Ga0496115_0005222 | 3300048918 | Bacteria | 9440 |
| 758 | Ga0496115_0008262 | 3300048918 | Bacteria | 7694 |
| 759 | Ga0496115_0036943 | 3300048918 | Bacteria | 3869 |
| 760 | Ga0496115_0083536 | 3300048918 | Bacteria | 2603 |
| 761 | Ga0496116_0000780 | 3300048919 | Bacteria | 40473 |
| 762 | Ga0496117_0015033 | 3300048920 | Bacteria | 6631 |
| 763 | Ga0496118_0000174 | 3300048921 | Bacteria | 115950 |
| 764 | Ga0496119_0003727 | 3300048922 | Bacteria | 15609 |
| 765 | Ga0496119_0004215 | 3300048922 | Bacteria | 14439 |
| 766 | Ga0496120_0004252 | 3300048923 | Bacteria | 12205 |
| 767 | Ga0496121_0005891 | 3300048924 | Bacteria | 15512 |
| 768 | Ga0496121_0016585 | 3300048924 | Bacteria | 7593 |
| 769 | Ga0496125_0013994 | 3300048928 | Bacteria | 7845 |
| 770 | Ga0496126_0029904 | 3300048929 | Bacteria | 5170 |
| 771 | Ga0501031_0000445 | 3300049568 | Bacteria | 23857 |
| 772 | Ga0501031_0058633 | 3300049568 | Bacteria | 2508 |
| 773 | Ga0501031_0140303 | 3300049568 | Bacteria | 1579 |
| 774 | Ga0501032_0000876 | 3300049569 | Bacteria | 24428 |
| 775 | Ga0501032_0064563 | 3300049569 | Bacteria | 2450 |
| 776 | Ga0501032_0192763 | 3300049569 | Bacteria | 1332 |
| 777 | Ga0501033_0000294 | 3300049570 | Bacteria | 47989 |
| 778 | Ga0501033_0014207 | 3300049570 | Bacteria | 6052 |
| 779 | Ga0501033_0215408 | 3300049570 | Bacteria | 1369 |
| 780 | Ga0501034_0003200 | 3300049571 | Bacteria | 18796 |
| 781 | Ga0501036_0001590 | 3300049572 | Bacteria | 17574 |
| 782 | Ga0501036_0005562 | 3300049572 | Bacteria | 10223 |
| 783 | Ga0501036_0012995 | 3300049572 | Bacteria | 6913 |
| 784 | Ga0501036_0183971 | 3300049572 | Bacteria | 1758 |
| 785 | Ga0501037_0000378 | 3300049573 | Bacteria | 37014 |
| 786 | Ga0501037_0005716 | 3300049573 | Bacteria | 9075 |
| 787 | Ga0501037_0169474 | 3300049573 | Bacteria | 1553 |
| 788 | Ga0501038_0000087 | 3300049574 | Bacteria | 78741 |
| 789 | Ga0501038_0008491 | 3300049574 | Bacteria | 9442 |
| 790 | Ga0501038_0132419 | 3300049574 | Bacteria | 2045 |
| 791 | Ga0501038_0344533 | 3300049574 | Bacteria | 1162 |
| 792 | Ga0501039_0001020 | 3300049575 | Bacteria | 20404 |
| 793 | Ga0501039_0003991 | 3300049575 | Bacteria | 11095 |
| 794 | Ga0501039_0103067 | 3300049575 | Bacteria | 2227 |
| 795 | Ga0501039_0139021 | 3300049575 | Bacteria | 1907 |
| 796 | Ga0501040_0000007 | 3300049576 | Bacteria | 90368 |
| 797 | Ga0501040_0000954 | 3300049576 | Bacteria | 18260 |
| 798 | Ga0501040_0006120 | 3300049576 | Bacteria | 7804 |
| 799 | Ga0501040_0017844 | 3300049576 | Bacteria | 4711 |
| 800 | Ga0501040_0040161 | 3300049576 | Bacteria | 3183 |
| 801 | Ga0501041_0000005 | 3300049577 | Bacteria | 75426 |
| 802 | Ga0501041_0001093 | 3300049577 | Bacteria | 14842 |
| 803 | Ga0501041_0002281 | 3300049577 | Bacteria | 10857 |
| 804 | Ga0501042_0003216 | 3300049578 | Bacteria | 10205 |
| 805 | Ga0501042_0003964 | 3300049578 | Bacteria | 9370 |
| 806 | Ga0501042_0034208 | 3300049578 | Bacteria | 3604 |
| 807 | Ga0501042_0069176 | 3300049578 | Bacteria | 2525 |
| 808 | Ga0501042_0145464 | 3300049578 | Bacteria | 1709 |
| 809 | Ga0501043_0000998 | 3300049579 | Bacteria | 24892 |
| 810 | Ga0501043_0048746 | 3300049579 | Bacteria | 3329 |
| 811 | Ga0501046_0001278 | 3300049580 | Bacteria | 24362 |
| 812 | Ga0501046_0017453 | 3300049580 | Bacteria | 5990 |
| 813 | Ga0501046_0028136 | 3300049580 | Bacteria | 4580 |
| 814 | Ga0501047_0000592 | 3300049581 | Bacteria | 38584 |
| 815 | Ga0501047_0009620 | 3300049581 | Bacteria | 9141 |
| 816 | Ga0501047_0014482 | 3300049581 | Bacteria | 7501 |
| 817 | Ga0501047_0084809 | 3300049581 | Bacteria | 3044 |
| 818 | Ga0501048_0000018 | 3300049582 | Bacteria | 72234 |
| 819 | Ga0501048_0001926 | 3300049582 | Bacteria | 15771 |
| 820 | Ga0501048_0011634 | 3300049582 | Bacteria | 6563 |
| 821 | Ga0501067_0000808 | 3300049583 | Bacteria | 16867 |
| 822 | Ga0501067_0009559 | 3300049583 | Bacteria | 5372 |
| 823 | Ga0501067_0073981 | 3300049583 | Bacteria | 1887 |
| 824 | Ga0501068_0000134 | 3300049584 | Bacteria | 33588 |
| 825 | Ga0501068_0011873 | 3300049584 | Bacteria | 4924 |
| 826 | Ga0501068_0018498 | 3300049584 | Bacteria | 4035 |
| 827 | Ga0501068_0028798 | 3300049584 | Bacteria | 3287 |
| 828 | Ga0501068_0203733 | 3300049584 | Bacteria | 1255 |
| 829 | Ga0501069_0000426 | 3300049585 | Bacteria | 19142 |
| 830 | Ga0501069_0007694 | 3300049585 | Bacteria | 5652 |
| 831 | Ga0501069_0009322 | 3300049585 | Bacteria | 5181 |
| 832 | Ga0501070_0004569 | 3300049586 | Bacteria | 11863 |
| 833 | Ga0501070_0005855 | 3300049586 | Bacteria | 10483 |
| 834 | Ga0501070_0009281 | 3300049586 | Bacteria | 8320 |
| 835 | Ga0501070_0018067 | 3300049586 | Bacteria | 5917 |
| 836 | Ga0501071_0000005 | 3300049587 | Bacteria | 78747 |
| 837 | Ga0501071_0001995 | 3300049587 | Bacteria | 12192 |
| 838 | Ga0501071_0019490 | 3300049587 | Bacteria | 4707 |
| 839 | Ga0501071_0039336 | 3300049587 | Bacteria | 3383 |
| 840 | Ga0501071_0225339 | 3300049587 | Bacteria | 1412 |
| 841 | Ga0501072_0000269 | 3300049588 | Bacteria | 37902 |
| 842 | Ga0501072_0004831 | 3300049588 | Bacteria | 10263 |
| 843 | Ga0501072_0012028 | 3300049588 | Bacteria | 6611 |
| 844 | Ga0501072_0014925 | 3300049588 | Bacteria | 5954 |
| 845 | Ga0501072_0035580 | 3300049588 | Bacteria | 3901 |
| 846 | Ga0501072_0038239 | 3300049588 | Bacteria | 3765 |
| 847 | Ga0501072_0357554 | 3300049588 | Bacteria | 1159 |
| 848 | Ga0501073_0001327 | 3300049589 | Bacteria | 18226 |
| 849 | Ga0501073_0033451 | 3300049589 | Bacteria | 3660 |
| 850 | Ga0501073_0061038 | 3300049589 | Bacteria | 2631 |
| 851 | Ga0501073_0065493 | 3300049589 | Bacteria | 2534 |
| 852 | Ga0501074_0001138 | 3300049590 | Bacteria | 17415 |
| 853 | Ga0501074_0044985 | 3300049590 | Bacteria | 3194 |
| 854 | Ga0501074_0060672 | 3300049590 | Bacteria | 2724 |
| 855 | Ga0501074_0136292 | 3300049590 | Bacteria | 1756 |
| 856 | Ga0501074_0161055 | 3300049590 | Bacteria | 1603 |
| 857 | Ga0501074_0164036 | 3300049590 | Bacteria | 1586 |
| 858 | Ga0501075_0000009 | 3300049591 | Bacteria | 97052 |
| 859 | Ga0501075_0000193 | 3300049591 | Bacteria | 31987 |
| 860 | Ga0501075_0007396 | 3300049591 | Bacteria | 7619 |
| 861 | Ga0501075_0021317 | 3300049591 | Bacteria | 4722 |
| 862 | Ga0501075_0062138 | 3300049591 | Bacteria | 2815 |
| 863 | Ga0501075_0110785 | 3300049591 | Bacteria | 2087 |
| 864 | Ga0501076_0000028 | 3300049592 | Bacteria | 76828 |
| 865 | Ga0501076_0001292 | 3300049592 | Bacteria | 16692 |
| 866 | Ga0501076_0004133 | 3300049592 | Bacteria | 10264 |
| 867 | Ga0501076_0011312 | 3300049592 | Bacteria | 6642 |
| 868 | Ga0501076_0036691 | 3300049592 | Bacteria | 3841 |
| 869 | Ga0501076_0137670 | 3300049592 | Bacteria | 1983 |
| 870 | Ga0501076_0170136 | 3300049592 | Bacteria | 1776 |
| 871 | Ga0501077_0000006 | 3300049593 | Bacteria | 119936 |
| 872 | Ga0501077_0001176 | 3300049593 | Bacteria | 15828 |
| 873 | Ga0501077_0020007 | 3300049593 | Bacteria | 4235 |
| 874 | Ga0501077_0036690 | 3300049593 | Bacteria | 3123 |
| 875 | Ga0501077_0173009 | 3300049593 | Bacteria | 1372 |
| 876 | Ga0501202_029492 | 3300049652 | Bacteria | 1138 |
| 877 | Ga0501079_0000881 | 3300049741 | Bacteria | 20585 |
| 878 | Ga0501079_0000929 | 3300049741 | Bacteria | 20116 |
| 879 | Ga0501079_0003399 | 3300049741 | Bacteria | 11682 |
| 880 | Ga0501079_0025921 | 3300049741 | Bacteria | 4497 |
| 881 | Ga0501079_0050832 | 3300049741 | Bacteria | 3198 |
| 882 | Ga0501079_0088348 | 3300049741 | Bacteria | 2400 |
| 883 | Ga0501079_0133505 | 3300049741 | Bacteria | 1932 |
| 884 | Ga0501080_0000626 | 3300049742 | Bacteria | 28026 |
| 885 | Ga0501080_0032292 | 3300049742 | Bacteria | 4881 |
| 886 | Ga0501080_0046552 | 3300049742 | Bacteria | 4038 |
| 887 | Ga0501081_0000003 | 3300049743 | Bacteria | 97558 |
| 888 | Ga0501081_0000159 | 3300049743 | Bacteria | 31036 |
| 889 | Ga0501081_0001137 | 3300049743 | Bacteria | 16055 |
| 890 | Ga0501081_0043392 | 3300049743 | Bacteria | 3085 |
| 891 | Ga0501081_0321051 | 3300049743 | Bacteria | 1138 |
| 892 | Ga0501083_0001673 | 3300049744 | Bacteria | 15132 |
| 893 | Ga0501083_0008047 | 3300049744 | Bacteria | 7457 |
| 894 | Ga0501083_0021756 | 3300049744 | Bacteria | 4454 |
| 895 | Ga0501083_0034238 | 3300049744 | Bacteria | 3474 |
| 896 | Ga0501035_0000175 | 3300049822 | Bacteria | 78747 |
| 897 | Ga0501035_0068212 | 3300049822 | Bacteria | 3154 |
| 898 | Ga0501035_0078473 | 3300049822 | Bacteria | 2916 |
| 899 | Ga0501044_0006303 | 3300049823 | Bacteria | 13113 |
| 900 | Ga0501044_0038039 | 3300049823 | Bacteria | 5025 |
| 901 | Ga0501044_0065287 | 3300049823 | Bacteria | 3712 |
| 902 | Ga0501044_0101327 | 3300049823 | Bacteria | 2897 |
| 903 | Ga0501045_0000009 | 3300049824 | Bacteria | 75255 |
| 904 | Ga0501045_0002161 | 3300049824 | Bacteria | 13314 |
| 905 | Ga0501045_0002370 | 3300049824 | Bacteria | 12795 |
| 906 | Ga0501045_0056157 | 3300049824 | Bacteria | 2879 |
| 907 | Ga0501045_0063835 | 3300049824 | Bacteria | 2703 |
| 908 | Ga0501045_0083925 | 3300049824 | Bacteria | 2350 |
| 909 | nmdc:mga00v17_38242_c1 | 3300050491 | Bacteria | 2868 |
| 910 | nmdc:mga00v17_42955_c1 | 3300050491 | Bacteria | 2721 |
| 911 | nmdc:mga00v17_87324_c1 | 3300050491 | Bacteria | 1955 |
| 912 | nmdc:mga0yw44_110719_c1 | 3300050492 | Bacteria | 1759 |
| 913 | nmdc:mga0yw44_16_c1 | 3300050492 | Bacteria | 80085 |
| 914 | nmdc:mga0yw44_24400_c1 | 3300050492 | Bacteria | 3421 |
| 915 | nmdc:mga0yw44_30503_c1 | 3300050492 | Bacteria | 3125 |
| 916 | nmdc:mga06z11_159774_c1 | 3300050494 | Bacteria | 1287 |
| 917 | nmdc:mga05p37_116658_c1 | 3300050507 | Bacteria | 3281 |
| 918 | nmdc:mga05p37_145145_c1 | 3300050507 | Bacteria | 2906 |
| 919 | nmdc:mga05p37_163019_c1 | 3300050507 | Bacteria | 2722 |
| 920 | nmdc:mga05p37_43470_c1 | 3300050507 | Bacteria | 5528 |
| 921 | nmdc:mga05p37_8447_c1 | 3300050507 | Bacteria | 12180 |
| 922 | nmdc:mga09592_1116_c1 | 3300050508 | Bacteria | 21373 |
| 923 | nmdc:mga09592_330607_c1 | 3300050508 | Bacteria | 1319 |
| 924 | nmdc:mga09592_49273_c1 | 3300050508 | Bacteria | 3551 |
| 925 | nmdc:mga0qj67_1508_c1 | 3300050509 | Bacteria | 16319 |
| 926 | nmdc:mga0qj67_76093_c1 | 3300050509 | Bacteria | 2684 |
| 927 | nmdc:mga0qj67_83580_c1 | 3300050509 | Bacteria | 2559 |
| 928 | nmdc:mga0qj67_9898_c1 | 3300050509 | Bacteria | 7109 |
| 929 | nmdc:mga06r32_351571_c1 | 3300050510 | Bacteria | 1458 |
| 930 | nmdc:mga06r32_4240_c1 | 3300050510 | Bacteria | 12848 |
| 931 | nmdc:mga06r32_60098_c1 | 3300050510 | Bacteria | 3656 |
| 932 | nmdc:mga06r32_80394_c1 | 3300050510 | Bacteria | 3172 |
| 933 | nmdc:mga08y16_16311_c1 | 3300050511 | Bacteria | 7809 |
| 934 | nmdc:mga08y16_2936_c1 | 3300050511 | Bacteria | 17557 |
| 935 | nmdc:mga08y16_368483_c1 | 3300050511 | Bacteria | 1474 |
| 936 | nmdc:mga08y16_640486_c1 | 3300050511 | Bacteria | 1068 |
| 937 | nmdc:mga0n895_204409_c1 | 3300050512 | Bacteria | 2006 |
| 938 | nmdc:mga0rr50_2782_c1 | 3300050513 | Bacteria | 9943 |
| 939 | nmdc:mga08x19_125208_c1 | 3300050514 | Bacteria | 1725 |
| 940 | nmdc:mga08x19_62434_c1 | 3300050514 | Bacteria | 2416 |
| 941 | nmdc:mga0a205_97616_c1 | 3300050515 | Bacteria | 2837 |
| 942 | Ga0495601_0000086 | 3300053077 | Bacteria | 50421 |
| 943 | Ga0495601_0030309 | 3300053077 | Bacteria | 3358 |
| 944 | Ga0495601_0078139 | 3300053077 | Bacteria | 2120 |
| 945 | Ga0495601_0096050 | 3300053077 | Bacteria | 1911 |
| 946 | Ga0495612_0000410 | 3300053078 | Bacteria | 17077 |
| 947 | Ga0495612_0005844 | 3300053078 | Bacteria | 5082 |
| 948 | Ga0495612_0011495 | 3300053078 | Bacteria | 3570 |
| 949 | Ga0495655_0001739 | 3300053083 | Bacteria | 3377 |
| 950 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 951 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 952 | Ga0495595_0013656 | 3300053084 | Bacteria | 3433 |
| 953 | Ga0495595_0027010 | 3300053084 | Bacteria | 2554 |
| 954 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 955 | Ga0495619_0000319 | 3300053085 | Bacteria | 33678 |
| 956 | Ga0495619_0003097 | 3300053085 | Bacteria | 10800 |
| 957 | Ga0495619_0008074 | 3300053085 | Bacteria | 6662 |
| 958 | Ga0495619_0010328 | 3300053085 | Bacteria | 5876 |
| 959 | Ga0495619_0143613 | 3300053085 | Bacteria | 1645 |
| 960 | Ga0500641_0002398 | 3300053096 | Bacteria | 6646 |
| 961 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 962 | Ga0500595_021781 | 3300053119 | Bacteria | 2282 |
| 963 | Ga0500628_002474 | 3300053129 | Bacteria | 3052 |
| 964 | Ga0501084_0001358 | 3300054114 | Bacteria | 19353 |
| 965 | Ga0501084_0005874 | 3300054114 | Bacteria | 10101 |
| 966 | Ga0501084_0016458 | 3300054114 | Bacteria | 6142 |
| 967 | Ga0501084_0050734 | 3300054114 | Bacteria | 3471 |
| 968 | Ga0501084_0352493 | 3300054114 | Bacteria | 1243 |
| 969 | Ga0590071_011163 | 3300059421 | Bacteria | 2103 |
| 970 | Ga0590075_003699 | 3300059424 | Bacteria | 3632 |
| 971 | Ga0590077_004894 | 3300059426 | Bacteria | 2740 |
| 972 | Ga0501082_0000063 | 3300060353 | Bacteria | 76891 |
| 973 | Ga0501082_0001009 | 3300060353 | Bacteria | 24886 |
| 974 | Ga0501082_0010791 | 3300060353 | Bacteria | 7866 |
| 975 | Ga0501082_0033591 | 3300060353 | Bacteria | 4426 |
| 976 | Ga0501082_0042607 | 3300060353 | Bacteria | 3913 |
| 977 | Ga0501082_0047272 | 3300060353 | Bacteria | 3708 |
| 978 | Ga0501082_0195502 | 3300060353 | Bacteria | 1759 |
| 979 | Ga0530510_0000014 | 3300061734 | Bacteria | 106661 |
| 980 | Ga0530510_0001148 | 3300061734 | Bacteria | 17568 |
| 981 | Ga0530510_0014247 | 3300061734 | Bacteria | 5606 |
| 982 | Ga0530510_0016425 | 3300061734 | Bacteria | 5240 |
| 983 | Ga0530510_0031133 | 3300061734 | Bacteria | 3835 |
| 984 | Ga0530510_0046814 | 3300061734 | Bacteria | 3125 |
| 985 | Ga0530510_0154128 | 3300061734 | Bacteria | 1697 |
| 986 | Ga0530510_0211494 | 3300061734 | Bacteria | 1441 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0140175 | Ga0495629_0140175_852_1670 | 263 |
| 2 | 3300035207 | Ga0373942_0030371 | Ga0373942_0030371_39_866 | 265 |
| 3 | 3300044694 | Ga0466963_0130885 | Ga0466963_0130885_17_910 | 267 |
| 4 | 3300028653 | Ga0265323_10019618 | Ga0265323_100196181 | 281 |
| 5 | 3300044693 | Ga0466961_0114028 | Ga0466961_0114028_418_1371 | 286 |
| 6 | 3300044842 | Ga0466957_0124802 | Ga0466957_0124802_314_1267 | 286 |
| 7 | 3300045049 | Ga0466959_0002692 | Ga0466959_0002692_2411_3364 | 286 |
| 8 | 3300045836 | Ga0466958_0005927 | Ga0466958_0005927_4031_4984 | 286 |
| 9 | 3300046452 | Ga0495617_006590 | Ga0495617_006590_2465_3391 | 295 |
| 10 | 3300046453 | Ga0495627_034218 | Ga0495627_034218_56_982 | 295 |
| 11 | 3300046512 | Ga0495610_0000053 | Ga0495610_0000053_85429_86355 | 295 |
| 12 | 3300047470 | Ga0495681_0000015 | Ga0495681_0000015_3997_4923 | 295 |
| 13 | 3300049592 | Ga0501076_0137670 | Ga0501076_0137670_311_1294 | 296 |
| 14 | 3300061734 | Ga0530510_0016425 | Ga0530510_0016425_1454_2437 | 296 |
| 15 | 3300049584 | Ga0501068_0018498 | Ga0501068_0018498_1664_2647 | 302 |
| 16 | 3300049591 | Ga0501075_0021317 | Ga0501075_0021317_2670_3653 | 302 |
| 17 | 3300049741 | Ga0501079_0088348 | Ga0501079_0088348_1193_2176 | 302 |
| 18 | 3300054114 | Ga0501084_0352493 | Ga0501084_0352493_145_1128 | 302 |
| 19 | 3300060353 | Ga0501082_0033591 | Ga0501082_0033591_2922_3905 | 302 |
| 20 | 3300005457 | Ga0070662_100000363 | Ga0070662_10000036313 | 304 |
| 21 | 3300025933 | Ga0207706_10000006 | Ga0207706_1000000618 | 304 |
| 22 | 3300049584 | Ga0501068_0203733 | Ga0501068_0203733_213_1208 | 305 |
| 23 | 3300049588 | Ga0501072_0035580 | Ga0501072_0035580_1098_2093 | 305 |
| 24 | 3300049589 | Ga0501073_0061038 | Ga0501073_0061038_453_1448 | 305 |
| 25 | 3300049744 | Ga0501083_0034238 | Ga0501083_0034238_985_1980 | 305 |
| 26 | 3300048918 | Ga0496115_0000001 | Ga0496115_0000001_139146_140081 | 306 |
| 27 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_492590_493525 | 306 |
| 28 | 3300053129 | Ga0500628_002474 | Ga0500628_002474_1426_2358 | 306 |
| 29 | 3300006051 | Ga0075364_10159535 | Ga0075364_101595352 | 307 |
| 30 | 3300049586 | Ga0501070_0018067 | Ga0501070_0018067_3210_4211 | 307 |
| 31 | 3300050491 | nmdc:mga00v17_87324_c1 | nmdc:mga00v17_87324_c1_738_1676 | 307 |
| 32 | 3300006038 | Ga0075365_10000014 | Ga0075365_100000142 | 308 |
| 33 | 3300009098 | Ga0105245_10010311 | Ga0105245_100103111 | 308 |
| 34 | 3300009993 | Ga0105028_101263 | Ga0105028_1012632 | 308 |
| 35 | 3300013102 | Ga0157371_10009099 | Ga0157371_100090996 | 308 |
| 36 | 3300028556 | Ga0265337_1000054 | Ga0265337_100005437 | 308 |
| 37 | 3300028558 | Ga0265326_10000027 | Ga0265326_1000002740 | 308 |
| 38 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003249 | 308 |
| 39 | 3300029957 | Ga0265324_10000103 | Ga0265324_1000010334 | 308 |
| 40 | 3300030733 | Ga0314311_1122819 | Ga0314311_11228192 | 308 |
| 41 | 3300030734 | Ga0316179_1002117 | Ga0316179_100211743 | 308 |
| 42 | 3300030736 | Ga0316180_1070555 | Ga0316180_10705552 | 308 |
| 43 | 3300030742 | Ga0316183_1122503 | Ga0316183_112250316 | 308 |
| 44 | 3300030745 | Ga0316182_1020791 | Ga0316182_102079120 | 308 |
| 45 | 3300031238 | Ga0265332_10007198 | Ga0265332_100071984 | 308 |
| 46 | 3300031239 | Ga0265328_10001275 | Ga0265328_100012756 | 308 |
| 47 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001249 | 308 |
| 48 | 3300031242 | Ga0265329_10002125 | Ga0265329_100021256 | 308 |
| 49 | 3300031250 | Ga0265331_10001895 | Ga0265331_100018954 | 308 |
| 50 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003249 | 308 |
| 51 | 3300031344 | Ga0265316_10020298 | Ga0265316_100202985 | 308 |
| 52 | 3300031711 | Ga0265314_10001375 | Ga0265314_100013756 | 308 |
| 53 | 3300042004 | Ga0439445_0002076 | Ga0439445_0002076_2342_3283 | 308 |
| 54 | 3300042006 | Ga0439432_006638 | Ga0439432_006638_2948_3889 | 308 |
| 55 | 3300049574 | Ga0501038_0344533 | Ga0501038_0344533_140_1120 | 308 |
| 56 | 3300049589 | Ga0501073_0065493 | Ga0501073_0065493_560_1516 | 308 |
| 57 | 3300049590 | Ga0501074_0136292 | Ga0501074_0136292_78_1061 | 308 |
| 58 | 3300049591 | Ga0501075_0110785 | Ga0501075_0110785_553_1536 | 308 |
| 59 | 3300049743 | Ga0501081_0043392 | Ga0501081_0043392_1496_2479 | 308 |
| 60 | 3300049824 | Ga0501045_0083925 | Ga0501045_0083925_666_1649 | 308 |
| 61 | 3300050492 | nmdc:mga0yw44_16_c1 | nmdc:mga0yw44_16_c1_78722_79663 | 308 |
| 62 | 3300005981 | Ga0081538_10001600 | Ga0081538_1000160015 | 309 |
| 63 | 3300005981 | Ga0081538_10122477 | Ga0081538_101224772 | 309 |
| 64 | 3300048918 | Ga0496115_0008262 | Ga0496115_0008262_2664_3686 | 309 |
| 65 | 3300050492 | nmdc:mga0yw44_24400_c1 | nmdc:mga0yw44_24400_c1_1002_1958 | 309 |
| 66 | 3300049742 | Ga0501080_0046552 | Ga0501080_0046552_1487_2482 | 310 |
| 67 | 3300005354 | Ga0070675_100089174 | Ga0070675_1000891743 | 311 |
| 68 | 3300005365 | Ga0070688_100053154 | Ga0070688_1000531542 | 311 |
| 69 | 3300005981 | Ga0081538_10000099 | Ga0081538_1000009972 | 311 |
| 70 | 3300014969 | Ga0157376_10096829 | Ga0157376_100968293 | 311 |
| 71 | 3300025960 | Ga0207651_10220835 | Ga0207651_102208351 | 311 |
| 72 | 3300026121 | Ga0207683_10343832 | Ga0207683_103438321 | 311 |
| 73 | 3300048903 | Ga0496100_0120231 | Ga0496100_0120231_641_1636 | 311 |
| 74 | 3300048914 | Ga0496111_0043856 | Ga0496111_0043856_2107_3102 | 311 |
| 75 | 3300006844 | Ga0075428_100078209 | Ga0075428_1000782095 | 312 |
| 76 | 3300006847 | Ga0075431_100227289 | Ga0075431_1002272892 | 312 |
| 77 | 3300006914 | Ga0075436_100135926 | Ga0075436_1001359262 | 312 |
| 78 | 3300050514 | nmdc:mga08x19_125208_c1 | nmdc:mga08x19_125208_c1_599_1660 | 312 |
| 79 | 3300005937 | Ga0081455_10007120 | Ga0081455_100071203 | 313 |
| 80 | 3300015261 | Ga0182006_1061684 | Ga0182006_10616842 | 313 |
| 81 | 3300037418 | Ga0395900_0124218 | Ga0395900_0124218_895_1845 | 313 |
| 82 | 3300037466 | Ga0395898_0254166 | Ga0395898_0254166_207_1157 | 313 |
| 83 | 3300037471 | Ga0395905_0401141 | Ga0395905_0401141_46_996 | 313 |
| 84 | 3300038443 | Ga0395901_0046351 | Ga0395901_0046351_1577_2527 | 313 |
| 85 | 3300044684 | Ga0466966_0232242 | Ga0466966_0232242_111_1064 | 313 |
| 86 | 3300005329 | Ga0070683_100013143 | Ga0070683_1000131433 | 314 |
| 87 | 3300005329 | Ga0070683_100023359 | Ga0070683_1000233597 | 314 |
| 88 | 3300005330 | Ga0070690_100301662 | Ga0070690_1003016621 | 314 |
| 89 | 3300005336 | Ga0070680_100004037 | Ga0070680_1000040377 | 314 |
| 90 | 3300005336 | Ga0070680_100005608 | Ga0070680_1000056083 | 314 |
| 91 | 3300005339 | Ga0070660_100001494 | Ga0070660_1000014943 | 314 |
| 92 | 3300005339 | Ga0070660_100305580 | Ga0070660_1003055802 | 314 |
| 93 | 3300005356 | Ga0070674_100000020 | Ga0070674_10000002018 | 314 |
| 94 | 3300005458 | Ga0070681_10008977 | Ga0070681_100089779 | 314 |
| 95 | 3300005530 | Ga0070679_100075881 | Ga0070679_1000758813 | 314 |
| 96 | 3300005535 | Ga0070684_100001226 | Ga0070684_10000122616 | 314 |
| 97 | 3300005535 | Ga0070684_100231040 | Ga0070684_1002310402 | 314 |
| 98 | 3300005577 | Ga0068857_100115283 | Ga0068857_1001152833 | 314 |
| 99 | 3300005718 | Ga0068866_10000019 | Ga0068866_1000001978 | 314 |
| 100 | 3300005981 | Ga0081538_10000252 | Ga0081538_1000025232 | 314 |
| 101 | 3300005981 | Ga0081538_10012000 | Ga0081538_100120005 | 314 |
| 102 | 3300006038 | Ga0075365_10062766 | Ga0075365_100627663 | 314 |
| 103 | 3300006051 | Ga0075364_10093685 | Ga0075364_100936852 | 314 |
| 104 | 3300009093 | Ga0105240_10026755 | Ga0105240_100267554 | 314 |
| 105 | 3300009098 | Ga0105245_10386593 | Ga0105245_103865932 | 314 |
| 106 | 3300013307 | Ga0157372_10151411 | Ga0157372_101514112 | 314 |
| 107 | 3300013308 | Ga0157375_10600278 | Ga0157375_106002781 | 314 |
| 108 | 3300020070 | Ga0206356_10987891 | Ga0206356_109878911 | 314 |
| 109 | 3300020082 | Ga0206353_11844079 | Ga0206353_118440796 | 314 |
| 110 | 3300025899 | Ga0207642_10000017 | Ga0207642_1000001776 | 314 |
| 111 | 3300025917 | Ga0207660_10018009 | Ga0207660_100180094 | 314 |
| 112 | 3300025917 | Ga0207660_10061128 | Ga0207660_100611283 | 314 |
| 113 | 3300025919 | Ga0207657_10001335 | Ga0207657_1000133522 | 314 |
| 114 | 3300025919 | Ga0207657_10271799 | Ga0207657_102717992 | 314 |
| 115 | 3300025920 | Ga0207649_10030765 | Ga0207649_100307652 | 314 |
| 116 | 3300025932 | Ga0207690_10326736 | Ga0207690_103267362 | 314 |
| 117 | 3300025937 | Ga0207669_10000016 | Ga0207669_10000016130 | 314 |
| 118 | 3300025944 | Ga0207661_10008416 | Ga0207661_100084167 | 314 |
| 119 | 3300026116 | Ga0207674_10072073 | Ga0207674_100720733 | 314 |
| 120 | 3300037312 | Ga0395899_0066624 | Ga0395899_0066624_1116_2072 | 314 |
| 121 | 3300037418 | Ga0395900_0117171 | Ga0395900_0117171_81_1037 | 314 |
| 122 | 3300037471 | Ga0395905_0025788 | Ga0395905_0025788_3966_4922 | 314 |
| 123 | 3300038443 | Ga0395901_0173308 | Ga0395901_0173308_564_1520 | 314 |
| 124 | 3300044694 | Ga0466963_0025241 | Ga0466963_0025241_1028_1984 | 314 |
| 125 | 3300045976 | Ga0466967_0079454 | Ga0466967_0079454_1165_2121 | 314 |
| 126 | 3300045976 | Ga0466967_0426272 | Ga0466967_0426272_245_1201 | 314 |
| 127 | 3300046461 | Ga0495641_0009756 | Ga0495641_0009756_3910_4923 | 314 |
| 128 | 3300046461 | Ga0495641_0070282 | Ga0495641_0070282_418_1383 | 314 |
| 129 | 3300046462 | Ga0495651_0004887 | Ga0495651_0004887_6418_7383 | 314 |
| 130 | 3300046463 | Ga0495653_0010741 | Ga0495653_0010741_4093_5058 | 314 |
| 131 | 3300046477 | Ga0495664_0045067 | Ga0495664_0045067_1352_2317 | 314 |
| 132 | 3300046511 | Ga0495608_0000406 | Ga0495608_0000406_15985_17004 | 314 |
| 133 | 3300046514 | Ga0495618_0000068 | Ga0495618_0000068_70493_71512 | 314 |
| 134 | 3300046516 | Ga0495628_0008805 | Ga0495628_0008805_828_1793 | 314 |
| 135 | 3300046517 | Ga0495630_0100644 | Ga0495630_0100644_885_1850 | 314 |
| 136 | 3300046533 | Ga0495640_0001520 | Ga0495640_0001520_10573_11538 | 314 |
| 137 | 3300046533 | Ga0495640_0041629 | Ga0495640_0041629_1315_2328 | 314 |
| 138 | 3300046559 | Ga0495667_0004189 | Ga0495667_0004189_2035_3000 | 314 |
| 139 | 3300046663 | Ga0495635_0180491 | Ga0495635_0180491_115_1080 | 314 |
| 140 | 3300046678 | Ga0495599_0080868 | Ga0495599_0080868_483_1448 | 314 |
| 141 | 3300046689 | Ga0495613_0020894 | Ga0495613_0020894_2124_3119 | 314 |
| 142 | 3300046809 | Ga0495600_0010047 | Ga0495600_0010047_4017_5036 | 314 |
| 143 | 3300047319 | Ga0495674_0000042 | Ga0495674_0000042_17733_18746 | 314 |
| 144 | 3300047319 | Ga0495674_0007533 | Ga0495674_0007533_2734_3699 | 314 |
| 145 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_30667_31686 | 314 |
| 146 | 3300047322 | Ga0495680_0003583 | Ga0495680_0003583_8319_9284 | 314 |
| 147 | 3300047444 | Ga0495675_0171167 | Ga0495675_0171167_307_1272 | 314 |
| 148 | 3300047471 | Ga0495684_0010791 | Ga0495684_0010791_1199_2164 | 314 |
| 149 | 3300048088 | Ga0495602_0130113 | Ga0495602_0130113_383_1348 | 314 |
| 150 | 3300048913 | Ga0496110_0075847 | Ga0496110_0075847_368_1363 | 314 |
| 151 | 3300048914 | Ga0496111_0051808 | Ga0496111_0051808_1662_2651 | 314 |
| 152 | 3300050491 | nmdc:mga00v17_38242_c1 | nmdc:mga00v17_38242_c1_1436_2464 | 314 |
| 153 | 3300050492 | nmdc:mga0yw44_30503_c1 | nmdc:mga0yw44_30503_c1_1219_2247 | 314 |
| 154 | 3300050510 | nmdc:mga06r32_80394_c1 | nmdc:mga06r32_80394_c1_857_1849 | 314 |
| 155 | 3300053077 | Ga0495601_0078139 | Ga0495601_0078139_330_1295 | 314 |
| 156 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_27450_28469 | 314 |
| 157 | 3300005327 | Ga0070658_10050495 | Ga0070658_100504953 | 315 |
| 158 | 3300005327 | Ga0070658_10165550 | Ga0070658_101655502 | 315 |
| 159 | 3300005329 | Ga0070683_100237672 | Ga0070683_1002376722 | 315 |
| 160 | 3300005337 | Ga0070682_100000080 | Ga0070682_10000008060 | 315 |
| 161 | 3300005339 | Ga0070660_100003867 | Ga0070660_1000038678 | 315 |
| 162 | 3300005339 | Ga0070660_100136777 | Ga0070660_1001367771 | 315 |
| 163 | 3300005339 | Ga0070660_100284427 | Ga0070660_1002844272 | 315 |
| 164 | 3300005344 | Ga0070661_100007123 | Ga0070661_1000071233 | 315 |
| 165 | 3300005344 | Ga0070661_100063455 | Ga0070661_1000634553 | 315 |
| 166 | 3300005366 | Ga0070659_100026115 | Ga0070659_1000261151 | 315 |
| 167 | 3300005458 | Ga0070681_10030842 | Ga0070681_100308423 | 315 |
| 168 | 3300005458 | Ga0070681_10183635 | Ga0070681_101836352 | 315 |
| 169 | 3300005530 | Ga0070679_100041206 | Ga0070679_1000412064 | 315 |
| 170 | 3300005539 | Ga0068853_100247958 | Ga0068853_1002479581 | 315 |
| 171 | 3300005546 | Ga0070696_100122600 | Ga0070696_1001226002 | 315 |
| 172 | 3300005548 | Ga0070665_100032824 | Ga0070665_1000328246 | 315 |
| 173 | 3300005563 | Ga0068855_100014350 | Ga0068855_1000143507 | 315 |
| 174 | 3300005563 | Ga0068855_100056520 | Ga0068855_1000565204 | 315 |
| 175 | 3300005563 | Ga0068855_100211426 | Ga0068855_1002114262 | 315 |
| 176 | 3300005578 | Ga0068854_100115490 | Ga0068854_1001154902 | 315 |
| 177 | 3300005614 | Ga0068856_100073050 | Ga0068856_1000730503 | 315 |
| 178 | 3300005614 | Ga0068856_100240699 | Ga0068856_1002406993 | 315 |
| 179 | 3300005616 | Ga0068852_100038655 | Ga0068852_1000386551 | 315 |
| 180 | 3300006175 | Ga0070712_100019039 | Ga0070712_1000190392 | 315 |
| 181 | 3300009093 | Ga0105240_10049813 | Ga0105240_100498134 | 315 |
| 182 | 3300009545 | Ga0105237_10163908 | Ga0105237_101639082 | 315 |
| 183 | 3300013105 | Ga0157369_10035965 | Ga0157369_100359652 | 315 |
| 184 | 3300013105 | Ga0157369_10075437 | Ga0157369_100754373 | 315 |
| 185 | 3300013296 | Ga0157374_10098614 | Ga0157374_100986143 | 315 |
| 186 | 3300013307 | Ga0157372_10434060 | Ga0157372_104340602 | 315 |
| 187 | 3300014969 | Ga0157376_10331348 | Ga0157376_103313482 | 315 |
| 188 | 3300020070 | Ga0206356_11507257 | Ga0206356_115072572 | 315 |
| 189 | 3300020081 | Ga0206354_10224168 | Ga0206354_102241682 | 315 |
| 190 | 3300020082 | Ga0206353_11255590 | Ga0206353_112555903 | 315 |
| 191 | 3300025912 | Ga0207707_10011148 | Ga0207707_100111489 | 315 |
| 192 | 3300025912 | Ga0207707_10012057 | Ga0207707_100120577 | 315 |
| 193 | 3300025917 | Ga0207660_10047444 | Ga0207660_100474442 | 315 |
| 194 | 3300025919 | Ga0207657_10002472 | Ga0207657_1000247221 | 315 |
| 195 | 3300025919 | Ga0207657_10003370 | Ga0207657_1000337012 | 315 |
| 196 | 3300025919 | Ga0207657_10029745 | Ga0207657_100297452 | 315 |
| 197 | 3300025920 | Ga0207649_10016170 | Ga0207649_100161703 | 315 |
| 198 | 3300025920 | Ga0207649_10320794 | Ga0207649_103207942 | 315 |
| 199 | 3300025921 | Ga0207652_10116676 | Ga0207652_101166762 | 315 |
| 200 | 3300025932 | Ga0207690_10031482 | Ga0207690_100314823 | 315 |
| 201 | 3300025949 | Ga0207667_10215088 | Ga0207667_102150882 | 315 |
| 202 | 3300025981 | Ga0207640_10206892 | Ga0207640_102068921 | 315 |
| 203 | 3300026067 | Ga0207678_10210895 | Ga0207678_102108952 | 315 |
| 204 | 3300026078 | Ga0207702_10033585 | Ga0207702_100335852 | 315 |
| 205 | 3300026078 | Ga0207702_10178202 | Ga0207702_101782022 | 315 |
| 206 | 3300026116 | Ga0207674_10050544 | Ga0207674_100505444 | 315 |
| 207 | 3300028379 | Ga0268266_10136436 | Ga0268266_101364362 | 315 |
| 208 | 3300037418 | Ga0395900_0049279 | Ga0395900_0049279_1224_2183 | 315 |
| 209 | 3300037466 | Ga0395898_0528300 | Ga0395898_0528300_13_972 | 315 |
| 210 | 3300038443 | Ga0395901_0136094 | Ga0395901_0136094_1523_2482 | 315 |
| 211 | 3300044706 | Ga0466964_0010017 | Ga0466964_0010017_509_1468 | 315 |
| 212 | 3300045049 | Ga0466959_0055724 | Ga0466959_0055724_1504_2463 | 315 |
| 213 | 3300045976 | Ga0466967_0069123 | Ga0466967_0069123_2168_3127 | 315 |
| 214 | 3300046454 | Ga0495592_0000621 | Ga0495592_0000621_5116_6135 | 315 |
| 215 | 3300048903 | Ga0496100_0006019 | Ga0496100_0006019_5129_6088 | 315 |
| 216 | 3300048905 | Ga0496102_0001674 | Ga0496102_0001674_5232_6191 | 315 |
| 217 | 3300048906 | Ga0496103_0080885 | Ga0496103_0080885_477_1436 | 315 |
| 218 | 3300048907 | Ga0496104_0000576 | Ga0496104_0000576_15793_16806 | 315 |
| 219 | 3300048907 | Ga0496104_0007540 | Ga0496104_0007540_5537_6496 | 315 |
| 220 | 3300048907 | Ga0496104_0059650 | Ga0496104_0059650_1430_2419 | 315 |
| 221 | 3300048908 | Ga0496105_0001400 | Ga0496105_0001400_4015_4974 | 315 |
| 222 | 3300048908 | Ga0496105_0009052 | Ga0496105_0009052_808_1821 | 315 |
| 223 | 3300048910 | Ga0496107_0026446 | Ga0496107_0026446_1463_2458 | 315 |
| 224 | 3300048910 | Ga0496107_0052198 | Ga0496107_0052198_841_1800 | 315 |
| 225 | 3300048911 | Ga0496108_0010904 | Ga0496108_0010904_4035_5024 | 315 |
| 226 | 3300048911 | Ga0496108_0026529 | Ga0496108_0026529_1267_2226 | 315 |
| 227 | 3300048912 | Ga0496109_0001613 | Ga0496109_0001613_7906_8865 | 315 |
| 228 | 3300048913 | Ga0496110_0001566 | Ga0496110_0001566_4272_5261 | 315 |
| 229 | 3300048913 | Ga0496110_0076003 | Ga0496110_0076003_1013_1972 | 315 |
| 230 | 3300048914 | Ga0496111_0017713 | Ga0496111_0017713_2468_3457 | 315 |
| 231 | 3300048917 | Ga0496114_0009498 | Ga0496114_0009498_2013_2972 | 315 |
| 232 | 3300048917 | Ga0496114_0157537 | Ga0496114_0157537_638_1633 | 315 |
| 233 | 3300048918 | Ga0496115_0005222 | Ga0496115_0005222_3193_4152 | 315 |
| 234 | 3300049573 | Ga0501037_0169474 | Ga0501037_0169474_322_1281 | 315 |
| 235 | 3300049583 | Ga0501067_0000808 | Ga0501067_0000808_13163_14122 | 315 |
| 236 | 3300049585 | Ga0501069_0009322 | Ga0501069_0009322_915_1874 | 315 |
| 237 | 3300050507 | nmdc:mga05p37_43470_c1 | nmdc:mga05p37_43470_c1_3277_4236 | 315 |
| 238 | 3300050508 | nmdc:mga09592_330607_c1 | nmdc:mga09592_330607_c1_241_1200 | 315 |
| 239 | 3300053077 | Ga0495601_0030309 | Ga0495601_0030309_2294_3307 | 315 |
| 240 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_128774_129787 | 315 |
| 241 | 3300060353 | Ga0501082_0010791 | Ga0501082_0010791_1160_2119 | 315 |
| 242 | 3300061734 | Ga0530510_0211494 | Ga0530510_0211494_75_1034 | 315 |
| 243 | 3300005471 | Ga0070698_100351864 | Ga0070698_1003518642 | 316 |
| 244 | 3300005841 | Ga0068863_100170585 | Ga0068863_1001705852 | 316 |
| 245 | 3300006175 | Ga0070712_100185024 | Ga0070712_1001850242 | 316 |
| 246 | 3300006844 | Ga0075428_100017809 | Ga0075428_1000178096 | 316 |
| 247 | 3300009094 | Ga0111539_10024191 | Ga0111539_100241912 | 316 |
| 248 | 3300009147 | Ga0114129_10013663 | Ga0114129_100136638 | 316 |
| 249 | 3300009148 | Ga0105243_10209206 | Ga0105243_102092062 | 316 |
| 250 | 3300010375 | Ga0105239_10093776 | Ga0105239_100937763 | 316 |
| 251 | 3300013308 | Ga0157375_10032670 | Ga0157375_100326702 | 316 |
| 252 | 3300014326 | Ga0157380_10000219 | Ga0157380_1000021924 | 316 |
| 253 | 3300014745 | Ga0157377_10086554 | Ga0157377_100865541 | 316 |
| 254 | 3300014968 | Ga0157379_10320088 | Ga0157379_103200882 | 316 |
| 255 | 3300025938 | Ga0207704_10000025 | Ga0207704_10000025101 | 316 |
| 256 | 3300025981 | Ga0207640_10245438 | Ga0207640_102454382 | 316 |
| 257 | 3300026088 | Ga0207641_10008529 | Ga0207641_100085295 | 316 |
| 258 | 3300027907 | Ga0207428_10191832 | Ga0207428_101918321 | 316 |
| 259 | 3300031251 | Ga0265327_10008056 | Ga0265327_100080568 | 316 |
| 260 | 3300031852 | Ga0307410_10303937 | Ga0307410_103039372 | 316 |
| 261 | 3300031995 | Ga0307409_100058788 | Ga0307409_1000587883 | 316 |
| 262 | 3300031995 | Ga0307409_100090923 | Ga0307409_1000909232 | 316 |
| 263 | 3300032002 | Ga0307416_100033278 | Ga0307416_1000332782 | 316 |
| 264 | 3300032002 | Ga0307416_100114944 | Ga0307416_1001149443 | 316 |
| 265 | 3300032126 | Ga0307415_100076841 | Ga0307415_1000768412 | 316 |
| 266 | 3300032126 | Ga0307415_100102523 | Ga0307415_1001025233 | 316 |
| 267 | 3300035121 | Ga0373960_0011977 | Ga0373960_0011977_1051_2025 | 316 |
| 268 | 3300035691 | Ga0373931_0043963 | Ga0373931_0043963_539_1513 | 316 |
| 269 | 3300037418 | Ga0395900_0006758 | Ga0395900_0006758_10280_11245 | 316 |
| 270 | 3300037418 | Ga0395900_0041817 | Ga0395900_0041817_3136_4128 | 316 |
| 271 | 3300037466 | Ga0395898_0003445 | Ga0395898_0003445_856_1821 | 316 |
| 272 | 3300037466 | Ga0395898_0010906 | Ga0395898_0010906_7569_8561 | 316 |
| 273 | 3300037466 | Ga0395898_0085211 | Ga0395898_0085211_1030_2046 | 316 |
| 274 | 3300037471 | Ga0395905_0012564 | Ga0395905_0012564_1000_1965 | 316 |
| 275 | 3300037471 | Ga0395905_0035952 | Ga0395905_0035952_2668_3684 | 316 |
| 276 | 3300037471 | Ga0395905_0042430 | Ga0395905_0042430_2608_3600 | 316 |
| 277 | 3300038443 | Ga0395901_0001420 | Ga0395901_0001420_14157_15122 | 316 |
| 278 | 3300038443 | Ga0395901_0065706 | Ga0395901_0065706_1065_2057 | 316 |
| 279 | 3300045976 | Ga0466967_0092522 | Ga0466967_0092522_672_1637 | 316 |
| 280 | 3300045976 | Ga0466967_0272881 | Ga0466967_0272881_649_1611 | 316 |
| 281 | 3300046454 | Ga0495592_0083460 | Ga0495592_0083460_285_1250 | 316 |
| 282 | 3300046462 | Ga0495651_0014023 | Ga0495651_0014023_4082_5044 | 316 |
| 283 | 3300046463 | Ga0495653_0069968 | Ga0495653_0069968_696_1661 | 316 |
| 284 | 3300046500 | Ga0495596_0070600 | Ga0495596_0070600_248_1222 | 316 |
| 285 | 3300046516 | Ga0495628_0039578 | Ga0495628_0039578_946_1911 | 316 |
| 286 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_1570_2577 | 316 |
| 287 | 3300046533 | Ga0495640_0233002 | Ga0495640_0233002_108_1073 | 316 |
| 288 | 3300046535 | Ga0495586_0031050 | Ga0495586_0031050_285_1250 | 316 |
| 289 | 3300046559 | Ga0495667_0044310 | Ga0495667_0044310_332_1294 | 316 |
| 290 | 3300046663 | Ga0495635_0112848 | Ga0495635_0112848_618_1583 | 316 |
| 291 | 3300046678 | Ga0495599_0026791 | Ga0495599_0026791_186_1151 | 316 |
| 292 | 3300046681 | Ga0495647_0000293 | Ga0495647_0000293_9626_10651 | 316 |
| 293 | 3300047317 | Ga0495604_0049521 | Ga0495604_0049521_1632_2594 | 316 |
| 294 | 3300047317 | Ga0495604_0071262 | Ga0495604_0071262_420_1385 | 316 |
| 295 | 3300047322 | Ga0495680_0005597 | Ga0495680_0005597_6258_7223 | 316 |
| 296 | 3300047444 | Ga0495675_0065903 | Ga0495675_0065903_900_1865 | 316 |
| 297 | 3300047471 | Ga0495684_0010019 | Ga0495684_0010019_5470_6435 | 316 |
| 298 | 3300048088 | Ga0495602_0061923 | Ga0495602_0061923_1263_2225 | 316 |
| 299 | 3300048905 | Ga0496102_0023784 | Ga0496102_0023784_4113_5126 | 316 |
| 300 | 3300048905 | Ga0496102_0218064 | Ga0496102_0218064_55_1050 | 316 |
| 301 | 3300048907 | Ga0496104_0350863 | Ga0496104_0350863_65_1027 | 316 |
| 302 | 3300048910 | Ga0496107_0174142 | Ga0496107_0174142_369_1364 | 316 |
| 303 | 3300048911 | Ga0496108_0041446 | Ga0496108_0041446_1873_2868 | 316 |
| 304 | 3300048912 | Ga0496109_0280872 | Ga0496109_0280872_310_1305 | 316 |
| 305 | 3300048913 | Ga0496110_0001195 | Ga0496110_0001195_9095_10090 | 316 |
| 306 | 3300048917 | Ga0496114_0012600 | Ga0496114_0012600_1824_2786 | 316 |
| 307 | 3300048918 | Ga0496115_0005218 | Ga0496115_0005218_2547_3509 | 316 |
| 308 | 3300050507 | nmdc:mga05p37_163019_c1 | nmdc:mga05p37_163019_c1_179_1186 | 316 |
| 309 | 3300050511 | nmdc:mga08y16_16311_c1 | nmdc:mga08y16_16311_c1_6212_7186 | 316 |
| 310 | 3300053077 | Ga0495601_0096050 | Ga0495601_0096050_515_1477 | 316 |
| 311 | 3300053078 | Ga0495612_0011495 | Ga0495612_0011495_1486_2451 | 316 |
| 312 | 3300053085 | Ga0495619_0003097 | Ga0495619_0003097_8328_9293 | 316 |
| 313 | 3300053085 | Ga0495619_0143613 | Ga0495619_0143613_411_1373 | 316 |
| 314 | 3300005329 | Ga0070683_100043303 | Ga0070683_1000433032 | 317 |
| 315 | 3300005445 | Ga0070708_100001181 | Ga0070708_1000011813 | 317 |
| 316 | 3300005981 | Ga0081538_10058246 | Ga0081538_100582463 | 317 |
| 317 | 3300005983 | Ga0081540_1000006 | Ga0081540_100000674 | 317 |
| 318 | 3300005985 | Ga0081539_10000062 | Ga0081539_1000006281 | 317 |
| 319 | 3300009098 | Ga0105245_10001677 | Ga0105245_1000167711 | 317 |
| 320 | 3300025927 | Ga0207687_10000646 | Ga0207687_1000064614 | 317 |
| 321 | 3300025938 | Ga0207704_10076865 | Ga0207704_100768652 | 317 |
| 322 | 3300025944 | Ga0207661_10030009 | Ga0207661_100300093 | 317 |
| 323 | 3300025981 | Ga0207640_10000285 | Ga0207640_100002858 | 317 |
| 324 | 3300026075 | Ga0207708_10329542 | Ga0207708_103295422 | 317 |
| 325 | 3300028379 | Ga0268266_10066071 | Ga0268266_100660713 | 317 |
| 326 | 3300031727 | Ga0316576_10143144 | Ga0316576_101431442 | 317 |
| 327 | 3300037312 | Ga0395899_0019939 | Ga0395899_0019939_668_1669 | 317 |
| 328 | 3300037466 | Ga0395898_0011062 | Ga0395898_0011062_7474_8475 | 317 |
| 329 | 3300037466 | Ga0395898_0077050 | Ga0395898_0077050_1244_2248 | 317 |
| 330 | 3300038443 | Ga0395901_0006110 | Ga0395901_0006110_9551_10552 | 317 |
| 331 | 3300044693 | Ga0466961_0026057 | Ga0466961_0026057_2194_3150 | 317 |
| 332 | 3300046459 | Ga0495629_0005520 | Ga0495629_0005520_3052_4068 | 317 |
| 333 | 3300046516 | Ga0495628_0268974 | Ga0495628_0268974_147_1145 | 317 |
| 334 | 3300046678 | Ga0495599_0031412 | Ga0495599_0031412_1650_2648 | 317 |
| 335 | 3300047446 | Ga0495679_011414 | Ga0495679_011414_2382_3380 | 317 |
| 336 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_166337_167401 | 317 |
| 337 | 3300048912 | Ga0496109_0180730 | Ga0496109_0180730_346_1344 | 317 |
| 338 | 3300048913 | Ga0496110_0146832 | Ga0496110_0146832_1112_2110 | 317 |
| 339 | 3300048913 | Ga0496110_0250567 | Ga0496110_0250567_520_1506 | 317 |
| 340 | 3300053077 | Ga0495601_0000086 | Ga0495601_0000086_31293_32291 | 317 |
| 341 | 3300053078 | Ga0495612_0005844 | Ga0495612_0005844_43_1041 | 317 |
| 342 | 3300003373 | JGI25407J50210_10010599 | JGI25407J50210_100105993 | 318 |
| 343 | 3300005458 | Ga0070681_10005901 | Ga0070681_1000590111 | 318 |
| 344 | 3300005530 | Ga0070679_100000537 | Ga0070679_10000053716 | 318 |
| 345 | 3300005548 | Ga0070665_100000159 | Ga0070665_100000159123 | 318 |
| 346 | 3300005842 | Ga0068858_100000049 | Ga0068858_10000004920 | 318 |
| 347 | 3300005843 | Ga0068860_100063112 | Ga0068860_1000631124 | 318 |
| 348 | 3300005937 | Ga0081455_10078225 | Ga0081455_100782253 | 318 |
| 349 | 3300005981 | Ga0081538_10000429 | Ga0081538_100004294 | 318 |
| 350 | 3300005981 | Ga0081538_10000691 | Ga0081538_100006917 | 318 |
| 351 | 3300005981 | Ga0081538_10000894 | Ga0081538_1000089414 | 318 |
| 352 | 3300005981 | Ga0081538_10003180 | Ga0081538_1000318026 | 318 |
| 353 | 3300005981 | Ga0081538_10006926 | Ga0081538_100069268 | 318 |
| 354 | 3300005981 | Ga0081538_10008586 | Ga0081538_100085863 | 318 |
| 355 | 3300009147 | Ga0114129_10003023 | Ga0114129_100030233 | 318 |
| 356 | 3300009545 | Ga0105237_10175697 | Ga0105237_101756972 | 318 |
| 357 | 3300009551 | Ga0105238_10242128 | Ga0105238_102421282 | 318 |
| 358 | 3300013308 | Ga0157375_10046134 | Ga0157375_100461343 | 318 |
| 359 | 3300025912 | Ga0207707_10157919 | Ga0207707_101579191 | 318 |
| 360 | 3300025921 | Ga0207652_10000631 | Ga0207652_1000063118 | 318 |
| 361 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006714 | 318 |
| 362 | 3300026078 | Ga0207702_10016146 | Ga0207702_100161468 | 318 |
| 363 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023343 | 318 |
| 364 | 3300028381 | Ga0268264_10007216 | Ga0268264_1000721610 | 318 |
| 365 | 3300036401 | Ga0373937_0033225 | Ga0373937_0033225_847_1842 | 318 |
| 366 | 3300046461 | Ga0495641_0015104 | Ga0495641_0015104_677_1678 | 318 |
| 367 | 3300046499 | Ga0495594_0000013 | Ga0495594_0000013_59767_60789 | 318 |
| 368 | 3300046535 | Ga0495586_0000527 | Ga0495586_0000527_3493_4494 | 318 |
| 369 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_123830_124852 | 318 |
| 370 | 3300046663 | Ga0495635_0000009 | Ga0495635_0000009_239321_240340 | 318 |
| 371 | 3300046675 | Ga0495657_0004915 | Ga0495657_0004915_2602_3621 | 318 |
| 372 | 3300046690 | Ga0495624_0000028 | Ga0495624_0000028_26699_27700 | 318 |
| 373 | 3300046694 | Ga0495649_0015920 | Ga0495649_0015920_1614_2615 | 318 |
| 374 | 3300047322 | Ga0495680_0000421 | Ga0495680_0000421_25241_26242 | 318 |
| 375 | 3300048910 | Ga0496107_0338919 | Ga0496107_0338919_26_1033 | 318 |
| 376 | 3300048913 | Ga0496110_0017994 | Ga0496110_0017994_1791_2792 | 318 |
| 377 | 3300049578 | Ga0501042_0145464 | Ga0501042_0145464_657_1643 | 318 |
| 378 | 3300049588 | Ga0501072_0014925 | Ga0501072_0014925_751_1722 | 318 |
| 379 | 3300049824 | Ga0501045_0063835 | Ga0501045_0063835_32_1018 | 318 |
| 380 | 3300050511 | nmdc:mga08y16_368483_c1 | nmdc:mga08y16_368483_c1_270_1253 | 318 |
| 381 | 3300050511 | nmdc:mga08y16_640486_c1 | nmdc:mga08y16_640486_c1_64_1035 | 318 |
| 382 | 3300053083 | Ga0495655_0001739 | Ga0495655_0001739_1738_2748 | 318 |
| 383 | 3300053119 | Ga0500595_021781 | Ga0500595_021781_596_1633 | 318 |
| 384 | 3300061734 | Ga0530510_0046814 | Ga0530510_0046814_762_1748 | 318 |
| 385 | 3300005356 | Ga0070674_100196524 | Ga0070674_1001965241 | 319 |
| 386 | 3300006038 | Ga0075365_10243986 | Ga0075365_102439862 | 319 |
| 387 | 3300006051 | Ga0075364_10164661 | Ga0075364_101646611 | 319 |
| 388 | 3300006051 | Ga0075364_10215756 | Ga0075364_102157561 | 319 |
| 389 | 3300009098 | Ga0105245_10003691 | Ga0105245_100036919 | 319 |
| 390 | 3300026121 | Ga0207683_10006404 | Ga0207683_100064045 | 319 |
| 391 | 3300031824 | Ga0307413_10023303 | Ga0307413_100233033 | 319 |
| 392 | 3300031911 | Ga0307412_10241304 | Ga0307412_102413041 | 319 |
| 393 | 3300031995 | Ga0307409_100012362 | Ga0307409_1000123625 | 319 |
| 394 | 3300032002 | Ga0307416_100011782 | Ga0307416_1000117826 | 319 |
| 395 | 3300032004 | Ga0307414_10120549 | Ga0307414_101205491 | 319 |
| 396 | 3300046516 | Ga0495628_0005324 | Ga0495628_0005324_1508_2527 | 319 |
| 397 | 3300048903 | Ga0496100_0179643 | Ga0496100_0179643_460_1452 | 319 |
| 398 | 3300048905 | Ga0496102_0017155 | Ga0496102_0017155_976_1968 | 319 |
| 399 | 3300048911 | Ga0496108_0008008 | Ga0496108_0008008_745_1746 | 319 |
| 400 | 3300048912 | Ga0496109_0028090 | Ga0496109_0028090_2981_3973 | 319 |
| 401 | 3300048916 | Ga0496113_0002837 | Ga0496113_0002837_2399_3400 | 319 |
| 402 | 3300048916 | Ga0496113_0216946 | Ga0496113_0216946_503_1495 | 319 |
| 403 | 3300048923 | Ga0496120_0004252 | Ga0496120_0004252_9594_10613 | 319 |
| 404 | 3300049588 | Ga0501072_0357554 | Ga0501072_0357554_44_1060 | 319 |
| 405 | 3300049593 | Ga0501077_0173009 | Ga0501077_0173009_86_1102 | 319 |
| 406 | 3300049743 | Ga0501081_0321051 | Ga0501081_0321051_51_1067 | 319 |
| 407 | 3300054114 | Ga0501084_0016458 | Ga0501084_0016458_1665_2654 | 319 |
| 408 | 3300005329 | Ga0070683_100001714 | Ga0070683_10000171416 | 320 |
| 409 | 3300005329 | Ga0070683_100018473 | Ga0070683_1000184732 | 320 |
| 410 | 3300005341 | Ga0070691_10008984 | Ga0070691_100089844 | 320 |
| 411 | 3300005344 | Ga0070661_100000005 | Ga0070661_100000005207 | 320 |
| 412 | 3300005354 | Ga0070675_100000058 | Ga0070675_10000005850 | 320 |
| 413 | 3300005364 | Ga0070673_100046800 | Ga0070673_1000468003 | 320 |
| 414 | 3300005365 | Ga0070688_100002793 | Ga0070688_1000027934 | 320 |
| 415 | 3300005365 | Ga0070688_100005500 | Ga0070688_1000055009 | 320 |
| 416 | 3300005466 | Ga0070685_10000293 | Ga0070685_1000029328 | 320 |
| 417 | 3300005535 | Ga0070684_100081312 | Ga0070684_1000813123 | 320 |
| 418 | 3300005543 | Ga0070672_100000004 | Ga0070672_10000000484 | 320 |
| 419 | 3300005719 | Ga0068861_100041642 | Ga0068861_1000416422 | 320 |
| 420 | 3300005834 | Ga0068851_10005192 | Ga0068851_100051922 | 320 |
| 421 | 3300005981 | Ga0081538_10000804 | Ga0081538_1000080433 | 320 |
| 422 | 3300006038 | Ga0075365_10160419 | Ga0075365_101604192 | 320 |
| 423 | 3300006844 | Ga0075428_100199352 | Ga0075428_1001993522 | 320 |
| 424 | 3300006846 | Ga0075430_100003677 | Ga0075430_1000036773 | 320 |
| 425 | 3300006847 | Ga0075431_100002485 | Ga0075431_1000024854 | 320 |
| 426 | 3300006880 | Ga0075429_100046393 | Ga0075429_1000463934 | 320 |
| 427 | 3300009098 | Ga0105245_10000056 | Ga0105245_100000567 | 320 |
| 428 | 3300013104 | Ga0157370_10214353 | Ga0157370_102143532 | 320 |
| 429 | 3300013105 | Ga0157369_10000099 | Ga0157369_1000009927 | 320 |
| 430 | 3300013297 | Ga0157378_10010497 | Ga0157378_100104973 | 320 |
| 431 | 3300025321 | Ga0207656_10117373 | Ga0207656_101173732 | 320 |
| 432 | 3300025915 | Ga0207693_10013240 | Ga0207693_100132402 | 320 |
| 433 | 3300025926 | Ga0207659_10000020 | Ga0207659_1000002056 | 320 |
| 434 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007115 | 320 |
| 435 | 3300025940 | Ga0207691_10000020 | Ga0207691_1000002042 | 320 |
| 436 | 3300025944 | Ga0207661_10001238 | Ga0207661_1000123816 | 320 |
| 437 | 3300025944 | Ga0207661_10001949 | Ga0207661_100019499 | 320 |
| 438 | 3300025960 | Ga0207651_10111878 | Ga0207651_101118783 | 320 |
| 439 | 3300031901 | Ga0307406_10011927 | Ga0307406_100119274 | 320 |
| 440 | 3300032126 | Ga0307415_100001131 | Ga0307415_1000011312 | 320 |
| 441 | 3300045976 | Ga0466967_0000046 | Ga0466967_0000046_14371_15384 | 320 |
| 442 | 3300046459 | Ga0495629_0036832 | Ga0495629_0036832_943_1938 | 320 |
| 443 | 3300046674 | Ga0495588_0000198 | Ga0495588_0000198_1632_2645 | 320 |
| 444 | 3300046681 | Ga0495647_0090494 | Ga0495647_0090494_229_1224 | 320 |
| 445 | 3300046690 | Ga0495624_0036177 | Ga0495624_0036177_1425_2432 | 320 |
| 446 | 3300047317 | Ga0495604_0003466 | Ga0495604_0003466_6463_7473 | 320 |
| 447 | 3300048915 | Ga0496112_0017217 | Ga0496112_0017217_1660_2670 | 320 |
| 448 | 3300048916 | Ga0496113_0000007 | Ga0496113_0000007_93217_94227 | 320 |
| 449 | 3300049586 | Ga0501070_0009281 | Ga0501070_0009281_1937_2983 | 320 |
| 450 | 3300049590 | Ga0501074_0044985 | Ga0501074_0044985_1606_2637 | 320 |
| 451 | 3300050508 | nmdc:mga09592_49273_c1 | nmdc:mga09592_49273_c1_652_1665 | 320 |
| 452 | 3300050509 | nmdc:mga0qj67_1508_c1 | nmdc:mga0qj67_1508_c1_4682_5695 | 320 |
| 453 | 3300050510 | nmdc:mga06r32_4240_c1 | nmdc:mga06r32_4240_c1_1248_2261 | 320 |
| 454 | 3300053078 | Ga0495612_0000410 | Ga0495612_0000410_657_1655 | 320 |
| 455 | 3300053085 | Ga0495619_0010328 | Ga0495619_0010328_3932_4927 | 320 |
| 456 | 3300059426 | Ga0590077_004894 | Ga0590077_004894_996_1991 | 320 |
| 457 | 3300005338 | Ga0068868_100220158 | Ga0068868_1002201581 | 321 |
| 458 | 3300005365 | Ga0070688_100000333 | Ga0070688_10000033321 | 321 |
| 459 | 3300005366 | Ga0070659_100115029 | Ga0070659_1001150293 | 321 |
| 460 | 3300005439 | Ga0070711_100008345 | Ga0070711_1000083456 | 321 |
| 461 | 3300005466 | Ga0070685_10003954 | Ga0070685_1000395410 | 321 |
| 462 | 3300005614 | Ga0068856_100018421 | Ga0068856_1000184218 | 321 |
| 463 | 3300005614 | Ga0068856_100023907 | Ga0068856_1000239073 | 321 |
| 464 | 3300005616 | Ga0068852_100000012 | Ga0068852_100000012114 | 321 |
| 465 | 3300005834 | Ga0068851_10004367 | Ga0068851_100043673 | 321 |
| 466 | 3300005841 | Ga0068863_100000032 | Ga0068863_10000003215 | 321 |
| 467 | 3300009177 | Ga0105248_10000032 | Ga0105248_10000032113 | 321 |
| 468 | 3300013307 | Ga0157372_10026370 | Ga0157372_100263707 | 321 |
| 469 | 3300014326 | Ga0157380_10362950 | Ga0157380_103629502 | 321 |
| 470 | 3300017792 | Ga0163161_10000058 | Ga0163161_1000005842 | 321 |
| 471 | 3300025321 | Ga0207656_10002305 | Ga0207656_100023058 | 321 |
| 472 | 3300025916 | Ga0207663_10014493 | Ga0207663_100144934 | 321 |
| 473 | 3300025916 | Ga0207663_10066421 | Ga0207663_100664212 | 321 |
| 474 | 3300025925 | Ga0207650_10025386 | Ga0207650_100253864 | 321 |
| 475 | 3300025928 | Ga0207700_10000008 | Ga0207700_10000008341 | 321 |
| 476 | 3300025928 | Ga0207700_10000016 | Ga0207700_100000166 | 321 |
| 477 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020261 | 321 |
| 478 | 3300026023 | Ga0207677_10052187 | Ga0207677_100521872 | 321 |
| 479 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016106 | 321 |
| 480 | 3300026078 | Ga0207702_10003815 | Ga0207702_100038156 | 321 |
| 481 | 3300026088 | Ga0207641_10000071 | Ga0207641_1000007116 | 321 |
| 482 | 3300026089 | Ga0207648_10000228 | Ga0207648_1000022828 | 321 |
| 483 | 3300026118 | Ga0207675_100140748 | Ga0207675_1001407483 | 321 |
| 484 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012233 | 321 |
| 485 | 3300031727 | Ga0316576_10180268 | Ga0316576_101802681 | 321 |
| 486 | 3300036712 | Ga0316584_0122658 | Ga0316584_0122658_470_1489 | 321 |
| 487 | 3300037418 | Ga0395900_0081851 | Ga0395900_0081851_67_1083 | 321 |
| 488 | 3300037466 | Ga0395898_0027143 | Ga0395898_0027143_4669_5685 | 321 |
| 489 | 3300037471 | Ga0395905_0002251 | Ga0395905_0002251_16644_17660 | 321 |
| 490 | 3300044842 | Ga0466957_0003681 | Ga0466957_0003681_5831_6844 | 321 |
| 491 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_107049_108059 | 321 |
| 492 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_11675_12688 | 321 |
| 493 | 3300046533 | Ga0495640_0047817 | Ga0495640_0047817_205_1224 | 321 |
| 494 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_11675_12688 | 321 |
| 495 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_48122_49132 | 321 |
| 496 | 3300046689 | Ga0495613_0000249 | Ga0495613_0000249_15996_17015 | 321 |
| 497 | 3300046809 | Ga0495600_0003314 | Ga0495600_0003314_6438_7451 | 321 |
| 498 | 3300047317 | Ga0495604_0006459 | Ga0495604_0006459_2387_3400 | 321 |
| 499 | 3300047444 | Ga0495675_0000209 | Ga0495675_0000209_11678_12691 | 321 |
| 500 | 3300048088 | Ga0495602_0000228 | Ga0495602_0000228_19934_20947 | 321 |
| 501 | 3300048088 | Ga0495602_0210737 | Ga0495602_0210737_219_1220 | 321 |
| 502 | 3300048907 | Ga0496104_0346090 | Ga0496104_0346090_150_1151 | 321 |
| 503 | 3300048911 | Ga0496108_0000045 | Ga0496108_0000045_116504_117517 | 321 |
| 504 | 3300048912 | Ga0496109_0000032 | Ga0496109_0000032_19909_20922 | 321 |
| 505 | 3300048912 | Ga0496109_0230154 | Ga0496109_0230154_264_1277 | 321 |
| 506 | 3300048913 | Ga0496110_0000033 | Ga0496110_0000033_62286_63296 | 321 |
| 507 | 3300048913 | Ga0496110_0027759 | Ga0496110_0027759_3305_4318 | 321 |
| 508 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_612409_613419 | 321 |
| 509 | 3300048916 | Ga0496113_0009418 | Ga0496113_0009418_4095_5087 | 321 |
| 510 | 3300049568 | Ga0501031_0058633 | Ga0501031_0058633_967_1974 | 321 |
| 511 | 3300049569 | Ga0501032_0064563 | Ga0501032_0064563_1159_2166 | 321 |
| 512 | 3300049570 | Ga0501033_0014207 | Ga0501033_0014207_3759_4766 | 321 |
| 513 | 3300049571 | Ga0501034_0003200 | Ga0501034_0003200_16631_17638 | 321 |
| 514 | 3300049572 | Ga0501036_0001590 | Ga0501036_0001590_15601_16608 | 321 |
| 515 | 3300049573 | Ga0501037_0005716 | Ga0501037_0005716_4329_5336 | 321 |
| 516 | 3300049574 | Ga0501038_0008491 | Ga0501038_0008491_1287_2294 | 321 |
| 517 | 3300049575 | Ga0501039_0003991 | Ga0501039_0003991_6716_7723 | 321 |
| 518 | 3300049576 | Ga0501040_0000954 | Ga0501040_0000954_9989_10996 | 321 |
| 519 | 3300049577 | Ga0501041_0001093 | Ga0501041_0001093_4329_5336 | 321 |
| 520 | 3300049578 | Ga0501042_0003964 | Ga0501042_0003964_3894_4901 | 321 |
| 521 | 3300049578 | Ga0501042_0069176 | Ga0501042_0069176_723_1715 | 321 |
| 522 | 3300049579 | Ga0501043_0048746 | Ga0501043_0048746_967_1974 | 321 |
| 523 | 3300049580 | Ga0501046_0028136 | Ga0501046_0028136_3039_4046 | 321 |
| 524 | 3300049581 | Ga0501047_0084809 | Ga0501047_0084809_879_1886 | 321 |
| 525 | 3300049582 | Ga0501048_0001926 | Ga0501048_0001926_6983_7990 | 321 |
| 526 | 3300049583 | Ga0501067_0009559 | Ga0501067_0009559_2361_3368 | 321 |
| 527 | 3300049584 | Ga0501068_0011873 | Ga0501068_0011873_879_1886 | 321 |
| 528 | 3300049586 | Ga0501070_0005855 | Ga0501070_0005855_1690_2697 | 321 |
| 529 | 3300049587 | Ga0501071_0001995 | Ga0501071_0001995_6716_7723 | 321 |
| 530 | 3300049588 | Ga0501072_0004831 | Ga0501072_0004831_4329_5336 | 321 |
| 531 | 3300049589 | Ga0501073_0033451 | Ga0501073_0033451_2369_3376 | 321 |
| 532 | 3300049590 | Ga0501074_0060672 | Ga0501074_0060672_751_1758 | 321 |
| 533 | 3300049591 | Ga0501075_0000193 | Ga0501075_0000193_14492_15499 | 321 |
| 534 | 3300049592 | Ga0501076_0001292 | Ga0501076_0001292_7979_8986 | 321 |
| 535 | 3300049593 | Ga0501077_0001176 | Ga0501077_0001176_4598_5605 | 321 |
| 536 | 3300049741 | Ga0501079_0000929 | Ga0501079_0000929_967_1974 | 321 |
| 537 | 3300049742 | Ga0501080_0032292 | Ga0501080_0032292_2519_3526 | 321 |
| 538 | 3300049743 | Ga0501081_0000159 | Ga0501081_0000159_29279_30286 | 321 |
| 539 | 3300049744 | Ga0501083_0008047 | Ga0501083_0008047_4082_5089 | 321 |
| 540 | 3300049822 | Ga0501035_0078473 | Ga0501035_0078473_1159_2166 | 321 |
| 541 | 3300049823 | Ga0501044_0038039 | Ga0501044_0038039_1287_2294 | 321 |
| 542 | 3300049824 | Ga0501045_0002161 | Ga0501045_0002161_4329_5336 | 321 |
| 543 | 3300050491 | nmdc:mga00v17_42955_c1 | nmdc:mga00v17_42955_c1_138_1172 | 321 |
| 544 | 3300050507 | nmdc:mga05p37_145145_c1 | nmdc:mga05p37_145145_c1_1538_2545 | 321 |
| 545 | 3300050510 | nmdc:mga06r32_60098_c1 | nmdc:mga06r32_60098_c1_721_1740 | 321 |
| 546 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_132568_133581 | 321 |
| 547 | 3300053084 | Ga0495595_0027010 | Ga0495595_0027010_1046_2059 | 321 |
| 548 | 3300053085 | Ga0495619_0000319 | Ga0495619_0000319_20991_22004 | 321 |
| 549 | 3300053085 | Ga0495619_0008074 | Ga0495619_0008074_4150_5151 | 321 |
| 550 | 3300054114 | Ga0501084_0001358 | Ga0501084_0001358_4470_5477 | 321 |
| 551 | 3300060353 | Ga0501082_0001009 | Ga0501082_0001009_7020_8027 | 321 |
| 552 | 3300061734 | Ga0530510_0001148 | Ga0530510_0001148_2369_3376 | 321 |
| 553 | 3300005330 | Ga0070690_100092170 | Ga0070690_1000921701 | 322 |
| 554 | 3300005334 | Ga0068869_100006717 | Ga0068869_1000067177 | 322 |
| 555 | 3300005336 | Ga0070680_100037693 | Ga0070680_1000376934 | 322 |
| 556 | 3300005341 | Ga0070691_10013863 | Ga0070691_100138633 | 322 |
| 557 | 3300005356 | Ga0070674_100051096 | Ga0070674_1000510963 | 322 |
| 558 | 3300005535 | Ga0070684_100128869 | Ga0070684_1001288691 | 322 |
| 559 | 3300005543 | Ga0070672_100254547 | Ga0070672_1002545472 | 322 |
| 560 | 3300005544 | Ga0070686_100079214 | Ga0070686_1000792142 | 322 |
| 561 | 3300005547 | Ga0070693_100046964 | Ga0070693_1000469643 | 322 |
| 562 | 3300005577 | Ga0068857_100001285 | Ga0068857_10000128510 | 322 |
| 563 | 3300005577 | Ga0068857_100006742 | Ga0068857_10000674210 | 322 |
| 564 | 3300005578 | Ga0068854_100142366 | Ga0068854_1001423661 | 322 |
| 565 | 3300005616 | Ga0068852_100134945 | Ga0068852_1001349453 | 322 |
| 566 | 3300005616 | Ga0068852_100285715 | Ga0068852_1002857152 | 322 |
| 567 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002220 | 322 |
| 568 | 3300005840 | Ga0068870_10077016 | Ga0068870_100770163 | 322 |
| 569 | 3300005842 | Ga0068858_100044747 | Ga0068858_1000447473 | 322 |
| 570 | 3300005937 | Ga0081455_10030105 | Ga0081455_100301056 | 322 |
| 571 | 3300005937 | Ga0081455_10052361 | Ga0081455_100523613 | 322 |
| 572 | 3300005985 | Ga0081539_10002242 | Ga0081539_1000224220 | 322 |
| 573 | 3300006163 | Ga0070715_10000012 | Ga0070715_1000001257 | 322 |
| 574 | 3300006844 | Ga0075428_100121552 | Ga0075428_1001215522 | 322 |
| 575 | 3300006847 | Ga0075431_100302345 | Ga0075431_1003023452 | 322 |
| 576 | 3300009094 | Ga0111539_10002085 | Ga0111539_1000208518 | 322 |
| 577 | 3300009094 | Ga0111539_10002336 | Ga0111539_1000233620 | 322 |
| 578 | 3300009098 | Ga0105245_10005665 | Ga0105245_100056655 | 322 |
| 579 | 3300009098 | Ga0105245_10064347 | Ga0105245_100643474 | 322 |
| 580 | 3300009147 | Ga0114129_10023252 | Ga0114129_100232522 | 322 |
| 581 | 3300009148 | Ga0105243_10099187 | Ga0105243_100991873 | 322 |
| 582 | 3300010375 | Ga0105239_10372906 | Ga0105239_103729062 | 322 |
| 583 | 3300011119 | Ga0105246_10039193 | Ga0105246_100391933 | 322 |
| 584 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001394 | 322 |
| 585 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003394 | 322 |
| 586 | 3300025899 | Ga0207642_10000004 | Ga0207642_10000004394 | 322 |
| 587 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001478 | 322 |
| 588 | 3300025925 | Ga0207650_10152474 | Ga0207650_101524741 | 322 |
| 589 | 3300025927 | Ga0207687_10006484 | Ga0207687_100064843 | 322 |
| 590 | 3300025933 | Ga0207706_10014837 | Ga0207706_100148376 | 322 |
| 591 | 3300025934 | Ga0207686_10142989 | Ga0207686_101429893 | 322 |
| 592 | 3300025935 | Ga0207709_10049455 | Ga0207709_100494552 | 322 |
| 593 | 3300025936 | Ga0207670_10087786 | Ga0207670_100877863 | 322 |
| 594 | 3300025936 | Ga0207670_10330977 | Ga0207670_103309771 | 322 |
| 595 | 3300025937 | Ga0207669_10000036 | Ga0207669_1000003630 | 322 |
| 596 | 3300025937 | Ga0207669_10322612 | Ga0207669_103226122 | 322 |
| 597 | 3300025942 | Ga0207689_10025225 | Ga0207689_100252253 | 322 |
| 598 | 3300025942 | Ga0207689_10093134 | Ga0207689_100931342 | 322 |
| 599 | 3300025944 | Ga0207661_10151734 | Ga0207661_101517342 | 322 |
| 600 | 3300025981 | Ga0207640_10060336 | Ga0207640_100603363 | 322 |
| 601 | 3300026035 | Ga0207703_10000053 | Ga0207703_1000005316 | 322 |
| 602 | 3300026075 | Ga0207708_10006689 | Ga0207708_100066897 | 322 |
| 603 | 3300026078 | Ga0207702_10302676 | Ga0207702_103026761 | 322 |
| 604 | 3300026089 | Ga0207648_10043290 | Ga0207648_100432901 | 322 |
| 605 | 3300026116 | Ga0207674_10002949 | Ga0207674_100029496 | 322 |
| 606 | 3300026118 | Ga0207675_100010716 | Ga0207675_1000107163 | 322 |
| 607 | 3300026121 | Ga0207683_10135986 | Ga0207683_101359862 | 322 |
| 608 | 3300026121 | Ga0207683_10172253 | Ga0207683_101722532 | 322 |
| 609 | 3300026142 | Ga0207698_10009350 | Ga0207698_100093505 | 322 |
| 610 | 3300027907 | Ga0207428_10235228 | Ga0207428_102352282 | 322 |
| 611 | 3300031548 | Ga0307408_100031047 | Ga0307408_1000310473 | 322 |
| 612 | 3300031548 | Ga0307408_100048271 | Ga0307408_1000482711 | 322 |
| 613 | 3300031548 | Ga0307408_100081761 | Ga0307408_1000817612 | 322 |
| 614 | 3300031824 | Ga0307413_10002156 | Ga0307413_100021563 | 322 |
| 615 | 3300031824 | Ga0307413_10051708 | Ga0307413_100517083 | 322 |
| 616 | 3300031852 | Ga0307410_10016214 | Ga0307410_100162143 | 322 |
| 617 | 3300031852 | Ga0307410_10058953 | Ga0307410_100589532 | 322 |
| 618 | 3300031901 | Ga0307406_10038981 | Ga0307406_100389813 | 322 |
| 619 | 3300031903 | Ga0307407_10022196 | Ga0307407_100221962 | 322 |
| 620 | 3300031911 | Ga0307412_10018003 | Ga0307412_100180033 | 322 |
| 621 | 3300031995 | Ga0307409_100058575 | Ga0307409_1000585752 | 322 |
| 622 | 3300031995 | Ga0307409_100099462 | Ga0307409_1000994623 | 322 |
| 623 | 3300032002 | Ga0307416_100028324 | Ga0307416_1000283244 | 322 |
| 624 | 3300032002 | Ga0307416_100045175 | Ga0307416_1000451751 | 322 |
| 625 | 3300032002 | Ga0307416_100060430 | Ga0307416_1000604303 | 322 |
| 626 | 3300032002 | Ga0307416_100377509 | Ga0307416_1003775092 | 322 |
| 627 | 3300032005 | Ga0307411_10006677 | Ga0307411_100066774 | 322 |
| 628 | 3300032126 | Ga0307415_100020790 | Ga0307415_1000207903 | 322 |
| 629 | 3300032126 | Ga0307415_100275124 | Ga0307415_1002751242 | 322 |
| 630 | 3300037466 | Ga0395898_0057103 | Ga0395898_0057103_1722_2720 | 322 |
| 631 | 3300037466 | Ga0395898_0267825 | Ga0395898_0267825_151_1167 | 322 |
| 632 | 3300038443 | Ga0395901_0020676 | Ga0395901_0020676_759_1775 | 322 |
| 633 | 3300042005 | Ga0439448_0016164 | Ga0439448_0016164_393_1382 | 322 |
| 634 | 3300044683 | Ga0466965_0057274 | Ga0466965_0057274_797_1792 | 322 |
| 635 | 3300044694 | Ga0466963_0043513 | Ga0466963_0043513_56_1072 | 322 |
| 636 | 3300044706 | Ga0466964_0000890 | Ga0466964_0000890_4245_5240 | 322 |
| 637 | 3300044735 | Ga0466968_0046907 | Ga0466968_0046907_134_1129 | 322 |
| 638 | 3300044901 | Ga0466960_0022744 | Ga0466960_0022744_1689_2684 | 322 |
| 639 | 3300045976 | Ga0466967_0004872 | Ga0466967_0004872_1831_2826 | 322 |
| 640 | 3300046457 | Ga0495590_0087496 | Ga0495590_0087496_46_1035 | 322 |
| 641 | 3300046474 | Ga0495605_0066960 | Ga0495605_0066960_689_1678 | 322 |
| 642 | 3300046491 | Ga0495584_0037550 | Ga0495584_0037550_779_1768 | 322 |
| 643 | 3300046491 | Ga0495584_0076703 | Ga0495584_0076703_167_1156 | 322 |
| 644 | 3300046500 | Ga0495596_0097391 | Ga0495596_0097391_123_1112 | 322 |
| 645 | 3300046518 | Ga0495631_0056015 | Ga0495631_0056015_291_1280 | 322 |
| 646 | 3300046523 | Ga0495644_0033884 | Ga0495644_0033884_512_1501 | 322 |
| 647 | 3300046535 | Ga0495586_0000620 | Ga0495586_0000620_5494_6495 | 322 |
| 648 | 3300046537 | Ga0495598_0040271 | Ga0495598_0040271_331_1320 | 322 |
| 649 | 3300046542 | Ga0495597_0042995 | Ga0495597_0042995_45_1034 | 322 |
| 650 | 3300046642 | Ga0495634_0000024 | Ga0495634_0000024_102829_103845 | 322 |
| 651 | 3300046660 | Ga0495625_0000029 | Ga0495625_0000029_2596_3591 | 322 |
| 652 | 3300047317 | Ga0495604_0000056 | Ga0495604_0000056_19413_20426 | 322 |
| 653 | 3300048905 | Ga0496102_0027850 | Ga0496102_0027850_2302_3315 | 322 |
| 654 | 3300048905 | Ga0496102_0282216 | Ga0496102_0282216_222_1235 | 322 |
| 655 | 3300048906 | Ga0496103_0061251 | Ga0496103_0061251_235_1248 | 322 |
| 656 | 3300048911 | Ga0496108_0000631 | Ga0496108_0000631_20489_21505 | 322 |
| 657 | 3300048911 | Ga0496108_0020923 | Ga0496108_0020923_1043_2032 | 322 |
| 658 | 3300048912 | Ga0496109_0000085 | Ga0496109_0000085_92423_93439 | 322 |
| 659 | 3300048913 | Ga0496110_0155076 | Ga0496110_0155076_311_1300 | 322 |
| 660 | 3300048914 | Ga0496111_0000230 | Ga0496111_0000230_2153_3142 | 322 |
| 661 | 3300048920 | Ga0496117_0015033 | Ga0496117_0015033_3662_4675 | 322 |
| 662 | 3300048921 | Ga0496118_0000174 | Ga0496118_0000174_111437_112450 | 322 |
| 663 | 3300049581 | Ga0501047_0009620 | Ga0501047_0009620_3474_4487 | 322 |
| 664 | 3300049583 | Ga0501067_0073981 | Ga0501067_0073981_202_1191 | 322 |
| 665 | 3300049584 | Ga0501068_0028798 | Ga0501068_0028798_1227_2213 | 322 |
| 666 | 3300049585 | Ga0501069_0007694 | Ga0501069_0007694_3378_4367 | 322 |
| 667 | 3300049587 | Ga0501071_0225339 | Ga0501071_0225339_94_1167 | 322 |
| 668 | 3300049591 | Ga0501075_0007396 | Ga0501075_0007396_5087_6100 | 322 |
| 669 | 3300049592 | Ga0501076_0011312 | Ga0501076_0011312_1066_2058 | 322 |
| 670 | 3300049652 | Ga0501202_029492 | Ga0501202_029492_87_1070 | 322 |
| 671 | 3300049744 | Ga0501083_0021756 | Ga0501083_0021756_566_1579 | 322 |
| 672 | 3300049823 | Ga0501044_0065287 | Ga0501044_0065287_909_1922 | 322 |
| 673 | 3300050509 | nmdc:mga0qj67_83580_c1 | nmdc:mga0qj67_83580_c1_1013_2005 | 322 |
| 674 | 3300050510 | nmdc:mga06r32_351571_c1 | nmdc:mga06r32_351571_c1_377_1369 | 322 |
| 675 | 3300050511 | nmdc:mga08y16_2936_c1 | nmdc:mga08y16_2936_c1_10080_11069 | 322 |
| 676 | 3300050515 | nmdc:mga0a205_97616_c1 | nmdc:mga0a205_97616_c1_1288_2304 | 322 |
| 677 | 3300053096 | Ga0500641_0002398 | Ga0500641_0002398_2601_3596 | 322 |
| 678 | 3300061734 | Ga0530510_0154128 | Ga0530510_0154128_668_1657 | 322 |
| 679 | 3300005336 | Ga0070680_100014559 | Ga0070680_1000145595 | 323 |
| 680 | 3300005337 | Ga0070682_100030235 | Ga0070682_1000302353 | 323 |
| 681 | 3300005338 | Ga0068868_100000095 | Ga0068868_10000009552 | 323 |
| 682 | 3300005344 | Ga0070661_100241349 | Ga0070661_1002413491 | 323 |
| 683 | 3300005456 | Ga0070678_100100238 | Ga0070678_1001002382 | 323 |
| 684 | 3300005458 | Ga0070681_10004636 | Ga0070681_100046363 | 323 |
| 685 | 3300005530 | Ga0070679_100001830 | Ga0070679_1000018305 | 323 |
| 686 | 3300005535 | Ga0070684_100003228 | Ga0070684_1000032282 | 323 |
| 687 | 3300005547 | Ga0070693_100000833 | Ga0070693_10000083311 | 323 |
| 688 | 3300005564 | Ga0070664_100375561 | Ga0070664_1003755612 | 323 |
| 689 | 3300005843 | Ga0068860_100044947 | Ga0068860_1000449475 | 323 |
| 690 | 3300006038 | Ga0075365_10086269 | Ga0075365_100862693 | 323 |
| 691 | 3300006038 | Ga0075365_10172521 | Ga0075365_101725212 | 323 |
| 692 | 3300006846 | Ga0075430_100100857 | Ga0075430_1001008572 | 323 |
| 693 | 3300009098 | Ga0105245_10005783 | Ga0105245_100057839 | 323 |
| 694 | 3300009148 | Ga0105243_10047394 | Ga0105243_100473942 | 323 |
| 695 | 3300013297 | Ga0157378_10510143 | Ga0157378_105101431 | 323 |
| 696 | 3300013307 | Ga0157372_10606721 | Ga0157372_106067212 | 323 |
| 697 | 3300013308 | Ga0157375_10048497 | Ga0157375_100484974 | 323 |
| 698 | 3300014325 | Ga0163163_10107630 | Ga0163163_101076302 | 323 |
| 699 | 3300014969 | Ga0157376_10103402 | Ga0157376_101034022 | 323 |
| 700 | 3300017792 | Ga0163161_10065977 | Ga0163161_100659773 | 323 |
| 701 | 3300025912 | Ga0207707_10003654 | Ga0207707_1000365410 | 323 |
| 702 | 3300025917 | Ga0207660_10005162 | Ga0207660_100051624 | 323 |
| 703 | 3300025921 | Ga0207652_10001944 | Ga0207652_1000194410 | 323 |
| 704 | 3300025927 | Ga0207687_10017967 | Ga0207687_100179674 | 323 |
| 705 | 3300025935 | Ga0207709_10060791 | Ga0207709_100607911 | 323 |
| 706 | 3300025944 | Ga0207661_10001780 | Ga0207661_100017809 | 323 |
| 707 | 3300025945 | Ga0207679_10308269 | Ga0207679_103082692 | 323 |
| 708 | 3300025981 | Ga0207640_10083577 | Ga0207640_100835772 | 323 |
| 709 | 3300026023 | Ga0207677_10001435 | Ga0207677_100014355 | 323 |
| 710 | 3300026078 | Ga0207702_10014205 | Ga0207702_100142057 | 323 |
| 711 | 3300026078 | Ga0207702_10016852 | Ga0207702_100168524 | 323 |
| 712 | 3300026118 | Ga0207675_100009465 | Ga0207675_1000094659 | 323 |
| 713 | 3300026121 | Ga0207683_10023702 | Ga0207683_100237024 | 323 |
| 714 | 3300036401 | Ga0373937_0074513 | Ga0373937_0074513_1754_2752 | 323 |
| 715 | 3300038443 | Ga0395901_0235219 | Ga0395901_0235219_465_1445 | 323 |
| 716 | 3300046462 | Ga0495651_0090570 | Ga0495651_0090570_1187_2185 | 323 |
| 717 | 3300046463 | Ga0495653_0022048 | Ga0495653_0022048_2532_3530 | 323 |
| 718 | 3300046511 | Ga0495608_0022630 | Ga0495608_0022630_1064_2062 | 323 |
| 719 | 3300046517 | Ga0495630_0032881 | Ga0495630_0032881_2619_3617 | 323 |
| 720 | 3300046529 | Ga0495652_0011511 | Ga0495652_0011511_5207_6205 | 323 |
| 721 | 3300046537 | Ga0495598_0000907 | Ga0495598_0000907_1360_2376 | 323 |
| 722 | 3300046543 | Ga0495645_0048974 | Ga0495645_0048974_477_1475 | 323 |
| 723 | 3300046559 | Ga0495667_0010495 | Ga0495667_0010495_1492_2490 | 323 |
| 724 | 3300046675 | Ga0495657_0019467 | Ga0495657_0019467_1684_2682 | 323 |
| 725 | 3300046678 | Ga0495599_0007133 | Ga0495599_0007133_1275_2273 | 323 |
| 726 | 3300046680 | Ga0495646_0087929 | Ga0495646_0087929_225_1223 | 323 |
| 727 | 3300046690 | Ga0495624_0041230 | Ga0495624_0041230_991_1989 | 323 |
| 728 | 3300046809 | Ga0495600_0045091 | Ga0495600_0045091_971_1969 | 323 |
| 729 | 3300047317 | Ga0495604_0009004 | Ga0495604_0009004_5931_6929 | 323 |
| 730 | 3300047319 | Ga0495674_0030284 | Ga0495674_0030284_495_1493 | 323 |
| 731 | 3300047322 | Ga0495680_0021298 | Ga0495680_0021298_254_1252 | 323 |
| 732 | 3300048088 | Ga0495602_0046294 | Ga0495602_0046294_966_1964 | 323 |
| 733 | 3300048903 | Ga0496100_0005985 | Ga0496100_0005985_1995_2984 | 323 |
| 734 | 3300048904 | Ga0496101_0001626 | Ga0496101_0001626_4261_5250 | 323 |
| 735 | 3300048905 | Ga0496102_0008240 | Ga0496102_0008240_5706_6695 | 323 |
| 736 | 3300048906 | Ga0496103_0004839 | Ga0496103_0004839_4810_5799 | 323 |
| 737 | 3300048907 | Ga0496104_0002883 | Ga0496104_0002883_3109_4098 | 323 |
| 738 | 3300048907 | Ga0496104_0025674 | Ga0496104_0025674_3646_4677 | 323 |
| 739 | 3300048908 | Ga0496105_0001452 | Ga0496105_0001452_10702_11691 | 323 |
| 740 | 3300048908 | Ga0496105_0005013 | Ga0496105_0005013_3165_4196 | 323 |
| 741 | 3300048910 | Ga0496107_0022185 | Ga0496107_0022185_383_1372 | 323 |
| 742 | 3300048910 | Ga0496107_0057330 | Ga0496107_0057330_1392_2381 | 323 |
| 743 | 3300048911 | Ga0496108_0001695 | Ga0496108_0001695_4001_4990 | 323 |
| 744 | 3300048912 | Ga0496109_0003228 | Ga0496109_0003228_2974_3963 | 323 |
| 745 | 3300048913 | Ga0496110_0005612 | Ga0496110_0005612_3254_4243 | 323 |
| 746 | 3300048913 | Ga0496110_0231305 | Ga0496110_0231305_466_1455 | 323 |
| 747 | 3300048914 | Ga0496111_0010363 | Ga0496111_0010363_3575_4564 | 323 |
| 748 | 3300048914 | Ga0496111_0013018 | Ga0496111_0013018_2611_3600 | 323 |
| 749 | 3300048917 | Ga0496114_0000184 | Ga0496114_0000184_36202_37191 | 323 |
| 750 | 3300048917 | Ga0496114_0000466 | Ga0496114_0000466_12188_13177 | 323 |
| 751 | 3300048918 | Ga0496115_0083536 | Ga0496115_0083536_840_1829 | 323 |
| 752 | 3300048922 | Ga0496119_0003727 | Ga0496119_0003727_10438_11469 | 323 |
| 753 | 3300048924 | Ga0496121_0005891 | Ga0496121_0005891_5971_7002 | 323 |
| 754 | 3300048928 | Ga0496125_0013994 | Ga0496125_0013994_3552_4583 | 323 |
| 755 | 3300048929 | Ga0496126_0029904 | Ga0496126_0029904_2863_3876 | 323 |
| 756 | 3300049568 | Ga0501031_0000445 | Ga0501031_0000445_3501_4547 | 323 |
| 757 | 3300049569 | Ga0501032_0000876 | Ga0501032_0000876_19263_20309 | 323 |
| 758 | 3300049570 | Ga0501033_0000294 | Ga0501033_0000294_4833_5879 | 323 |
| 759 | 3300049572 | Ga0501036_0005562 | Ga0501036_0005562_174_1220 | 323 |
| 760 | 3300049573 | Ga0501037_0000378 | Ga0501037_0000378_21126_22172 | 323 |
| 761 | 3300049574 | Ga0501038_0000087 | Ga0501038_0000087_9010_10056 | 323 |
| 762 | 3300049575 | Ga0501039_0001020 | Ga0501039_0001020_14526_15572 | 323 |
| 763 | 3300049576 | Ga0501040_0000007 | Ga0501040_0000007_20631_21677 | 323 |
| 764 | 3300049576 | Ga0501040_0017844 | Ga0501040_0017844_1355_2401 | 323 |
| 765 | 3300049577 | Ga0501041_0000005 | Ga0501041_0000005_58054_59100 | 323 |
| 766 | 3300049578 | Ga0501042_0003216 | Ga0501042_0003216_174_1220 | 323 |
| 767 | 3300049579 | Ga0501043_0000998 | Ga0501043_0000998_14843_15889 | 323 |
| 768 | 3300049580 | Ga0501046_0001278 | Ga0501046_0001278_18356_19402 | 323 |
| 769 | 3300049581 | Ga0501047_0000592 | Ga0501047_0000592_18346_19392 | 323 |
| 770 | 3300049581 | Ga0501047_0014482 | Ga0501047_0014482_2068_3108 | 323 |
| 771 | 3300049582 | Ga0501048_0000018 | Ga0501048_0000018_68692_69738 | 323 |
| 772 | 3300049584 | Ga0501068_0000134 | Ga0501068_0000134_19201_20247 | 323 |
| 773 | 3300049585 | Ga0501069_0000426 | Ga0501069_0000426_8993_10039 | 323 |
| 774 | 3300049586 | Ga0501070_0004569 | Ga0501070_0004569_2924_3970 | 323 |
| 775 | 3300049587 | Ga0501071_0000005 | Ga0501071_0000005_68692_69738 | 323 |
| 776 | 3300049588 | Ga0501072_0000269 | Ga0501072_0000269_22142_23188 | 323 |
| 777 | 3300049589 | Ga0501073_0001327 | Ga0501073_0001327_8205_9251 | 323 |
| 778 | 3300049590 | Ga0501074_0001138 | Ga0501074_0001138_11409_12455 | 323 |
| 779 | 3300049591 | Ga0501075_0000009 | Ga0501075_0000009_13047_14093 | 323 |
| 780 | 3300049591 | Ga0501075_0062138 | Ga0501075_0062138_1078_2124 | 323 |
| 781 | 3300049592 | Ga0501076_0000028 | Ga0501076_0000028_9010_10056 | 323 |
| 782 | 3300049593 | Ga0501077_0000006 | Ga0501077_0000006_42111_43157 | 323 |
| 783 | 3300049741 | Ga0501079_0000881 | Ga0501079_0000881_46_1092 | 323 |
| 784 | 3300049741 | Ga0501079_0025921 | Ga0501079_0025921_2998_4044 | 323 |
| 785 | 3300049742 | Ga0501080_0000626 | Ga0501080_0000626_19263_20309 | 323 |
| 786 | 3300049743 | Ga0501081_0000003 | Ga0501081_0000003_22142_23188 | 323 |
| 787 | 3300049744 | Ga0501083_0001673 | Ga0501083_0001673_10019_11065 | 323 |
| 788 | 3300049822 | Ga0501035_0000175 | Ga0501035_0000175_9010_10056 | 323 |
| 789 | 3300049823 | Ga0501044_0006303 | Ga0501044_0006303_4057_5103 | 323 |
| 790 | 3300049823 | Ga0501044_0101327 | Ga0501044_0101327_495_1535 | 323 |
| 791 | 3300049824 | Ga0501045_0000009 | Ga0501045_0000009_20630_21676 | 323 |
| 792 | 3300050492 | nmdc:mga0yw44_110719_c1 | nmdc:mga0yw44_110719_c1_235_1266 | 323 |
| 793 | 3300050494 | nmdc:mga06z11_159774_c1 | nmdc:mga06z11_159774_c1_241_1272 | 323 |
| 794 | 3300050509 | nmdc:mga0qj67_76093_c1 | nmdc:mga0qj67_76093_c1_224_1216 | 323 |
| 795 | 3300053084 | Ga0495595_0013656 | Ga0495595_0013656_1693_2691 | 323 |
| 796 | 3300054114 | Ga0501084_0005874 | Ga0501084_0005874_9010_10056 | 323 |
| 797 | 3300060353 | Ga0501082_0000063 | Ga0501082_0000063_58851_59897 | 323 |
| 798 | 3300060353 | Ga0501082_0195502 | Ga0501082_0195502_426_1472 | 323 |
| 799 | 3300061734 | Ga0530510_0000014 | Ga0530510_0000014_84218_85264 | 323 |
| 800 | 3300005439 | Ga0070711_100322332 | Ga0070711_1003223322 | 324 |
| 801 | 3300006038 | Ga0075365_10023969 | Ga0075365_100239694 | 324 |
| 802 | 3300025915 | Ga0207693_10271474 | Ga0207693_102714742 | 324 |
| 803 | 3300031548 | Ga0307408_100239143 | Ga0307408_1002391433 | 324 |
| 804 | 3300031901 | Ga0307406_10027082 | Ga0307406_100270824 | 324 |
| 805 | 3300031903 | Ga0307407_10048327 | Ga0307407_100483271 | 324 |
| 806 | 3300032002 | Ga0307416_100020572 | Ga0307416_1000205726 | 324 |
| 807 | 3300032002 | Ga0307416_100185584 | Ga0307416_1001855842 | 324 |
| 808 | 3300032004 | Ga0307414_10113428 | Ga0307414_101134283 | 324 |
| 809 | 3300037312 | Ga0395899_0145260 | Ga0395899_0145260_92_1093 | 324 |
| 810 | 3300037418 | Ga0395900_0003557 | Ga0395900_0003557_9720_10721 | 324 |
| 811 | 3300037418 | Ga0395900_0010351 | Ga0395900_0010351_5789_6790 | 324 |
| 812 | 3300037466 | Ga0395898_0011171 | Ga0395898_0011171_2450_3451 | 324 |
| 813 | 3300037471 | Ga0395905_0010800 | Ga0395905_0010800_1131_2132 | 324 |
| 814 | 3300037471 | Ga0395905_0046007 | Ga0395905_0046007_1030_2031 | 324 |
| 815 | 3300038443 | Ga0395901_0032816 | Ga0395901_0032816_2665_3666 | 324 |
| 816 | 3300038443 | Ga0395901_0064884 | Ga0395901_0064884_2248_3249 | 324 |
| 817 | 3300048905 | Ga0496102_0044639 | Ga0496102_0044639_2190_3176 | 324 |
| 818 | 3300048906 | Ga0496103_0146001 | Ga0496103_0146001_353_1339 | 324 |
| 819 | 3300048907 | Ga0496104_0086342 | Ga0496104_0086342_876_1862 | 324 |
| 820 | 3300048908 | Ga0496105_0006590 | Ga0496105_0006590_826_1812 | 324 |
| 821 | 3300048908 | Ga0496105_0264236 | Ga0496105_0264236_298_1293 | 324 |
| 822 | 3300048910 | Ga0496107_0106160 | Ga0496107_0106160_245_1231 | 324 |
| 823 | 3300048911 | Ga0496108_0002798 | Ga0496108_0002798_12198_13184 | 324 |
| 824 | 3300048912 | Ga0496109_0412684 | Ga0496109_0412684_41_1033 | 324 |
| 825 | 3300048915 | Ga0496112_0001529 | Ga0496112_0001529_925_1911 | 324 |
| 826 | 3300048916 | Ga0496113_0046175 | Ga0496113_0046175_1672_2658 | 324 |
| 827 | 3300048917 | Ga0496114_0060025 | Ga0496114_0060025_1533_2522 | 324 |
| 828 | 3300048917 | Ga0496114_0071057 | Ga0496114_0071057_1178_2164 | 324 |
| 829 | 3300048918 | Ga0496115_0036943 | Ga0496115_0036943_2049_3035 | 324 |
| 830 | 3300048919 | Ga0496116_0000780 | Ga0496116_0000780_9386_10420 | 324 |
| 831 | 3300048922 | Ga0496119_0004215 | Ga0496119_0004215_9367_10401 | 324 |
| 832 | 3300048924 | Ga0496121_0016585 | Ga0496121_0016585_4381_5400 | 324 |
| 833 | 3300049569 | Ga0501032_0192763 | Ga0501032_0192763_166_1200 | 324 |
| 834 | 3300049592 | Ga0501076_0170136 | Ga0501076_0170136_702_1703 | 324 |
| 835 | 3300059421 | Ga0590071_011163 | Ga0590071_011163_566_1555 | 324 |
| 836 | 3300059424 | Ga0590075_003699 | Ga0590075_003699_567_1556 | 324 |
| 837 | 3300005467 | Ga0070706_100066121 | Ga0070706_1000661213 | 325 |
| 838 | 3300005471 | Ga0070698_100001638 | Ga0070698_1000016386 | 325 |
| 839 | 3300005471 | Ga0070698_100024518 | Ga0070698_1000245182 | 325 |
| 840 | 3300005937 | Ga0081455_10008830 | Ga0081455_100088303 | 325 |
| 841 | 3300005985 | Ga0081539_10060633 | Ga0081539_100606332 | 325 |
| 842 | 3300006028 | Ga0070717_10096537 | Ga0070717_100965372 | 325 |
| 843 | 3300006847 | Ga0075431_100152117 | Ga0075431_1001521172 | 325 |
| 844 | 3300006871 | Ga0075434_100007144 | Ga0075434_1000071444 | 325 |
| 845 | 3300009147 | Ga0114129_10001119 | Ga0114129_1000111917 | 325 |
| 846 | 3300009147 | Ga0114129_10029378 | Ga0114129_100293784 | 325 |
| 847 | 3300037418 | Ga0395900_0004073 | Ga0395900_0004073_13308_14297 | 325 |
| 848 | 3300037418 | Ga0395900_0094819 | Ga0395900_0094819_893_1894 | 325 |
| 849 | 3300037466 | Ga0395898_0001604 | Ga0395898_0001604_25576_26565 | 325 |
| 850 | 3300037471 | Ga0395905_0032416 | Ga0395905_0032416_3635_4624 | 325 |
| 851 | 3300038443 | Ga0395901_0002643 | Ga0395901_0002643_15488_16477 | 325 |
| 852 | 3300046664 | Ga0495659_0006884 | Ga0495659_0006884_1033_2025 | 325 |
| 853 | 3300050507 | nmdc:mga05p37_116658_c1 | nmdc:mga05p37_116658_c1_2230_3222 | 325 |
| 854 | 3300050507 | nmdc:mga05p37_8447_c1 | nmdc:mga05p37_8447_c1_2432_3427 | 325 |
| 855 | 3300050512 | nmdc:mga0n895_204409_c1 | nmdc:mga0n895_204409_c1_381_1376 | 325 |
| 856 | 3300050513 | nmdc:mga0rr50_2782_c1 | nmdc:mga0rr50_2782_c1_147_1142 | 325 |
| 857 | 3300050514 | nmdc:mga08x19_62434_c1 | nmdc:mga08x19_62434_c1_229_1224 | 325 |
| 858 | 3300003373 | JGI25407J50210_10002731 | JGI25407J50210_100027314 | 326 |
| 859 | 3300003373 | JGI25407J50210_10003431 | JGI25407J50210_100034312 | 326 |
| 860 | 3300005339 | Ga0070660_100065384 | Ga0070660_1000653843 | 326 |
| 861 | 3300005340 | Ga0070689_100057873 | Ga0070689_1000578732 | 326 |
| 862 | 3300005367 | Ga0070667_100087275 | Ga0070667_1000872752 | 326 |
| 863 | 3300005434 | Ga0070709_10007649 | Ga0070709_100076492 | 326 |
| 864 | 3300005437 | Ga0070710_10029625 | Ga0070710_100296252 | 326 |
| 865 | 3300005441 | Ga0070700_100021145 | Ga0070700_1000211452 | 326 |
| 866 | 3300005455 | Ga0070663_100032323 | Ga0070663_1000323232 | 326 |
| 867 | 3300005456 | Ga0070678_100007594 | Ga0070678_1000075946 | 326 |
| 868 | 3300005466 | Ga0070685_10045930 | Ga0070685_100459302 | 326 |
| 869 | 3300005467 | Ga0070706_100004949 | Ga0070706_10000494914 | 326 |
| 870 | 3300005468 | Ga0070707_100001551 | Ga0070707_10000155122 | 326 |
| 871 | 3300005471 | Ga0070698_100084562 | Ga0070698_1000845623 | 326 |
| 872 | 3300005518 | Ga0070699_100017223 | Ga0070699_1000172237 | 326 |
| 873 | 3300005549 | Ga0070704_100076925 | Ga0070704_1000769252 | 326 |
| 874 | 3300005614 | Ga0068856_100042442 | Ga0068856_1000424424 | 326 |
| 875 | 3300005615 | Ga0070702_100010715 | Ga0070702_1000107153 | 326 |
| 876 | 3300005618 | Ga0068864_100345034 | Ga0068864_1003450342 | 326 |
| 877 | 3300005937 | Ga0081455_10068826 | Ga0081455_100688263 | 326 |
| 878 | 3300005981 | Ga0081538_10000297 | Ga0081538_1000029734 | 326 |
| 879 | 3300005981 | Ga0081538_10000502 | Ga0081538_1000050223 | 326 |
| 880 | 3300005981 | Ga0081538_10000925 | Ga0081538_1000092529 | 326 |
| 881 | 3300005981 | Ga0081538_10008148 | Ga0081538_100081484 | 326 |
| 882 | 3300005981 | Ga0081538_10018371 | Ga0081538_100183716 | 326 |
| 883 | 3300006038 | Ga0075365_10016179 | Ga0075365_100161796 | 326 |
| 884 | 3300006163 | Ga0070715_10022486 | Ga0070715_100224862 | 326 |
| 885 | 3300006237 | Ga0097621_100024560 | Ga0097621_1000245604 | 326 |
| 886 | 3300006358 | Ga0068871_100027672 | Ga0068871_1000276722 | 326 |
| 887 | 3300006846 | Ga0075430_100077997 | Ga0075430_1000779973 | 326 |
| 888 | 3300006847 | Ga0075431_100045347 | Ga0075431_1000453476 | 326 |
| 889 | 3300006880 | Ga0075429_100007313 | Ga0075429_1000073135 | 326 |
| 890 | 3300009098 | Ga0105245_10060054 | Ga0105245_100600542 | 326 |
| 891 | 3300009148 | Ga0105243_10074340 | Ga0105243_100743402 | 326 |
| 892 | 3300009177 | Ga0105248_10083797 | Ga0105248_100837975 | 326 |
| 893 | 3300009551 | Ga0105238_10249005 | Ga0105238_102490052 | 326 |
| 894 | 3300009553 | Ga0105249_10011189 | Ga0105249_100111893 | 326 |
| 895 | 3300010375 | Ga0105239_10006331 | Ga0105239_1000633113 | 326 |
| 896 | 3300013296 | Ga0157374_10006829 | Ga0157374_100068298 | 326 |
| 897 | 3300013308 | Ga0157375_10010359 | Ga0157375_100103594 | 326 |
| 898 | 3300014745 | Ga0157377_10005388 | Ga0157377_100053884 | 326 |
| 899 | 3300014969 | Ga0157376_10047691 | Ga0157376_100476913 | 326 |
| 900 | 3300025899 | Ga0207642_10014374 | Ga0207642_100143742 | 326 |
| 901 | 3300025906 | Ga0207699_10027383 | Ga0207699_100273833 | 326 |
| 902 | 3300025915 | Ga0207693_10001551 | Ga0207693_100015516 | 326 |
| 903 | 3300025916 | Ga0207663_10108944 | Ga0207663_101089442 | 326 |
| 904 | 3300025919 | Ga0207657_10014368 | Ga0207657_100143687 | 326 |
| 905 | 3300025922 | Ga0207646_10009623 | Ga0207646_100096234 | 326 |
| 906 | 3300025927 | Ga0207687_10161060 | Ga0207687_101610602 | 326 |
| 907 | 3300025938 | Ga0207704_10008706 | Ga0207704_100087062 | 326 |
| 908 | 3300025940 | Ga0207691_10018612 | Ga0207691_100186123 | 326 |
| 909 | 3300025941 | Ga0207711_10134064 | Ga0207711_101340643 | 326 |
| 910 | 3300026023 | Ga0207677_10018809 | Ga0207677_100188093 | 326 |
| 911 | 3300026067 | Ga0207678_10025503 | Ga0207678_100255033 | 326 |
| 912 | 3300026075 | Ga0207708_10000757 | Ga0207708_1000075725 | 326 |
| 913 | 3300026089 | Ga0207648_10026646 | Ga0207648_100266464 | 326 |
| 914 | 3300026095 | Ga0207676_10080307 | Ga0207676_100803072 | 326 |
| 915 | 3300026121 | Ga0207683_10000740 | Ga0207683_1000074022 | 326 |
| 916 | 3300028379 | Ga0268266_10027948 | Ga0268266_100279482 | 326 |
| 917 | 3300035725 | Ga0373947_0036675 | Ga0373947_0036675_1498_2502 | 326 |
| 918 | 3300037068 | Ga0373925_0085421 | Ga0373925_0085421_654_1658 | 326 |
| 919 | 3300037466 | Ga0395898_0009405 | Ga0395898_0009405_3667_4677 | 326 |
| 920 | 3300037466 | Ga0395898_0115528 | Ga0395898_0115528_828_1832 | 326 |
| 921 | 3300037471 | Ga0395905_0001761 | Ga0395905_0001761_17255_18265 | 326 |
| 922 | 3300037471 | Ga0395905_0171259 | Ga0395905_0171259_765_1769 | 326 |
| 923 | 3300038443 | Ga0395901_0001597 | Ga0395901_0001597_17639_18649 | 326 |
| 924 | 3300041512 | Ga0451853_2357732 | Ga0451853_2357732_13_1020 | 326 |
| 925 | 3300046455 | Ga0495603_0133104 | Ga0495603_0133104_89_1093 | 326 |
| 926 | 3300046455 | Ga0495603_0181746 | Ga0495603_0181746_101_1108 | 326 |
| 927 | 3300046473 | Ga0495582_0027982 | Ga0495582_0027982_688_1692 | 326 |
| 928 | 3300046473 | Ga0495582_0038899 | Ga0495582_0038899_353_1357 | 326 |
| 929 | 3300046475 | Ga0495639_0047772 | Ga0495639_0047772_61_1065 | 326 |
| 930 | 3300046491 | Ga0495584_0028330 | Ga0495584_0028330_510_1517 | 326 |
| 931 | 3300046499 | Ga0495594_0021620 | Ga0495594_0021620_2235_3239 | 326 |
| 932 | 3300046674 | Ga0495588_0058425 | Ga0495588_0058425_844_1848 | 326 |
| 933 | 3300046692 | Ga0495671_0059350 | Ga0495671_0059350_480_1487 | 326 |
| 934 | 3300047315 | Ga0495581_0000983 | Ga0495581_0000983_12201_13205 | 326 |
| 935 | 3300047321 | Ga0495676_0005250 | Ga0495676_0005250_4886_5890 | 326 |
| 936 | 3300047321 | Ga0495676_0078076 | Ga0495676_0078076_1209_2213 | 326 |
| 937 | 3300048904 | Ga0496101_0032186 | Ga0496101_0032186_1822_2826 | 326 |
| 938 | 3300048905 | Ga0496102_0042632 | Ga0496102_0042632_1475_2479 | 326 |
| 939 | 3300048906 | Ga0496103_0002323 | Ga0496103_0002323_1214_2218 | 326 |
| 940 | 3300048907 | Ga0496104_0167800 | Ga0496104_0167800_119_1126 | 326 |
| 941 | 3300048908 | Ga0496105_0117228 | Ga0496105_0117228_1113_2117 | 326 |
| 942 | 3300048912 | Ga0496109_0002720 | Ga0496109_0002720_1134_2141 | 326 |
| 943 | 3300048912 | Ga0496109_0035376 | Ga0496109_0035376_2982_3986 | 326 |
| 944 | 3300048913 | Ga0496110_0020938 | Ga0496110_0020938_1480_2487 | 326 |
| 945 | 3300048914 | Ga0496111_0002628 | Ga0496111_0002628_590_1597 | 326 |
| 946 | 3300048915 | Ga0496112_0046356 | Ga0496112_0046356_2863_3867 | 326 |
| 947 | 3300048916 | Ga0496113_0121550 | Ga0496113_0121550_905_1912 | 326 |
| 948 | 3300048917 | Ga0496114_0001692 | Ga0496114_0001692_13418_14422 | 326 |
| 949 | 3300048917 | Ga0496114_0072956 | Ga0496114_0072956_94_1101 | 326 |
| 950 | 3300049568 | Ga0501031_0140303 | Ga0501031_0140303_120_1118 | 326 |
| 951 | 3300049570 | Ga0501033_0215408 | Ga0501033_0215408_55_1053 | 326 |
| 952 | 3300049572 | Ga0501036_0012995 | Ga0501036_0012995_1785_2783 | 326 |
| 953 | 3300049572 | Ga0501036_0183971 | Ga0501036_0183971_631_1629 | 326 |
| 954 | 3300049574 | Ga0501038_0132419 | Ga0501038_0132419_10_1008 | 326 |
| 955 | 3300049575 | Ga0501039_0103067 | Ga0501039_0103067_1140_2138 | 326 |
| 956 | 3300049575 | Ga0501039_0139021 | Ga0501039_0139021_741_1736 | 326 |
| 957 | 3300049576 | Ga0501040_0006120 | Ga0501040_0006120_3387_4385 | 326 |
| 958 | 3300049576 | Ga0501040_0040161 | Ga0501040_0040161_797_1795 | 326 |
| 959 | 3300049577 | Ga0501041_0002281 | Ga0501041_0002281_9670_10668 | 326 |
| 960 | 3300049578 | Ga0501042_0034208 | Ga0501042_0034208_913_1911 | 326 |
| 961 | 3300049580 | Ga0501046_0017453 | Ga0501046_0017453_2478_3476 | 326 |
| 962 | 3300049582 | Ga0501048_0011634 | Ga0501048_0011634_757_1755 | 326 |
| 963 | 3300049587 | Ga0501071_0019490 | Ga0501071_0019490_3562_4560 | 326 |
| 964 | 3300049587 | Ga0501071_0039336 | Ga0501071_0039336_1738_2736 | 326 |
| 965 | 3300049588 | Ga0501072_0012028 | Ga0501072_0012028_4523_5521 | 326 |
| 966 | 3300049588 | Ga0501072_0038239 | Ga0501072_0038239_1041_2039 | 326 |
| 967 | 3300049590 | Ga0501074_0161055 | Ga0501074_0161055_304_1296 | 326 |
| 968 | 3300049590 | Ga0501074_0164036 | Ga0501074_0164036_406_1404 | 326 |
| 969 | 3300049592 | Ga0501076_0004133 | Ga0501076_0004133_6991_7989 | 326 |
| 970 | 3300049592 | Ga0501076_0036691 | Ga0501076_0036691_368_1366 | 326 |
| 971 | 3300049593 | Ga0501077_0020007 | Ga0501077_0020007_3008_4006 | 326 |
| 972 | 3300049593 | Ga0501077_0036690 | Ga0501077_0036690_1429_2427 | 326 |
| 973 | 3300049741 | Ga0501079_0003399 | Ga0501079_0003399_6693_7691 | 326 |
| 974 | 3300049741 | Ga0501079_0050832 | Ga0501079_0050832_1561_2559 | 326 |
| 975 | 3300049741 | Ga0501079_0133505 | Ga0501079_0133505_858_1850 | 326 |
| 976 | 3300049743 | Ga0501081_0001137 | Ga0501081_0001137_2769_3767 | 326 |
| 977 | 3300049822 | Ga0501035_0068212 | Ga0501035_0068212_1756_2754 | 326 |
| 978 | 3300049824 | Ga0501045_0002370 | Ga0501045_0002370_9709_10707 | 326 |
| 979 | 3300049824 | Ga0501045_0056157 | Ga0501045_0056157_291_1289 | 326 |
| 980 | 3300050508 | nmdc:mga09592_1116_c1 | nmdc:mga09592_1116_c1_5580_6572 | 326 |
| 981 | 3300050509 | nmdc:mga0qj67_9898_c1 | nmdc:mga0qj67_9898_c1_4534_5526 | 326 |
| 982 | 3300054114 | Ga0501084_0050734 | Ga0501084_0050734_1065_2063 | 326 |
| 983 | 3300060353 | Ga0501082_0042607 | Ga0501082_0042607_367_1365 | 326 |
| 984 | 3300060353 | Ga0501082_0047272 | Ga0501082_0047272_1848_2846 | 326 |
| 985 | 3300061734 | Ga0530510_0014247 | Ga0530510_0014247_370_1368 | 326 |
| 986 | 3300061734 | Ga0530510_0031133 | Ga0530510_0031133_978_1976 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9466 | 6 | 229 |
| 7x0q-assembly1.cif.gz_B | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9436 | 6 | 227 |
| 8eop-assembly1.cif.gz_A | cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state | 0.9428 | 5 | 229 |
| 8hps-assembly1.cif.gz_D | lpqy-sugabc in state 5 | 0.9386 | 7 | 227 |
| 8hpr-assembly1.cif.gz_C | lpqy-sugabc in state 4 | 0.9369 | 7 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9828 | 4 | 231 | 3.40.50.300 |
| af_A4I2P8_1496_1744_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9793 | 2 | 229 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9704 | 4 | 229 | 3.40.50.300 |
| af_P78363_1926_2175_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9694 | 7 | 231 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9662 | 7 | 229 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I2M2I1-F1-model_v4 | ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein | 0.9817 | 7 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A1D2R6P7-F1-model_v4 | ABC transporter domain-containing protein | 0.9782 | 7 | 230 |
GO:0005524
GO:0016887 |
| AF-A0A7C6CAI4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9781 | 7 | 230 |
GO:0005524
GO:0016887 |
| AF-A0A7V5DKD2-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9742 | 7 | 222 |
GO:0005524
GO:0016887 GO:0017004 GO:0022857 |
| AF-A0A4Q7PN08-F1-model_v4 | deleted | 0.9733 | 6 | 229 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar