F487518

General Info

Members Datasets Scaffolds Average Seq Length
986 346 986 328

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10018371|Ga0081538_100183716
Length 356
Sequence LLVAGAPPGRVPRGAYARGVRDEHGIQAEGLVREFKGGIRAVDGIRLEVRPGEIYGFLGPNGAGKSTTVHMLTTLLPPTAGTACVAGFDVARDGAKVRAAIGAALQEAALDPLLTGREHLRLQTALHGMPKAERRERTEALLERVGLTQAADRKVRTYSGGMKRRLDLALALVHEPSILFLDEPTTGLDPQSRNALWSEVARLSGDEGVTVFLTTQYLEEADVLADRVGIIDHGRIVAEGTPGALKAEIGRPSVEAVPCNSSERAAVAEVLRRFGRPVPGSPKGVTVRLDGGEEALADVVRALETEGLHLDHLQLHSPTLDDVFLAKTGRSLEGAAEEAESRPDAESEGEPEPLRA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
155 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
156 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 11.05
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002731 3300003373 Bacteria 4198
2 JGI25407J50210_10003431 3300003373 Bacteria 3791
3 JGI25407J50210_10010599 3300003373 Bacteria 2347
4 Ga0070658_10050495 3300005327 Bacteria 3371
5 Ga0070658_10165550 3300005327 Bacteria 1856
6 Ga0070683_100001714 3300005329 Bacteria 17052
7 Ga0070683_100013143 3300005329 Bacteria 7208
8 Ga0070683_100018473 3300005329 Bacteria 6176
9 Ga0070683_100023359 3300005329 Bacteria 5530
10 Ga0070683_100043303 3300005329 Bacteria 4149
11 Ga0070683_100237672 3300005329 Bacteria 1732
12 Ga0070690_100092170 3300005330 Bacteria 1998
13 Ga0070690_100301662 3300005330 Bacteria 1149
14 Ga0068869_100006717 3300005334 Bacteria 7312
15 Ga0070680_100004037 3300005336 Bacteria 10977
16 Ga0070680_100005608 3300005336 Bacteria 9506
17 Ga0070680_100014559 3300005336 Bacteria 6152
18 Ga0070680_100037693 3300005336 Bacteria 3907
19 Ga0070682_100000080 3300005337 Bacteria 85683
20 Ga0070682_100030235 3300005337 Bacteria 3268
21 Ga0068868_100000095 3300005338 Bacteria 54537
22 Ga0068868_100220158 3300005338 Bacteria 1589
23 Ga0070660_100001494 3300005339 Bacteria 16003
24 Ga0070660_100003867 3300005339 Bacteria 10339
25 Ga0070660_100065384 3300005339 Bacteria 2830
26 Ga0070660_100136777 3300005339 Bacteria 1963
27 Ga0070660_100284427 3300005339 Bacteria 1353
28 Ga0070660_100305580 3300005339 Bacteria 1305
29 Ga0070689_100057873 3300005340 Bacteria 3010
30 Ga0070691_10008984 3300005341 Bacteria 4572
31 Ga0070691_10013863 3300005341 Bacteria 3699
32 Ga0070661_100000005 3300005344 Bacteria 220455
33 Ga0070661_100007123 3300005344 Bacteria 7712
34 Ga0070661_100063455 3300005344 Bacteria 2713
35 Ga0070661_100241349 3300005344 Bacteria 1392
36 Ga0070675_100000058 3300005354 Bacteria 66874
37 Ga0070675_100089174 3300005354 Bacteria 2582
38 Ga0070674_100000020 3300005356 Bacteria 88217
39 Ga0070674_100051096 3300005356 Bacteria 2848
40 Ga0070674_100196524 3300005356 Bacteria 1555
41 Ga0070673_100046800 3300005364 Bacteria 3362
42 Ga0070688_100000333 3300005365 Bacteria 24059
43 Ga0070688_100002793 3300005365 Bacteria 8872
44 Ga0070688_100005500 3300005365 Bacteria 6680
45 Ga0070688_100053154 3300005365 Bacteria 2533
46 Ga0070659_100026115 3300005366 Bacteria 4492
47 Ga0070659_100115029 3300005366 Bacteria 2174
48 Ga0070667_100087275 3300005367 Bacteria 2677
49 Ga0070709_10007649 3300005434 Bacteria 5931
50 Ga0070710_10029625 3300005437 Bacteria 2938
51 Ga0070711_100008345 3300005439 Bacteria 6342
52 Ga0070711_100322332 3300005439 Bacteria 1235
53 Ga0070700_100021145 3300005441 Bacteria 3779
54 Ga0070708_100001181 3300005445 Bacteria 20099
55 Ga0070663_100032323 3300005455 Bacteria 3606
56 Ga0070678_100007594 3300005456 Bacteria 6440
57 Ga0070678_100100238 3300005456 Bacteria 2243
58 Ga0070662_100000363 3300005457 Bacteria 27116
59 Ga0070681_10004636 3300005458 Bacteria 13126
60 Ga0070681_10005901 3300005458 Bacteria 11857
61 Ga0070681_10008977 3300005458 Bacteria 9830
62 Ga0070681_10030842 3300005458 Bacteria 5381
63 Ga0070681_10183635 3300005458 Bacteria 2012
64 Ga0070685_10000293 3300005466 Bacteria 31562
65 Ga0070685_10003954 3300005466 Bacteria 7487
66 Ga0070685_10045930 3300005466 Bacteria 2506
67 Ga0070706_100004949 3300005467 Bacteria 12754
68 Ga0070706_100066121 3300005467 Bacteria 3344
69 Ga0070707_100001551 3300005468 Bacteria 22322
70 Ga0070698_100001638 3300005471 Bacteria 24965
71 Ga0070698_100024518 3300005471 Bacteria 6294
72 Ga0070698_100084562 3300005471 Bacteria 3161
73 Ga0070698_100351864 3300005471 Bacteria 1405
74 Ga0070699_100017223 3300005518 Bacteria 6206
75 Ga0070679_100000537 3300005530 Bacteria 32232
76 Ga0070679_100001830 3300005530 Bacteria 19170
77 Ga0070679_100041206 3300005530 Bacteria 4595
78 Ga0070679_100075881 3300005530 Bacteria 3351
79 Ga0070684_100001226 3300005535 Bacteria 18422
80 Ga0070684_100003228 3300005535 Bacteria 12193
81 Ga0070684_100081312 3300005535 Bacteria 2867
82 Ga0070684_100128869 3300005535 Bacteria 2281
83 Ga0070684_100231040 3300005535 Bacteria 1689
84 Ga0068853_100247958 3300005539 Bacteria 1633
85 Ga0070672_100000004 3300005543 Bacteria 129970
86 Ga0070672_100254547 3300005543 Bacteria 1480
87 Ga0070686_100079214 3300005544 Bacteria 2171
88 Ga0070696_100122600 3300005546 Bacteria 1883
89 Ga0070693_100000833 3300005547 Bacteria 13687
90 Ga0070693_100046964 3300005547 Bacteria 2454
91 Ga0070665_100000159 3300005548 Bacteria 122613
92 Ga0070665_100032824 3300005548 Bacteria 5223
93 Ga0070704_100076925 3300005549 Bacteria 2442
94 Ga0068855_100014350 3300005563 Bacteria 9539
95 Ga0068855_100056520 3300005563 Bacteria 4605
96 Ga0068855_100211426 3300005563 Bacteria 2179
97 Ga0070664_100375561 3300005564 Bacteria 1297
98 Ga0068857_100001285 3300005577 Bacteria 19722
99 Ga0068857_100006742 3300005577 Bacteria 9874
100 Ga0068857_100115283 3300005577 Bacteria 2417
101 Ga0068854_100115490 3300005578 Bacteria 2031
102 Ga0068854_100142366 3300005578 Bacteria 1841
103 Ga0068856_100018421 3300005614 Bacteria 6768
104 Ga0068856_100023907 3300005614 Bacteria 5944
105 Ga0068856_100042442 3300005614 Bacteria 4474
106 Ga0068856_100073050 3300005614 Bacteria 3396
107 Ga0068856_100240699 3300005614 Bacteria 1825
108 Ga0070702_100010715 3300005615 Bacteria 4529
109 Ga0068852_100000012 3300005616 Bacteria 140734
110 Ga0068852_100038655 3300005616 Bacteria 4012
111 Ga0068852_100134945 3300005616 Bacteria 2278
112 Ga0068852_100285715 3300005616 Bacteria 1592
113 Ga0068864_100345034 3300005618 Bacteria 1404
114 Ga0068866_10000002 3300005718 Bacteria 394090
115 Ga0068866_10000019 3300005718 Bacteria 64778
116 Ga0068861_100041642 3300005719 Bacteria 3441
117 Ga0068851_10004367 3300005834 Bacteria 6365
118 Ga0068851_10005192 3300005834 Bacteria 5912
119 Ga0068870_10077016 3300005840 Bacteria 1833
120 Ga0068863_100000032 3300005841 Bacteria 172402
121 Ga0068863_100170585 3300005841 Bacteria 2087
122 Ga0068858_100000049 3300005842 Bacteria 122693
123 Ga0068858_100044747 3300005842 Bacteria 4103
124 Ga0068860_100044947 3300005843 Bacteria 4209
125 Ga0068860_100063112 3300005843 Bacteria 3520
126 Ga0081455_10007120 3300005937 Bacteria 11846
127 Ga0081455_10008830 3300005937 Bacteria 10428
128 Ga0081455_10030105 3300005937 Bacteria 4938
129 Ga0081455_10052361 3300005937 Bacteria 3495
130 Ga0081455_10068826 3300005937 Bacteria 2945
131 Ga0081455_10078225 3300005937 Bacteria 2718
132 Ga0081538_10000099 3300005981 Bacteria 83947
133 Ga0081538_10000252 3300005981 Bacteria 60660
134 Ga0081538_10000297 3300005981 Bacteria 57258
135 Ga0081538_10000429 3300005981 Bacteria 47236
136 Ga0081538_10000502 3300005981 Bacteria 43774
137 Ga0081538_10000691 3300005981 Bacteria 37035
138 Ga0081538_10000804 3300005981 Bacteria 34030
139 Ga0081538_10000894 3300005981 Bacteria 32276
140 Ga0081538_10000925 3300005981 Bacteria 31656
141 Ga0081538_10001600 3300005981 Bacteria 23244
142 Ga0081538_10003180 3300005981 Bacteria 15595
143 Ga0081538_10006926 3300005981 Bacteria 9860
144 Ga0081538_10008148 3300005981 Bacteria 8942
145 Ga0081538_10008586 3300005981 Bacteria 8645
146 Ga0081538_10012000 3300005981 Bacteria 6979
147 Ga0081538_10018371 3300005981 Bacteria 5253
148 Ga0081538_10058246 3300005981 Bacteria 2243
149 Ga0081538_10122477 3300005981 Bacteria 1246
150 Ga0081540_1000006 3300005983 Bacteria 208724
151 Ga0081539_10000062 3300005985 Bacteria 249871
152 Ga0081539_10002242 3300005985 Bacteria 28126
153 Ga0081539_10060633 3300005985 Bacteria 2076
154 Ga0070717_10096537 3300006028 Bacteria 2504
155 Ga0075365_10000014 3300006038 Bacteria 79945
156 Ga0075365_10016179 3300006038 Bacteria 4530
157 Ga0075365_10023969 3300006038 Bacteria 3844
158 Ga0075365_10062766 3300006038 Bacteria 2486
159 Ga0075365_10086269 3300006038 Bacteria 2133
160 Ga0075365_10160419 3300006038 Bacteria 1567
161 Ga0075365_10172521 3300006038 Bacteria 1510
162 Ga0075365_10243986 3300006038 Bacteria 1262
163 Ga0075364_10093685 3300006051 Bacteria 1994
164 Ga0075364_10159535 3300006051 Bacteria 1522
165 Ga0075364_10164661 3300006051 Bacteria 1498
166 Ga0075364_10215756 3300006051 Bacteria 1301
167 Ga0070715_10000012 3300006163 Bacteria 173731
168 Ga0070715_10022486 3300006163 Bacteria 2460
169 Ga0070712_100019039 3300006175 Bacteria 4468
170 Ga0070712_100185024 3300006175 Bacteria 1626
171 Ga0097621_100024560 3300006237 Bacteria 4708
172 Ga0068871_100027672 3300006358 Bacteria 4436
173 Ga0075428_100017809 3300006844 Bacteria 7849
174 Ga0075428_100078209 3300006844 Bacteria 3611
175 Ga0075428_100121552 3300006844 Bacteria 2843
176 Ga0075428_100199352 3300006844 Bacteria 2164
177 Ga0075430_100003677 3300006846 Bacteria 12874
178 Ga0075430_100077997 3300006846 Bacteria 2777
179 Ga0075430_100100857 3300006846 Bacteria 2411
180 Ga0075431_100002485 3300006847 Bacteria 17777
181 Ga0075431_100045347 3300006847 Bacteria 4533
182 Ga0075431_100152117 3300006847 Bacteria 2382
183 Ga0075431_100227289 3300006847 Bacteria 1902
184 Ga0075431_100302345 3300006847 Bacteria 1616
185 Ga0075434_100007144 3300006871 Bacteria 10320
186 Ga0075429_100007313 3300006880 Bacteria 9585
187 Ga0075429_100046393 3300006880 Bacteria 3780
188 Ga0075436_100135926 3300006914 Bacteria 1726
189 Ga0105240_10026755 3300009093 Bacteria 7565
190 Ga0105240_10049813 3300009093 Bacteria 5284
191 Ga0111539_10002085 3300009094 Bacteria 26719
192 Ga0111539_10002336 3300009094 Bacteria 25254
193 Ga0111539_10024191 3300009094 Bacteria 7458
194 Ga0105245_10000056 3300009098 Bacteria 124109
195 Ga0105245_10001677 3300009098 Bacteria 20157
196 Ga0105245_10003691 3300009098 Bacteria 13667
197 Ga0105245_10005665 3300009098 Bacteria 10974
198 Ga0105245_10005783 3300009098 Bacteria 10850
199 Ga0105245_10010311 3300009098 Bacteria 8139
200 Ga0105245_10060054 3300009098 Bacteria 3424
201 Ga0105245_10064347 3300009098 Bacteria 3314
202 Ga0105245_10386593 3300009098 Bacteria 1395
203 Ga0114129_10001119 3300009147 Bacteria 35383
204 Ga0114129_10003023 3300009147 Bacteria 23586
205 Ga0114129_10013663 3300009147 Bacteria 11570
206 Ga0114129_10023252 3300009147 Bacteria 8791
207 Ga0114129_10029378 3300009147 Bacteria 7787
208 Ga0105243_10047394 3300009148 Bacteria 3383
209 Ga0105243_10074340 3300009148 Bacteria 2756
210 Ga0105243_10099187 3300009148 Bacteria 2414
211 Ga0105243_10209206 3300009148 Bacteria 1716
212 Ga0105248_10000032 3300009177 Bacteria 201114
213 Ga0105248_10083797 3300009177 Bacteria 3586
214 Ga0105237_10163908 3300009545 Bacteria 2222
215 Ga0105237_10175697 3300009545 Bacteria 2142
216 Ga0105238_10242128 3300009551 Bacteria 1781
217 Ga0105238_10249005 3300009551 Bacteria 1755
218 Ga0105249_10011189 3300009553 Bacteria 7881
219 Ga0105028_101263 3300009993 Bacteria 2665
220 Ga0105239_10006331 3300010375 Bacteria 13766
221 Ga0105239_10093776 3300010375 Bacteria 3315
222 Ga0105239_10372906 3300010375 Bacteria 1613
223 Ga0105246_10039193 3300011119 Bacteria 3190
224 Ga0157371_10009099 3300013102 Bacteria 7848
225 Ga0157370_10214353 3300013104 Bacteria 1784
226 Ga0157369_10000099 3300013105 Bacteria 120032
227 Ga0157369_10035965 3300013105 Bacteria 5428
228 Ga0157369_10075437 3300013105 Bacteria 3616
229 Ga0157374_10006829 3300013296 Bacteria 9708
230 Ga0157374_10098614 3300013296 Bacteria 2798
231 Ga0157378_10010497 3300013297 Bacteria 8091
232 Ga0157378_10510143 3300013297 Bacteria 1202
233 Ga0157372_10026370 3300013307 Bacteria 6324
234 Ga0157372_10151411 3300013307 Bacteria 2678
235 Ga0157372_10434060 3300013307 Bacteria 1531
236 Ga0157372_10606721 3300013307 Bacteria 1276
237 Ga0157375_10010359 3300013308 Bacteria 8207
238 Ga0157375_10032670 3300013308 Bacteria 4937
239 Ga0157375_10046134 3300013308 Bacteria 4246
240 Ga0157375_10048497 3300013308 Bacteria 4155
241 Ga0157375_10600278 3300013308 Bacteria 1260
242 Ga0163163_10107630 3300014325 Bacteria 2814
243 Ga0157380_10000219 3300014326 Bacteria 34156
244 Ga0157380_10362950 3300014326 Bacteria 1360
245 Ga0157377_10005388 3300014745 Bacteria 6009
246 Ga0157377_10086554 3300014745 Bacteria 1842
247 Ga0157379_10320088 3300014968 Bacteria 1416
248 Ga0157376_10047691 3300014969 Bacteria 3538
249 Ga0157376_10096829 3300014969 Bacteria 2569
250 Ga0157376_10103402 3300014969 Bacteria 2494
251 Ga0157376_10331348 3300014969 Bacteria 1450
252 Ga0182006_1061684 3300015261 Bacteria 1413
253 Ga0163161_10000058 3300017792 Bacteria 114035
254 Ga0163161_10065977 3300017792 Bacteria 2642
255 Ga0206356_10987891 3300020070 Bacteria 1988
256 Ga0206356_11507257 3300020070 Bacteria 1649
257 Ga0206354_10224168 3300020081 Bacteria 2296
258 Ga0206353_11255590 3300020082 Bacteria 3314
259 Ga0206353_11844079 3300020082 Bacteria 5443
260 Ga0207656_10002305 3300025321 Bacteria 6410
261 Ga0207656_10117373 3300025321 Bacteria 1236
262 Ga0207642_10000001 3300025899 Bacteria 714030
263 Ga0207642_10000003 3300025899 Bacteria 650651
264 Ga0207642_10000004 3300025899 Bacteria 407822
265 Ga0207642_10000017 3300025899 Bacteria 64774
266 Ga0207642_10014374 3300025899 Bacteria 2919
267 Ga0207685_10000001 3300025905 Bacteria 604473
268 Ga0207699_10027383 3300025906 Bacteria 3155
269 Ga0207707_10003654 3300025912 Bacteria 13645
270 Ga0207707_10011148 3300025912 Bacteria 7820
271 Ga0207707_10012057 3300025912 Bacteria 7517
272 Ga0207707_10157919 3300025912 Bacteria 1983
273 Ga0207693_10001551 3300025915 Bacteria 20284
274 Ga0207693_10013240 3300025915 Bacteria 6654
275 Ga0207693_10271474 3300025915 Bacteria 1329
276 Ga0207663_10014493 3300025916 Bacteria 4318
277 Ga0207663_10066421 3300025916 Bacteria 2309
278 Ga0207663_10108944 3300025916 Bacteria 1876
279 Ga0207660_10005162 3300025917 Bacteria 8488
280 Ga0207660_10018009 3300025917 Bacteria 4704
281 Ga0207660_10047444 3300025917 Bacteria 3037
282 Ga0207660_10061128 3300025917 Bacteria 2711
283 Ga0207657_10001335 3300025919 Bacteria 26208
284 Ga0207657_10002472 3300025919 Bacteria 19995
285 Ga0207657_10003370 3300025919 Bacteria 17079
286 Ga0207657_10014368 3300025919 Bacteria 7732
287 Ga0207657_10029745 3300025919 Bacteria 4967
288 Ga0207657_10271799 3300025919 Bacteria 1347
289 Ga0207649_10016170 3300025920 Bacteria 4202
290 Ga0207649_10030765 3300025920 Bacteria 3183
291 Ga0207649_10320794 3300025920 Bacteria 1138
292 Ga0207652_10000631 3300025921 Bacteria 34868
293 Ga0207652_10001944 3300025921 Bacteria 17885
294 Ga0207652_10116676 3300025921 Bacteria 2372
295 Ga0207646_10009623 3300025922 Bacteria 9534
296 Ga0207650_10025386 3300025925 Bacteria 4221
297 Ga0207650_10152474 3300025925 Bacteria 1825
298 Ga0207659_10000020 3300025926 Bacteria 151552
299 Ga0207687_10000007 3300025927 Bacteria 604185
300 Ga0207687_10000646 3300025927 Bacteria 23464
301 Ga0207687_10006484 3300025927 Bacteria 7727
302 Ga0207687_10017967 3300025927 Bacteria 4665
303 Ga0207687_10161060 3300025927 Bacteria 1722
304 Ga0207700_10000008 3300025928 Bacteria 341717
305 Ga0207700_10000016 3300025928 Bacteria 202434
306 Ga0207690_10031482 3300025932 Bacteria 3395
307 Ga0207690_10326736 3300025932 Bacteria 1207
308 Ga0207706_10000006 3300025933 Bacteria 216994
309 Ga0207706_10014837 3300025933 Bacteria 7053
310 Ga0207686_10142989 3300025934 Bacteria 1656
311 Ga0207709_10049455 3300025935 Bacteria 2566
312 Ga0207709_10060791 3300025935 Bacteria 2357
313 Ga0207670_10087786 3300025936 Bacteria 2192
314 Ga0207670_10330977 3300025936 Bacteria 1201
315 Ga0207669_10000016 3300025937 Bacteria 124532
316 Ga0207669_10000036 3300025937 Bacteria 78568
317 Ga0207669_10322612 3300025937 Bacteria 1183
318 Ga0207704_10000025 3300025938 Bacteria 135523
319 Ga0207704_10008706 3300025938 Bacteria 4867
320 Ga0207704_10076865 3300025938 Bacteria 2141
321 Ga0207691_10000020 3300025940 Bacteria 133465
322 Ga0207691_10018612 3300025940 Bacteria 6582
323 Ga0207711_10000020 3300025941 Bacteria 363325
324 Ga0207711_10134064 3300025941 Bacteria 2223
325 Ga0207689_10025225 3300025942 Bacteria 4983
326 Ga0207689_10093134 3300025942 Bacteria 2475
327 Ga0207661_10001238 3300025944 Bacteria 17056
328 Ga0207661_10001780 3300025944 Bacteria 14742
329 Ga0207661_10001949 3300025944 Bacteria 14185
330 Ga0207661_10008416 3300025944 Bacteria 7373
331 Ga0207661_10030009 3300025944 Bacteria 4182
332 Ga0207661_10151734 3300025944 Bacteria 2003
333 Ga0207679_10308269 3300025945 Bacteria 1367
334 Ga0207667_10215088 3300025949 Bacteria 1970
335 Ga0207651_10111878 3300025960 Bacteria 2051
336 Ga0207651_10220835 3300025960 Bacteria 1532
337 Ga0207640_10000285 3300025981 Bacteria 33957
338 Ga0207640_10060336 3300025981 Bacteria 2506
339 Ga0207640_10083577 3300025981 Bacteria 2189
340 Ga0207640_10206892 3300025981 Bacteria 1492
341 Ga0207640_10245438 3300025981 Bacteria 1386
342 Ga0207677_10001435 3300026023 Bacteria 12669
343 Ga0207677_10018809 3300026023 Bacteria 4155
344 Ga0207677_10052187 3300026023 Bacteria 2777
345 Ga0207703_10000053 3300026035 Bacteria 143924
346 Ga0207703_10000067 3300026035 Bacteria 125623
347 Ga0207678_10025503 3300026067 Bacteria 5161
348 Ga0207678_10210895 3300026067 Bacteria 1661
349 Ga0207708_10000757 3300026075 Bacteria 24232
350 Ga0207708_10006689 3300026075 Bacteria 8525
351 Ga0207708_10329542 3300026075 Bacteria 1248
352 Ga0207702_10000016 3300026078 Bacteria 226633
353 Ga0207702_10003815 3300026078 Bacteria 13603
354 Ga0207702_10014205 3300026078 Bacteria 6613
355 Ga0207702_10016146 3300026078 Bacteria 6181
356 Ga0207702_10016852 3300026078 Bacteria 6048
357 Ga0207702_10033585 3300026078 Bacteria 4286
358 Ga0207702_10178202 3300026078 Bacteria 1955
359 Ga0207702_10302676 3300026078 Bacteria 1518
360 Ga0207641_10000071 3300026088 Bacteria 151812
361 Ga0207641_10008529 3300026088 Bacteria 8466
362 Ga0207648_10000228 3300026089 Bacteria 60032
363 Ga0207648_10026646 3300026089 Bacteria 5135
364 Ga0207648_10043290 3300026089 Bacteria 3952
365 Ga0207676_10080307 3300026095 Bacteria 2647
366 Ga0207674_10002949 3300026116 Bacteria 21132
367 Ga0207674_10050544 3300026116 Bacteria 4247
368 Ga0207674_10072073 3300026116 Bacteria 3471
369 Ga0207675_100009465 3300026118 Bacteria 9119
370 Ga0207675_100010716 3300026118 Bacteria 8586
371 Ga0207675_100140748 3300026118 Bacteria 2292
372 Ga0207683_10000740 3300026121 Bacteria 29707
373 Ga0207683_10006404 3300026121 Bacteria 10083
374 Ga0207683_10023702 3300026121 Bacteria 5280
375 Ga0207683_10135986 3300026121 Bacteria 2212
376 Ga0207683_10172253 3300026121 Bacteria 1961
377 Ga0207683_10343832 3300026121 Bacteria 1368
378 Ga0207698_10000012 3300026142 Bacteria 260061
379 Ga0207698_10009350 3300026142 Bacteria 6246
380 Ga0207428_10191832 3300027907 Bacteria 1540
381 Ga0207428_10235228 3300027907 Bacteria 1370
382 Ga0268266_10000023 3300028379 Bacteria 501899
383 Ga0268266_10027948 3300028379 Bacteria 4798
384 Ga0268266_10066071 3300028379 Bacteria 3127
385 Ga0268266_10136436 3300028379 Bacteria 2198
386 Ga0268264_10007216 3300028381 Bacteria 9306
387 Ga0265337_1000054 3300028556 Bacteria 52183
388 Ga0265326_10000027 3300028558 Bacteria 110843
389 Ga0265323_10019618 3300028653 Bacteria 2607
390 Ga0265322_10000003 3300028654 Bacteria 468671
391 Ga0265324_10000103 3300029957 Bacteria 67507
392 Ga0314311_1122819 3300030733 Bacteria 6045
393 Ga0316179_1002117 3300030734 Bacteria 36853
394 Ga0316180_1070555 3300030736 Bacteria 5463
395 Ga0316183_1122503 3300030742 Bacteria 24386
396 Ga0316182_1020791 3300030745 Bacteria 37858
397 Ga0265332_10007198 3300031238 Bacteria 5035
398 Ga0265328_10001275 3300031239 Bacteria 11625
399 Ga0265320_10000001 3300031240 Bacteria 847191
400 Ga0265329_10002125 3300031242 Bacteria 9180
401 Ga0265331_10001895 3300031250 Bacteria 14686
402 Ga0265327_10000003 3300031251 Bacteria 852750
403 Ga0265327_10008056 3300031251 Bacteria 7945
404 Ga0265316_10020298 3300031344 Bacteria 5661
405 Ga0307408_100031047 3300031548 Bacteria 3716
406 Ga0307408_100048271 3300031548 Bacteria 3053
407 Ga0307408_100081761 3300031548 Bacteria 2416
408 Ga0307408_100239143 3300031548 Bacteria 1491
409 Ga0265314_10001375 3300031711 Bacteria 27314
410 Ga0316576_10143144 3300031727 Bacteria 1800
411 Ga0316576_10180268 3300031727 Bacteria 1593
412 Ga0307413_10002156 3300031824 Bacteria 7907
413 Ga0307413_10023303 3300031824 Bacteria 3354
414 Ga0307413_10051708 3300031824 Bacteria 2477
415 Ga0307410_10016214 3300031852 Bacteria 4438
416 Ga0307410_10058953 3300031852 Bacteria 2619
417 Ga0307410_10303937 3300031852 Bacteria 1260
418 Ga0307406_10011927 3300031901 Bacteria 4940
419 Ga0307406_10027082 3300031901 Bacteria 3450
420 Ga0307406_10038981 3300031901 Bacteria 2944
421 Ga0307407_10022196 3300031903 Bacteria 3288
422 Ga0307407_10048327 3300031903 Bacteria 2421
423 Ga0307412_10018003 3300031911 Bacteria 4241
424 Ga0307412_10241304 3300031911 Bacteria 1398
425 Ga0307409_100012362 3300031995 Bacteria 5438
426 Ga0307409_100058575 3300031995 Bacteria 2992
427 Ga0307409_100058788 3300031995 Bacteria 2988
428 Ga0307409_100090923 3300031995 Bacteria 2500
429 Ga0307409_100099462 3300031995 Bacteria 2408
430 Ga0307416_100011782 3300032002 Bacteria 5856
431 Ga0307416_100020572 3300032002 Bacteria 4713
432 Ga0307416_100028324 3300032002 Bacteria 4164
433 Ga0307416_100033278 3300032002 Bacteria 3906
434 Ga0307416_100045175 3300032002 Bacteria 3466
435 Ga0307416_100060430 3300032002 Bacteria 3086
436 Ga0307416_100114944 3300032002 Bacteria 2382
437 Ga0307416_100185584 3300032002 Bacteria 1954
438 Ga0307416_100377509 3300032002 Bacteria 1446
439 Ga0307414_10113428 3300032004 Bacteria 2069
440 Ga0307414_10120549 3300032004 Bacteria 2016
441 Ga0307411_10006677 3300032005 Bacteria 5796
442 Ga0307415_100001131 3300032126 Bacteria 12469
443 Ga0307415_100020790 3300032126 Bacteria 4016
444 Ga0307415_100076841 3300032126 Bacteria 2369
445 Ga0307415_100102523 3300032126 Bacteria 2103
446 Ga0307415_100275124 3300032126 Bacteria 1381
447 Ga0373960_0011977 3300035121 Bacteria 2147
448 Ga0373942_0030371 3300035207 Bacteria 1423
449 Ga0373931_0043963 3300035691 Bacteria 2355
450 Ga0373947_0036675 3300035725 Bacteria 2908
451 Ga0373937_0033225 3300036401 Bacteria 4684
452 Ga0373937_0074513 3300036401 Bacteria 3132
453 Ga0316584_0122658 3300036712 Bacteria 1941
454 Ga0373925_0085421 3300037068 Bacteria 2406
455 Ga0395899_0019939 3300037312 Bacteria 5088
456 Ga0395899_0066624 3300037312 Bacteria 2644
457 Ga0395899_0145260 3300037312 Bacteria 1685
458 Ga0395900_0003557 3300037418 Bacteria 16757
459 Ga0395900_0004073 3300037418 Bacteria 15587
460 Ga0395900_0006758 3300037418 Bacteria 11903
461 Ga0395900_0010351 3300037418 Bacteria 9543
462 Ga0395900_0041817 3300037418 Bacteria 4723
463 Ga0395900_0049279 3300037418 Bacteria 4339
464 Ga0395900_0081851 3300037418 Bacteria 3316
465 Ga0395900_0094819 3300037418 Bacteria 3066
466 Ga0395900_0117171 3300037418 Bacteria 2733
467 Ga0395900_0124218 3300037418 Bacteria 2647
468 Ga0395898_0001604 3300037466 Bacteria 30854
469 Ga0395898_0003445 3300037466 Bacteria 17691
470 Ga0395898_0009405 3300037466 Bacteria 10264
471 Ga0395898_0010906 3300037466 Bacteria 9483
472 Ga0395898_0011062 3300037466 Bacteria 9398
473 Ga0395898_0011171 3300037466 Bacteria 9351
474 Ga0395898_0027143 3300037466 Bacteria 5751
475 Ga0395898_0057103 3300037466 Bacteria 3804
476 Ga0395898_0077050 3300037466 Bacteria 3219
477 Ga0395898_0085211 3300037466 Bacteria 3045
478 Ga0395898_0115528 3300037466 Bacteria 2571
479 Ga0395898_0254166 3300037466 Bacteria 1676
480 Ga0395898_0267825 3300037466 Bacteria 1629
481 Ga0395898_0528300 3300037466 Bacteria 1121
482 Ga0395905_0001761 3300037471 Bacteria 25226
483 Ga0395905_0002251 3300037471 Bacteria 21694
484 Ga0395905_0010800 3300037471 Bacteria 8847
485 Ga0395905_0012564 3300037471 Bacteria 8144
486 Ga0395905_0025788 3300037471 Bacteria 5542
487 Ga0395905_0032416 3300037471 Bacteria 4914
488 Ga0395905_0035952 3300037471 Bacteria 4651
489 Ga0395905_0042430 3300037471 Bacteria 4269
490 Ga0395905_0046007 3300037471 Bacteria 4093
491 Ga0395905_0171259 3300037471 Bacteria 2039
492 Ga0395905_0401141 3300037471 Bacteria 1266
493 Ga0395901_0001420 3300038443 Bacteria 24995
494 Ga0395901_0001597 3300038443 Bacteria 23455
495 Ga0395901_0002643 3300038443 Bacteria 18106
496 Ga0395901_0006110 3300038443 Bacteria 12202
497 Ga0395901_0020676 3300038443 Bacteria 6737
498 Ga0395901_0032816 3300038443 Bacteria 5356
499 Ga0395901_0046351 3300038443 Bacteria 4515
500 Ga0395901_0064884 3300038443 Bacteria 3801
501 Ga0395901_0065706 3300038443 Bacteria 3777
502 Ga0395901_0136094 3300038443 Bacteria 2582
503 Ga0395901_0173308 3300038443 Bacteria 2263
504 Ga0395901_0235219 3300038443 Bacteria 1912
505 Ga0451853_2357732 3300041512 Bacteria 1284
506 Ga0439445_0002076 3300042004 Bacteria 4433
507 Ga0439448_0016164 3300042005 Bacteria 2269
508 Ga0439432_006638 3300042006 Bacteria 4122
509 Ga0466965_0057274 3300044683 Bacteria 1942
510 Ga0466966_0232242 3300044684 Bacteria 1113
511 Ga0466961_0026057 3300044693 Bacteria 3759
512 Ga0466961_0114028 3300044693 Bacteria 1699
513 Ga0466963_0025241 3300044694 Bacteria 3788
514 Ga0466963_0043513 3300044694 Bacteria 2953
515 Ga0466963_0130885 3300044694 Bacteria 1733
516 Ga0466964_0000890 3300044706 Bacteria 9790
517 Ga0466964_0010017 3300044706 Bacteria 3571
518 Ga0466968_0046907 3300044735 Bacteria 1836
519 Ga0466957_0003681 3300044842 Bacteria 8460
520 Ga0466957_0124802 3300044842 Bacteria 1644
521 Ga0466960_0022744 3300044901 Bacteria 2806
522 Ga0466959_0002692 3300045049 Bacteria 11414
523 Ga0466959_0055724 3300045049 Bacteria 2885
524 Ga0466958_0005927 3300045836 Bacteria 6606
525 Ga0466967_0000046 3300045976 Bacteria 43911
526 Ga0466967_0004872 3300045976 Bacteria 9164
527 Ga0466967_0069123 3300045976 Bacteria 3155
528 Ga0466967_0079454 3300045976 Bacteria 2957
529 Ga0466967_0092522 3300045976 Bacteria 2750
530 Ga0466967_0272881 3300045976 Bacteria 1621
531 Ga0466967_0426272 3300045976 Bacteria 1294
532 Ga0495617_006590 3300046452 Bacteria 4062
533 Ga0495627_034218 3300046453 Bacteria 1588
534 Ga0495592_0000621 3300046454 Bacteria 24971
535 Ga0495592_0083460 3300046454 Bacteria 2307
536 Ga0495603_0133104 3300046455 Bacteria 1447
537 Ga0495603_0181746 3300046455 Bacteria 1217
538 Ga0495590_0087496 3300046457 Bacteria 1101
539 Ga0495629_0005520 3300046459 Bacteria 9437
540 Ga0495629_0036832 3300046459 Bacteria 3451
541 Ga0495629_0140175 3300046459 Bacteria 1683
542 Ga0495641_0009756 3300046461 Bacteria 5666
543 Ga0495641_0015104 3300046461 Bacteria 4144
544 Ga0495641_0070282 3300046461 Bacteria 1573
545 Ga0495651_0004887 3300046462 Bacteria 10251
546 Ga0495651_0014023 3300046462 Bacteria 6199
547 Ga0495651_0090570 3300046462 Bacteria 2294
548 Ga0495653_0010741 3300046463 Bacteria 7498
549 Ga0495653_0022048 3300046463 Bacteria 5155
550 Ga0495653_0069968 3300046463 Bacteria 2627
551 Ga0495582_0000005 3300046473 Bacteria 156170
552 Ga0495582_0027982 3300046473 Bacteria 3092
553 Ga0495582_0038899 3300046473 Bacteria 2618
554 Ga0495605_0066960 3300046474 Bacteria 1705
555 Ga0495639_0047772 3300046475 Bacteria 1940
556 Ga0495664_0045067 3300046477 Bacteria 2615
557 Ga0495584_0028330 3300046491 Bacteria 2837
558 Ga0495584_0037550 3300046491 Bacteria 2449
559 Ga0495584_0076703 3300046491 Bacteria 1681
560 Ga0495594_0000013 3300046499 Bacteria 103201
561 Ga0495594_0021620 3300046499 Bacteria 3435
562 Ga0495596_0070600 3300046500 Bacteria 1357
563 Ga0495596_0097391 3300046500 Bacteria 1142
564 Ga0495608_0000031 3300046511 Bacteria 145255
565 Ga0495608_0000406 3300046511 Bacteria 30178
566 Ga0495608_0022630 3300046511 Bacteria 4310
567 Ga0495610_0000053 3300046512 Bacteria 142545
568 Ga0495618_0000068 3300046514 Bacteria 74614
569 Ga0495628_0005324 3300046516 Bacteria 11286
570 Ga0495628_0008805 3300046516 Bacteria 8638
571 Ga0495628_0039578 3300046516 Bacteria 3770
572 Ga0495628_0268974 3300046516 Bacteria 1268
573 Ga0495630_0000018 3300046517 Bacteria 186064
574 Ga0495630_0032881 3300046517 Bacteria 3867
575 Ga0495630_0100644 3300046517 Bacteria 2186
576 Ga0495631_0056015 3300046518 Bacteria 1717
577 Ga0495644_0033884 3300046523 Bacteria 1928
578 Ga0495652_0011511 3300046529 Bacteria 8000
579 Ga0495640_0001520 3300046533 Bacteria 18268
580 Ga0495640_0041629 3300046533 Bacteria 3209
581 Ga0495640_0047817 3300046533 Bacteria 2959
582 Ga0495640_0233002 3300046533 Bacteria 1158
583 Ga0495586_0000527 3300046535 Bacteria 22292
584 Ga0495586_0000620 3300046535 Bacteria 20523
585 Ga0495586_0031050 3300046535 Bacteria 2860
586 Ga0495598_0000907 3300046537 Bacteria 5706
587 Ga0495598_0040271 3300046537 Bacteria 1362
588 Ga0495597_0042995 3300046542 Bacteria 2013
589 Ga0495645_0048974 3300046543 Bacteria 3077
590 Ga0495622_0000014 3300046557 Bacteria 182142
591 Ga0495667_0004189 3300046559 Bacteria 9713
592 Ga0495667_0010495 3300046559 Bacteria 6267
593 Ga0495667_0044310 3300046559 Bacteria 2947
594 Ga0495634_0000024 3300046642 Bacteria 116230
595 Ga0495625_0000029 3300046660 Bacteria 244646
596 Ga0495635_0000009 3300046663 Bacteria 259024
597 Ga0495635_0112848 3300046663 Bacteria 1856
598 Ga0495635_0180491 3300046663 Bacteria 1435
599 Ga0495659_0006884 3300046664 Bacteria 3596
600 Ga0495588_0000198 3300046674 Bacteria 60956
601 Ga0495588_0058425 3300046674 Bacteria 1994
602 Ga0495657_0000024 3300046675 Bacteria 145255
603 Ga0495657_0004915 3300046675 Bacteria 10635
604 Ga0495657_0019467 3300046675 Bacteria 4895
605 Ga0495599_0007133 3300046678 Bacteria 6767
606 Ga0495599_0026791 3300046678 Bacteria 3613
607 Ga0495599_0031412 3300046678 Bacteria 3333
608 Ga0495599_0080868 3300046678 Bacteria 2029
609 Ga0495646_0087929 3300046680 Bacteria 1800
610 Ga0495647_0000293 3300046681 Bacteria 13969
611 Ga0495647_0090494 3300046681 Bacteria 1254
612 Ga0495658_0000019 3300046683 Bacteria 91606
613 Ga0495613_0000249 3300046689 Bacteria 50975
614 Ga0495613_0020894 3300046689 Bacteria 4880
615 Ga0495624_0000028 3300046690 Bacteria 93474
616 Ga0495624_0036177 3300046690 Bacteria 3185
617 Ga0495624_0041230 3300046690 Bacteria 2954
618 Ga0495671_0059350 3300046692 Bacteria 1891
619 Ga0495649_0015920 3300046694 Bacteria 4271
620 Ga0495600_0003314 3300046809 Bacteria 9451
621 Ga0495600_0010047 3300046809 Bacteria 5867
622 Ga0495600_0045091 3300046809 Bacteria 2876
623 Ga0495581_0000983 3300047315 Bacteria 15316
624 Ga0495604_0000056 3300047317 Bacteria 100110
625 Ga0495604_0003466 3300047317 Bacteria 12570
626 Ga0495604_0006459 3300047317 Bacteria 9300
627 Ga0495604_0009004 3300047317 Bacteria 7895
628 Ga0495604_0049521 3300047317 Bacteria 3264
629 Ga0495604_0071262 3300047317 Bacteria 2629
630 Ga0495674_0000042 3300047319 Bacteria 94820
631 Ga0495674_0007533 3300047319 Bacteria 10396
632 Ga0495674_0030284 3300047319 Bacteria 4922
633 Ga0495676_0005250 3300047321 Bacteria 11854
634 Ga0495676_0078076 3300047321 Bacteria 2522
635 Ga0495680_0000023 3300047322 Bacteria 116444
636 Ga0495680_0000421 3300047322 Bacteria 47432
637 Ga0495680_0003583 3300047322 Bacteria 15204
638 Ga0495680_0005597 3300047322 Bacteria 11781
639 Ga0495680_0021298 3300047322 Bacteria 5429
640 Ga0495675_0000209 3300047444 Bacteria 42691
641 Ga0495675_0065903 3300047444 Bacteria 2290
642 Ga0495675_0171167 3300047444 Bacteria 1334
643 Ga0495679_011414 3300047446 Bacteria 3429
644 Ga0495681_0000015 3300047470 Bacteria 183538
645 Ga0495684_0010019 3300047471 Bacteria 7327
646 Ga0495684_0010791 3300047471 Bacteria 7061
647 Ga0495602_0000228 3300048088 Bacteria 52649
648 Ga0495602_0046294 3300048088 Bacteria 3930
649 Ga0495602_0061923 3300048088 Bacteria 3249
650 Ga0495602_0130113 3300048088 Bacteria 2009
651 Ga0495602_0210737 3300048088 Bacteria 1475
652 Ga0496100_0005985 3300048903 Bacteria 6599
653 Ga0496100_0006019 3300048903 Bacteria 6584
654 Ga0496100_0120231 3300048903 Bacteria 1836
655 Ga0496100_0179643 3300048903 Bacteria 1530
656 Ga0496101_0001626 3300048904 Bacteria 13507
657 Ga0496101_0032186 3300048904 Bacteria 3689
658 Ga0496102_0001674 3300048905 Bacteria 19466
659 Ga0496102_0008240 3300048905 Bacteria 8924
660 Ga0496102_0017155 3300048905 Bacteria 6340
661 Ga0496102_0023784 3300048905 Bacteria 5444
662 Ga0496102_0027850 3300048905 Bacteria 5047
663 Ga0496102_0042632 3300048905 Bacteria 4112
664 Ga0496102_0044639 3300048905 Bacteria 4023
665 Ga0496102_0218064 3300048905 Bacteria 1798
666 Ga0496102_0282216 3300048905 Bacteria 1565
667 Ga0496103_0002323 3300048906 Bacteria 12016
668 Ga0496103_0004839 3300048906 Bacteria 8133
669 Ga0496103_0061251 3300048906 Bacteria 2340
670 Ga0496103_0080885 3300048906 Bacteria 2043
671 Ga0496103_0146001 3300048906 Bacteria 1514
672 Ga0496104_0000576 3300048907 Bacteria 31360
673 Ga0496104_0002883 3300048907 Bacteria 14819
674 Ga0496104_0007540 3300048907 Bacteria 9621
675 Ga0496104_0025674 3300048907 Bacteria 5434
676 Ga0496104_0059650 3300048907 Bacteria 3612
677 Ga0496104_0086342 3300048907 Bacteria 2995
678 Ga0496104_0167800 3300048907 Bacteria 2105
679 Ga0496104_0346090 3300048907 Bacteria 1399
680 Ga0496104_0350863 3300048907 Bacteria 1388
681 Ga0496105_0001400 3300048908 Bacteria 16942
682 Ga0496105_0001452 3300048908 Bacteria 16682
683 Ga0496105_0005013 3300048908 Bacteria 10024
684 Ga0496105_0006590 3300048908 Bacteria 8939
685 Ga0496105_0009052 3300048908 Bacteria 7768
686 Ga0496105_0117228 3300048908 Bacteria 2196
687 Ga0496105_0264236 3300048908 Bacteria 1391
688 Ga0496106_0000013 3300048909 Bacteria 202263
689 Ga0496107_0022185 3300048910 Bacteria 4486
690 Ga0496107_0026446 3300048910 Bacteria 4114
691 Ga0496107_0052198 3300048910 Bacteria 2949
692 Ga0496107_0057330 3300048910 Bacteria 2816
693 Ga0496107_0106160 3300048910 Bacteria 2062
694 Ga0496107_0174142 3300048910 Bacteria 1597
695 Ga0496107_0338919 3300048910 Bacteria 1119
696 Ga0496108_0000045 3300048911 Bacteria 137416
697 Ga0496108_0000631 3300048911 Bacteria 27478
698 Ga0496108_0001695 3300048911 Bacteria 17470
699 Ga0496108_0002798 3300048911 Bacteria 13983
700 Ga0496108_0008008 3300048911 Bacteria 8574
701 Ga0496108_0010904 3300048911 Bacteria 7378
702 Ga0496108_0020923 3300048911 Bacteria 5379
703 Ga0496108_0026529 3300048911 Bacteria 4779
704 Ga0496108_0041446 3300048911 Bacteria 3844
705 Ga0496109_0000032 3300048912 Bacteria 162984
706 Ga0496109_0000085 3300048912 Bacteria 95437
707 Ga0496109_0001613 3300048912 Bacteria 18839
708 Ga0496109_0002720 3300048912 Bacteria 14822
709 Ga0496109_0003228 3300048912 Bacteria 13577
710 Ga0496109_0028090 3300048912 Bacteria 5029
711 Ga0496109_0035376 3300048912 Bacteria 4505
712 Ga0496109_0180730 3300048912 Bacteria 1981
713 Ga0496109_0230154 3300048912 Bacteria 1744
714 Ga0496109_0280872 3300048912 Bacteria 1569
715 Ga0496109_0412684 3300048912 Bacteria 1276
716 Ga0496110_0000033 3300048913 Bacteria 65539
717 Ga0496110_0001195 3300048913 Bacteria 18498
718 Ga0496110_0001566 3300048913 Bacteria 16673
719 Ga0496110_0005612 3300048913 Bacteria 9847
720 Ga0496110_0017994 3300048913 Bacteria 5919
721 Ga0496110_0020938 3300048913 Bacteria 5525
722 Ga0496110_0027759 3300048913 Bacteria 4855
723 Ga0496110_0075847 3300048913 Bacteria 2988
724 Ga0496110_0076003 3300048913 Bacteria 2985
725 Ga0496110_0146832 3300048913 Bacteria 2134
726 Ga0496110_0155076 3300048913 Bacteria 2074
727 Ga0496110_0231305 3300048913 Bacteria 1681
728 Ga0496110_0250567 3300048913 Bacteria 1612
729 Ga0496111_0000230 3300048914 Bacteria 26717
730 Ga0496111_0002628 3300048914 Bacteria 10890
731 Ga0496111_0010363 3300048914 Bacteria 6251
732 Ga0496111_0013018 3300048914 Bacteria 5648
733 Ga0496111_0017713 3300048914 Bacteria 4926
734 Ga0496111_0043856 3300048914 Bacteria 3216
735 Ga0496111_0051808 3300048914 Bacteria 2964
736 Ga0496112_0000002 3300048915 Bacteria 782039
737 Ga0496112_0001529 3300048915 Bacteria 17832
738 Ga0496112_0017217 3300048915 Bacteria 6785
739 Ga0496112_0046356 3300048915 Bacteria 4263
740 Ga0496113_0000007 3300048916 Bacteria 95884
741 Ga0496113_0002837 3300048916 Bacteria 10193
742 Ga0496113_0009418 3300048916 Bacteria 6407
743 Ga0496113_0046175 3300048916 Bacteria 3233
744 Ga0496113_0121550 3300048916 Bacteria 2042
745 Ga0496113_0216946 3300048916 Bacteria 1524
746 Ga0496114_0000184 3300048917 Bacteria 44982
747 Ga0496114_0000466 3300048917 Bacteria 29601
748 Ga0496114_0001692 3300048917 Bacteria 16754
749 Ga0496114_0009498 3300048917 Bacteria 7719
750 Ga0496114_0012600 3300048917 Bacteria 6774
751 Ga0496114_0060025 3300048917 Bacteria 3178
752 Ga0496114_0071057 3300048917 Bacteria 2924
753 Ga0496114_0072956 3300048917 Bacteria 2888
754 Ga0496114_0157537 3300048917 Bacteria 1972
755 Ga0496115_0000001 3300048918 Bacteria 367230
756 Ga0496115_0005218 3300048918 Bacteria 9445
757 Ga0496115_0005222 3300048918 Bacteria 9440
758 Ga0496115_0008262 3300048918 Bacteria 7694
759 Ga0496115_0036943 3300048918 Bacteria 3869
760 Ga0496115_0083536 3300048918 Bacteria 2603
761 Ga0496116_0000780 3300048919 Bacteria 40473
762 Ga0496117_0015033 3300048920 Bacteria 6631
763 Ga0496118_0000174 3300048921 Bacteria 115950
764 Ga0496119_0003727 3300048922 Bacteria 15609
765 Ga0496119_0004215 3300048922 Bacteria 14439
766 Ga0496120_0004252 3300048923 Bacteria 12205
767 Ga0496121_0005891 3300048924 Bacteria 15512
768 Ga0496121_0016585 3300048924 Bacteria 7593
769 Ga0496125_0013994 3300048928 Bacteria 7845
770 Ga0496126_0029904 3300048929 Bacteria 5170
771 Ga0501031_0000445 3300049568 Bacteria 23857
772 Ga0501031_0058633 3300049568 Bacteria 2508
773 Ga0501031_0140303 3300049568 Bacteria 1579
774 Ga0501032_0000876 3300049569 Bacteria 24428
775 Ga0501032_0064563 3300049569 Bacteria 2450
776 Ga0501032_0192763 3300049569 Bacteria 1332
777 Ga0501033_0000294 3300049570 Bacteria 47989
778 Ga0501033_0014207 3300049570 Bacteria 6052
779 Ga0501033_0215408 3300049570 Bacteria 1369
780 Ga0501034_0003200 3300049571 Bacteria 18796
781 Ga0501036_0001590 3300049572 Bacteria 17574
782 Ga0501036_0005562 3300049572 Bacteria 10223
783 Ga0501036_0012995 3300049572 Bacteria 6913
784 Ga0501036_0183971 3300049572 Bacteria 1758
785 Ga0501037_0000378 3300049573 Bacteria 37014
786 Ga0501037_0005716 3300049573 Bacteria 9075
787 Ga0501037_0169474 3300049573 Bacteria 1553
788 Ga0501038_0000087 3300049574 Bacteria 78741
789 Ga0501038_0008491 3300049574 Bacteria 9442
790 Ga0501038_0132419 3300049574 Bacteria 2045
791 Ga0501038_0344533 3300049574 Bacteria 1162
792 Ga0501039_0001020 3300049575 Bacteria 20404
793 Ga0501039_0003991 3300049575 Bacteria 11095
794 Ga0501039_0103067 3300049575 Bacteria 2227
795 Ga0501039_0139021 3300049575 Bacteria 1907
796 Ga0501040_0000007 3300049576 Bacteria 90368
797 Ga0501040_0000954 3300049576 Bacteria 18260
798 Ga0501040_0006120 3300049576 Bacteria 7804
799 Ga0501040_0017844 3300049576 Bacteria 4711
800 Ga0501040_0040161 3300049576 Bacteria 3183
801 Ga0501041_0000005 3300049577 Bacteria 75426
802 Ga0501041_0001093 3300049577 Bacteria 14842
803 Ga0501041_0002281 3300049577 Bacteria 10857
804 Ga0501042_0003216 3300049578 Bacteria 10205
805 Ga0501042_0003964 3300049578 Bacteria 9370
806 Ga0501042_0034208 3300049578 Bacteria 3604
807 Ga0501042_0069176 3300049578 Bacteria 2525
808 Ga0501042_0145464 3300049578 Bacteria 1709
809 Ga0501043_0000998 3300049579 Bacteria 24892
810 Ga0501043_0048746 3300049579 Bacteria 3329
811 Ga0501046_0001278 3300049580 Bacteria 24362
812 Ga0501046_0017453 3300049580 Bacteria 5990
813 Ga0501046_0028136 3300049580 Bacteria 4580
814 Ga0501047_0000592 3300049581 Bacteria 38584
815 Ga0501047_0009620 3300049581 Bacteria 9141
816 Ga0501047_0014482 3300049581 Bacteria 7501
817 Ga0501047_0084809 3300049581 Bacteria 3044
818 Ga0501048_0000018 3300049582 Bacteria 72234
819 Ga0501048_0001926 3300049582 Bacteria 15771
820 Ga0501048_0011634 3300049582 Bacteria 6563
821 Ga0501067_0000808 3300049583 Bacteria 16867
822 Ga0501067_0009559 3300049583 Bacteria 5372
823 Ga0501067_0073981 3300049583 Bacteria 1887
824 Ga0501068_0000134 3300049584 Bacteria 33588
825 Ga0501068_0011873 3300049584 Bacteria 4924
826 Ga0501068_0018498 3300049584 Bacteria 4035
827 Ga0501068_0028798 3300049584 Bacteria 3287
828 Ga0501068_0203733 3300049584 Bacteria 1255
829 Ga0501069_0000426 3300049585 Bacteria 19142
830 Ga0501069_0007694 3300049585 Bacteria 5652
831 Ga0501069_0009322 3300049585 Bacteria 5181
832 Ga0501070_0004569 3300049586 Bacteria 11863
833 Ga0501070_0005855 3300049586 Bacteria 10483
834 Ga0501070_0009281 3300049586 Bacteria 8320
835 Ga0501070_0018067 3300049586 Bacteria 5917
836 Ga0501071_0000005 3300049587 Bacteria 78747
837 Ga0501071_0001995 3300049587 Bacteria 12192
838 Ga0501071_0019490 3300049587 Bacteria 4707
839 Ga0501071_0039336 3300049587 Bacteria 3383
840 Ga0501071_0225339 3300049587 Bacteria 1412
841 Ga0501072_0000269 3300049588 Bacteria 37902
842 Ga0501072_0004831 3300049588 Bacteria 10263
843 Ga0501072_0012028 3300049588 Bacteria 6611
844 Ga0501072_0014925 3300049588 Bacteria 5954
845 Ga0501072_0035580 3300049588 Bacteria 3901
846 Ga0501072_0038239 3300049588 Bacteria 3765
847 Ga0501072_0357554 3300049588 Bacteria 1159
848 Ga0501073_0001327 3300049589 Bacteria 18226
849 Ga0501073_0033451 3300049589 Bacteria 3660
850 Ga0501073_0061038 3300049589 Bacteria 2631
851 Ga0501073_0065493 3300049589 Bacteria 2534
852 Ga0501074_0001138 3300049590 Bacteria 17415
853 Ga0501074_0044985 3300049590 Bacteria 3194
854 Ga0501074_0060672 3300049590 Bacteria 2724
855 Ga0501074_0136292 3300049590 Bacteria 1756
856 Ga0501074_0161055 3300049590 Bacteria 1603
857 Ga0501074_0164036 3300049590 Bacteria 1586
858 Ga0501075_0000009 3300049591 Bacteria 97052
859 Ga0501075_0000193 3300049591 Bacteria 31987
860 Ga0501075_0007396 3300049591 Bacteria 7619
861 Ga0501075_0021317 3300049591 Bacteria 4722
862 Ga0501075_0062138 3300049591 Bacteria 2815
863 Ga0501075_0110785 3300049591 Bacteria 2087
864 Ga0501076_0000028 3300049592 Bacteria 76828
865 Ga0501076_0001292 3300049592 Bacteria 16692
866 Ga0501076_0004133 3300049592 Bacteria 10264
867 Ga0501076_0011312 3300049592 Bacteria 6642
868 Ga0501076_0036691 3300049592 Bacteria 3841
869 Ga0501076_0137670 3300049592 Bacteria 1983
870 Ga0501076_0170136 3300049592 Bacteria 1776
871 Ga0501077_0000006 3300049593 Bacteria 119936
872 Ga0501077_0001176 3300049593 Bacteria 15828
873 Ga0501077_0020007 3300049593 Bacteria 4235
874 Ga0501077_0036690 3300049593 Bacteria 3123
875 Ga0501077_0173009 3300049593 Bacteria 1372
876 Ga0501202_029492 3300049652 Bacteria 1138
877 Ga0501079_0000881 3300049741 Bacteria 20585
878 Ga0501079_0000929 3300049741 Bacteria 20116
879 Ga0501079_0003399 3300049741 Bacteria 11682
880 Ga0501079_0025921 3300049741 Bacteria 4497
881 Ga0501079_0050832 3300049741 Bacteria 3198
882 Ga0501079_0088348 3300049741 Bacteria 2400
883 Ga0501079_0133505 3300049741 Bacteria 1932
884 Ga0501080_0000626 3300049742 Bacteria 28026
885 Ga0501080_0032292 3300049742 Bacteria 4881
886 Ga0501080_0046552 3300049742 Bacteria 4038
887 Ga0501081_0000003 3300049743 Bacteria 97558
888 Ga0501081_0000159 3300049743 Bacteria 31036
889 Ga0501081_0001137 3300049743 Bacteria 16055
890 Ga0501081_0043392 3300049743 Bacteria 3085
891 Ga0501081_0321051 3300049743 Bacteria 1138
892 Ga0501083_0001673 3300049744 Bacteria 15132
893 Ga0501083_0008047 3300049744 Bacteria 7457
894 Ga0501083_0021756 3300049744 Bacteria 4454
895 Ga0501083_0034238 3300049744 Bacteria 3474
896 Ga0501035_0000175 3300049822 Bacteria 78747
897 Ga0501035_0068212 3300049822 Bacteria 3154
898 Ga0501035_0078473 3300049822 Bacteria 2916
899 Ga0501044_0006303 3300049823 Bacteria 13113
900 Ga0501044_0038039 3300049823 Bacteria 5025
901 Ga0501044_0065287 3300049823 Bacteria 3712
902 Ga0501044_0101327 3300049823 Bacteria 2897
903 Ga0501045_0000009 3300049824 Bacteria 75255
904 Ga0501045_0002161 3300049824 Bacteria 13314
905 Ga0501045_0002370 3300049824 Bacteria 12795
906 Ga0501045_0056157 3300049824 Bacteria 2879
907 Ga0501045_0063835 3300049824 Bacteria 2703
908 Ga0501045_0083925 3300049824 Bacteria 2350
909 nmdc:mga00v17_38242_c1 3300050491 Bacteria 2868
910 nmdc:mga00v17_42955_c1 3300050491 Bacteria 2721
911 nmdc:mga00v17_87324_c1 3300050491 Bacteria 1955
912 nmdc:mga0yw44_110719_c1 3300050492 Bacteria 1759
913 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
914 nmdc:mga0yw44_24400_c1 3300050492 Bacteria 3421
915 nmdc:mga0yw44_30503_c1 3300050492 Bacteria 3125
916 nmdc:mga06z11_159774_c1 3300050494 Bacteria 1287
917 nmdc:mga05p37_116658_c1 3300050507 Bacteria 3281
918 nmdc:mga05p37_145145_c1 3300050507 Bacteria 2906
919 nmdc:mga05p37_163019_c1 3300050507 Bacteria 2722
920 nmdc:mga05p37_43470_c1 3300050507 Bacteria 5528
921 nmdc:mga05p37_8447_c1 3300050507 Bacteria 12180
922 nmdc:mga09592_1116_c1 3300050508 Bacteria 21373
923 nmdc:mga09592_330607_c1 3300050508 Bacteria 1319
924 nmdc:mga09592_49273_c1 3300050508 Bacteria 3551
925 nmdc:mga0qj67_1508_c1 3300050509 Bacteria 16319
926 nmdc:mga0qj67_76093_c1 3300050509 Bacteria 2684
927 nmdc:mga0qj67_83580_c1 3300050509 Bacteria 2559
928 nmdc:mga0qj67_9898_c1 3300050509 Bacteria 7109
929 nmdc:mga06r32_351571_c1 3300050510 Bacteria 1458
930 nmdc:mga06r32_4240_c1 3300050510 Bacteria 12848
931 nmdc:mga06r32_60098_c1 3300050510 Bacteria 3656
932 nmdc:mga06r32_80394_c1 3300050510 Bacteria 3172
933 nmdc:mga08y16_16311_c1 3300050511 Bacteria 7809
934 nmdc:mga08y16_2936_c1 3300050511 Bacteria 17557
935 nmdc:mga08y16_368483_c1 3300050511 Bacteria 1474
936 nmdc:mga08y16_640486_c1 3300050511 Bacteria 1068
937 nmdc:mga0n895_204409_c1 3300050512 Bacteria 2006
938 nmdc:mga0rr50_2782_c1 3300050513 Bacteria 9943
939 nmdc:mga08x19_125208_c1 3300050514 Bacteria 1725
940 nmdc:mga08x19_62434_c1 3300050514 Bacteria 2416
941 nmdc:mga0a205_97616_c1 3300050515 Bacteria 2837
942 Ga0495601_0000086 3300053077 Bacteria 50421
943 Ga0495601_0030309 3300053077 Bacteria 3358
944 Ga0495601_0078139 3300053077 Bacteria 2120
945 Ga0495601_0096050 3300053077 Bacteria 1911
946 Ga0495612_0000410 3300053078 Bacteria 17077
947 Ga0495612_0005844 3300053078 Bacteria 5082
948 Ga0495612_0011495 3300053078 Bacteria 3570
949 Ga0495655_0001739 3300053083 Bacteria 3377
950 Ga0495595_0000014 3300053084 Bacteria 145255
951 Ga0495595_0000109 3300053084 Bacteria 37617
952 Ga0495595_0013656 3300053084 Bacteria 3433
953 Ga0495595_0027010 3300053084 Bacteria 2554
954 Ga0495619_0000022 3300053085 Bacteria 184144
955 Ga0495619_0000319 3300053085 Bacteria 33678
956 Ga0495619_0003097 3300053085 Bacteria 10800
957 Ga0495619_0008074 3300053085 Bacteria 6662
958 Ga0495619_0010328 3300053085 Bacteria 5876
959 Ga0495619_0143613 3300053085 Bacteria 1645
960 Ga0500641_0002398 3300053096 Bacteria 6646
961 Ga0500562_000002 3300053108 Bacteria 977234
962 Ga0500595_021781 3300053119 Bacteria 2282
963 Ga0500628_002474 3300053129 Bacteria 3052
964 Ga0501084_0001358 3300054114 Bacteria 19353
965 Ga0501084_0005874 3300054114 Bacteria 10101
966 Ga0501084_0016458 3300054114 Bacteria 6142
967 Ga0501084_0050734 3300054114 Bacteria 3471
968 Ga0501084_0352493 3300054114 Bacteria 1243
969 Ga0590071_011163 3300059421 Bacteria 2103
970 Ga0590075_003699 3300059424 Bacteria 3632
971 Ga0590077_004894 3300059426 Bacteria 2740
972 Ga0501082_0000063 3300060353 Bacteria 76891
973 Ga0501082_0001009 3300060353 Bacteria 24886
974 Ga0501082_0010791 3300060353 Bacteria 7866
975 Ga0501082_0033591 3300060353 Bacteria 4426
976 Ga0501082_0042607 3300060353 Bacteria 3913
977 Ga0501082_0047272 3300060353 Bacteria 3708
978 Ga0501082_0195502 3300060353 Bacteria 1759
979 Ga0530510_0000014 3300061734 Bacteria 106661
980 Ga0530510_0001148 3300061734 Bacteria 17568
981 Ga0530510_0014247 3300061734 Bacteria 5606
982 Ga0530510_0016425 3300061734 Bacteria 5240
983 Ga0530510_0031133 3300061734 Bacteria 3835
984 Ga0530510_0046814 3300061734 Bacteria 3125
985 Ga0530510_0154128 3300061734 Bacteria 1697
986 Ga0530510_0211494 3300061734 Bacteria 1441

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0140175 Ga0495629_0140175_852_1670 263
2 3300035207 Ga0373942_0030371 Ga0373942_0030371_39_866 265
3 3300044694 Ga0466963_0130885 Ga0466963_0130885_17_910 267
4 3300028653 Ga0265323_10019618 Ga0265323_100196181 281
5 3300044693 Ga0466961_0114028 Ga0466961_0114028_418_1371 286
6 3300044842 Ga0466957_0124802 Ga0466957_0124802_314_1267 286
7 3300045049 Ga0466959_0002692 Ga0466959_0002692_2411_3364 286
8 3300045836 Ga0466958_0005927 Ga0466958_0005927_4031_4984 286
9 3300046452 Ga0495617_006590 Ga0495617_006590_2465_3391 295
10 3300046453 Ga0495627_034218 Ga0495627_034218_56_982 295
11 3300046512 Ga0495610_0000053 Ga0495610_0000053_85429_86355 295
12 3300047470 Ga0495681_0000015 Ga0495681_0000015_3997_4923 295
13 3300049592 Ga0501076_0137670 Ga0501076_0137670_311_1294 296
14 3300061734 Ga0530510_0016425 Ga0530510_0016425_1454_2437 296
15 3300049584 Ga0501068_0018498 Ga0501068_0018498_1664_2647 302
16 3300049591 Ga0501075_0021317 Ga0501075_0021317_2670_3653 302
17 3300049741 Ga0501079_0088348 Ga0501079_0088348_1193_2176 302
18 3300054114 Ga0501084_0352493 Ga0501084_0352493_145_1128 302
19 3300060353 Ga0501082_0033591 Ga0501082_0033591_2922_3905 302
20 3300005457 Ga0070662_100000363 Ga0070662_10000036313 304
21 3300025933 Ga0207706_10000006 Ga0207706_1000000618 304
22 3300049584 Ga0501068_0203733 Ga0501068_0203733_213_1208 305
23 3300049588 Ga0501072_0035580 Ga0501072_0035580_1098_2093 305
24 3300049589 Ga0501073_0061038 Ga0501073_0061038_453_1448 305
25 3300049744 Ga0501083_0034238 Ga0501083_0034238_985_1980 305
26 3300048918 Ga0496115_0000001 Ga0496115_0000001_139146_140081 306
27 3300053108 Ga0500562_000002 Ga0500562_000002_492590_493525 306
28 3300053129 Ga0500628_002474 Ga0500628_002474_1426_2358 306
29 3300006051 Ga0075364_10159535 Ga0075364_101595352 307
30 3300049586 Ga0501070_0018067 Ga0501070_0018067_3210_4211 307
31 3300050491 nmdc:mga00v17_87324_c1 nmdc:mga00v17_87324_c1_738_1676 307
32 3300006038 Ga0075365_10000014 Ga0075365_100000142 308
33 3300009098 Ga0105245_10010311 Ga0105245_100103111 308
34 3300009993 Ga0105028_101263 Ga0105028_1012632 308
35 3300013102 Ga0157371_10009099 Ga0157371_100090996 308
36 3300028556 Ga0265337_1000054 Ga0265337_100005437 308
37 3300028558 Ga0265326_10000027 Ga0265326_1000002740 308
38 3300028654 Ga0265322_10000003 Ga0265322_10000003249 308
39 3300029957 Ga0265324_10000103 Ga0265324_1000010334 308
40 3300030733 Ga0314311_1122819 Ga0314311_11228192 308
41 3300030734 Ga0316179_1002117 Ga0316179_100211743 308
42 3300030736 Ga0316180_1070555 Ga0316180_10705552 308
43 3300030742 Ga0316183_1122503 Ga0316183_112250316 308
44 3300030745 Ga0316182_1020791 Ga0316182_102079120 308
45 3300031238 Ga0265332_10007198 Ga0265332_100071984 308
46 3300031239 Ga0265328_10001275 Ga0265328_100012756 308
47 3300031240 Ga0265320_10000001 Ga0265320_10000001249 308
48 3300031242 Ga0265329_10002125 Ga0265329_100021256 308
49 3300031250 Ga0265331_10001895 Ga0265331_100018954 308
50 3300031251 Ga0265327_10000003 Ga0265327_10000003249 308
51 3300031344 Ga0265316_10020298 Ga0265316_100202985 308
52 3300031711 Ga0265314_10001375 Ga0265314_100013756 308
53 3300042004 Ga0439445_0002076 Ga0439445_0002076_2342_3283 308
54 3300042006 Ga0439432_006638 Ga0439432_006638_2948_3889 308
55 3300049574 Ga0501038_0344533 Ga0501038_0344533_140_1120 308
56 3300049589 Ga0501073_0065493 Ga0501073_0065493_560_1516 308
57 3300049590 Ga0501074_0136292 Ga0501074_0136292_78_1061 308
58 3300049591 Ga0501075_0110785 Ga0501075_0110785_553_1536 308
59 3300049743 Ga0501081_0043392 Ga0501081_0043392_1496_2479 308
60 3300049824 Ga0501045_0083925 Ga0501045_0083925_666_1649 308
61 3300050492 nmdc:mga0yw44_16_c1 nmdc:mga0yw44_16_c1_78722_79663 308
62 3300005981 Ga0081538_10001600 Ga0081538_1000160015 309
63 3300005981 Ga0081538_10122477 Ga0081538_101224772 309
64 3300048918 Ga0496115_0008262 Ga0496115_0008262_2664_3686 309
65 3300050492 nmdc:mga0yw44_24400_c1 nmdc:mga0yw44_24400_c1_1002_1958 309
66 3300049742 Ga0501080_0046552 Ga0501080_0046552_1487_2482 310
67 3300005354 Ga0070675_100089174 Ga0070675_1000891743 311
68 3300005365 Ga0070688_100053154 Ga0070688_1000531542 311
69 3300005981 Ga0081538_10000099 Ga0081538_1000009972 311
70 3300014969 Ga0157376_10096829 Ga0157376_100968293 311
71 3300025960 Ga0207651_10220835 Ga0207651_102208351 311
72 3300026121 Ga0207683_10343832 Ga0207683_103438321 311
73 3300048903 Ga0496100_0120231 Ga0496100_0120231_641_1636 311
74 3300048914 Ga0496111_0043856 Ga0496111_0043856_2107_3102 311
75 3300006844 Ga0075428_100078209 Ga0075428_1000782095 312
76 3300006847 Ga0075431_100227289 Ga0075431_1002272892 312
77 3300006914 Ga0075436_100135926 Ga0075436_1001359262 312
78 3300050514 nmdc:mga08x19_125208_c1 nmdc:mga08x19_125208_c1_599_1660 312
79 3300005937 Ga0081455_10007120 Ga0081455_100071203 313
80 3300015261 Ga0182006_1061684 Ga0182006_10616842 313
81 3300037418 Ga0395900_0124218 Ga0395900_0124218_895_1845 313
82 3300037466 Ga0395898_0254166 Ga0395898_0254166_207_1157 313
83 3300037471 Ga0395905_0401141 Ga0395905_0401141_46_996 313
84 3300038443 Ga0395901_0046351 Ga0395901_0046351_1577_2527 313
85 3300044684 Ga0466966_0232242 Ga0466966_0232242_111_1064 313
86 3300005329 Ga0070683_100013143 Ga0070683_1000131433 314
87 3300005329 Ga0070683_100023359 Ga0070683_1000233597 314
88 3300005330 Ga0070690_100301662 Ga0070690_1003016621 314
89 3300005336 Ga0070680_100004037 Ga0070680_1000040377 314
90 3300005336 Ga0070680_100005608 Ga0070680_1000056083 314
91 3300005339 Ga0070660_100001494 Ga0070660_1000014943 314
92 3300005339 Ga0070660_100305580 Ga0070660_1003055802 314
93 3300005356 Ga0070674_100000020 Ga0070674_10000002018 314
94 3300005458 Ga0070681_10008977 Ga0070681_100089779 314
95 3300005530 Ga0070679_100075881 Ga0070679_1000758813 314
96 3300005535 Ga0070684_100001226 Ga0070684_10000122616 314
97 3300005535 Ga0070684_100231040 Ga0070684_1002310402 314
98 3300005577 Ga0068857_100115283 Ga0068857_1001152833 314
99 3300005718 Ga0068866_10000019 Ga0068866_1000001978 314
100 3300005981 Ga0081538_10000252 Ga0081538_1000025232 314
101 3300005981 Ga0081538_10012000 Ga0081538_100120005 314
102 3300006038 Ga0075365_10062766 Ga0075365_100627663 314
103 3300006051 Ga0075364_10093685 Ga0075364_100936852 314
104 3300009093 Ga0105240_10026755 Ga0105240_100267554 314
105 3300009098 Ga0105245_10386593 Ga0105245_103865932 314
106 3300013307 Ga0157372_10151411 Ga0157372_101514112 314
107 3300013308 Ga0157375_10600278 Ga0157375_106002781 314
108 3300020070 Ga0206356_10987891 Ga0206356_109878911 314
109 3300020082 Ga0206353_11844079 Ga0206353_118440796 314
110 3300025899 Ga0207642_10000017 Ga0207642_1000001776 314
111 3300025917 Ga0207660_10018009 Ga0207660_100180094 314
112 3300025917 Ga0207660_10061128 Ga0207660_100611283 314
113 3300025919 Ga0207657_10001335 Ga0207657_1000133522 314
114 3300025919 Ga0207657_10271799 Ga0207657_102717992 314
115 3300025920 Ga0207649_10030765 Ga0207649_100307652 314
116 3300025932 Ga0207690_10326736 Ga0207690_103267362 314
117 3300025937 Ga0207669_10000016 Ga0207669_10000016130 314
118 3300025944 Ga0207661_10008416 Ga0207661_100084167 314
119 3300026116 Ga0207674_10072073 Ga0207674_100720733 314
120 3300037312 Ga0395899_0066624 Ga0395899_0066624_1116_2072 314
121 3300037418 Ga0395900_0117171 Ga0395900_0117171_81_1037 314
122 3300037471 Ga0395905_0025788 Ga0395905_0025788_3966_4922 314
123 3300038443 Ga0395901_0173308 Ga0395901_0173308_564_1520 314
124 3300044694 Ga0466963_0025241 Ga0466963_0025241_1028_1984 314
125 3300045976 Ga0466967_0079454 Ga0466967_0079454_1165_2121 314
126 3300045976 Ga0466967_0426272 Ga0466967_0426272_245_1201 314
127 3300046461 Ga0495641_0009756 Ga0495641_0009756_3910_4923 314
128 3300046461 Ga0495641_0070282 Ga0495641_0070282_418_1383 314
129 3300046462 Ga0495651_0004887 Ga0495651_0004887_6418_7383 314
130 3300046463 Ga0495653_0010741 Ga0495653_0010741_4093_5058 314
131 3300046477 Ga0495664_0045067 Ga0495664_0045067_1352_2317 314
132 3300046511 Ga0495608_0000406 Ga0495608_0000406_15985_17004 314
133 3300046514 Ga0495618_0000068 Ga0495618_0000068_70493_71512 314
134 3300046516 Ga0495628_0008805 Ga0495628_0008805_828_1793 314
135 3300046517 Ga0495630_0100644 Ga0495630_0100644_885_1850 314
136 3300046533 Ga0495640_0001520 Ga0495640_0001520_10573_11538 314
137 3300046533 Ga0495640_0041629 Ga0495640_0041629_1315_2328 314
138 3300046559 Ga0495667_0004189 Ga0495667_0004189_2035_3000 314
139 3300046663 Ga0495635_0180491 Ga0495635_0180491_115_1080 314
140 3300046678 Ga0495599_0080868 Ga0495599_0080868_483_1448 314
141 3300046689 Ga0495613_0020894 Ga0495613_0020894_2124_3119 314
142 3300046809 Ga0495600_0010047 Ga0495600_0010047_4017_5036 314
143 3300047319 Ga0495674_0000042 Ga0495674_0000042_17733_18746 314
144 3300047319 Ga0495674_0007533 Ga0495674_0007533_2734_3699 314
145 3300047322 Ga0495680_0000023 Ga0495680_0000023_30667_31686 314
146 3300047322 Ga0495680_0003583 Ga0495680_0003583_8319_9284 314
147 3300047444 Ga0495675_0171167 Ga0495675_0171167_307_1272 314
148 3300047471 Ga0495684_0010791 Ga0495684_0010791_1199_2164 314
149 3300048088 Ga0495602_0130113 Ga0495602_0130113_383_1348 314
150 3300048913 Ga0496110_0075847 Ga0496110_0075847_368_1363 314
151 3300048914 Ga0496111_0051808 Ga0496111_0051808_1662_2651 314
152 3300050491 nmdc:mga00v17_38242_c1 nmdc:mga00v17_38242_c1_1436_2464 314
153 3300050492 nmdc:mga0yw44_30503_c1 nmdc:mga0yw44_30503_c1_1219_2247 314
154 3300050510 nmdc:mga06r32_80394_c1 nmdc:mga06r32_80394_c1_857_1849 314
155 3300053077 Ga0495601_0078139 Ga0495601_0078139_330_1295 314
156 3300053084 Ga0495595_0000109 Ga0495595_0000109_27450_28469 314
157 3300005327 Ga0070658_10050495 Ga0070658_100504953 315
158 3300005327 Ga0070658_10165550 Ga0070658_101655502 315
159 3300005329 Ga0070683_100237672 Ga0070683_1002376722 315
160 3300005337 Ga0070682_100000080 Ga0070682_10000008060 315
161 3300005339 Ga0070660_100003867 Ga0070660_1000038678 315
162 3300005339 Ga0070660_100136777 Ga0070660_1001367771 315
163 3300005339 Ga0070660_100284427 Ga0070660_1002844272 315
164 3300005344 Ga0070661_100007123 Ga0070661_1000071233 315
165 3300005344 Ga0070661_100063455 Ga0070661_1000634553 315
166 3300005366 Ga0070659_100026115 Ga0070659_1000261151 315
167 3300005458 Ga0070681_10030842 Ga0070681_100308423 315
168 3300005458 Ga0070681_10183635 Ga0070681_101836352 315
169 3300005530 Ga0070679_100041206 Ga0070679_1000412064 315
170 3300005539 Ga0068853_100247958 Ga0068853_1002479581 315
171 3300005546 Ga0070696_100122600 Ga0070696_1001226002 315
172 3300005548 Ga0070665_100032824 Ga0070665_1000328246 315
173 3300005563 Ga0068855_100014350 Ga0068855_1000143507 315
174 3300005563 Ga0068855_100056520 Ga0068855_1000565204 315
175 3300005563 Ga0068855_100211426 Ga0068855_1002114262 315
176 3300005578 Ga0068854_100115490 Ga0068854_1001154902 315
177 3300005614 Ga0068856_100073050 Ga0068856_1000730503 315
178 3300005614 Ga0068856_100240699 Ga0068856_1002406993 315
179 3300005616 Ga0068852_100038655 Ga0068852_1000386551 315
180 3300006175 Ga0070712_100019039 Ga0070712_1000190392 315
181 3300009093 Ga0105240_10049813 Ga0105240_100498134 315
182 3300009545 Ga0105237_10163908 Ga0105237_101639082 315
183 3300013105 Ga0157369_10035965 Ga0157369_100359652 315
184 3300013105 Ga0157369_10075437 Ga0157369_100754373 315
185 3300013296 Ga0157374_10098614 Ga0157374_100986143 315
186 3300013307 Ga0157372_10434060 Ga0157372_104340602 315
187 3300014969 Ga0157376_10331348 Ga0157376_103313482 315
188 3300020070 Ga0206356_11507257 Ga0206356_115072572 315
189 3300020081 Ga0206354_10224168 Ga0206354_102241682 315
190 3300020082 Ga0206353_11255590 Ga0206353_112555903 315
191 3300025912 Ga0207707_10011148 Ga0207707_100111489 315
192 3300025912 Ga0207707_10012057 Ga0207707_100120577 315
193 3300025917 Ga0207660_10047444 Ga0207660_100474442 315
194 3300025919 Ga0207657_10002472 Ga0207657_1000247221 315
195 3300025919 Ga0207657_10003370 Ga0207657_1000337012 315
196 3300025919 Ga0207657_10029745 Ga0207657_100297452 315
197 3300025920 Ga0207649_10016170 Ga0207649_100161703 315
198 3300025920 Ga0207649_10320794 Ga0207649_103207942 315
199 3300025921 Ga0207652_10116676 Ga0207652_101166762 315
200 3300025932 Ga0207690_10031482 Ga0207690_100314823 315
201 3300025949 Ga0207667_10215088 Ga0207667_102150882 315
202 3300025981 Ga0207640_10206892 Ga0207640_102068921 315
203 3300026067 Ga0207678_10210895 Ga0207678_102108952 315
204 3300026078 Ga0207702_10033585 Ga0207702_100335852 315
205 3300026078 Ga0207702_10178202 Ga0207702_101782022 315
206 3300026116 Ga0207674_10050544 Ga0207674_100505444 315
207 3300028379 Ga0268266_10136436 Ga0268266_101364362 315
208 3300037418 Ga0395900_0049279 Ga0395900_0049279_1224_2183 315
209 3300037466 Ga0395898_0528300 Ga0395898_0528300_13_972 315
210 3300038443 Ga0395901_0136094 Ga0395901_0136094_1523_2482 315
211 3300044706 Ga0466964_0010017 Ga0466964_0010017_509_1468 315
212 3300045049 Ga0466959_0055724 Ga0466959_0055724_1504_2463 315
213 3300045976 Ga0466967_0069123 Ga0466967_0069123_2168_3127 315
214 3300046454 Ga0495592_0000621 Ga0495592_0000621_5116_6135 315
215 3300048903 Ga0496100_0006019 Ga0496100_0006019_5129_6088 315
216 3300048905 Ga0496102_0001674 Ga0496102_0001674_5232_6191 315
217 3300048906 Ga0496103_0080885 Ga0496103_0080885_477_1436 315
218 3300048907 Ga0496104_0000576 Ga0496104_0000576_15793_16806 315
219 3300048907 Ga0496104_0007540 Ga0496104_0007540_5537_6496 315
220 3300048907 Ga0496104_0059650 Ga0496104_0059650_1430_2419 315
221 3300048908 Ga0496105_0001400 Ga0496105_0001400_4015_4974 315
222 3300048908 Ga0496105_0009052 Ga0496105_0009052_808_1821 315
223 3300048910 Ga0496107_0026446 Ga0496107_0026446_1463_2458 315
224 3300048910 Ga0496107_0052198 Ga0496107_0052198_841_1800 315
225 3300048911 Ga0496108_0010904 Ga0496108_0010904_4035_5024 315
226 3300048911 Ga0496108_0026529 Ga0496108_0026529_1267_2226 315
227 3300048912 Ga0496109_0001613 Ga0496109_0001613_7906_8865 315
228 3300048913 Ga0496110_0001566 Ga0496110_0001566_4272_5261 315
229 3300048913 Ga0496110_0076003 Ga0496110_0076003_1013_1972 315
230 3300048914 Ga0496111_0017713 Ga0496111_0017713_2468_3457 315
231 3300048917 Ga0496114_0009498 Ga0496114_0009498_2013_2972 315
232 3300048917 Ga0496114_0157537 Ga0496114_0157537_638_1633 315
233 3300048918 Ga0496115_0005222 Ga0496115_0005222_3193_4152 315
234 3300049573 Ga0501037_0169474 Ga0501037_0169474_322_1281 315
235 3300049583 Ga0501067_0000808 Ga0501067_0000808_13163_14122 315
236 3300049585 Ga0501069_0009322 Ga0501069_0009322_915_1874 315
237 3300050507 nmdc:mga05p37_43470_c1 nmdc:mga05p37_43470_c1_3277_4236 315
238 3300050508 nmdc:mga09592_330607_c1 nmdc:mga09592_330607_c1_241_1200 315
239 3300053077 Ga0495601_0030309 Ga0495601_0030309_2294_3307 315
240 3300053085 Ga0495619_0000022 Ga0495619_0000022_128774_129787 315
241 3300060353 Ga0501082_0010791 Ga0501082_0010791_1160_2119 315
242 3300061734 Ga0530510_0211494 Ga0530510_0211494_75_1034 315
243 3300005471 Ga0070698_100351864 Ga0070698_1003518642 316
244 3300005841 Ga0068863_100170585 Ga0068863_1001705852 316
245 3300006175 Ga0070712_100185024 Ga0070712_1001850242 316
246 3300006844 Ga0075428_100017809 Ga0075428_1000178096 316
247 3300009094 Ga0111539_10024191 Ga0111539_100241912 316
248 3300009147 Ga0114129_10013663 Ga0114129_100136638 316
249 3300009148 Ga0105243_10209206 Ga0105243_102092062 316
250 3300010375 Ga0105239_10093776 Ga0105239_100937763 316
251 3300013308 Ga0157375_10032670 Ga0157375_100326702 316
252 3300014326 Ga0157380_10000219 Ga0157380_1000021924 316
253 3300014745 Ga0157377_10086554 Ga0157377_100865541 316
254 3300014968 Ga0157379_10320088 Ga0157379_103200882 316
255 3300025938 Ga0207704_10000025 Ga0207704_10000025101 316
256 3300025981 Ga0207640_10245438 Ga0207640_102454382 316
257 3300026088 Ga0207641_10008529 Ga0207641_100085295 316
258 3300027907 Ga0207428_10191832 Ga0207428_101918321 316
259 3300031251 Ga0265327_10008056 Ga0265327_100080568 316
260 3300031852 Ga0307410_10303937 Ga0307410_103039372 316
261 3300031995 Ga0307409_100058788 Ga0307409_1000587883 316
262 3300031995 Ga0307409_100090923 Ga0307409_1000909232 316
263 3300032002 Ga0307416_100033278 Ga0307416_1000332782 316
264 3300032002 Ga0307416_100114944 Ga0307416_1001149443 316
265 3300032126 Ga0307415_100076841 Ga0307415_1000768412 316
266 3300032126 Ga0307415_100102523 Ga0307415_1001025233 316
267 3300035121 Ga0373960_0011977 Ga0373960_0011977_1051_2025 316
268 3300035691 Ga0373931_0043963 Ga0373931_0043963_539_1513 316
269 3300037418 Ga0395900_0006758 Ga0395900_0006758_10280_11245 316
270 3300037418 Ga0395900_0041817 Ga0395900_0041817_3136_4128 316
271 3300037466 Ga0395898_0003445 Ga0395898_0003445_856_1821 316
272 3300037466 Ga0395898_0010906 Ga0395898_0010906_7569_8561 316
273 3300037466 Ga0395898_0085211 Ga0395898_0085211_1030_2046 316
274 3300037471 Ga0395905_0012564 Ga0395905_0012564_1000_1965 316
275 3300037471 Ga0395905_0035952 Ga0395905_0035952_2668_3684 316
276 3300037471 Ga0395905_0042430 Ga0395905_0042430_2608_3600 316
277 3300038443 Ga0395901_0001420 Ga0395901_0001420_14157_15122 316
278 3300038443 Ga0395901_0065706 Ga0395901_0065706_1065_2057 316
279 3300045976 Ga0466967_0092522 Ga0466967_0092522_672_1637 316
280 3300045976 Ga0466967_0272881 Ga0466967_0272881_649_1611 316
281 3300046454 Ga0495592_0083460 Ga0495592_0083460_285_1250 316
282 3300046462 Ga0495651_0014023 Ga0495651_0014023_4082_5044 316
283 3300046463 Ga0495653_0069968 Ga0495653_0069968_696_1661 316
284 3300046500 Ga0495596_0070600 Ga0495596_0070600_248_1222 316
285 3300046516 Ga0495628_0039578 Ga0495628_0039578_946_1911 316
286 3300046517 Ga0495630_0000018 Ga0495630_0000018_1570_2577 316
287 3300046533 Ga0495640_0233002 Ga0495640_0233002_108_1073 316
288 3300046535 Ga0495586_0031050 Ga0495586_0031050_285_1250 316
289 3300046559 Ga0495667_0044310 Ga0495667_0044310_332_1294 316
290 3300046663 Ga0495635_0112848 Ga0495635_0112848_618_1583 316
291 3300046678 Ga0495599_0026791 Ga0495599_0026791_186_1151 316
292 3300046681 Ga0495647_0000293 Ga0495647_0000293_9626_10651 316
293 3300047317 Ga0495604_0049521 Ga0495604_0049521_1632_2594 316
294 3300047317 Ga0495604_0071262 Ga0495604_0071262_420_1385 316
295 3300047322 Ga0495680_0005597 Ga0495680_0005597_6258_7223 316
296 3300047444 Ga0495675_0065903 Ga0495675_0065903_900_1865 316
297 3300047471 Ga0495684_0010019 Ga0495684_0010019_5470_6435 316
298 3300048088 Ga0495602_0061923 Ga0495602_0061923_1263_2225 316
299 3300048905 Ga0496102_0023784 Ga0496102_0023784_4113_5126 316
300 3300048905 Ga0496102_0218064 Ga0496102_0218064_55_1050 316
301 3300048907 Ga0496104_0350863 Ga0496104_0350863_65_1027 316
302 3300048910 Ga0496107_0174142 Ga0496107_0174142_369_1364 316
303 3300048911 Ga0496108_0041446 Ga0496108_0041446_1873_2868 316
304 3300048912 Ga0496109_0280872 Ga0496109_0280872_310_1305 316
305 3300048913 Ga0496110_0001195 Ga0496110_0001195_9095_10090 316
306 3300048917 Ga0496114_0012600 Ga0496114_0012600_1824_2786 316
307 3300048918 Ga0496115_0005218 Ga0496115_0005218_2547_3509 316
308 3300050507 nmdc:mga05p37_163019_c1 nmdc:mga05p37_163019_c1_179_1186 316
309 3300050511 nmdc:mga08y16_16311_c1 nmdc:mga08y16_16311_c1_6212_7186 316
310 3300053077 Ga0495601_0096050 Ga0495601_0096050_515_1477 316
311 3300053078 Ga0495612_0011495 Ga0495612_0011495_1486_2451 316
312 3300053085 Ga0495619_0003097 Ga0495619_0003097_8328_9293 316
313 3300053085 Ga0495619_0143613 Ga0495619_0143613_411_1373 316
314 3300005329 Ga0070683_100043303 Ga0070683_1000433032 317
315 3300005445 Ga0070708_100001181 Ga0070708_1000011813 317
316 3300005981 Ga0081538_10058246 Ga0081538_100582463 317
317 3300005983 Ga0081540_1000006 Ga0081540_100000674 317
318 3300005985 Ga0081539_10000062 Ga0081539_1000006281 317
319 3300009098 Ga0105245_10001677 Ga0105245_1000167711 317
320 3300025927 Ga0207687_10000646 Ga0207687_1000064614 317
321 3300025938 Ga0207704_10076865 Ga0207704_100768652 317
322 3300025944 Ga0207661_10030009 Ga0207661_100300093 317
323 3300025981 Ga0207640_10000285 Ga0207640_100002858 317
324 3300026075 Ga0207708_10329542 Ga0207708_103295422 317
325 3300028379 Ga0268266_10066071 Ga0268266_100660713 317
326 3300031727 Ga0316576_10143144 Ga0316576_101431442 317
327 3300037312 Ga0395899_0019939 Ga0395899_0019939_668_1669 317
328 3300037466 Ga0395898_0011062 Ga0395898_0011062_7474_8475 317
329 3300037466 Ga0395898_0077050 Ga0395898_0077050_1244_2248 317
330 3300038443 Ga0395901_0006110 Ga0395901_0006110_9551_10552 317
331 3300044693 Ga0466961_0026057 Ga0466961_0026057_2194_3150 317
332 3300046459 Ga0495629_0005520 Ga0495629_0005520_3052_4068 317
333 3300046516 Ga0495628_0268974 Ga0495628_0268974_147_1145 317
334 3300046678 Ga0495599_0031412 Ga0495599_0031412_1650_2648 317
335 3300047446 Ga0495679_011414 Ga0495679_011414_2382_3380 317
336 3300048909 Ga0496106_0000013 Ga0496106_0000013_166337_167401 317
337 3300048912 Ga0496109_0180730 Ga0496109_0180730_346_1344 317
338 3300048913 Ga0496110_0146832 Ga0496110_0146832_1112_2110 317
339 3300048913 Ga0496110_0250567 Ga0496110_0250567_520_1506 317
340 3300053077 Ga0495601_0000086 Ga0495601_0000086_31293_32291 317
341 3300053078 Ga0495612_0005844 Ga0495612_0005844_43_1041 317
342 3300003373 JGI25407J50210_10010599 JGI25407J50210_100105993 318
343 3300005458 Ga0070681_10005901 Ga0070681_1000590111 318
344 3300005530 Ga0070679_100000537 Ga0070679_10000053716 318
345 3300005548 Ga0070665_100000159 Ga0070665_100000159123 318
346 3300005842 Ga0068858_100000049 Ga0068858_10000004920 318
347 3300005843 Ga0068860_100063112 Ga0068860_1000631124 318
348 3300005937 Ga0081455_10078225 Ga0081455_100782253 318
349 3300005981 Ga0081538_10000429 Ga0081538_100004294 318
350 3300005981 Ga0081538_10000691 Ga0081538_100006917 318
351 3300005981 Ga0081538_10000894 Ga0081538_1000089414 318
352 3300005981 Ga0081538_10003180 Ga0081538_1000318026 318
353 3300005981 Ga0081538_10006926 Ga0081538_100069268 318
354 3300005981 Ga0081538_10008586 Ga0081538_100085863 318
355 3300009147 Ga0114129_10003023 Ga0114129_100030233 318
356 3300009545 Ga0105237_10175697 Ga0105237_101756972 318
357 3300009551 Ga0105238_10242128 Ga0105238_102421282 318
358 3300013308 Ga0157375_10046134 Ga0157375_100461343 318
359 3300025912 Ga0207707_10157919 Ga0207707_101579191 318
360 3300025921 Ga0207652_10000631 Ga0207652_1000063118 318
361 3300026035 Ga0207703_10000067 Ga0207703_1000006714 318
362 3300026078 Ga0207702_10016146 Ga0207702_100161468 318
363 3300028379 Ga0268266_10000023 Ga0268266_10000023343 318
364 3300028381 Ga0268264_10007216 Ga0268264_1000721610 318
365 3300036401 Ga0373937_0033225 Ga0373937_0033225_847_1842 318
366 3300046461 Ga0495641_0015104 Ga0495641_0015104_677_1678 318
367 3300046499 Ga0495594_0000013 Ga0495594_0000013_59767_60789 318
368 3300046535 Ga0495586_0000527 Ga0495586_0000527_3493_4494 318
369 3300046557 Ga0495622_0000014 Ga0495622_0000014_123830_124852 318
370 3300046663 Ga0495635_0000009 Ga0495635_0000009_239321_240340 318
371 3300046675 Ga0495657_0004915 Ga0495657_0004915_2602_3621 318
372 3300046690 Ga0495624_0000028 Ga0495624_0000028_26699_27700 318
373 3300046694 Ga0495649_0015920 Ga0495649_0015920_1614_2615 318
374 3300047322 Ga0495680_0000421 Ga0495680_0000421_25241_26242 318
375 3300048910 Ga0496107_0338919 Ga0496107_0338919_26_1033 318
376 3300048913 Ga0496110_0017994 Ga0496110_0017994_1791_2792 318
377 3300049578 Ga0501042_0145464 Ga0501042_0145464_657_1643 318
378 3300049588 Ga0501072_0014925 Ga0501072_0014925_751_1722 318
379 3300049824 Ga0501045_0063835 Ga0501045_0063835_32_1018 318
380 3300050511 nmdc:mga08y16_368483_c1 nmdc:mga08y16_368483_c1_270_1253 318
381 3300050511 nmdc:mga08y16_640486_c1 nmdc:mga08y16_640486_c1_64_1035 318
382 3300053083 Ga0495655_0001739 Ga0495655_0001739_1738_2748 318
383 3300053119 Ga0500595_021781 Ga0500595_021781_596_1633 318
384 3300061734 Ga0530510_0046814 Ga0530510_0046814_762_1748 318
385 3300005356 Ga0070674_100196524 Ga0070674_1001965241 319
386 3300006038 Ga0075365_10243986 Ga0075365_102439862 319
387 3300006051 Ga0075364_10164661 Ga0075364_101646611 319
388 3300006051 Ga0075364_10215756 Ga0075364_102157561 319
389 3300009098 Ga0105245_10003691 Ga0105245_100036919 319
390 3300026121 Ga0207683_10006404 Ga0207683_100064045 319
391 3300031824 Ga0307413_10023303 Ga0307413_100233033 319
392 3300031911 Ga0307412_10241304 Ga0307412_102413041 319
393 3300031995 Ga0307409_100012362 Ga0307409_1000123625 319
394 3300032002 Ga0307416_100011782 Ga0307416_1000117826 319
395 3300032004 Ga0307414_10120549 Ga0307414_101205491 319
396 3300046516 Ga0495628_0005324 Ga0495628_0005324_1508_2527 319
397 3300048903 Ga0496100_0179643 Ga0496100_0179643_460_1452 319
398 3300048905 Ga0496102_0017155 Ga0496102_0017155_976_1968 319
399 3300048911 Ga0496108_0008008 Ga0496108_0008008_745_1746 319
400 3300048912 Ga0496109_0028090 Ga0496109_0028090_2981_3973 319
401 3300048916 Ga0496113_0002837 Ga0496113_0002837_2399_3400 319
402 3300048916 Ga0496113_0216946 Ga0496113_0216946_503_1495 319
403 3300048923 Ga0496120_0004252 Ga0496120_0004252_9594_10613 319
404 3300049588 Ga0501072_0357554 Ga0501072_0357554_44_1060 319
405 3300049593 Ga0501077_0173009 Ga0501077_0173009_86_1102 319
406 3300049743 Ga0501081_0321051 Ga0501081_0321051_51_1067 319
407 3300054114 Ga0501084_0016458 Ga0501084_0016458_1665_2654 319
408 3300005329 Ga0070683_100001714 Ga0070683_10000171416 320
409 3300005329 Ga0070683_100018473 Ga0070683_1000184732 320
410 3300005341 Ga0070691_10008984 Ga0070691_100089844 320
411 3300005344 Ga0070661_100000005 Ga0070661_100000005207 320
412 3300005354 Ga0070675_100000058 Ga0070675_10000005850 320
413 3300005364 Ga0070673_100046800 Ga0070673_1000468003 320
414 3300005365 Ga0070688_100002793 Ga0070688_1000027934 320
415 3300005365 Ga0070688_100005500 Ga0070688_1000055009 320
416 3300005466 Ga0070685_10000293 Ga0070685_1000029328 320
417 3300005535 Ga0070684_100081312 Ga0070684_1000813123 320
418 3300005543 Ga0070672_100000004 Ga0070672_10000000484 320
419 3300005719 Ga0068861_100041642 Ga0068861_1000416422 320
420 3300005834 Ga0068851_10005192 Ga0068851_100051922 320
421 3300005981 Ga0081538_10000804 Ga0081538_1000080433 320
422 3300006038 Ga0075365_10160419 Ga0075365_101604192 320
423 3300006844 Ga0075428_100199352 Ga0075428_1001993522 320
424 3300006846 Ga0075430_100003677 Ga0075430_1000036773 320
425 3300006847 Ga0075431_100002485 Ga0075431_1000024854 320
426 3300006880 Ga0075429_100046393 Ga0075429_1000463934 320
427 3300009098 Ga0105245_10000056 Ga0105245_100000567 320
428 3300013104 Ga0157370_10214353 Ga0157370_102143532 320
429 3300013105 Ga0157369_10000099 Ga0157369_1000009927 320
430 3300013297 Ga0157378_10010497 Ga0157378_100104973 320
431 3300025321 Ga0207656_10117373 Ga0207656_101173732 320
432 3300025915 Ga0207693_10013240 Ga0207693_100132402 320
433 3300025926 Ga0207659_10000020 Ga0207659_1000002056 320
434 3300025927 Ga0207687_10000007 Ga0207687_10000007115 320
435 3300025940 Ga0207691_10000020 Ga0207691_1000002042 320
436 3300025944 Ga0207661_10001238 Ga0207661_1000123816 320
437 3300025944 Ga0207661_10001949 Ga0207661_100019499 320
438 3300025960 Ga0207651_10111878 Ga0207651_101118783 320
439 3300031901 Ga0307406_10011927 Ga0307406_100119274 320
440 3300032126 Ga0307415_100001131 Ga0307415_1000011312 320
441 3300045976 Ga0466967_0000046 Ga0466967_0000046_14371_15384 320
442 3300046459 Ga0495629_0036832 Ga0495629_0036832_943_1938 320
443 3300046674 Ga0495588_0000198 Ga0495588_0000198_1632_2645 320
444 3300046681 Ga0495647_0090494 Ga0495647_0090494_229_1224 320
445 3300046690 Ga0495624_0036177 Ga0495624_0036177_1425_2432 320
446 3300047317 Ga0495604_0003466 Ga0495604_0003466_6463_7473 320
447 3300048915 Ga0496112_0017217 Ga0496112_0017217_1660_2670 320
448 3300048916 Ga0496113_0000007 Ga0496113_0000007_93217_94227 320
449 3300049586 Ga0501070_0009281 Ga0501070_0009281_1937_2983 320
450 3300049590 Ga0501074_0044985 Ga0501074_0044985_1606_2637 320
451 3300050508 nmdc:mga09592_49273_c1 nmdc:mga09592_49273_c1_652_1665 320
452 3300050509 nmdc:mga0qj67_1508_c1 nmdc:mga0qj67_1508_c1_4682_5695 320
453 3300050510 nmdc:mga06r32_4240_c1 nmdc:mga06r32_4240_c1_1248_2261 320
454 3300053078 Ga0495612_0000410 Ga0495612_0000410_657_1655 320
455 3300053085 Ga0495619_0010328 Ga0495619_0010328_3932_4927 320
456 3300059426 Ga0590077_004894 Ga0590077_004894_996_1991 320
457 3300005338 Ga0068868_100220158 Ga0068868_1002201581 321
458 3300005365 Ga0070688_100000333 Ga0070688_10000033321 321
459 3300005366 Ga0070659_100115029 Ga0070659_1001150293 321
460 3300005439 Ga0070711_100008345 Ga0070711_1000083456 321
461 3300005466 Ga0070685_10003954 Ga0070685_1000395410 321
462 3300005614 Ga0068856_100018421 Ga0068856_1000184218 321
463 3300005614 Ga0068856_100023907 Ga0068856_1000239073 321
464 3300005616 Ga0068852_100000012 Ga0068852_100000012114 321
465 3300005834 Ga0068851_10004367 Ga0068851_100043673 321
466 3300005841 Ga0068863_100000032 Ga0068863_10000003215 321
467 3300009177 Ga0105248_10000032 Ga0105248_10000032113 321
468 3300013307 Ga0157372_10026370 Ga0157372_100263707 321
469 3300014326 Ga0157380_10362950 Ga0157380_103629502 321
470 3300017792 Ga0163161_10000058 Ga0163161_1000005842 321
471 3300025321 Ga0207656_10002305 Ga0207656_100023058 321
472 3300025916 Ga0207663_10014493 Ga0207663_100144934 321
473 3300025916 Ga0207663_10066421 Ga0207663_100664212 321
474 3300025925 Ga0207650_10025386 Ga0207650_100253864 321
475 3300025928 Ga0207700_10000008 Ga0207700_10000008341 321
476 3300025928 Ga0207700_10000016 Ga0207700_100000166 321
477 3300025941 Ga0207711_10000020 Ga0207711_10000020261 321
478 3300026023 Ga0207677_10052187 Ga0207677_100521872 321
479 3300026078 Ga0207702_10000016 Ga0207702_10000016106 321
480 3300026078 Ga0207702_10003815 Ga0207702_100038156 321
481 3300026088 Ga0207641_10000071 Ga0207641_1000007116 321
482 3300026089 Ga0207648_10000228 Ga0207648_1000022828 321
483 3300026118 Ga0207675_100140748 Ga0207675_1001407483 321
484 3300026142 Ga0207698_10000012 Ga0207698_10000012233 321
485 3300031727 Ga0316576_10180268 Ga0316576_101802681 321
486 3300036712 Ga0316584_0122658 Ga0316584_0122658_470_1489 321
487 3300037418 Ga0395900_0081851 Ga0395900_0081851_67_1083 321
488 3300037466 Ga0395898_0027143 Ga0395898_0027143_4669_5685 321
489 3300037471 Ga0395905_0002251 Ga0395905_0002251_16644_17660 321
490 3300044842 Ga0466957_0003681 Ga0466957_0003681_5831_6844 321
491 3300046473 Ga0495582_0000005 Ga0495582_0000005_107049_108059 321
492 3300046511 Ga0495608_0000031 Ga0495608_0000031_11675_12688 321
493 3300046533 Ga0495640_0047817 Ga0495640_0047817_205_1224 321
494 3300046675 Ga0495657_0000024 Ga0495657_0000024_11675_12688 321
495 3300046683 Ga0495658_0000019 Ga0495658_0000019_48122_49132 321
496 3300046689 Ga0495613_0000249 Ga0495613_0000249_15996_17015 321
497 3300046809 Ga0495600_0003314 Ga0495600_0003314_6438_7451 321
498 3300047317 Ga0495604_0006459 Ga0495604_0006459_2387_3400 321
499 3300047444 Ga0495675_0000209 Ga0495675_0000209_11678_12691 321
500 3300048088 Ga0495602_0000228 Ga0495602_0000228_19934_20947 321
501 3300048088 Ga0495602_0210737 Ga0495602_0210737_219_1220 321
502 3300048907 Ga0496104_0346090 Ga0496104_0346090_150_1151 321
503 3300048911 Ga0496108_0000045 Ga0496108_0000045_116504_117517 321
504 3300048912 Ga0496109_0000032 Ga0496109_0000032_19909_20922 321
505 3300048912 Ga0496109_0230154 Ga0496109_0230154_264_1277 321
506 3300048913 Ga0496110_0000033 Ga0496110_0000033_62286_63296 321
507 3300048913 Ga0496110_0027759 Ga0496110_0027759_3305_4318 321
508 3300048915 Ga0496112_0000002 Ga0496112_0000002_612409_613419 321
509 3300048916 Ga0496113_0009418 Ga0496113_0009418_4095_5087 321
510 3300049568 Ga0501031_0058633 Ga0501031_0058633_967_1974 321
511 3300049569 Ga0501032_0064563 Ga0501032_0064563_1159_2166 321
512 3300049570 Ga0501033_0014207 Ga0501033_0014207_3759_4766 321
513 3300049571 Ga0501034_0003200 Ga0501034_0003200_16631_17638 321
514 3300049572 Ga0501036_0001590 Ga0501036_0001590_15601_16608 321
515 3300049573 Ga0501037_0005716 Ga0501037_0005716_4329_5336 321
516 3300049574 Ga0501038_0008491 Ga0501038_0008491_1287_2294 321
517 3300049575 Ga0501039_0003991 Ga0501039_0003991_6716_7723 321
518 3300049576 Ga0501040_0000954 Ga0501040_0000954_9989_10996 321
519 3300049577 Ga0501041_0001093 Ga0501041_0001093_4329_5336 321
520 3300049578 Ga0501042_0003964 Ga0501042_0003964_3894_4901 321
521 3300049578 Ga0501042_0069176 Ga0501042_0069176_723_1715 321
522 3300049579 Ga0501043_0048746 Ga0501043_0048746_967_1974 321
523 3300049580 Ga0501046_0028136 Ga0501046_0028136_3039_4046 321
524 3300049581 Ga0501047_0084809 Ga0501047_0084809_879_1886 321
525 3300049582 Ga0501048_0001926 Ga0501048_0001926_6983_7990 321
526 3300049583 Ga0501067_0009559 Ga0501067_0009559_2361_3368 321
527 3300049584 Ga0501068_0011873 Ga0501068_0011873_879_1886 321
528 3300049586 Ga0501070_0005855 Ga0501070_0005855_1690_2697 321
529 3300049587 Ga0501071_0001995 Ga0501071_0001995_6716_7723 321
530 3300049588 Ga0501072_0004831 Ga0501072_0004831_4329_5336 321
531 3300049589 Ga0501073_0033451 Ga0501073_0033451_2369_3376 321
532 3300049590 Ga0501074_0060672 Ga0501074_0060672_751_1758 321
533 3300049591 Ga0501075_0000193 Ga0501075_0000193_14492_15499 321
534 3300049592 Ga0501076_0001292 Ga0501076_0001292_7979_8986 321
535 3300049593 Ga0501077_0001176 Ga0501077_0001176_4598_5605 321
536 3300049741 Ga0501079_0000929 Ga0501079_0000929_967_1974 321
537 3300049742 Ga0501080_0032292 Ga0501080_0032292_2519_3526 321
538 3300049743 Ga0501081_0000159 Ga0501081_0000159_29279_30286 321
539 3300049744 Ga0501083_0008047 Ga0501083_0008047_4082_5089 321
540 3300049822 Ga0501035_0078473 Ga0501035_0078473_1159_2166 321
541 3300049823 Ga0501044_0038039 Ga0501044_0038039_1287_2294 321
542 3300049824 Ga0501045_0002161 Ga0501045_0002161_4329_5336 321
543 3300050491 nmdc:mga00v17_42955_c1 nmdc:mga00v17_42955_c1_138_1172 321
544 3300050507 nmdc:mga05p37_145145_c1 nmdc:mga05p37_145145_c1_1538_2545 321
545 3300050510 nmdc:mga06r32_60098_c1 nmdc:mga06r32_60098_c1_721_1740 321
546 3300053084 Ga0495595_0000014 Ga0495595_0000014_132568_133581 321
547 3300053084 Ga0495595_0027010 Ga0495595_0027010_1046_2059 321
548 3300053085 Ga0495619_0000319 Ga0495619_0000319_20991_22004 321
549 3300053085 Ga0495619_0008074 Ga0495619_0008074_4150_5151 321
550 3300054114 Ga0501084_0001358 Ga0501084_0001358_4470_5477 321
551 3300060353 Ga0501082_0001009 Ga0501082_0001009_7020_8027 321
552 3300061734 Ga0530510_0001148 Ga0530510_0001148_2369_3376 321
553 3300005330 Ga0070690_100092170 Ga0070690_1000921701 322
554 3300005334 Ga0068869_100006717 Ga0068869_1000067177 322
555 3300005336 Ga0070680_100037693 Ga0070680_1000376934 322
556 3300005341 Ga0070691_10013863 Ga0070691_100138633 322
557 3300005356 Ga0070674_100051096 Ga0070674_1000510963 322
558 3300005535 Ga0070684_100128869 Ga0070684_1001288691 322
559 3300005543 Ga0070672_100254547 Ga0070672_1002545472 322
560 3300005544 Ga0070686_100079214 Ga0070686_1000792142 322
561 3300005547 Ga0070693_100046964 Ga0070693_1000469643 322
562 3300005577 Ga0068857_100001285 Ga0068857_10000128510 322
563 3300005577 Ga0068857_100006742 Ga0068857_10000674210 322
564 3300005578 Ga0068854_100142366 Ga0068854_1001423661 322
565 3300005616 Ga0068852_100134945 Ga0068852_1001349453 322
566 3300005616 Ga0068852_100285715 Ga0068852_1002857152 322
567 3300005718 Ga0068866_10000002 Ga0068866_10000002220 322
568 3300005840 Ga0068870_10077016 Ga0068870_100770163 322
569 3300005842 Ga0068858_100044747 Ga0068858_1000447473 322
570 3300005937 Ga0081455_10030105 Ga0081455_100301056 322
571 3300005937 Ga0081455_10052361 Ga0081455_100523613 322
572 3300005985 Ga0081539_10002242 Ga0081539_1000224220 322
573 3300006163 Ga0070715_10000012 Ga0070715_1000001257 322
574 3300006844 Ga0075428_100121552 Ga0075428_1001215522 322
575 3300006847 Ga0075431_100302345 Ga0075431_1003023452 322
576 3300009094 Ga0111539_10002085 Ga0111539_1000208518 322
577 3300009094 Ga0111539_10002336 Ga0111539_1000233620 322
578 3300009098 Ga0105245_10005665 Ga0105245_100056655 322
579 3300009098 Ga0105245_10064347 Ga0105245_100643474 322
580 3300009147 Ga0114129_10023252 Ga0114129_100232522 322
581 3300009148 Ga0105243_10099187 Ga0105243_100991873 322
582 3300010375 Ga0105239_10372906 Ga0105239_103729062 322
583 3300011119 Ga0105246_10039193 Ga0105246_100391933 322
584 3300025899 Ga0207642_10000001 Ga0207642_10000001394 322
585 3300025899 Ga0207642_10000003 Ga0207642_10000003394 322
586 3300025899 Ga0207642_10000004 Ga0207642_10000004394 322
587 3300025905 Ga0207685_10000001 Ga0207685_10000001478 322
588 3300025925 Ga0207650_10152474 Ga0207650_101524741 322
589 3300025927 Ga0207687_10006484 Ga0207687_100064843 322
590 3300025933 Ga0207706_10014837 Ga0207706_100148376 322
591 3300025934 Ga0207686_10142989 Ga0207686_101429893 322
592 3300025935 Ga0207709_10049455 Ga0207709_100494552 322
593 3300025936 Ga0207670_10087786 Ga0207670_100877863 322
594 3300025936 Ga0207670_10330977 Ga0207670_103309771 322
595 3300025937 Ga0207669_10000036 Ga0207669_1000003630 322
596 3300025937 Ga0207669_10322612 Ga0207669_103226122 322
597 3300025942 Ga0207689_10025225 Ga0207689_100252253 322
598 3300025942 Ga0207689_10093134 Ga0207689_100931342 322
599 3300025944 Ga0207661_10151734 Ga0207661_101517342 322
600 3300025981 Ga0207640_10060336 Ga0207640_100603363 322
601 3300026035 Ga0207703_10000053 Ga0207703_1000005316 322
602 3300026075 Ga0207708_10006689 Ga0207708_100066897 322
603 3300026078 Ga0207702_10302676 Ga0207702_103026761 322
604 3300026089 Ga0207648_10043290 Ga0207648_100432901 322
605 3300026116 Ga0207674_10002949 Ga0207674_100029496 322
606 3300026118 Ga0207675_100010716 Ga0207675_1000107163 322
607 3300026121 Ga0207683_10135986 Ga0207683_101359862 322
608 3300026121 Ga0207683_10172253 Ga0207683_101722532 322
609 3300026142 Ga0207698_10009350 Ga0207698_100093505 322
610 3300027907 Ga0207428_10235228 Ga0207428_102352282 322
611 3300031548 Ga0307408_100031047 Ga0307408_1000310473 322
612 3300031548 Ga0307408_100048271 Ga0307408_1000482711 322
613 3300031548 Ga0307408_100081761 Ga0307408_1000817612 322
614 3300031824 Ga0307413_10002156 Ga0307413_100021563 322
615 3300031824 Ga0307413_10051708 Ga0307413_100517083 322
616 3300031852 Ga0307410_10016214 Ga0307410_100162143 322
617 3300031852 Ga0307410_10058953 Ga0307410_100589532 322
618 3300031901 Ga0307406_10038981 Ga0307406_100389813 322
619 3300031903 Ga0307407_10022196 Ga0307407_100221962 322
620 3300031911 Ga0307412_10018003 Ga0307412_100180033 322
621 3300031995 Ga0307409_100058575 Ga0307409_1000585752 322
622 3300031995 Ga0307409_100099462 Ga0307409_1000994623 322
623 3300032002 Ga0307416_100028324 Ga0307416_1000283244 322
624 3300032002 Ga0307416_100045175 Ga0307416_1000451751 322
625 3300032002 Ga0307416_100060430 Ga0307416_1000604303 322
626 3300032002 Ga0307416_100377509 Ga0307416_1003775092 322
627 3300032005 Ga0307411_10006677 Ga0307411_100066774 322
628 3300032126 Ga0307415_100020790 Ga0307415_1000207903 322
629 3300032126 Ga0307415_100275124 Ga0307415_1002751242 322
630 3300037466 Ga0395898_0057103 Ga0395898_0057103_1722_2720 322
631 3300037466 Ga0395898_0267825 Ga0395898_0267825_151_1167 322
632 3300038443 Ga0395901_0020676 Ga0395901_0020676_759_1775 322
633 3300042005 Ga0439448_0016164 Ga0439448_0016164_393_1382 322
634 3300044683 Ga0466965_0057274 Ga0466965_0057274_797_1792 322
635 3300044694 Ga0466963_0043513 Ga0466963_0043513_56_1072 322
636 3300044706 Ga0466964_0000890 Ga0466964_0000890_4245_5240 322
637 3300044735 Ga0466968_0046907 Ga0466968_0046907_134_1129 322
638 3300044901 Ga0466960_0022744 Ga0466960_0022744_1689_2684 322
639 3300045976 Ga0466967_0004872 Ga0466967_0004872_1831_2826 322
640 3300046457 Ga0495590_0087496 Ga0495590_0087496_46_1035 322
641 3300046474 Ga0495605_0066960 Ga0495605_0066960_689_1678 322
642 3300046491 Ga0495584_0037550 Ga0495584_0037550_779_1768 322
643 3300046491 Ga0495584_0076703 Ga0495584_0076703_167_1156 322
644 3300046500 Ga0495596_0097391 Ga0495596_0097391_123_1112 322
645 3300046518 Ga0495631_0056015 Ga0495631_0056015_291_1280 322
646 3300046523 Ga0495644_0033884 Ga0495644_0033884_512_1501 322
647 3300046535 Ga0495586_0000620 Ga0495586_0000620_5494_6495 322
648 3300046537 Ga0495598_0040271 Ga0495598_0040271_331_1320 322
649 3300046542 Ga0495597_0042995 Ga0495597_0042995_45_1034 322
650 3300046642 Ga0495634_0000024 Ga0495634_0000024_102829_103845 322
651 3300046660 Ga0495625_0000029 Ga0495625_0000029_2596_3591 322
652 3300047317 Ga0495604_0000056 Ga0495604_0000056_19413_20426 322
653 3300048905 Ga0496102_0027850 Ga0496102_0027850_2302_3315 322
654 3300048905 Ga0496102_0282216 Ga0496102_0282216_222_1235 322
655 3300048906 Ga0496103_0061251 Ga0496103_0061251_235_1248 322
656 3300048911 Ga0496108_0000631 Ga0496108_0000631_20489_21505 322
657 3300048911 Ga0496108_0020923 Ga0496108_0020923_1043_2032 322
658 3300048912 Ga0496109_0000085 Ga0496109_0000085_92423_93439 322
659 3300048913 Ga0496110_0155076 Ga0496110_0155076_311_1300 322
660 3300048914 Ga0496111_0000230 Ga0496111_0000230_2153_3142 322
661 3300048920 Ga0496117_0015033 Ga0496117_0015033_3662_4675 322
662 3300048921 Ga0496118_0000174 Ga0496118_0000174_111437_112450 322
663 3300049581 Ga0501047_0009620 Ga0501047_0009620_3474_4487 322
664 3300049583 Ga0501067_0073981 Ga0501067_0073981_202_1191 322
665 3300049584 Ga0501068_0028798 Ga0501068_0028798_1227_2213 322
666 3300049585 Ga0501069_0007694 Ga0501069_0007694_3378_4367 322
667 3300049587 Ga0501071_0225339 Ga0501071_0225339_94_1167 322
668 3300049591 Ga0501075_0007396 Ga0501075_0007396_5087_6100 322
669 3300049592 Ga0501076_0011312 Ga0501076_0011312_1066_2058 322
670 3300049652 Ga0501202_029492 Ga0501202_029492_87_1070 322
671 3300049744 Ga0501083_0021756 Ga0501083_0021756_566_1579 322
672 3300049823 Ga0501044_0065287 Ga0501044_0065287_909_1922 322
673 3300050509 nmdc:mga0qj67_83580_c1 nmdc:mga0qj67_83580_c1_1013_2005 322
674 3300050510 nmdc:mga06r32_351571_c1 nmdc:mga06r32_351571_c1_377_1369 322
675 3300050511 nmdc:mga08y16_2936_c1 nmdc:mga08y16_2936_c1_10080_11069 322
676 3300050515 nmdc:mga0a205_97616_c1 nmdc:mga0a205_97616_c1_1288_2304 322
677 3300053096 Ga0500641_0002398 Ga0500641_0002398_2601_3596 322
678 3300061734 Ga0530510_0154128 Ga0530510_0154128_668_1657 322
679 3300005336 Ga0070680_100014559 Ga0070680_1000145595 323
680 3300005337 Ga0070682_100030235 Ga0070682_1000302353 323
681 3300005338 Ga0068868_100000095 Ga0068868_10000009552 323
682 3300005344 Ga0070661_100241349 Ga0070661_1002413491 323
683 3300005456 Ga0070678_100100238 Ga0070678_1001002382 323
684 3300005458 Ga0070681_10004636 Ga0070681_100046363 323
685 3300005530 Ga0070679_100001830 Ga0070679_1000018305 323
686 3300005535 Ga0070684_100003228 Ga0070684_1000032282 323
687 3300005547 Ga0070693_100000833 Ga0070693_10000083311 323
688 3300005564 Ga0070664_100375561 Ga0070664_1003755612 323
689 3300005843 Ga0068860_100044947 Ga0068860_1000449475 323
690 3300006038 Ga0075365_10086269 Ga0075365_100862693 323
691 3300006038 Ga0075365_10172521 Ga0075365_101725212 323
692 3300006846 Ga0075430_100100857 Ga0075430_1001008572 323
693 3300009098 Ga0105245_10005783 Ga0105245_100057839 323
694 3300009148 Ga0105243_10047394 Ga0105243_100473942 323
695 3300013297 Ga0157378_10510143 Ga0157378_105101431 323
696 3300013307 Ga0157372_10606721 Ga0157372_106067212 323
697 3300013308 Ga0157375_10048497 Ga0157375_100484974 323
698 3300014325 Ga0163163_10107630 Ga0163163_101076302 323
699 3300014969 Ga0157376_10103402 Ga0157376_101034022 323
700 3300017792 Ga0163161_10065977 Ga0163161_100659773 323
701 3300025912 Ga0207707_10003654 Ga0207707_1000365410 323
702 3300025917 Ga0207660_10005162 Ga0207660_100051624 323
703 3300025921 Ga0207652_10001944 Ga0207652_1000194410 323
704 3300025927 Ga0207687_10017967 Ga0207687_100179674 323
705 3300025935 Ga0207709_10060791 Ga0207709_100607911 323
706 3300025944 Ga0207661_10001780 Ga0207661_100017809 323
707 3300025945 Ga0207679_10308269 Ga0207679_103082692 323
708 3300025981 Ga0207640_10083577 Ga0207640_100835772 323
709 3300026023 Ga0207677_10001435 Ga0207677_100014355 323
710 3300026078 Ga0207702_10014205 Ga0207702_100142057 323
711 3300026078 Ga0207702_10016852 Ga0207702_100168524 323
712 3300026118 Ga0207675_100009465 Ga0207675_1000094659 323
713 3300026121 Ga0207683_10023702 Ga0207683_100237024 323
714 3300036401 Ga0373937_0074513 Ga0373937_0074513_1754_2752 323
715 3300038443 Ga0395901_0235219 Ga0395901_0235219_465_1445 323
716 3300046462 Ga0495651_0090570 Ga0495651_0090570_1187_2185 323
717 3300046463 Ga0495653_0022048 Ga0495653_0022048_2532_3530 323
718 3300046511 Ga0495608_0022630 Ga0495608_0022630_1064_2062 323
719 3300046517 Ga0495630_0032881 Ga0495630_0032881_2619_3617 323
720 3300046529 Ga0495652_0011511 Ga0495652_0011511_5207_6205 323
721 3300046537 Ga0495598_0000907 Ga0495598_0000907_1360_2376 323
722 3300046543 Ga0495645_0048974 Ga0495645_0048974_477_1475 323
723 3300046559 Ga0495667_0010495 Ga0495667_0010495_1492_2490 323
724 3300046675 Ga0495657_0019467 Ga0495657_0019467_1684_2682 323
725 3300046678 Ga0495599_0007133 Ga0495599_0007133_1275_2273 323
726 3300046680 Ga0495646_0087929 Ga0495646_0087929_225_1223 323
727 3300046690 Ga0495624_0041230 Ga0495624_0041230_991_1989 323
728 3300046809 Ga0495600_0045091 Ga0495600_0045091_971_1969 323
729 3300047317 Ga0495604_0009004 Ga0495604_0009004_5931_6929 323
730 3300047319 Ga0495674_0030284 Ga0495674_0030284_495_1493 323
731 3300047322 Ga0495680_0021298 Ga0495680_0021298_254_1252 323
732 3300048088 Ga0495602_0046294 Ga0495602_0046294_966_1964 323
733 3300048903 Ga0496100_0005985 Ga0496100_0005985_1995_2984 323
734 3300048904 Ga0496101_0001626 Ga0496101_0001626_4261_5250 323
735 3300048905 Ga0496102_0008240 Ga0496102_0008240_5706_6695 323
736 3300048906 Ga0496103_0004839 Ga0496103_0004839_4810_5799 323
737 3300048907 Ga0496104_0002883 Ga0496104_0002883_3109_4098 323
738 3300048907 Ga0496104_0025674 Ga0496104_0025674_3646_4677 323
739 3300048908 Ga0496105_0001452 Ga0496105_0001452_10702_11691 323
740 3300048908 Ga0496105_0005013 Ga0496105_0005013_3165_4196 323
741 3300048910 Ga0496107_0022185 Ga0496107_0022185_383_1372 323
742 3300048910 Ga0496107_0057330 Ga0496107_0057330_1392_2381 323
743 3300048911 Ga0496108_0001695 Ga0496108_0001695_4001_4990 323
744 3300048912 Ga0496109_0003228 Ga0496109_0003228_2974_3963 323
745 3300048913 Ga0496110_0005612 Ga0496110_0005612_3254_4243 323
746 3300048913 Ga0496110_0231305 Ga0496110_0231305_466_1455 323
747 3300048914 Ga0496111_0010363 Ga0496111_0010363_3575_4564 323
748 3300048914 Ga0496111_0013018 Ga0496111_0013018_2611_3600 323
749 3300048917 Ga0496114_0000184 Ga0496114_0000184_36202_37191 323
750 3300048917 Ga0496114_0000466 Ga0496114_0000466_12188_13177 323
751 3300048918 Ga0496115_0083536 Ga0496115_0083536_840_1829 323
752 3300048922 Ga0496119_0003727 Ga0496119_0003727_10438_11469 323
753 3300048924 Ga0496121_0005891 Ga0496121_0005891_5971_7002 323
754 3300048928 Ga0496125_0013994 Ga0496125_0013994_3552_4583 323
755 3300048929 Ga0496126_0029904 Ga0496126_0029904_2863_3876 323
756 3300049568 Ga0501031_0000445 Ga0501031_0000445_3501_4547 323
757 3300049569 Ga0501032_0000876 Ga0501032_0000876_19263_20309 323
758 3300049570 Ga0501033_0000294 Ga0501033_0000294_4833_5879 323
759 3300049572 Ga0501036_0005562 Ga0501036_0005562_174_1220 323
760 3300049573 Ga0501037_0000378 Ga0501037_0000378_21126_22172 323
761 3300049574 Ga0501038_0000087 Ga0501038_0000087_9010_10056 323
762 3300049575 Ga0501039_0001020 Ga0501039_0001020_14526_15572 323
763 3300049576 Ga0501040_0000007 Ga0501040_0000007_20631_21677 323
764 3300049576 Ga0501040_0017844 Ga0501040_0017844_1355_2401 323
765 3300049577 Ga0501041_0000005 Ga0501041_0000005_58054_59100 323
766 3300049578 Ga0501042_0003216 Ga0501042_0003216_174_1220 323
767 3300049579 Ga0501043_0000998 Ga0501043_0000998_14843_15889 323
768 3300049580 Ga0501046_0001278 Ga0501046_0001278_18356_19402 323
769 3300049581 Ga0501047_0000592 Ga0501047_0000592_18346_19392 323
770 3300049581 Ga0501047_0014482 Ga0501047_0014482_2068_3108 323
771 3300049582 Ga0501048_0000018 Ga0501048_0000018_68692_69738 323
772 3300049584 Ga0501068_0000134 Ga0501068_0000134_19201_20247 323
773 3300049585 Ga0501069_0000426 Ga0501069_0000426_8993_10039 323
774 3300049586 Ga0501070_0004569 Ga0501070_0004569_2924_3970 323
775 3300049587 Ga0501071_0000005 Ga0501071_0000005_68692_69738 323
776 3300049588 Ga0501072_0000269 Ga0501072_0000269_22142_23188 323
777 3300049589 Ga0501073_0001327 Ga0501073_0001327_8205_9251 323
778 3300049590 Ga0501074_0001138 Ga0501074_0001138_11409_12455 323
779 3300049591 Ga0501075_0000009 Ga0501075_0000009_13047_14093 323
780 3300049591 Ga0501075_0062138 Ga0501075_0062138_1078_2124 323
781 3300049592 Ga0501076_0000028 Ga0501076_0000028_9010_10056 323
782 3300049593 Ga0501077_0000006 Ga0501077_0000006_42111_43157 323
783 3300049741 Ga0501079_0000881 Ga0501079_0000881_46_1092 323
784 3300049741 Ga0501079_0025921 Ga0501079_0025921_2998_4044 323
785 3300049742 Ga0501080_0000626 Ga0501080_0000626_19263_20309 323
786 3300049743 Ga0501081_0000003 Ga0501081_0000003_22142_23188 323
787 3300049744 Ga0501083_0001673 Ga0501083_0001673_10019_11065 323
788 3300049822 Ga0501035_0000175 Ga0501035_0000175_9010_10056 323
789 3300049823 Ga0501044_0006303 Ga0501044_0006303_4057_5103 323
790 3300049823 Ga0501044_0101327 Ga0501044_0101327_495_1535 323
791 3300049824 Ga0501045_0000009 Ga0501045_0000009_20630_21676 323
792 3300050492 nmdc:mga0yw44_110719_c1 nmdc:mga0yw44_110719_c1_235_1266 323
793 3300050494 nmdc:mga06z11_159774_c1 nmdc:mga06z11_159774_c1_241_1272 323
794 3300050509 nmdc:mga0qj67_76093_c1 nmdc:mga0qj67_76093_c1_224_1216 323
795 3300053084 Ga0495595_0013656 Ga0495595_0013656_1693_2691 323
796 3300054114 Ga0501084_0005874 Ga0501084_0005874_9010_10056 323
797 3300060353 Ga0501082_0000063 Ga0501082_0000063_58851_59897 323
798 3300060353 Ga0501082_0195502 Ga0501082_0195502_426_1472 323
799 3300061734 Ga0530510_0000014 Ga0530510_0000014_84218_85264 323
800 3300005439 Ga0070711_100322332 Ga0070711_1003223322 324
801 3300006038 Ga0075365_10023969 Ga0075365_100239694 324
802 3300025915 Ga0207693_10271474 Ga0207693_102714742 324
803 3300031548 Ga0307408_100239143 Ga0307408_1002391433 324
804 3300031901 Ga0307406_10027082 Ga0307406_100270824 324
805 3300031903 Ga0307407_10048327 Ga0307407_100483271 324
806 3300032002 Ga0307416_100020572 Ga0307416_1000205726 324
807 3300032002 Ga0307416_100185584 Ga0307416_1001855842 324
808 3300032004 Ga0307414_10113428 Ga0307414_101134283 324
809 3300037312 Ga0395899_0145260 Ga0395899_0145260_92_1093 324
810 3300037418 Ga0395900_0003557 Ga0395900_0003557_9720_10721 324
811 3300037418 Ga0395900_0010351 Ga0395900_0010351_5789_6790 324
812 3300037466 Ga0395898_0011171 Ga0395898_0011171_2450_3451 324
813 3300037471 Ga0395905_0010800 Ga0395905_0010800_1131_2132 324
814 3300037471 Ga0395905_0046007 Ga0395905_0046007_1030_2031 324
815 3300038443 Ga0395901_0032816 Ga0395901_0032816_2665_3666 324
816 3300038443 Ga0395901_0064884 Ga0395901_0064884_2248_3249 324
817 3300048905 Ga0496102_0044639 Ga0496102_0044639_2190_3176 324
818 3300048906 Ga0496103_0146001 Ga0496103_0146001_353_1339 324
819 3300048907 Ga0496104_0086342 Ga0496104_0086342_876_1862 324
820 3300048908 Ga0496105_0006590 Ga0496105_0006590_826_1812 324
821 3300048908 Ga0496105_0264236 Ga0496105_0264236_298_1293 324
822 3300048910 Ga0496107_0106160 Ga0496107_0106160_245_1231 324
823 3300048911 Ga0496108_0002798 Ga0496108_0002798_12198_13184 324
824 3300048912 Ga0496109_0412684 Ga0496109_0412684_41_1033 324
825 3300048915 Ga0496112_0001529 Ga0496112_0001529_925_1911 324
826 3300048916 Ga0496113_0046175 Ga0496113_0046175_1672_2658 324
827 3300048917 Ga0496114_0060025 Ga0496114_0060025_1533_2522 324
828 3300048917 Ga0496114_0071057 Ga0496114_0071057_1178_2164 324
829 3300048918 Ga0496115_0036943 Ga0496115_0036943_2049_3035 324
830 3300048919 Ga0496116_0000780 Ga0496116_0000780_9386_10420 324
831 3300048922 Ga0496119_0004215 Ga0496119_0004215_9367_10401 324
832 3300048924 Ga0496121_0016585 Ga0496121_0016585_4381_5400 324
833 3300049569 Ga0501032_0192763 Ga0501032_0192763_166_1200 324
834 3300049592 Ga0501076_0170136 Ga0501076_0170136_702_1703 324
835 3300059421 Ga0590071_011163 Ga0590071_011163_566_1555 324
836 3300059424 Ga0590075_003699 Ga0590075_003699_567_1556 324
837 3300005467 Ga0070706_100066121 Ga0070706_1000661213 325
838 3300005471 Ga0070698_100001638 Ga0070698_1000016386 325
839 3300005471 Ga0070698_100024518 Ga0070698_1000245182 325
840 3300005937 Ga0081455_10008830 Ga0081455_100088303 325
841 3300005985 Ga0081539_10060633 Ga0081539_100606332 325
842 3300006028 Ga0070717_10096537 Ga0070717_100965372 325
843 3300006847 Ga0075431_100152117 Ga0075431_1001521172 325
844 3300006871 Ga0075434_100007144 Ga0075434_1000071444 325
845 3300009147 Ga0114129_10001119 Ga0114129_1000111917 325
846 3300009147 Ga0114129_10029378 Ga0114129_100293784 325
847 3300037418 Ga0395900_0004073 Ga0395900_0004073_13308_14297 325
848 3300037418 Ga0395900_0094819 Ga0395900_0094819_893_1894 325
849 3300037466 Ga0395898_0001604 Ga0395898_0001604_25576_26565 325
850 3300037471 Ga0395905_0032416 Ga0395905_0032416_3635_4624 325
851 3300038443 Ga0395901_0002643 Ga0395901_0002643_15488_16477 325
852 3300046664 Ga0495659_0006884 Ga0495659_0006884_1033_2025 325
853 3300050507 nmdc:mga05p37_116658_c1 nmdc:mga05p37_116658_c1_2230_3222 325
854 3300050507 nmdc:mga05p37_8447_c1 nmdc:mga05p37_8447_c1_2432_3427 325
855 3300050512 nmdc:mga0n895_204409_c1 nmdc:mga0n895_204409_c1_381_1376 325
856 3300050513 nmdc:mga0rr50_2782_c1 nmdc:mga0rr50_2782_c1_147_1142 325
857 3300050514 nmdc:mga08x19_62434_c1 nmdc:mga08x19_62434_c1_229_1224 325
858 3300003373 JGI25407J50210_10002731 JGI25407J50210_100027314 326
859 3300003373 JGI25407J50210_10003431 JGI25407J50210_100034312 326
860 3300005339 Ga0070660_100065384 Ga0070660_1000653843 326
861 3300005340 Ga0070689_100057873 Ga0070689_1000578732 326
862 3300005367 Ga0070667_100087275 Ga0070667_1000872752 326
863 3300005434 Ga0070709_10007649 Ga0070709_100076492 326
864 3300005437 Ga0070710_10029625 Ga0070710_100296252 326
865 3300005441 Ga0070700_100021145 Ga0070700_1000211452 326
866 3300005455 Ga0070663_100032323 Ga0070663_1000323232 326
867 3300005456 Ga0070678_100007594 Ga0070678_1000075946 326
868 3300005466 Ga0070685_10045930 Ga0070685_100459302 326
869 3300005467 Ga0070706_100004949 Ga0070706_10000494914 326
870 3300005468 Ga0070707_100001551 Ga0070707_10000155122 326
871 3300005471 Ga0070698_100084562 Ga0070698_1000845623 326
872 3300005518 Ga0070699_100017223 Ga0070699_1000172237 326
873 3300005549 Ga0070704_100076925 Ga0070704_1000769252 326
874 3300005614 Ga0068856_100042442 Ga0068856_1000424424 326
875 3300005615 Ga0070702_100010715 Ga0070702_1000107153 326
876 3300005618 Ga0068864_100345034 Ga0068864_1003450342 326
877 3300005937 Ga0081455_10068826 Ga0081455_100688263 326
878 3300005981 Ga0081538_10000297 Ga0081538_1000029734 326
879 3300005981 Ga0081538_10000502 Ga0081538_1000050223 326
880 3300005981 Ga0081538_10000925 Ga0081538_1000092529 326
881 3300005981 Ga0081538_10008148 Ga0081538_100081484 326
882 3300005981 Ga0081538_10018371 Ga0081538_100183716 326
883 3300006038 Ga0075365_10016179 Ga0075365_100161796 326
884 3300006163 Ga0070715_10022486 Ga0070715_100224862 326
885 3300006237 Ga0097621_100024560 Ga0097621_1000245604 326
886 3300006358 Ga0068871_100027672 Ga0068871_1000276722 326
887 3300006846 Ga0075430_100077997 Ga0075430_1000779973 326
888 3300006847 Ga0075431_100045347 Ga0075431_1000453476 326
889 3300006880 Ga0075429_100007313 Ga0075429_1000073135 326
890 3300009098 Ga0105245_10060054 Ga0105245_100600542 326
891 3300009148 Ga0105243_10074340 Ga0105243_100743402 326
892 3300009177 Ga0105248_10083797 Ga0105248_100837975 326
893 3300009551 Ga0105238_10249005 Ga0105238_102490052 326
894 3300009553 Ga0105249_10011189 Ga0105249_100111893 326
895 3300010375 Ga0105239_10006331 Ga0105239_1000633113 326
896 3300013296 Ga0157374_10006829 Ga0157374_100068298 326
897 3300013308 Ga0157375_10010359 Ga0157375_100103594 326
898 3300014745 Ga0157377_10005388 Ga0157377_100053884 326
899 3300014969 Ga0157376_10047691 Ga0157376_100476913 326
900 3300025899 Ga0207642_10014374 Ga0207642_100143742 326
901 3300025906 Ga0207699_10027383 Ga0207699_100273833 326
902 3300025915 Ga0207693_10001551 Ga0207693_100015516 326
903 3300025916 Ga0207663_10108944 Ga0207663_101089442 326
904 3300025919 Ga0207657_10014368 Ga0207657_100143687 326
905 3300025922 Ga0207646_10009623 Ga0207646_100096234 326
906 3300025927 Ga0207687_10161060 Ga0207687_101610602 326
907 3300025938 Ga0207704_10008706 Ga0207704_100087062 326
908 3300025940 Ga0207691_10018612 Ga0207691_100186123 326
909 3300025941 Ga0207711_10134064 Ga0207711_101340643 326
910 3300026023 Ga0207677_10018809 Ga0207677_100188093 326
911 3300026067 Ga0207678_10025503 Ga0207678_100255033 326
912 3300026075 Ga0207708_10000757 Ga0207708_1000075725 326
913 3300026089 Ga0207648_10026646 Ga0207648_100266464 326
914 3300026095 Ga0207676_10080307 Ga0207676_100803072 326
915 3300026121 Ga0207683_10000740 Ga0207683_1000074022 326
916 3300028379 Ga0268266_10027948 Ga0268266_100279482 326
917 3300035725 Ga0373947_0036675 Ga0373947_0036675_1498_2502 326
918 3300037068 Ga0373925_0085421 Ga0373925_0085421_654_1658 326
919 3300037466 Ga0395898_0009405 Ga0395898_0009405_3667_4677 326
920 3300037466 Ga0395898_0115528 Ga0395898_0115528_828_1832 326
921 3300037471 Ga0395905_0001761 Ga0395905_0001761_17255_18265 326
922 3300037471 Ga0395905_0171259 Ga0395905_0171259_765_1769 326
923 3300038443 Ga0395901_0001597 Ga0395901_0001597_17639_18649 326
924 3300041512 Ga0451853_2357732 Ga0451853_2357732_13_1020 326
925 3300046455 Ga0495603_0133104 Ga0495603_0133104_89_1093 326
926 3300046455 Ga0495603_0181746 Ga0495603_0181746_101_1108 326
927 3300046473 Ga0495582_0027982 Ga0495582_0027982_688_1692 326
928 3300046473 Ga0495582_0038899 Ga0495582_0038899_353_1357 326
929 3300046475 Ga0495639_0047772 Ga0495639_0047772_61_1065 326
930 3300046491 Ga0495584_0028330 Ga0495584_0028330_510_1517 326
931 3300046499 Ga0495594_0021620 Ga0495594_0021620_2235_3239 326
932 3300046674 Ga0495588_0058425 Ga0495588_0058425_844_1848 326
933 3300046692 Ga0495671_0059350 Ga0495671_0059350_480_1487 326
934 3300047315 Ga0495581_0000983 Ga0495581_0000983_12201_13205 326
935 3300047321 Ga0495676_0005250 Ga0495676_0005250_4886_5890 326
936 3300047321 Ga0495676_0078076 Ga0495676_0078076_1209_2213 326
937 3300048904 Ga0496101_0032186 Ga0496101_0032186_1822_2826 326
938 3300048905 Ga0496102_0042632 Ga0496102_0042632_1475_2479 326
939 3300048906 Ga0496103_0002323 Ga0496103_0002323_1214_2218 326
940 3300048907 Ga0496104_0167800 Ga0496104_0167800_119_1126 326
941 3300048908 Ga0496105_0117228 Ga0496105_0117228_1113_2117 326
942 3300048912 Ga0496109_0002720 Ga0496109_0002720_1134_2141 326
943 3300048912 Ga0496109_0035376 Ga0496109_0035376_2982_3986 326
944 3300048913 Ga0496110_0020938 Ga0496110_0020938_1480_2487 326
945 3300048914 Ga0496111_0002628 Ga0496111_0002628_590_1597 326
946 3300048915 Ga0496112_0046356 Ga0496112_0046356_2863_3867 326
947 3300048916 Ga0496113_0121550 Ga0496113_0121550_905_1912 326
948 3300048917 Ga0496114_0001692 Ga0496114_0001692_13418_14422 326
949 3300048917 Ga0496114_0072956 Ga0496114_0072956_94_1101 326
950 3300049568 Ga0501031_0140303 Ga0501031_0140303_120_1118 326
951 3300049570 Ga0501033_0215408 Ga0501033_0215408_55_1053 326
952 3300049572 Ga0501036_0012995 Ga0501036_0012995_1785_2783 326
953 3300049572 Ga0501036_0183971 Ga0501036_0183971_631_1629 326
954 3300049574 Ga0501038_0132419 Ga0501038_0132419_10_1008 326
955 3300049575 Ga0501039_0103067 Ga0501039_0103067_1140_2138 326
956 3300049575 Ga0501039_0139021 Ga0501039_0139021_741_1736 326
957 3300049576 Ga0501040_0006120 Ga0501040_0006120_3387_4385 326
958 3300049576 Ga0501040_0040161 Ga0501040_0040161_797_1795 326
959 3300049577 Ga0501041_0002281 Ga0501041_0002281_9670_10668 326
960 3300049578 Ga0501042_0034208 Ga0501042_0034208_913_1911 326
961 3300049580 Ga0501046_0017453 Ga0501046_0017453_2478_3476 326
962 3300049582 Ga0501048_0011634 Ga0501048_0011634_757_1755 326
963 3300049587 Ga0501071_0019490 Ga0501071_0019490_3562_4560 326
964 3300049587 Ga0501071_0039336 Ga0501071_0039336_1738_2736 326
965 3300049588 Ga0501072_0012028 Ga0501072_0012028_4523_5521 326
966 3300049588 Ga0501072_0038239 Ga0501072_0038239_1041_2039 326
967 3300049590 Ga0501074_0161055 Ga0501074_0161055_304_1296 326
968 3300049590 Ga0501074_0164036 Ga0501074_0164036_406_1404 326
969 3300049592 Ga0501076_0004133 Ga0501076_0004133_6991_7989 326
970 3300049592 Ga0501076_0036691 Ga0501076_0036691_368_1366 326
971 3300049593 Ga0501077_0020007 Ga0501077_0020007_3008_4006 326
972 3300049593 Ga0501077_0036690 Ga0501077_0036690_1429_2427 326
973 3300049741 Ga0501079_0003399 Ga0501079_0003399_6693_7691 326
974 3300049741 Ga0501079_0050832 Ga0501079_0050832_1561_2559 326
975 3300049741 Ga0501079_0133505 Ga0501079_0133505_858_1850 326
976 3300049743 Ga0501081_0001137 Ga0501081_0001137_2769_3767 326
977 3300049822 Ga0501035_0068212 Ga0501035_0068212_1756_2754 326
978 3300049824 Ga0501045_0002370 Ga0501045_0002370_9709_10707 326
979 3300049824 Ga0501045_0056157 Ga0501045_0056157_291_1289 326
980 3300050508 nmdc:mga09592_1116_c1 nmdc:mga09592_1116_c1_5580_6572 326
981 3300050509 nmdc:mga0qj67_9898_c1 nmdc:mga0qj67_9898_c1_4534_5526 326
982 3300054114 Ga0501084_0050734 Ga0501084_0050734_1065_2063 326
983 3300060353 Ga0501082_0042607 Ga0501082_0042607_367_1365 326
984 3300060353 Ga0501082_0047272 Ga0501082_0047272_1848_2846 326
985 3300061734 Ga0530510_0014247 Ga0530510_0014247_370_1368 326
986 3300061734 Ga0530510_0031133 Ga0530510_0031133_978_1976 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

186

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

104

220

0.84

PF13732

DUF4162

Domain of unknown function (DUF4162)

240

328

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9466 6 229
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9436 6 227
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9428 5 229
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.9386 7 227
8hpr-assembly1.cif.gz_C lpqy-sugabc in state 4 0.9369 7 227
ID Description Score Start End Superfamily
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9828 4 231 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9793 2 229 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 4 229 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 7 231 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 7 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9817 7 226 GO:0005524
GO:0016887
AF-A0A1D2R6P7-F1-model_v4 ABC transporter domain-containing protein 0.9782 7 230 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9781 7 230 GO:0005524
GO:0016887
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9742 7 222 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A4Q7PN08-F1-model_v4 deleted 0.9733 6 229

Feature Viewer

pLDDT pTM Quality
91.43 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map