F487512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 985 | 384 | 1970 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300053111|Ga0500572_013913|Ga0500572_013913_15_1196 |
| Length | 393 |
| Sequence | MRHHSDDRDALAETAVICVFPQTTRQVARAVTAITLDLVTLVDLGLPTMPGTTPVDNTVPRPDSPLLVDQFGRVARDLRVSLTDRCNLRCTYCMPAEGLDWLPSPELLSDDELIRLLRVAVADLGVTNVRFTGGEPLLRRGLVDIVAATAALRPRPRISMTTNGIGLARRAEALADAGLDRVNVSLDTLRSNRFVEIARRDRLSDVLNGLAAARAAGLSPVKVNAVLLRGVNDDEAAGLLRFCVQNGYHLRFIEQMPLDPQHGWHRASLVTADEILTMLHKEFDLTPSETPRGSAPAERWLVDGGPAQVGVIGSVTRPFCADCDRSRLTADGQMRNCLFSQTETDLRGPLRAGAGDDELAGTWRAGTWTKLAGHRINDAGFAQPIRPMSAIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 2 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 88 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 163 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 164 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 165 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 180 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 342 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 346 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 347 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 348 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 349 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 350 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 351 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 352 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 353 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 354 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 355 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 356 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 357 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 358 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 359 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 360 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 361 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 362 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 363 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 364 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 365 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 366 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 367 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 368 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 369 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 370 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 371 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 372 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 373 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 374 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 375 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 376 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 377 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 378 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 379 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 380 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 381 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 382 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 383 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 384 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.92 |
| Metatranscriptomes | 0.91 |
| Isolates | 4.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.54 |
| Nodule | 0 |
| Rhizoplane | 4.87 |
| Rhizosphere | 85.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500572_013913 | 3300053111 | Bacteria | 2001 |
| 2 | Ga0006562J51391_1065946 | 3300003578 | Bacteria | 1640 |
| 3 | Ga0070683_100032402 | 3300005329 | Bacteria | 4759 |
| 4 | Ga0070683_100082859 | 3300005329 | Bacteria | 3004 |
| 5 | Ga0070690_100350394 | 3300005330 | Bacteria | 1071 |
| 6 | Ga0068869_100020459 | 3300005334 | Bacteria | 4537 |
| 7 | Ga0068869_100063944 | 3300005334 | Bacteria | 2705 |
| 8 | Ga0070666_10041765 | 3300005335 | Bacteria | 3065 |
| 9 | Ga0070680_100147309 | 3300005336 | Bacteria | 1976 |
| 10 | Ga0070682_100050527 | 3300005337 | Bacteria | 2596 |
| 11 | Ga0070682_100095390 | 3300005337 | Bacteria | 1953 |
| 12 | Ga0068868_100225971 | 3300005338 | Bacteria | 1569 |
| 13 | Ga0068868_100276552 | 3300005338 | Bacteria | 1420 |
| 14 | Ga0070689_100175330 | 3300005340 | Bacteria | 1739 |
| 15 | Ga0070687_100007051 | 3300005343 | Bacteria | 4650 |
| 16 | Ga0070661_100060301 | 3300005344 | Bacteria | 2784 |
| 17 | Ga0070661_100070263 | 3300005344 | Bacteria | 2575 |
| 18 | Ga0070668_100075083 | 3300005347 | Bacteria | 2638 |
| 19 | Ga0070668_100087917 | 3300005347 | Bacteria | 2446 |
| 20 | Ga0070669_100119215 | 3300005353 | Bacteria | 2011 |
| 21 | Ga0070675_100061776 | 3300005354 | Bacteria | 3094 |
| 22 | Ga0070671_100002762 | 3300005355 | Bacteria | 13632 |
| 23 | Ga0070673_100099206 | 3300005364 | Bacteria | 2395 |
| 24 | Ga0070673_100301505 | 3300005364 | Bacteria | 1411 |
| 25 | Ga0070709_10000127 | 3300005434 | Bacteria | 50350 |
| 26 | Ga0070709_10000306 | 3300005434 | Bacteria | 31025 |
| 27 | Ga0070709_10033374 | 3300005434 | Bacteria | 3112 |
| 28 | Ga0070709_10065967 | 3300005434 | Bacteria | 2320 |
| 29 | Ga0070709_10232543 | 3300005434 | Bacteria | 1320 |
| 30 | Ga0070714_100001423 | 3300005435 | Bacteria | 17383 |
| 31 | Ga0070714_100004430 | 3300005435 | Bacteria | 10569 |
| 32 | Ga0070714_100006087 | 3300005435 | Bacteria | 9268 |
| 33 | Ga0070714_100031980 | 3300005435 | Bacteria | 4393 |
| 34 | Ga0070714_100052519 | 3300005435 | Bacteria | 3476 |
| 35 | Ga0070714_100106131 | 3300005435 | Bacteria | 2481 |
| 36 | Ga0070714_100165938 | 3300005435 | Bacteria | 2001 |
| 37 | Ga0070714_100176271 | 3300005435 | Bacteria | 1943 |
| 38 | Ga0070714_100203388 | 3300005435 | Bacteria | 1812 |
| 39 | Ga0070714_100237441 | 3300005435 | Bacteria | 1681 |
| 40 | Ga0070714_100274434 | 3300005435 | Bacteria | 1564 |
| 41 | Ga0070714_100377148 | 3300005435 | Bacteria | 1336 |
| 42 | Ga0070713_100002458 | 3300005436 | Bacteria | 12098 |
| 43 | Ga0070713_100004485 | 3300005436 | Bacteria | 9386 |
| 44 | Ga0070713_100017290 | 3300005436 | Bacteria | 5450 |
| 45 | Ga0070713_100017870 | 3300005436 | Bacteria | 5378 |
| 46 | Ga0070713_100068179 | 3300005436 | Bacteria | 2997 |
| 47 | Ga0070713_100124013 | 3300005436 | Bacteria | 2269 |
| 48 | Ga0070713_100227770 | 3300005436 | Bacteria | 1693 |
| 49 | Ga0070713_100309530 | 3300005436 | Bacteria | 1456 |
| 50 | Ga0070710_10000263 | 3300005437 | Bacteria | 25012 |
| 51 | Ga0070710_10000784 | 3300005437 | Bacteria | 15212 |
| 52 | Ga0070710_10003125 | 3300005437 | Bacteria | 7843 |
| 53 | Ga0070710_10036614 | 3300005437 | Bacteria | 2683 |
| 54 | Ga0070710_10156020 | 3300005437 | Bacteria | 1412 |
| 55 | Ga0070711_100000252 | 3300005439 | Bacteria | 27454 |
| 56 | Ga0070711_100002553 | 3300005439 | Bacteria | 10422 |
| 57 | Ga0070711_100054730 | 3300005439 | Bacteria | 2754 |
| 58 | Ga0070711_100075813 | 3300005439 | Bacteria | 2383 |
| 59 | Ga0070711_100287801 | 3300005439 | Bacteria | 1302 |
| 60 | Ga0070700_100126212 | 3300005441 | Bacteria | 1721 |
| 61 | Ga0070694_100057693 | 3300005444 | Bacteria | 2640 |
| 62 | Ga0070708_100002180 | 3300005445 | Bacteria | 15120 |
| 63 | Ga0070708_100010328 | 3300005445 | Bacteria | 7561 |
| 64 | Ga0070708_100055178 | 3300005445 | Bacteria | 3533 |
| 65 | Ga0070708_100145303 | 3300005445 | Bacteria | 2202 |
| 66 | Ga0070708_100178759 | 3300005445 | Bacteria | 1983 |
| 67 | Ga0070663_100158772 | 3300005455 | Bacteria | 1739 |
| 68 | Ga0070678_100272595 | 3300005456 | Bacteria | 1428 |
| 69 | Ga0070678_100363272 | 3300005456 | Bacteria | 1248 |
| 70 | Ga0070678_100441291 | 3300005456 | Bacteria | 1138 |
| 71 | Ga0070662_100040046 | 3300005457 | Bacteria | 3335 |
| 72 | Ga0070662_100073351 | 3300005457 | Bacteria | 2528 |
| 73 | Ga0070681_10023995 | 3300005458 | Bacteria | 6140 |
| 74 | Ga0070681_10086981 | 3300005458 | Bacteria | 3079 |
| 75 | Ga0070681_10100248 | 3300005458 | Bacteria | 2842 |
| 76 | Ga0070685_10065305 | 3300005466 | Bacteria | 2141 |
| 77 | Ga0070706_100001269 | 3300005467 | Bacteria | 26954 |
| 78 | Ga0070706_100003695 | 3300005467 | Bacteria | 14971 |
| 79 | Ga0070706_100005270 | 3300005467 | Bacteria | 12334 |
| 80 | Ga0070706_100006080 | 3300005467 | Bacteria | 11410 |
| 81 | Ga0070706_100024878 | 3300005467 | Bacteria | 5512 |
| 82 | Ga0070706_100025642 | 3300005467 | Bacteria | 5426 |
| 83 | Ga0070706_100043482 | 3300005467 | Bacteria | 4151 |
| 84 | Ga0070706_100047100 | 3300005467 | Bacteria | 3978 |
| 85 | Ga0070706_100063667 | 3300005467 | Bacteria | 3408 |
| 86 | Ga0070706_100164173 | 3300005467 | Bacteria | 2074 |
| 87 | Ga0070706_100297534 | 3300005467 | Bacteria | 1506 |
| 88 | Ga0070707_100000297 | 3300005468 | Bacteria | 48412 |
| 89 | Ga0070707_100001249 | 3300005468 | Bacteria | 24989 |
| 90 | Ga0070707_100003076 | 3300005468 | Bacteria | 15801 |
| 91 | Ga0070707_100005280 | 3300005468 | Bacteria | 12092 |
| 92 | Ga0070707_100012369 | 3300005468 | Bacteria | 7969 |
| 93 | Ga0070707_100056602 | 3300005468 | Bacteria | 3761 |
| 94 | Ga0070707_100100560 | 3300005468 | Bacteria | 2801 |
| 95 | Ga0070707_100227186 | 3300005468 | Bacteria | 1818 |
| 96 | Ga0070707_100248012 | 3300005468 | Bacteria | 1733 |
| 97 | Ga0070698_100000013 | 3300005471 | Bacteria | 114652 |
| 98 | Ga0070698_100002204 | 3300005471 | Bacteria | 21610 |
| 99 | Ga0070698_100009265 | 3300005471 | Bacteria | 10562 |
| 100 | Ga0070698_100009780 | 3300005471 | Bacteria | 10253 |
| 101 | Ga0070698_100010926 | 3300005471 | Bacteria | 9659 |
| 102 | Ga0070698_100016085 | 3300005471 | Bacteria | 7898 |
| 103 | Ga0070698_100025636 | 3300005471 | Bacteria | 6143 |
| 104 | Ga0070698_100031009 | 3300005471 | Bacteria | 5543 |
| 105 | Ga0070698_100069327 | 3300005471 | Bacteria | 3541 |
| 106 | Ga0070698_100104395 | 3300005471 | Bacteria | 2804 |
| 107 | Ga0070699_100001713 | 3300005518 | Bacteria | 19993 |
| 108 | Ga0070699_100020728 | 3300005518 | Bacteria | 5670 |
| 109 | Ga0070699_100034432 | 3300005518 | Bacteria | 4377 |
| 110 | Ga0070679_100079829 | 3300005530 | Bacteria | 3261 |
| 111 | Ga0070679_100304959 | 3300005530 | Bacteria | 1543 |
| 112 | Ga0070684_100070799 | 3300005535 | Bacteria | 3069 |
| 113 | Ga0070697_100003247 | 3300005536 | Bacteria | 12482 |
| 114 | Ga0070697_100041739 | 3300005536 | Bacteria | 3714 |
| 115 | Ga0070697_100192188 | 3300005536 | Bacteria | 1733 |
| 116 | Ga0070697_100209838 | 3300005536 | Bacteria | 1658 |
| 117 | Ga0070686_100206095 | 3300005544 | Bacteria | 1413 |
| 118 | Ga0070695_100014384 | 3300005545 | Bacteria | 4769 |
| 119 | Ga0070696_100000771 | 3300005546 | Bacteria | 20574 |
| 120 | Ga0070696_100035391 | 3300005546 | Bacteria | 3438 |
| 121 | Ga0070696_100046225 | 3300005546 | Bacteria | 3017 |
| 122 | Ga0070693_100340476 | 3300005547 | Bacteria | 1023 |
| 123 | Ga0070665_100007588 | 3300005548 | Bacteria | 11031 |
| 124 | Ga0070664_100241291 | 3300005564 | Bacteria | 1622 |
| 125 | Ga0068857_100080817 | 3300005577 | Bacteria | 2902 |
| 126 | Ga0068854_100127389 | 3300005578 | Bacteria | 1940 |
| 127 | Ga0068856_100044842 | 3300005614 | Bacteria | 4352 |
| 128 | Ga0068856_100052050 | 3300005614 | Bacteria | 4037 |
| 129 | Ga0068856_100136980 | 3300005614 | Bacteria | 2454 |
| 130 | Ga0070702_100004766 | 3300005615 | Bacteria | 6232 |
| 131 | Ga0068852_100005686 | 3300005616 | Bacteria | 8943 |
| 132 | Ga0068859_100059451 | 3300005617 | Bacteria | 3850 |
| 133 | Ga0068859_100358782 | 3300005617 | Bacteria | 1552 |
| 134 | Ga0068859_100359565 | 3300005617 | Bacteria | 1551 |
| 135 | Ga0068864_100042320 | 3300005618 | Bacteria | 3898 |
| 136 | Ga0068861_100210450 | 3300005719 | Bacteria | 1638 |
| 137 | Ga0068863_100003224 | 3300005841 | Bacteria | 16160 |
| 138 | Ga0068863_100030365 | 3300005841 | Bacteria | 5162 |
| 139 | Ga0068858_100086267 | 3300005842 | Bacteria | 2920 |
| 140 | Ga0068858_100091945 | 3300005842 | Bacteria | 2824 |
| 141 | Ga0068858_100323981 | 3300005842 | Bacteria | 1473 |
| 142 | Ga0068860_100390729 | 3300005843 | Bacteria | 1375 |
| 143 | Ga0068862_100230634 | 3300005844 | Bacteria | 1679 |
| 144 | Ga0081455_10012980 | 3300005937 | Bacteria | 8262 |
| 145 | Ga0081540_1001190 | 3300005983 | Bacteria | 22780 |
| 146 | Ga0070717_10003955 | 3300006028 | Bacteria | 10667 |
| 147 | Ga0070717_10016529 | 3300006028 | Bacteria | 5721 |
| 148 | Ga0070717_10022951 | 3300006028 | Bacteria | 4937 |
| 149 | Ga0070717_10023037 | 3300006028 | Bacteria | 4928 |
| 150 | Ga0070717_10023164 | 3300006028 | Bacteria | 4916 |
| 151 | Ga0070717_10034725 | 3300006028 | Bacteria | 4078 |
| 152 | Ga0070717_10059391 | 3300006028 | Bacteria | 3164 |
| 153 | Ga0070717_10097677 | 3300006028 | Bacteria | 2489 |
| 154 | Ga0070717_10114193 | 3300006028 | Bacteria | 2307 |
| 155 | Ga0070717_10136410 | 3300006028 | Bacteria | 2113 |
| 156 | Ga0070717_10151329 | 3300006028 | Bacteria | 2008 |
| 157 | Ga0070717_10232254 | 3300006028 | Bacteria | 1624 |
| 158 | Ga0075365_10053204 | 3300006038 | Bacteria | 2681 |
| 159 | Ga0075368_10026267 | 3300006042 | Bacteria | 2240 |
| 160 | Ga0075363_100002499 | 3300006048 | Bacteria | 7529 |
| 161 | Ga0075363_100019518 | 3300006048 | Bacteria | 3390 |
| 162 | Ga0075363_100030927 | 3300006048 | Bacteria | 2773 |
| 163 | Ga0075364_10004881 | 3300006051 | Bacteria | 7768 |
| 164 | Ga0075364_10077088 | 3300006051 | Bacteria | 2200 |
| 165 | Ga0075364_10120586 | 3300006051 | Bacteria | 1755 |
| 166 | Ga0070715_10036193 | 3300006163 | Bacteria | 2035 |
| 167 | Ga0070715_10050123 | 3300006163 | Bacteria | 1791 |
| 168 | Ga0070715_10051996 | 3300006163 | Bacteria | 1766 |
| 169 | Ga0070716_100064061 | 3300006173 | Bacteria | 2136 |
| 170 | Ga0070716_100094245 | 3300006173 | Bacteria | 1820 |
| 171 | Ga0070712_100001201 | 3300006175 | Bacteria | 15656 |
| 172 | Ga0070712_100007373 | 3300006175 | Bacteria | 6862 |
| 173 | Ga0070712_100015306 | 3300006175 | Bacteria | 4935 |
| 174 | Ga0070712_100021738 | 3300006175 | Bacteria | 4218 |
| 175 | Ga0070712_100040505 | 3300006175 | Bacteria | 3194 |
| 176 | Ga0070712_100052821 | 3300006175 | Bacteria | 2836 |
| 177 | Ga0070712_100085619 | 3300006175 | Bacteria | 2295 |
| 178 | Ga0070712_100209151 | 3300006175 | Bacteria | 1537 |
| 179 | Ga0070712_100230914 | 3300006175 | Bacteria | 1469 |
| 180 | Ga0075362_10029091 | 3300006177 | Bacteria | 2378 |
| 181 | Ga0075370_10003064 | 3300006353 | Bacteria | 7884 |
| 182 | Ga0075370_10017806 | 3300006353 | Bacteria | 3843 |
| 183 | Ga0068871_100043860 | 3300006358 | Bacteria | 3594 |
| 184 | Ga0068871_100065625 | 3300006358 | Bacteria | 2973 |
| 185 | Ga0075428_100000550 | 3300006844 | Bacteria | 38346 |
| 186 | Ga0075428_100122267 | 3300006844 | Bacteria | 2834 |
| 187 | Ga0075428_100165936 | 3300006844 | Bacteria | 2395 |
| 188 | Ga0075430_100002143 | 3300006846 | Bacteria | 16333 |
| 189 | Ga0075434_100032282 | 3300006871 | Bacteria | 5163 |
| 190 | Ga0075434_100056501 | 3300006871 | Bacteria | 3900 |
| 191 | Ga0075429_100015835 | 3300006880 | Bacteria | 6530 |
| 192 | Ga0075436_100020862 | 3300006914 | Bacteria | 4494 |
| 193 | Ga0075436_100042357 | 3300006914 | Bacteria | 3140 |
| 194 | Ga0075436_100206092 | 3300006914 | Bacteria | 1393 |
| 195 | Ga0097620_100059443 | 3300006931 | Bacteria | 3850 |
| 196 | Ga0097620_100358777 | 3300006931 | Bacteria | 1552 |
| 197 | Ga0097620_100359553 | 3300006931 | Bacteria | 1551 |
| 198 | Ga0075435_100005579 | 3300007076 | Bacteria | 8809 |
| 199 | Ga0075435_100121226 | 3300007076 | Bacteria | 2182 |
| 200 | Ga0075435_100275625 | 3300007076 | Bacteria | 1435 |
| 201 | Ga0099795_10108310 | 3300007788 | Bacteria | 1098 |
| 202 | Ga0111539_10042869 | 3300009094 | Bacteria | 5430 |
| 203 | Ga0111539_10267592 | 3300009094 | Bacteria | 1990 |
| 204 | Ga0105245_10025841 | 3300009098 | Bacteria | 5164 |
| 205 | Ga0105247_10004677 | 3300009101 | Bacteria | 8723 |
| 206 | Ga0114129_10000517 | 3300009147 | Bacteria | 47115 |
| 207 | Ga0114129_10203201 | 3300009147 | Bacteria | 2682 |
| 208 | Ga0105243_10024812 | 3300009148 | Bacteria | 4576 |
| 209 | Ga0105243_10060520 | 3300009148 | Bacteria | 3025 |
| 210 | Ga0105237_10003987 | 3300009545 | Bacteria | 17256 |
| 211 | Ga0105237_10176771 | 3300009545 | Bacteria | 2135 |
| 212 | Ga0105238_10106918 | 3300009551 | Bacteria | 2779 |
| 213 | Ga0105249_10034058 | 3300009553 | Bacteria | 4613 |
| 214 | Ga0105239_10003624 | 3300010375 | Bacteria | 18873 |
| 215 | Ga0105239_10145336 | 3300010375 | Bacteria | 2644 |
| 216 | Ga0105246_10036887 | 3300011119 | Bacteria | 3277 |
| 217 | Ga0157340_1000852 | 3300012473 | Bacteria | 1277 |
| 218 | Ga0157342_1001348 | 3300012507 | Bacteria | 1793 |
| 219 | Ga0157371_10011020 | 3300013102 | Bacteria | 7003 |
| 220 | Ga0157370_10014854 | 3300013104 | Bacteria | 7945 |
| 221 | Ga0157370_10261495 | 3300013104 | Bacteria | 1599 |
| 222 | Ga0157370_10364576 | 3300013104 | Bacteria | 1331 |
| 223 | Ga0157369_10019798 | 3300013105 | Bacteria | 7531 |
| 224 | Ga0157374_10115253 | 3300013296 | Bacteria | 2588 |
| 225 | Ga0163162_10106884 | 3300013306 | Bacteria | 2893 |
| 226 | Ga0163162_10314551 | 3300013306 | Bacteria | 1699 |
| 227 | Ga0163163_10012828 | 3300014325 | Bacteria | 7646 |
| 228 | Ga0163163_10318820 | 3300014325 | Bacteria | 1608 |
| 229 | Ga0157377_10004816 | 3300014745 | Bacteria | 6267 |
| 230 | Ga0157379_10023428 | 3300014968 | Bacteria | 5479 |
| 231 | Ga0206349_1282006 | 3300020075 | Bacteria | 1626 |
| 232 | Ga0206351_10133754 | 3300020077 | Bacteria | 1044 |
| 233 | Ga0206354_11275327 | 3300020081 | Bacteria | 1120 |
| 234 | Ga0206354_11425287 | 3300020081 | Bacteria | 1286 |
| 235 | Ga0206353_10577580 | 3300020082 | Bacteria | 1147 |
| 236 | Ga0213876_10003327 | 3300021384 | Bacteria | 9212 |
| 237 | Ga0213875_10000292 | 3300021388 | Bacteria | 48320 |
| 238 | Ga0213875_10008633 | 3300021388 | Bacteria | 5204 |
| 239 | Ga0213875_10023859 | 3300021388 | Bacteria | 2919 |
| 240 | Ga0213875_10085224 | 3300021388 | Bacteria | 1474 |
| 241 | Ga0224712_10027138 | 3300022467 | Bacteria | 2034 |
| 242 | Ga0224712_10031915 | 3300022467 | Bacteria | 1915 |
| 243 | Ga0224572_1005598 | 3300024225 | Bacteria | 2245 |
| 244 | Ga0209051_1015347 | 3300025303 | Bacteria | 3528 |
| 245 | Ga0207692_10001325 | 3300025898 | Bacteria | 9218 |
| 246 | Ga0207692_10005780 | 3300025898 | Bacteria | 4979 |
| 247 | Ga0207692_10010116 | 3300025898 | Bacteria | 3963 |
| 248 | Ga0207692_10011629 | 3300025898 | Bacteria | 3753 |
| 249 | Ga0207692_10025048 | 3300025898 | Bacteria | 2782 |
| 250 | Ga0207692_10125714 | 3300025898 | Bacteria | 1442 |
| 251 | Ga0207642_10019344 | 3300025899 | Bacteria | 2635 |
| 252 | Ga0207710_10002600 | 3300025900 | Bacteria | 8328 |
| 253 | Ga0207688_10017033 | 3300025901 | Bacteria | 3949 |
| 254 | Ga0207688_10058959 | 3300025901 | Bacteria | 2161 |
| 255 | Ga0207685_10000628 | 3300025905 | Bacteria | 6203 |
| 256 | Ga0207685_10003965 | 3300025905 | Bacteria | 3684 |
| 257 | Ga0207699_10000282 | 3300025906 | Bacteria | 27821 |
| 258 | Ga0207699_10000772 | 3300025906 | Bacteria | 15285 |
| 259 | Ga0207699_10004375 | 3300025906 | Bacteria | 6756 |
| 260 | Ga0207699_10026845 | 3300025906 | Bacteria | 3180 |
| 261 | Ga0207699_10046759 | 3300025906 | Bacteria | 2533 |
| 262 | Ga0207699_10072859 | 3300025906 | Bacteria | 2105 |
| 263 | Ga0207643_10016456 | 3300025908 | Bacteria | 4034 |
| 264 | Ga0207705_10054606 | 3300025909 | Bacteria | 2879 |
| 265 | Ga0207684_10000569 | 3300025910 | Bacteria | 44877 |
| 266 | Ga0207684_10001052 | 3300025910 | Bacteria | 30862 |
| 267 | Ga0207684_10003988 | 3300025910 | Bacteria | 14121 |
| 268 | Ga0207684_10011066 | 3300025910 | Bacteria | 7900 |
| 269 | Ga0207684_10012727 | 3300025910 | Bacteria | 7301 |
| 270 | Ga0207684_10015244 | 3300025910 | Bacteria | 6620 |
| 271 | Ga0207684_10057037 | 3300025910 | Bacteria | 3314 |
| 272 | Ga0207684_10220148 | 3300025910 | Bacteria | 1638 |
| 273 | Ga0207684_10224381 | 3300025910 | Bacteria | 1622 |
| 274 | Ga0207684_10255658 | 3300025910 | Bacteria | 1512 |
| 275 | Ga0207707_10253218 | 3300025912 | Bacteria | 1529 |
| 276 | Ga0207695_10234537 | 3300025913 | Bacteria | 1738 |
| 277 | Ga0207671_10064503 | 3300025914 | Bacteria | 2723 |
| 278 | Ga0207693_10002607 | 3300025915 | Bacteria | 15672 |
| 279 | Ga0207693_10037179 | 3300025915 | Bacteria | 3837 |
| 280 | Ga0207693_10039017 | 3300025915 | Bacteria | 3739 |
| 281 | Ga0207693_10043294 | 3300025915 | Bacteria | 3542 |
| 282 | Ga0207693_10051024 | 3300025915 | Bacteria | 3248 |
| 283 | Ga0207693_10107284 | 3300025915 | Bacteria | 2191 |
| 284 | Ga0207663_10009350 | 3300025916 | Bacteria | 5173 |
| 285 | Ga0207663_10044861 | 3300025916 | Bacteria | 2716 |
| 286 | Ga0207663_10102011 | 3300025916 | Bacteria | 1929 |
| 287 | Ga0207663_10396752 | 3300025916 | Bacteria | 1054 |
| 288 | Ga0207662_10039259 | 3300025918 | Bacteria | 2776 |
| 289 | Ga0207657_10017194 | 3300025919 | Bacteria | 6947 |
| 290 | Ga0207657_10270461 | 3300025919 | Bacteria | 1351 |
| 291 | Ga0207652_10022367 | 3300025921 | Bacteria | 5230 |
| 292 | Ga0207646_10000193 | 3300025922 | Bacteria | 83049 |
| 293 | Ga0207646_10002442 | 3300025922 | Bacteria | 21928 |
| 294 | Ga0207646_10009983 | 3300025922 | Bacteria | 9327 |
| 295 | Ga0207646_10015645 | 3300025922 | Bacteria | 7153 |
| 296 | Ga0207646_10017226 | 3300025922 | Bacteria | 6767 |
| 297 | Ga0207646_10018514 | 3300025922 | Bacteria | 6493 |
| 298 | Ga0207646_10046167 | 3300025922 | Bacteria | 3908 |
| 299 | Ga0207646_10046201 | 3300025922 | Bacteria | 3907 |
| 300 | Ga0207646_10081727 | 3300025922 | Bacteria | 2889 |
| 301 | Ga0207646_10111812 | 3300025922 | Bacteria | 2452 |
| 302 | Ga0207646_10242460 | 3300025922 | Bacteria | 1628 |
| 303 | Ga0207700_10000402 | 3300025928 | Bacteria | 25312 |
| 304 | Ga0207700_10000617 | 3300025928 | Bacteria | 20774 |
| 305 | Ga0207700_10006063 | 3300025928 | Bacteria | 7281 |
| 306 | Ga0207700_10013522 | 3300025928 | Bacteria | 5314 |
| 307 | Ga0207700_10135394 | 3300025928 | Bacteria | 2017 |
| 308 | Ga0207700_10217631 | 3300025928 | Bacteria | 1617 |
| 309 | Ga0207700_10276759 | 3300025928 | Bacteria | 1442 |
| 310 | Ga0207664_10000500 | 3300025929 | Bacteria | 27955 |
| 311 | Ga0207664_10001508 | 3300025929 | Bacteria | 15252 |
| 312 | Ga0207664_10004947 | 3300025929 | Bacteria | 9068 |
| 313 | Ga0207664_10011349 | 3300025929 | Bacteria | 6326 |
| 314 | Ga0207664_10012335 | 3300025929 | Bacteria | 6106 |
| 315 | Ga0207664_10030848 | 3300025929 | Bacteria | 4096 |
| 316 | Ga0207664_10070233 | 3300025929 | Bacteria | 2818 |
| 317 | Ga0207664_10097741 | 3300025929 | Bacteria | 2419 |
| 318 | Ga0207664_10120376 | 3300025929 | Bacteria | 2196 |
| 319 | Ga0207664_10137621 | 3300025929 | Bacteria | 2062 |
| 320 | Ga0207664_10332609 | 3300025929 | Bacteria | 1342 |
| 321 | Ga0207644_10019033 | 3300025931 | Bacteria | 4654 |
| 322 | Ga0207706_10022715 | 3300025933 | Bacteria | 5630 |
| 323 | Ga0207706_10089555 | 3300025933 | Bacteria | 2705 |
| 324 | Ga0207686_10018200 | 3300025934 | Bacteria | 3973 |
| 325 | Ga0207709_10123245 | 3300025935 | Bacteria | 1754 |
| 326 | Ga0207665_10001073 | 3300025939 | Bacteria | 18388 |
| 327 | Ga0207665_10024965 | 3300025939 | Bacteria | 3941 |
| 328 | Ga0207665_10027731 | 3300025939 | Bacteria | 3742 |
| 329 | Ga0207691_10032411 | 3300025940 | Bacteria | 4871 |
| 330 | Ga0207689_10012904 | 3300025942 | Bacteria | 7136 |
| 331 | Ga0207661_10005201 | 3300025944 | Bacteria | 9151 |
| 332 | Ga0207661_10117238 | 3300025944 | Bacteria | 2262 |
| 333 | Ga0207661_10265465 | 3300025944 | Bacteria | 1530 |
| 334 | Ga0207661_10318757 | 3300025944 | Bacteria | 1397 |
| 335 | Ga0207679_10128966 | 3300025945 | Bacteria | 2026 |
| 336 | Ga0207651_10155115 | 3300025960 | Bacteria | 1788 |
| 337 | Ga0207668_10023324 | 3300025972 | Bacteria | 3976 |
| 338 | Ga0207668_10113067 | 3300025972 | Bacteria | 2041 |
| 339 | Ga0207658_10084089 | 3300025986 | Bacteria | 2448 |
| 340 | Ga0207677_10045492 | 3300026023 | Bacteria | 2931 |
| 341 | Ga0207703_10136815 | 3300026035 | Bacteria | 2121 |
| 342 | Ga0207639_10152878 | 3300026041 | Bacteria | 1935 |
| 343 | Ga0207678_10000552 | 3300026067 | Bacteria | 34170 |
| 344 | Ga0207678_10012122 | 3300026067 | Bacteria | 7570 |
| 345 | Ga0207708_10016973 | 3300026075 | Bacteria | 5480 |
| 346 | Ga0207702_10192351 | 3300026078 | Bacteria | 1886 |
| 347 | Ga0207702_10245455 | 3300026078 | Bacteria | 1679 |
| 348 | Ga0207702_10487469 | 3300026078 | Bacteria | 1200 |
| 349 | Ga0207641_10002132 | 3300026088 | Bacteria | 18705 |
| 350 | Ga0207641_10040438 | 3300026088 | Bacteria | 3905 |
| 351 | Ga0207641_10091403 | 3300026088 | Bacteria | 2663 |
| 352 | Ga0207641_10243738 | 3300026088 | Bacteria | 1676 |
| 353 | Ga0207641_10272842 | 3300026088 | Bacteria | 1587 |
| 354 | Ga0207648_10069074 | 3300026089 | Bacteria | 3078 |
| 355 | Ga0207676_10203342 | 3300026095 | Bacteria | 1752 |
| 356 | Ga0207674_10004442 | 3300026116 | Bacteria | 16859 |
| 357 | Ga0207674_10195303 | 3300026116 | Bacteria | 1973 |
| 358 | Ga0207675_100022004 | 3300026118 | Bacteria | 5935 |
| 359 | Ga0207675_100033345 | 3300026118 | Bacteria | 4798 |
| 360 | Ga0207683_10002778 | 3300026121 | Bacteria | 15294 |
| 361 | Ga0207683_10368872 | 3300026121 | Bacteria | 1319 |
| 362 | Ga0207428_10039743 | 3300027907 | Bacteria | 3820 |
| 363 | Ga0268266_10012597 | 3300028379 | Bacteria | 7306 |
| 364 | Ga0268264_10004106 | 3300028381 | Bacteria | 12455 |
| 365 | Ga0265337_1000029 | 3300028556 | Bacteria | 66490 |
| 366 | Ga0265326_10002030 | 3300028558 | Bacteria | 6920 |
| 367 | Ga0265319_1005636 | 3300028563 | Bacteria | 5956 |
| 368 | Ga0265334_10001137 | 3300028573 | Bacteria | 12999 |
| 369 | Ga0265318_10069542 | 3300028577 | Bacteria | 1305 |
| 370 | Ga0265323_10014236 | 3300028653 | Bacteria | 3155 |
| 371 | Ga0265336_10020254 | 3300028666 | Bacteria | 2136 |
| 372 | Ga0265338_10000175 | 3300028800 | Bacteria | 118915 |
| 373 | Ga0265338_10000436 | 3300028800 | Bacteria | 75054 |
| 374 | Ga0265338_10004964 | 3300028800 | Bacteria | 17622 |
| 375 | Ga0265338_10005981 | 3300028800 | Bacteria | 15651 |
| 376 | Ga0265324_10005049 | 3300029957 | Bacteria | 5786 |
| 377 | Ga0316177_1003448 | 3300030731 | Bacteria | 1270 |
| 378 | Ga0316176_1024211 | 3300030732 | Bacteria | 2839 |
| 379 | Ga0314311_1157289 | 3300030733 | Bacteria | 3577 |
| 380 | Ga0316180_1036232 | 3300030736 | Bacteria | 3444 |
| 381 | Ga0265332_10048359 | 3300031238 | Bacteria | 1829 |
| 382 | Ga0265320_10005394 | 3300031240 | Bacteria | 8219 |
| 383 | Ga0265325_10005263 | 3300031241 | Bacteria | 8030 |
| 384 | Ga0265340_10003762 | 3300031247 | Bacteria | 8540 |
| 385 | Ga0265339_10008916 | 3300031249 | Bacteria | 6348 |
| 386 | Ga0265327_10000246 | 3300031251 | Bacteria | 107698 |
| 387 | Ga0265316_10012850 | 3300031344 | Bacteria | 7477 |
| 388 | Ga0307509_10053096 | 3300031507 | Bacteria | 4324 |
| 389 | Ga0307408_100156669 | 3300031548 | Bacteria | 1804 |
| 390 | Ga0265313_10006156 | 3300031595 | Bacteria | 8606 |
| 391 | Ga0265314_10045687 | 3300031711 | Bacteria | 3094 |
| 392 | Ga0265342_10056556 | 3300031712 | Bacteria | 2324 |
| 393 | Ga0316578_10053577 | 3300031728 | Bacteria | 2364 |
| 394 | Ga0316214_1005685 | 3300033545 | Bacteria | 1639 |
| 395 | Ga0373948_0003623 | 3300034817 | Bacteria | 2389 |
| 396 | Ga0373926_0000298 | 3300035083 | Bacteria | 12232 |
| 397 | Ga0373926_0001951 | 3300035083 | Bacteria | 6459 |
| 398 | Ga0373926_0053127 | 3300035083 | Bacteria | 1465 |
| 399 | Ga0373934_0000127 | 3300035086 | Bacteria | 27874 |
| 400 | Ga0373934_0000666 | 3300035086 | Bacteria | 12167 |
| 401 | Ga0373934_0027350 | 3300035086 | Bacteria | 2215 |
| 402 | Ga0373934_0041259 | 3300035086 | Bacteria | 1821 |
| 403 | Ga0373934_0060239 | 3300035086 | Bacteria | 1511 |
| 404 | Ga0373940_0004432 | 3300035088 | Bacteria | 2966 |
| 405 | Ga0373940_0007303 | 3300035088 | Bacteria | 2489 |
| 406 | Ga0373949_0008783 | 3300035090 | Bacteria | 2211 |
| 407 | Ga0373923_0000778 | 3300035111 | Bacteria | 8296 |
| 408 | Ga0373923_0023180 | 3300035111 | Bacteria | 2440 |
| 409 | Ga0373923_0043236 | 3300035111 | Bacteria | 1864 |
| 410 | Ga0373923_0058186 | 3300035111 | Bacteria | 1636 |
| 411 | Ga0373923_0082047 | 3300035111 | Bacteria | 1400 |
| 412 | Ga0373932_0027270 | 3300035112 | Bacteria | 1561 |
| 413 | Ga0373936_0000200 | 3300035113 | Bacteria | 19968 |
| 414 | Ga0373936_0003669 | 3300035113 | Bacteria | 5762 |
| 415 | Ga0373936_0005680 | 3300035113 | Bacteria | 4704 |
| 416 | Ga0373939_0084863 | 3300035114 | Bacteria | 1059 |
| 417 | Ga0373941_0056713 | 3300035115 | Bacteria | 1262 |
| 418 | Ga0373945_0000615 | 3300035116 | Bacteria | 10245 |
| 419 | Ga0373945_0022029 | 3300035116 | Bacteria | 2192 |
| 420 | Ga0373953_0001228 | 3300035117 | Bacteria | 7308 |
| 421 | Ga0373953_0001345 | 3300035117 | Bacteria | 7069 |
| 422 | Ga0373953_0005883 | 3300035117 | Bacteria | 4007 |
| 423 | Ga0373953_0010326 | 3300035117 | Bacteria | 3246 |
| 424 | Ga0373953_0023360 | 3300035117 | Bacteria | 2340 |
| 425 | Ga0373953_0116948 | 3300035117 | Bacteria | 1131 |
| 426 | Ga0373954_0004112 | 3300035118 | Bacteria | 6237 |
| 427 | Ga0373954_0070300 | 3300035118 | Bacteria | 1663 |
| 428 | Ga0373954_0105597 | 3300035118 | Bacteria | 1360 |
| 429 | Ga0373954_0109196 | 3300035118 | Bacteria | 1337 |
| 430 | Ga0373954_0198131 | 3300035118 | Bacteria | 986 |
| 431 | Ga0373956_0005048 | 3300035119 | Bacteria | 5288 |
| 432 | Ga0373956_0007016 | 3300035119 | Bacteria | 4528 |
| 433 | Ga0373956_0015390 | 3300035119 | Bacteria | 3202 |
| 434 | Ga0373956_0018019 | 3300035119 | Bacteria | 2987 |
| 435 | Ga0373956_0023777 | 3300035119 | Bacteria | 2633 |
| 436 | Ga0373957_0000382 | 3300035120 | Bacteria | 11207 |
| 437 | Ga0373957_0001217 | 3300035120 | Bacteria | 6870 |
| 438 | Ga0373957_0005940 | 3300035120 | Bacteria | 3818 |
| 439 | Ga0373957_0018173 | 3300035120 | Bacteria | 2458 |
| 440 | Ga0373957_0028488 | 3300035120 | Bacteria | 2035 |
| 441 | Ga0373943_0001122 | 3300035170 | Bacteria | 11970 |
| 442 | Ga0373943_0005113 | 3300035170 | Bacteria | 5904 |
| 443 | Ga0373943_0028916 | 3300035170 | Bacteria | 2615 |
| 444 | Ga0373943_0153787 | 3300035170 | Bacteria | 1248 |
| 445 | Ga0373943_0193654 | 3300035170 | Bacteria | 1122 |
| 446 | Ga0373946_0000133 | 3300035171 | Bacteria | 22295 |
| 447 | Ga0373946_0000657 | 3300035171 | Bacteria | 11584 |
| 448 | Ga0373946_0022631 | 3300035171 | Bacteria | 2448 |
| 449 | Ga0373955_0000104 | 3300035172 | Bacteria | 33710 |
| 450 | Ga0373955_0002558 | 3300035172 | Bacteria | 7956 |
| 451 | Ga0373955_0003003 | 3300035172 | Bacteria | 7392 |
| 452 | Ga0373955_0019613 | 3300035172 | Bacteria | 3383 |
| 453 | Ga0373955_0021614 | 3300035172 | Bacteria | 3251 |
| 454 | Ga0373955_0037185 | 3300035172 | Bacteria | 2587 |
| 455 | Ga0373942_0014022 | 3300035207 | Bacteria | 1934 |
| 456 | Ga0373961_0021412 | 3300035241 | Bacteria | 1719 |
| 457 | Ga0373962_0024411 | 3300035242 | Bacteria | 1616 |
| 458 | Ga0373924_0000089 | 3300035410 | Bacteria | 25257 |
| 459 | Ga0373924_0000461 | 3300035410 | Bacteria | 12502 |
| 460 | Ga0373924_0018443 | 3300035410 | Bacteria | 2688 |
| 461 | Ga0373924_0060119 | 3300035410 | Bacteria | 1588 |
| 462 | Ga0373924_0072630 | 3300035410 | Bacteria | 1453 |
| 463 | Ga0373924_0121781 | 3300035410 | Bacteria | 1132 |
| 464 | Ga0373931_0012604 | 3300035691 | Bacteria | 4099 |
| 465 | Ga0373935_0001924 | 3300035692 | Bacteria | 11679 |
| 466 | Ga0373935_0018839 | 3300035692 | Bacteria | 4206 |
| 467 | Ga0373935_0022142 | 3300035692 | Bacteria | 3894 |
| 468 | Ga0373935_0032679 | 3300035692 | Bacteria | 3233 |
| 469 | Ga0373935_0054497 | 3300035692 | Bacteria | 2546 |
| 470 | Ga0373935_0076685 | 3300035692 | Bacteria | 2165 |
| 471 | Ga0373935_0076706 | 3300035692 | Bacteria | 2165 |
| 472 | Ga0373927_0004795 | 3300035695 | Bacteria | 9410 |
| 473 | Ga0373927_0022395 | 3300035695 | Bacteria | 4139 |
| 474 | Ga0373927_0100916 | 3300035695 | Bacteria | 1877 |
| 475 | Ga0373933_0000344 | 3300035724 | Bacteria | 29733 |
| 476 | Ga0373933_0008889 | 3300035724 | Bacteria | 5477 |
| 477 | Ga0373933_0013645 | 3300035724 | Bacteria | 4505 |
| 478 | Ga0373933_0022514 | 3300035724 | Bacteria | 3589 |
| 479 | Ga0373933_0032943 | 3300035724 | Bacteria | 3012 |
| 480 | Ga0373933_0038674 | 3300035724 | Bacteria | 2803 |
| 481 | Ga0373933_0061357 | 3300035724 | Bacteria | 2268 |
| 482 | Ga0373947_0000001 | 3300035725 | Bacteria | 510932 |
| 483 | Ga0373947_0000713 | 3300035725 | Bacteria | 19785 |
| 484 | Ga0373947_0002054 | 3300035725 | Bacteria | 12280 |
| 485 | Ga0373947_0052877 | 3300035725 | Bacteria | 2447 |
| 486 | Ga0373947_0056245 | 3300035725 | Bacteria | 2378 |
| 487 | Ga0373947_0220274 | 3300035725 | Bacteria | 1247 |
| 488 | Ga0373937_0000029 | 3300036401 | Bacteria | 123547 |
| 489 | Ga0373937_0001321 | 3300036401 | Bacteria | 20742 |
| 490 | Ga0373937_0019707 | 3300036401 | Bacteria | 6041 |
| 491 | Ga0373937_0023604 | 3300036401 | Bacteria | 5540 |
| 492 | Ga0373937_0053453 | 3300036401 | Bacteria | 3705 |
| 493 | Ga0373937_0109196 | 3300036401 | Bacteria | 2572 |
| 494 | Ga0373937_0122863 | 3300036401 | Bacteria | 2420 |
| 495 | Ga0373937_0138862 | 3300036401 | Bacteria | 2273 |
| 496 | Ga0373937_0142425 | 3300036401 | Bacteria | 2243 |
| 497 | Ga0373937_0169624 | 3300036401 | Bacteria | 2047 |
| 498 | Ga0372808_005845 | 3300036459 | Bacteria | 1638 |
| 499 | Ga0373925_0000051 | 3300037068 | Bacteria | 127667 |
| 500 | Ga0373925_0000746 | 3300037068 | Bacteria | 29863 |
| 501 | Ga0373925_0001818 | 3300037068 | Bacteria | 17815 |
| 502 | Ga0373925_0012835 | 3300037068 | Bacteria | 6068 |
| 503 | Ga0373925_0044607 | 3300037068 | Bacteria | 3292 |
| 504 | Ga0373925_0054461 | 3300037068 | Bacteria | 2992 |
| 505 | Ga0373925_0066392 | 3300037068 | Bacteria | 2719 |
| 506 | Ga0373925_0089925 | 3300037068 | Bacteria | 2346 |
| 507 | Ga0373925_0166099 | 3300037068 | Bacteria | 1740 |
| 508 | Ga0395900_0447085 | 3300037418 | Bacteria | 1249 |
| 509 | Ga0436364_0022484 | 3300037853 | Bacteria | 2383 |
| 510 | Ga0436364_0038371 | 3300037853 | Bacteria | 3473 |
| 511 | Ga0436364_0207895 | 3300037853 | Bacteria | 5819 |
| 512 | Ga0436364_0261777 | 3300037853 | Bacteria | 1644 |
| 513 | Ga0436364_0607771 | 3300037853 | Bacteria | 6782 |
| 514 | Ga0436364_0653920 | 3300037853 | Bacteria | 6896 |
| 515 | Ga0436364_1492889 | 3300037853 | Bacteria | 100509 |
| 516 | Ga0436365_0469598 | 3300039437 | Bacteria | 28546 |
| 517 | Ga0436365_0795808 | 3300039437 | Bacteria | 5670 |
| 518 | Ga0436365_1139118 | 3300039437 | Bacteria | 3258 |
| 519 | Ga0436365_1324307 | 3300039437 | Bacteria | 6333 |
| 520 | Ga0436365_1937384 | 3300039437 | Bacteria | 8653 |
| 521 | Ga0436360_0620934 | 3300039438 | Bacteria | 1738 |
| 522 | Ga0436363_0275598 | 3300039450 | Bacteria | 1372 |
| 523 | Ga0436363_0802797 | 3300039450 | Bacteria | 1109 |
| 524 | Ga0436363_0915299 | 3300039450 | Bacteria | 2839 |
| 525 | Ga0466972_0002299 | 3300044658 | Bacteria | 9397 |
| 526 | Ga0466972_0005017 | 3300044658 | Bacteria | 6634 |
| 527 | Ga0466972_0011314 | 3300044658 | Bacteria | 4477 |
| 528 | Ga0466972_0070602 | 3300044658 | Bacteria | 1666 |
| 529 | Ga0466965_0007426 | 3300044683 | Bacteria | 5031 |
| 530 | Ga0466965_0012306 | 3300044683 | Bacteria | 4022 |
| 531 | Ga0466965_0015451 | 3300044683 | Bacteria | 3627 |
| 532 | Ga0466966_0007826 | 3300044684 | Bacteria | 7074 |
| 533 | Ga0466966_0118455 | 3300044684 | Bacteria | 1628 |
| 534 | Ga0466961_0009319 | 3300044693 | Bacteria | 6253 |
| 535 | Ga0466961_0269615 | 3300044693 | Bacteria | 1043 |
| 536 | Ga0466963_0009920 | 3300044694 | Bacteria | 5751 |
| 537 | Ga0466963_0028403 | 3300044694 | Bacteria | 3591 |
| 538 | Ga0466963_0034847 | 3300044694 | Bacteria | 3277 |
| 539 | Ga0466963_0082914 | 3300044694 | Bacteria | 2174 |
| 540 | Ga0466963_0158614 | 3300044694 | Bacteria | 1574 |
| 541 | Ga0466963_0223201 | 3300044694 | Bacteria | 1320 |
| 542 | Ga0466971_0036024 | 3300044719 | Bacteria | 2219 |
| 543 | Ga0466968_0000520 | 3300044735 | Bacteria | 13079 |
| 544 | Ga0466970_0015442 | 3300044765 | Bacteria | 3926 |
| 545 | Ga0466970_0018922 | 3300044765 | Bacteria | 3567 |
| 546 | Ga0466957_0044411 | 3300044842 | Bacteria | 2692 |
| 547 | Ga0466957_0110955 | 3300044842 | Bacteria | 1739 |
| 548 | Ga0466957_0301196 | 3300044842 | Bacteria | 1077 |
| 549 | Ga0466960_0001803 | 3300044901 | Bacteria | 7860 |
| 550 | Ga0466960_0002210 | 3300044901 | Bacteria | 7264 |
| 551 | Ga0466960_0005461 | 3300044901 | Bacteria | 5038 |
| 552 | Ga0466960_0007239 | 3300044901 | Bacteria | 4494 |
| 553 | Ga0466959_0001523 | 3300045049 | Bacteria | 14229 |
| 554 | Ga0466959_0128134 | 3300045049 | Bacteria | 1800 |
| 555 | Ga0466958_0012622 | 3300045836 | Bacteria | 4788 |
| 556 | Ga0466958_0079049 | 3300045836 | Bacteria | 2022 |
| 557 | Ga0466958_0123415 | 3300045836 | Bacteria | 1623 |
| 558 | Ga0466958_0210483 | 3300045836 | Bacteria | 1239 |
| 559 | Ga0466967_0026207 | 3300045976 | Bacteria | 4824 |
| 560 | Ga0466967_0041230 | 3300045976 | Bacteria | 3979 |
| 561 | Ga0466967_0060504 | 3300045976 | Bacteria | 3356 |
| 562 | Ga0466967_0067276 | 3300045976 | Bacteria | 3195 |
| 563 | Ga0466967_0107709 | 3300045976 | Bacteria | 2556 |
| 564 | Ga0466967_0108943 | 3300045976 | Bacteria | 2542 |
| 565 | Ga0466967_0267124 | 3300045976 | Bacteria | 1638 |
| 566 | Ga0466967_0281218 | 3300045976 | Bacteria | 1597 |
| 567 | Ga0466967_0343048 | 3300045976 | Bacteria | 1445 |
| 568 | Ga0495592_0000040 | 3300046454 | Bacteria | 123599 |
| 569 | Ga0495592_0004066 | 3300046454 | Bacteria | 10636 |
| 570 | Ga0495592_0004607 | 3300046454 | Bacteria | 10097 |
| 571 | Ga0495592_0014414 | 3300046454 | Bacteria | 6000 |
| 572 | Ga0495592_0026105 | 3300046454 | Bacteria | 4431 |
| 573 | Ga0495592_0174242 | 3300046454 | Bacteria | 1471 |
| 574 | Ga0495592_0258768 | 3300046454 | Bacteria | 1147 |
| 575 | Ga0495603_0003281 | 3300046455 | Bacteria | 9636 |
| 576 | Ga0495629_0009622 | 3300046459 | Bacteria | 7059 |
| 577 | Ga0495629_0016375 | 3300046459 | Bacteria | 5321 |
| 578 | Ga0495629_0020486 | 3300046459 | Bacteria | 4721 |
| 579 | Ga0495629_0209935 | 3300046459 | Bacteria | 1345 |
| 580 | Ga0495641_0002661 | 3300046461 | Bacteria | 13935 |
| 581 | Ga0495641_0008226 | 3300046461 | Bacteria | 6391 |
| 582 | Ga0495641_0023583 | 3300046461 | Bacteria | 3053 |
| 583 | Ga0495651_0000017 | 3300046462 | Bacteria | 124010 |
| 584 | Ga0495651_0004720 | 3300046462 | Bacteria | 10429 |
| 585 | Ga0495651_0008205 | 3300046462 | Bacteria | 8005 |
| 586 | Ga0495651_0011586 | 3300046462 | Bacteria | 6774 |
| 587 | Ga0495651_0043565 | 3300046462 | Bacteria | 3481 |
| 588 | Ga0495651_0077846 | 3300046462 | Bacteria | 2509 |
| 589 | Ga0495651_0299850 | 3300046462 | Bacteria | 1078 |
| 590 | Ga0495653_0002780 | 3300046463 | Bacteria | 13960 |
| 591 | Ga0495653_0005046 | 3300046463 | Bacteria | 10714 |
| 592 | Ga0495653_0005317 | 3300046463 | Bacteria | 10474 |
| 593 | Ga0495653_0006639 | 3300046463 | Bacteria | 9496 |
| 594 | Ga0495653_0010190 | 3300046463 | Bacteria | 7691 |
| 595 | Ga0495653_0104450 | 3300046463 | Bacteria | 2047 |
| 596 | Ga0495653_0193363 | 3300046463 | Bacteria | 1386 |
| 597 | Ga0495650_0067876 | 3300046471 | Bacteria | 1408 |
| 598 | Ga0495580_0001230 | 3300046472 | Bacteria | 22588 |
| 599 | Ga0495580_0172776 | 3300046472 | Bacteria | 1493 |
| 600 | Ga0495582_0000867 | 3300046473 | Bacteria | 16771 |
| 601 | Ga0495582_0115017 | 3300046473 | Bacteria | 1512 |
| 602 | Ga0495639_0003679 | 3300046475 | Bacteria | 6602 |
| 603 | Ga0495639_0113780 | 3300046475 | Bacteria | 1286 |
| 604 | Ga0495662_0000668 | 3300046476 | Bacteria | 16177 |
| 605 | Ga0495662_0018037 | 3300046476 | Bacteria | 3415 |
| 606 | Ga0495662_0024483 | 3300046476 | Bacteria | 2913 |
| 607 | Ga0495662_0034250 | 3300046476 | Bacteria | 2452 |
| 608 | Ga0495662_0059792 | 3300046476 | Bacteria | 1840 |
| 609 | Ga0495664_0004823 | 3300046477 | Bacteria | 7372 |
| 610 | Ga0495664_0005990 | 3300046477 | Bacteria | 6701 |
| 611 | Ga0495664_0020630 | 3300046477 | Bacteria | 3801 |
| 612 | Ga0495664_0046273 | 3300046477 | Bacteria | 2581 |
| 613 | Ga0495664_0068699 | 3300046477 | Bacteria | 2114 |
| 614 | Ga0495664_0074885 | 3300046477 | Bacteria | 2025 |
| 615 | Ga0495664_0154613 | 3300046477 | Bacteria | 1391 |
| 616 | Ga0495606_0033078 | 3300046507 | Bacteria | 3572 |
| 617 | Ga0495608_0000415 | 3300046511 | Bacteria | 29826 |
| 618 | Ga0495608_0006208 | 3300046511 | Bacteria | 8482 |
| 619 | Ga0495608_0008989 | 3300046511 | Bacteria | 6985 |
| 620 | Ga0495608_0021664 | 3300046511 | Bacteria | 4411 |
| 621 | Ga0495608_0050356 | 3300046511 | Bacteria | 2763 |
| 622 | Ga0495618_0002727 | 3300046514 | Bacteria | 11250 |
| 623 | Ga0495618_0012852 | 3300046514 | Bacteria | 5088 |
| 624 | Ga0495618_0026176 | 3300046514 | Bacteria | 3624 |
| 625 | Ga0495618_0047569 | 3300046514 | Bacteria | 2707 |
| 626 | Ga0495618_0109903 | 3300046514 | Bacteria | 1765 |
| 627 | Ga0495628_0000756 | 3300046516 | Bacteria | 29861 |
| 628 | Ga0495628_0009420 | 3300046516 | Bacteria | 8335 |
| 629 | Ga0495628_0020189 | 3300046516 | Bacteria | 5498 |
| 630 | Ga0495628_0059312 | 3300046516 | Bacteria | 3005 |
| 631 | Ga0495628_0124644 | 3300046516 | Bacteria | 1974 |
| 632 | Ga0495628_0232791 | 3300046516 | Bacteria | 1380 |
| 633 | Ga0495630_0001078 | 3300046517 | Bacteria | 18805 |
| 634 | Ga0495630_0033094 | 3300046517 | Bacteria | 3854 |
| 635 | Ga0495630_0071256 | 3300046517 | Bacteria | 2615 |
| 636 | Ga0495630_0120944 | 3300046517 | Bacteria | 1986 |
| 637 | Ga0495666_0003716 | 3300046526 | Bacteria | 7712 |
| 638 | Ga0495666_0060684 | 3300046526 | Bacteria | 1807 |
| 639 | Ga0495666_0072473 | 3300046526 | Bacteria | 1636 |
| 640 | Ga0495652_0003051 | 3300046529 | Bacteria | 16790 |
| 641 | Ga0495652_0010386 | 3300046529 | Bacteria | 8439 |
| 642 | Ga0495652_0058652 | 3300046529 | Bacteria | 3258 |
| 643 | Ga0495652_0064690 | 3300046529 | Bacteria | 3075 |
| 644 | Ga0495652_0149268 | 3300046529 | Bacteria | 1828 |
| 645 | Ga0495652_0173913 | 3300046529 | Bacteria | 1659 |
| 646 | Ga0495652_0177097 | 3300046529 | Bacteria | 1640 |
| 647 | Ga0495665_0000134 | 3300046531 | Bacteria | 35684 |
| 648 | Ga0495665_0009177 | 3300046531 | Bacteria | 5360 |
| 649 | Ga0495665_0011365 | 3300046531 | Bacteria | 4819 |
| 650 | Ga0495640_0009227 | 3300046533 | Bacteria | 7694 |
| 651 | Ga0495640_0029695 | 3300046533 | Bacteria | 3921 |
| 652 | Ga0495640_0198796 | 3300046533 | Bacteria | 1271 |
| 653 | Ga0495586_0002971 | 3300046535 | Bacteria | 9137 |
| 654 | Ga0495587_0000419 | 3300046536 | Bacteria | 29862 |
| 655 | Ga0495587_0002110 | 3300046536 | Bacteria | 13289 |
| 656 | Ga0495587_0009754 | 3300046536 | Bacteria | 6138 |
| 657 | Ga0495587_0033147 | 3300046536 | Bacteria | 3119 |
| 658 | Ga0495587_0035854 | 3300046536 | Bacteria | 2987 |
| 659 | Ga0495587_0039213 | 3300046536 | Bacteria | 2836 |
| 660 | Ga0495587_0045103 | 3300046536 | Bacteria | 2621 |
| 661 | Ga0495587_0073360 | 3300046536 | Bacteria | 1988 |
| 662 | Ga0495645_0008285 | 3300046543 | Bacteria | 7253 |
| 663 | Ga0495645_0038872 | 3300046543 | Bacteria | 3470 |
| 664 | Ga0495645_0040081 | 3300046543 | Bacteria | 3416 |
| 665 | Ga0495645_0064146 | 3300046543 | Bacteria | 2658 |
| 666 | Ga0495645_0102574 | 3300046543 | Bacteria | 2033 |
| 667 | Ga0495622_0058710 | 3300046557 | Bacteria | 1782 |
| 668 | Ga0495667_0000336 | 3300046559 | Bacteria | 29840 |
| 669 | Ga0495667_0002108 | 3300046559 | Bacteria | 13223 |
| 670 | Ga0495667_0005389 | 3300046559 | Bacteria | 8650 |
| 671 | Ga0495667_0010012 | 3300046559 | Bacteria | 6420 |
| 672 | Ga0495667_0010079 | 3300046559 | Bacteria | 6399 |
| 673 | Ga0495667_0021069 | 3300046559 | Bacteria | 4397 |
| 674 | Ga0495667_0025039 | 3300046559 | Bacteria | 4022 |
| 675 | Ga0495667_0031721 | 3300046559 | Bacteria | 3543 |
| 676 | Ga0495634_0003699 | 3300046642 | Bacteria | 12194 |
| 677 | Ga0495634_0061896 | 3300046642 | Bacteria | 2486 |
| 678 | Ga0495634_0066969 | 3300046642 | Bacteria | 2376 |
| 679 | Ga0495634_0212588 | 3300046642 | Bacteria | 1196 |
| 680 | Ga0495634_0213915 | 3300046642 | Bacteria | 1192 |
| 681 | Ga0495635_0001724 | 3300046663 | Bacteria | 14720 |
| 682 | Ga0495635_0012119 | 3300046663 | Bacteria | 6045 |
| 683 | Ga0495635_0047265 | 3300046663 | Bacteria | 2968 |
| 684 | Ga0495635_0047908 | 3300046663 | Bacteria | 2946 |
| 685 | Ga0495635_0052668 | 3300046663 | Bacteria | 2803 |
| 686 | Ga0495635_0055387 | 3300046663 | Bacteria | 2731 |
| 687 | Ga0495635_0056829 | 3300046663 | Bacteria | 2693 |
| 688 | Ga0495635_0070778 | 3300046663 | Bacteria | 2391 |
| 689 | Ga0495635_0073060 | 3300046663 | Bacteria | 2349 |
| 690 | Ga0495635_0099653 | 3300046663 | Bacteria | 1986 |
| 691 | Ga0495588_0025172 | 3300046674 | Bacteria | 2963 |
| 692 | Ga0495657_0000032 | 3300046675 | Bacteria | 123599 |
| 693 | Ga0495657_0020005 | 3300046675 | Bacteria | 4820 |
| 694 | Ga0495657_0026860 | 3300046675 | Bacteria | 4071 |
| 695 | Ga0495657_0036208 | 3300046675 | Bacteria | 3412 |
| 696 | Ga0495657_0043318 | 3300046675 | Bacteria | 3070 |
| 697 | Ga0495657_0045281 | 3300046675 | Bacteria | 2986 |
| 698 | Ga0495657_0046319 | 3300046675 | Bacteria | 2945 |
| 699 | Ga0495657_0055247 | 3300046675 | Bacteria | 2649 |
| 700 | Ga0495599_0000412 | 3300046678 | Bacteria | 24414 |
| 701 | Ga0495599_0004894 | 3300046678 | Bacteria | 7964 |
| 702 | Ga0495599_0025657 | 3300046678 | Bacteria | 3690 |
| 703 | Ga0495599_0037219 | 3300046678 | Bacteria | 3057 |
| 704 | Ga0495599_0056674 | 3300046678 | Bacteria | 2452 |
| 705 | Ga0495599_0093726 | 3300046678 | Bacteria | 1873 |
| 706 | Ga0495599_0098378 | 3300046678 | Bacteria | 1823 |
| 707 | Ga0495599_0190100 | 3300046678 | Bacteria | 1263 |
| 708 | Ga0495623_0000675 | 3300046679 | Bacteria | 22673 |
| 709 | Ga0495623_0029862 | 3300046679 | Bacteria | 3507 |
| 710 | Ga0495623_0037567 | 3300046679 | Bacteria | 3098 |
| 711 | Ga0495623_0123594 | 3300046679 | Bacteria | 1555 |
| 712 | Ga0495646_0005293 | 3300046680 | Bacteria | 8145 |
| 713 | Ga0495646_0013379 | 3300046680 | Bacteria | 5215 |
| 714 | Ga0495646_0039402 | 3300046680 | Bacteria | 2913 |
| 715 | Ga0495646_0055727 | 3300046680 | Bacteria | 2372 |
| 716 | Ga0495646_0058163 | 3300046680 | Bacteria | 2311 |
| 717 | Ga0495658_0000376 | 3300046683 | Bacteria | 25075 |
| 718 | Ga0495658_0048718 | 3300046683 | Bacteria | 2390 |
| 719 | Ga0495613_0001261 | 3300046689 | Bacteria | 19288 |
| 720 | Ga0495613_0021059 | 3300046689 | Bacteria | 4860 |
| 721 | Ga0495613_0180187 | 3300046689 | Bacteria | 1496 |
| 722 | Ga0495624_0001162 | 3300046690 | Bacteria | 20865 |
| 723 | Ga0495624_0007172 | 3300046690 | Bacteria | 7845 |
| 724 | Ga0495624_0035272 | 3300046690 | Bacteria | 3230 |
| 725 | Ga0495624_0088418 | 3300046690 | Bacteria | 1913 |
| 726 | Ga0495649_0157896 | 3300046694 | Bacteria | 1190 |
| 727 | Ga0495600_0000683 | 3300046809 | Bacteria | 17720 |
| 728 | Ga0495600_0012175 | 3300046809 | Bacteria | 5373 |
| 729 | Ga0495600_0021876 | 3300046809 | Bacteria | 4100 |
| 730 | Ga0495600_0024003 | 3300046809 | Bacteria | 3926 |
| 731 | Ga0495600_0051462 | 3300046809 | Bacteria | 2688 |
| 732 | Ga0495600_0072233 | 3300046809 | Bacteria | 2254 |
| 733 | Ga0495600_0271672 | 3300046809 | Bacteria | 1075 |
| 734 | Ga0495581_0004652 | 3300047315 | Bacteria | 7922 |
| 735 | Ga0495581_0004741 | 3300047315 | Bacteria | 7850 |
| 736 | Ga0495581_0014002 | 3300047315 | Bacteria | 4652 |
| 737 | Ga0495581_0037476 | 3300047315 | Bacteria | 2806 |
| 738 | Ga0495581_0100853 | 3300047315 | Bacteria | 1677 |
| 739 | Ga0495604_0000627 | 3300047317 | Bacteria | 30411 |
| 740 | Ga0495604_0010768 | 3300047317 | Bacteria | 7261 |
| 741 | Ga0495604_0013549 | 3300047317 | Bacteria | 6502 |
| 742 | Ga0495604_0029565 | 3300047317 | Bacteria | 4359 |
| 743 | Ga0495604_0052683 | 3300047317 | Bacteria | 3149 |
| 744 | Ga0495604_0100193 | 3300047317 | Bacteria | 2130 |
| 745 | Ga0495674_0004676 | 3300047319 | Bacteria | 13159 |
| 746 | Ga0495674_0009201 | 3300047319 | Bacteria | 9386 |
| 747 | Ga0495674_0026417 | 3300047319 | Bacteria | 5312 |
| 748 | Ga0495674_0154271 | 3300047319 | Bacteria | 1924 |
| 749 | Ga0495674_0219602 | 3300047319 | Bacteria | 1572 |
| 750 | Ga0495676_0002068 | 3300047321 | Bacteria | 17662 |
| 751 | Ga0495676_0011340 | 3300047321 | Bacteria | 8046 |
| 752 | Ga0495676_0163060 | 3300047321 | Bacteria | 1575 |
| 753 | Ga0495680_0001340 | 3300047322 | Bacteria | 26770 |
| 754 | Ga0495680_0002955 | 3300047322 | Bacteria | 17013 |
| 755 | Ga0495680_0004557 | 3300047322 | Bacteria | 13236 |
| 756 | Ga0495680_0017001 | 3300047322 | Bacteria | 6226 |
| 757 | Ga0495680_0024279 | 3300047322 | Bacteria | 5030 |
| 758 | Ga0495680_0157438 | 3300047322 | Bacteria | 1651 |
| 759 | Ga0495675_0008576 | 3300047444 | Bacteria | 6336 |
| 760 | Ga0495675_0023434 | 3300047444 | Bacteria | 3933 |
| 761 | Ga0495675_0026076 | 3300047444 | Bacteria | 3725 |
| 762 | Ga0495675_0064642 | 3300047444 | Bacteria | 2314 |
| 763 | Ga0495685_010874 | 3300047447 | Bacteria | 3058 |
| 764 | Ga0495684_0002024 | 3300047471 | Bacteria | 16305 |
| 765 | Ga0495684_0002236 | 3300047471 | Bacteria | 15508 |
| 766 | Ga0495684_0009603 | 3300047471 | Bacteria | 7459 |
| 767 | Ga0495684_0010833 | 3300047471 | Bacteria | 7050 |
| 768 | Ga0495684_0020391 | 3300047471 | Bacteria | 5108 |
| 769 | Ga0495684_0027577 | 3300047471 | Bacteria | 4360 |
| 770 | Ga0495684_0058448 | 3300047471 | Bacteria | 2937 |
| 771 | Ga0495684_0114025 | 3300047471 | Bacteria | 2038 |
| 772 | Ga0495684_0211035 | 3300047471 | Bacteria | 1427 |
| 773 | Ga0495686_0023719 | 3300047472 | Bacteria | 4041 |
| 774 | Ga0495593_0002690 | 3300047673 | Bacteria | 10696 |
| 775 | Ga0495593_0007716 | 3300047673 | Bacteria | 6277 |
| 776 | Ga0495593_0012450 | 3300047673 | Bacteria | 4862 |
| 777 | Ga0495593_0041959 | 3300047673 | Bacteria | 2457 |
| 778 | Ga0495602_0001077 | 3300048088 | Bacteria | 26795 |
| 779 | Ga0495602_0030905 | 3300048088 | Bacteria | 5070 |
| 780 | Ga0495602_0040713 | 3300048088 | Bacteria | 4255 |
| 781 | Ga0495602_0045172 | 3300048088 | Bacteria | 3988 |
| 782 | Ga0495602_0060021 | 3300048088 | Bacteria | 3317 |
| 783 | Ga0495602_0156441 | 3300048088 | Bacteria | 1784 |
| 784 | Ga0495614_0009076 | 3300048089 | Bacteria | 4406 |
| 785 | Ga0496100_0001640 | 3300048903 | Bacteria | 11082 |
| 786 | Ga0496100_0082488 | 3300048903 | Bacteria | 2174 |
| 787 | Ga0496100_0198350 | 3300048903 | Bacteria | 1461 |
| 788 | Ga0496101_0000395 | 3300048904 | Bacteria | 28467 |
| 789 | Ga0496101_0093368 | 3300048904 | Bacteria | 2241 |
| 790 | Ga0496101_0133587 | 3300048904 | Bacteria | 1886 |
| 791 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 792 | Ga0496102_0000029 | 3300048905 | Bacteria | 222195 |
| 793 | Ga0496102_0000292 | 3300048905 | Bacteria | 64203 |
| 794 | Ga0496102_0049716 | 3300048905 | Bacteria | 3815 |
| 795 | Ga0496102_0078587 | 3300048905 | Bacteria | 3037 |
| 796 | Ga0496102_0166598 | 3300048905 | Bacteria | 2073 |
| 797 | Ga0496102_0224414 | 3300048905 | Bacteria | 1771 |
| 798 | Ga0496103_0000143 | 3300048906 | Bacteria | 74753 |
| 799 | Ga0496103_0000296 | 3300048906 | Bacteria | 45922 |
| 800 | Ga0496103_0000431 | 3300048906 | Bacteria | 36468 |
| 801 | Ga0496103_0037709 | 3300048906 | Bacteria | 2962 |
| 802 | Ga0496103_0062898 | 3300048906 | Bacteria | 2311 |
| 803 | Ga0496104_0008912 | 3300048907 | Bacteria | 8915 |
| 804 | Ga0496105_0006989 | 3300048908 | Bacteria | 8693 |
| 805 | Ga0496105_0027956 | 3300048908 | Bacteria | 4612 |
| 806 | Ga0496106_0002927 | 3300048909 | Bacteria | 12703 |
| 807 | Ga0496106_0189331 | 3300048909 | Bacteria | 1635 |
| 808 | Ga0496107_0005683 | 3300048910 | Bacteria | 8531 |
| 809 | Ga0496107_0055516 | 3300048910 | Bacteria | 2860 |
| 810 | Ga0496108_0131740 | 3300048911 | Bacteria | 2149 |
| 811 | Ga0496108_0131853 | 3300048911 | Bacteria | 2148 |
| 812 | Ga0496109_0068511 | 3300048912 | Bacteria | 3253 |
| 813 | Ga0496109_0072263 | 3300048912 | Bacteria | 3169 |
| 814 | Ga0496109_0156681 | 3300048912 | Bacteria | 2133 |
| 815 | Ga0496110_0016518 | 3300048913 | Bacteria | 6163 |
| 816 | Ga0496110_0043835 | 3300048913 | Bacteria | 3906 |
| 817 | Ga0496110_0053361 | 3300048913 | Bacteria | 3554 |
| 818 | Ga0496110_0091469 | 3300048913 | Bacteria | 2722 |
| 819 | Ga0496110_0102664 | 3300048913 | Bacteria | 2564 |
| 820 | Ga0496111_0016728 | 3300048914 | Bacteria | 5059 |
| 821 | Ga0496111_0026714 | 3300048914 | Bacteria | 4078 |
| 822 | Ga0496112_0034576 | 3300048915 | Bacteria | 4918 |
| 823 | Ga0496112_0122137 | 3300048915 | Bacteria | 2575 |
| 824 | Ga0496113_0011885 | 3300048916 | Bacteria | 5834 |
| 825 | Ga0496113_0017401 | 3300048916 | Bacteria | 4988 |
| 826 | Ga0496113_0130492 | 3300048916 | Bacteria | 1972 |
| 827 | Ga0496113_0305993 | 3300048916 | Bacteria | 1273 |
| 828 | Ga0496114_0003724 | 3300048917 | Bacteria | 11743 |
| 829 | Ga0496114_0276679 | 3300048917 | Bacteria | 1479 |
| 830 | Ga0496114_0345998 | 3300048917 | Bacteria | 1315 |
| 831 | Ga0496115_0082002 | 3300048918 | Bacteria | 2627 |
| 832 | Ga0496115_0084901 | 3300048918 | Bacteria | 2582 |
| 833 | Ga0496116_0000072 | 3300048919 | Bacteria | 238158 |
| 834 | Ga0496116_0000422 | 3300048919 | Bacteria | 59708 |
| 835 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 836 | Ga0496117_0000682 | 3300048920 | Bacteria | 54224 |
| 837 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 838 | Ga0496118_0000437 | 3300048921 | Bacteria | 69069 |
| 839 | Ga0496118_0000598 | 3300048921 | Bacteria | 59753 |
| 840 | Ga0496119_0000517 | 3300048922 | Bacteria | 52595 |
| 841 | Ga0496119_0002265 | 3300048922 | Bacteria | 21391 |
| 842 | Ga0496119_0039881 | 3300048922 | Bacteria | 3013 |
| 843 | Ga0496119_0060487 | 3300048922 | Bacteria | 2267 |
| 844 | Ga0496119_0143577 | 3300048922 | Bacteria | 1286 |
| 845 | Ga0496120_0000631 | 3300048923 | Bacteria | 52495 |
| 846 | Ga0496120_0038488 | 3300048923 | Bacteria | 2828 |
| 847 | Ga0496121_0002639 | 3300048924 | Bacteria | 26992 |
| 848 | Ga0496121_0132651 | 3300048924 | Bacteria | 1861 |
| 849 | Ga0496122_0021922 | 3300048925 | Bacteria | 5696 |
| 850 | Ga0496123_0009759 | 3300048926 | Bacteria | 8584 |
| 851 | Ga0496126_0000344 | 3300048929 | Bacteria | 97456 |
| 852 | Ga0496126_0000379 | 3300048929 | Bacteria | 92123 |
| 853 | Ga0496126_0002073 | 3300048929 | Bacteria | 28106 |
| 854 | Ga0496126_0002899 | 3300048929 | Bacteria | 22357 |
| 855 | Ga0496126_0005028 | 3300048929 | Bacteria | 15383 |
| 856 | Ga0496126_0053530 | 3300048929 | Bacteria | 3661 |
| 857 | Ga0496126_0198462 | 3300048929 | Bacteria | 1695 |
| 858 | Ga0496126_0253578 | 3300048929 | Bacteria | 1465 |
| 859 | Ga0501031_0000061 | 3300049568 | Bacteria | 58363 |
| 860 | Ga0501032_0000155 | 3300049569 | Bacteria | 55506 |
| 861 | Ga0501032_0075471 | 3300049569 | Bacteria | 2245 |
| 862 | Ga0501032_0107558 | 3300049569 | Bacteria | 1847 |
| 863 | Ga0501033_0000217 | 3300049570 | Bacteria | 55235 |
| 864 | Ga0501034_0001039 | 3300049571 | Bacteria | 39597 |
| 865 | Ga0501034_0122402 | 3300049571 | Bacteria | 2587 |
| 866 | Ga0501034_0168470 | 3300049571 | Bacteria | 2158 |
| 867 | Ga0501036_0002172 | 3300049572 | Bacteria | 15309 |
| 868 | Ga0501036_0047832 | 3300049572 | Bacteria | 3621 |
| 869 | Ga0501037_0026771 | 3300049573 | Bacteria | 4261 |
| 870 | Ga0501037_0058863 | 3300049573 | Bacteria | 2803 |
| 871 | Ga0501038_0000167 | 3300049574 | Bacteria | 55508 |
| 872 | Ga0501039_0000153 | 3300049575 | Bacteria | 47341 |
| 873 | Ga0501042_0101359 | 3300049578 | Bacteria | 2070 |
| 874 | Ga0501043_0000079 | 3300049579 | Bacteria | 85383 |
| 875 | Ga0501043_0001428 | 3300049579 | Bacteria | 20870 |
| 876 | Ga0501043_0072309 | 3300049579 | Bacteria | 2709 |
| 877 | Ga0501046_0008291 | 3300049580 | Bacteria | 9072 |
| 878 | Ga0501047_0000565 | 3300049581 | Bacteria | 39569 |
| 879 | Ga0501047_0010544 | 3300049581 | Bacteria | 8739 |
| 880 | Ga0501047_0017638 | 3300049581 | Bacteria | 6840 |
| 881 | Ga0501047_0084715 | 3300049581 | Bacteria | 3046 |
| 882 | Ga0501047_0179657 | 3300049581 | Bacteria | 1983 |
| 883 | Ga0501047_0277844 | 3300049581 | Bacteria | 1520 |
| 884 | Ga0501048_0000141 | 3300049582 | Bacteria | 43576 |
| 885 | Ga0501048_0008749 | 3300049582 | Bacteria | 7628 |
| 886 | Ga0501067_0004847 | 3300049583 | Bacteria | 7465 |
| 887 | Ga0501069_0000117 | 3300049585 | Bacteria | 35159 |
| 888 | Ga0501069_0012357 | 3300049585 | Bacteria | 4539 |
| 889 | Ga0501069_0244191 | 3300049585 | Bacteria | 1047 |
| 890 | Ga0501070_0000217 | 3300049586 | Bacteria | 54554 |
| 891 | Ga0501070_0001241 | 3300049586 | Bacteria | 22855 |
| 892 | Ga0501070_0024834 | 3300049586 | Bacteria | 5025 |
| 893 | Ga0501070_0125394 | 3300049586 | Bacteria | 2122 |
| 894 | Ga0501070_0413083 | 3300049586 | Bacteria | 1090 |
| 895 | Ga0501071_0025200 | 3300049587 | Bacteria | 4165 |
| 896 | Ga0501073_0006678 | 3300049589 | Bacteria | 8591 |
| 897 | Ga0501073_0032860 | 3300049589 | Bacteria | 3698 |
| 898 | Ga0501074_0000226 | 3300049590 | Bacteria | 31303 |
| 899 | Ga0501074_0003971 | 3300049590 | Bacteria | 10542 |
| 900 | Ga0501080_0000079 | 3300049742 | Bacteria | 65752 |
| 901 | Ga0501080_0001119 | 3300049742 | Bacteria | 22084 |
| 902 | Ga0501080_0033432 | 3300049742 | Bacteria | 4799 |
| 903 | Ga0501035_0000786 | 3300049822 | Bacteria | 33990 |
| 904 | Ga0501035_0015462 | 3300049822 | Bacteria | 7039 |
| 905 | Ga0501044_0001530 | 3300049823 | Bacteria | 27125 |
| 906 | Ga0501044_0022723 | 3300049823 | Bacteria | 6678 |
| 907 | nmdc:mga03n38_1095_c1 | 3300050490 | Bacteria | 7478 |
| 908 | nmdc:mga03n38_11307_c1 | 3300050490 | Bacteria | 3320 |
| 909 | nmdc:mga03n38_8689_c1 | 3300050490 | Bacteria | 3658 |
| 910 | nmdc:mga00v17_12331_c1 | 3300050491 | Bacteria | 4715 |
| 911 | nmdc:mga00v17_7415_c1 | 3300050491 | Bacteria | 5852 |
| 912 | nmdc:mga06z11_9524_c1 | 3300050494 | Bacteria | 4097 |
| 913 | nmdc:mga04h51_19012_c1 | 3300050495 | Bacteria | 2032 |
| 914 | nmdc:mga07m45_172057_c1 | 3300050496 | Bacteria | 1259 |
| 915 | nmdc:mga05p37_174869_c1 | 3300050507 | Bacteria | 2616 |
| 916 | nmdc:mga05p37_357616_c1 | 3300050507 | Bacteria | 1718 |
| 917 | nmdc:mga09592_11839_c1 | 3300050508 | Bacteria | 7095 |
| 918 | nmdc:mga0n895_10593_c1 | 3300050512 | Bacteria | 8160 |
| 919 | nmdc:mga0n895_36156_c1 | 3300050512 | Bacteria | 4768 |
| 920 | nmdc:mga0n895_403209_c1 | 3300050512 | Bacteria | 1383 |
| 921 | nmdc:mga0rr50_145137_c1 | 3300050513 | Bacteria | 1913 |
| 922 | nmdc:mga0rr50_313434_c1 | 3300050513 | Bacteria | 1314 |
| 923 | nmdc:mga0rr50_4657_c1 | 3300050513 | Bacteria | 8084 |
| 924 | nmdc:mga0rr50_80405_c1 | 3300050513 | Bacteria | 2513 |
| 925 | nmdc:mga08x19_36785_c1 | 3300050514 | Bacteria | 3102 |
| 926 | nmdc:mga08x19_9136_c1 | 3300050514 | Bacteria | 5919 |
| 927 | nmdc:mga0a205_173719_c1 | 3300050515 | Bacteria | 2051 |
| 928 | Ga0495601_0001363 | 3300053077 | Bacteria | 13436 |
| 929 | Ga0495601_0022765 | 3300053077 | Bacteria | 3850 |
| 930 | Ga0495601_0031731 | 3300053077 | Bacteria | 3284 |
| 931 | Ga0495612_0001188 | 3300053078 | Bacteria | 10722 |
| 932 | Ga0495612_0006147 | 3300053078 | Bacteria | 4941 |
| 933 | Ga0495612_0021323 | 3300053078 | Bacteria | 2599 |
| 934 | Ga0500635_0005708 | 3300053080 | Bacteria | 3285 |
| 935 | Ga0495595_0067103 | 3300053084 | Bacteria | 1690 |
| 936 | Ga0495619_0000574 | 3300053085 | Bacteria | 24419 |
| 937 | Ga0495619_0027532 | 3300053085 | Bacteria | 3661 |
| 938 | Ga0495619_0040378 | 3300053085 | Bacteria | 3051 |
| 939 | Ga0495619_0111073 | 3300053085 | Bacteria | 1873 |
| 940 | Ga0500643_001870 | 3300053087 | Bacteria | 11463 |
| 941 | Ga0500559_0002620 | 3300053136 | Bacteria | 9186 |
| 942 | Ga0500559_0020901 | 3300053136 | Bacteria | 2770 |
| 943 | Ga0501084_0003565 | 3300054114 | Bacteria | 12634 |
| 944 | Ga0466962_0052625 | 3300061719 | Bacteria | 1946 |
| 945 | 2501943711 | 2501939600 | Bacteria | 6907073 |
| 946 | 2515721142 | 2515154129 | Bacteria | 5584369 |
| 947 | 2515850619 | 2515154155 | Bacteria | 7985436 |
| 948 | 2516084251 | 2515154202 | Bacteria | 5471270 |
| 949 | 2623585723 | 2622736626 | Bacteria | 7181580 |
| 950 | 2644014053 | 2643221601 | Bacteria | 7493239 |
| 951 | 2644174385 | 2643221631 | Bacteria | 8168043 |
| 952 | 2644445087 | 2643221679 | Bacteria | 3839507 |
| 953 | 2676475169 | 2675903058 | Bacteria | 6822861 |
| 954 | 2739602995 | 2739367653 | Bacteria | 2780952 |
| 955 | 2808851881 | 2808606360 | Bacteria | 4404006 |
| 956 | 2816425648 | 2816332119 | Bacteria | 8120218 |
| 957 | 2816505811 | 2816332139 | Bacteria | 9138787 |
| 958 | 2817508483 | 2816332305 | Bacteria | 2697803 |
| 959 | 2827629898 | 2827628540 | Bacteria | 6858585 |
| 960 | 2856743867 | 2856741275 | Bacteria | 8096094 |
| 961 | 2856859608 | 2856858025 | Bacteria | 7255264 |
| 962 | 2857727926 | 2857727296 | Bacteria | 2745552 |
| 963 | 2861528174 | 2861520306 | Bacteria | 8348283 |
| 964 | 2867509836 | 2867507094 | Bacteria | 6506033 |
| 965 | 2870783043 | 2870782633 | Bacteria | 9624083 |
| 966 | 2873319493 | 2873314349 | Bacteria | 8512634 |
| 967 | 2883825436 | 2883821847 | Bacteria | 5121194 |
| 968 | 2891331119 | 2891326441 | Bacteria | 6439512 |
| 969 | 2891400575 | 2891395885 | Bacteria | 9251614 |
| 970 | 2891562277 | 2891554331 | Bacteria | 8812224 |
| 971 | 2891569693 | 2891562705 | Bacteria | 8039471 |
| 972 | 2902797350 | 2902792274 | Bacteria | 7270173 |
| 973 | 2905927635 | 2905926851 | Bacteria | 4423176 |
| 974 | 2905929192 | 2905926851 | Bacteria | 4423176 |
| 975 | 2915363091 | 2915358134 | Bacteria | 6050864 |
| 976 | 2917740971 | 2917736166 | Bacteria | 9690793 |
| 977 | 3003009313 | 3002998708 | Bacteria | 11715108 |
| 978 | 649816316 | 649633069 | Bacteria | 6962533 |
| 979 | 8004022882 | 8004021418 | Bacteria | 4313954 |
| 980 | 8004026101 | 8004025490 | Bacteria | 4327753 |
| 981 | 8053953147 | 8053945823 | Bacteria | 8962862 |
| 982 | 8054476866 | 8054472261 | Bacteria | 7464355 |
| 983 | 8055069984 | 8055066027 | Bacteria | 9479577 |
| 984 | 8055174623 | 8055172936 | Bacteria | 9305943 |
| 985 | 8057571017 | 8057568493 | Bacteria | 7221719 |
| 986 | Ga0500572_013913 | |||
| 987 | Ga0006562J51391_1065946 | |||
| 988 | Ga0070683_100032402 | |||
| 989 | Ga0070683_100082859 | |||
| 990 | Ga0070690_100350394 | |||
| 991 | Ga0068869_100020459 | |||
| 992 | Ga0068869_100063944 | |||
| 993 | Ga0070666_10041765 | |||
| 994 | Ga0070680_100147309 | |||
| 995 | Ga0070682_100050527 | |||
| 996 | Ga0070682_100095390 | |||
| 997 | Ga0068868_100225971 | |||
| 998 | Ga0068868_100276552 | |||
| 999 | Ga0070689_100175330 | |||
| 1000 | Ga0070687_100007051 | |||
| 1001 | Ga0070661_100060301 | |||
| 1002 | Ga0070661_100070263 | |||
| 1003 | Ga0070668_100075083 | |||
| 1004 | Ga0070668_100087917 | |||
| 1005 | Ga0070669_100119215 | |||
| 1006 | Ga0070675_100061776 | |||
| 1007 | Ga0070671_100002762 | |||
| 1008 | Ga0070673_100099206 | |||
| 1009 | Ga0070673_100301505 | |||
| 1010 | Ga0070709_10000127 | |||
| 1011 | Ga0070709_10000306 | |||
| 1012 | Ga0070709_10033374 | |||
| 1013 | Ga0070709_10065967 | |||
| 1014 | Ga0070709_10232543 | |||
| 1015 | Ga0070714_100001423 | |||
| 1016 | Ga0070714_100004430 | |||
| 1017 | Ga0070714_100006087 | |||
| 1018 | Ga0070714_100031980 | |||
| 1019 | Ga0070714_100052519 | |||
| 1020 | Ga0070714_100106131 | |||
| 1021 | Ga0070714_100165938 | |||
| 1022 | Ga0070714_100176271 | |||
| 1023 | Ga0070714_100203388 | |||
| 1024 | Ga0070714_100237441 | |||
| 1025 | Ga0070714_100274434 | |||
| 1026 | Ga0070714_100377148 | |||
| 1027 | Ga0070713_100002458 | |||
| 1028 | Ga0070713_100004485 | |||
| 1029 | Ga0070713_100017290 | |||
| 1030 | Ga0070713_100017870 | |||
| 1031 | Ga0070713_100068179 | |||
| 1032 | Ga0070713_100124013 | |||
| 1033 | Ga0070713_100227770 | |||
| 1034 | Ga0070713_100309530 | |||
| 1035 | Ga0070710_10000263 | |||
| 1036 | Ga0070710_10000784 | |||
| 1037 | Ga0070710_10003125 | |||
| 1038 | Ga0070710_10036614 | |||
| 1039 | Ga0070710_10156020 | |||
| 1040 | Ga0070711_100000252 | |||
| 1041 | Ga0070711_100002553 | |||
| 1042 | Ga0070711_100054730 | |||
| 1043 | Ga0070711_100075813 | |||
| 1044 | Ga0070711_100287801 | |||
| 1045 | Ga0070700_100126212 | |||
| 1046 | Ga0070694_100057693 | |||
| 1047 | Ga0070708_100002180 | |||
| 1048 | Ga0070708_100010328 | |||
| 1049 | Ga0070708_100055178 | |||
| 1050 | Ga0070708_100145303 | |||
| 1051 | Ga0070708_100178759 | |||
| 1052 | Ga0070663_100158772 | |||
| 1053 | Ga0070678_100272595 | |||
| 1054 | Ga0070678_100363272 | |||
| 1055 | Ga0070678_100441291 | |||
| 1056 | Ga0070662_100040046 | |||
| 1057 | Ga0070662_100073351 | |||
| 1058 | Ga0070681_10023995 | |||
| 1059 | Ga0070681_10086981 | |||
| 1060 | Ga0070681_10100248 | |||
| 1061 | Ga0070685_10065305 | |||
| 1062 | Ga0070706_100001269 | |||
| 1063 | Ga0070706_100003695 | |||
| 1064 | Ga0070706_100005270 | |||
| 1065 | Ga0070706_100006080 | |||
| 1066 | Ga0070706_100024878 | |||
| 1067 | Ga0070706_100025642 | |||
| 1068 | Ga0070706_100043482 | |||
| 1069 | Ga0070706_100047100 | |||
| 1070 | Ga0070706_100063667 | |||
| 1071 | Ga0070706_100164173 | |||
| 1072 | Ga0070706_100297534 | |||
| 1073 | Ga0070707_100000297 | |||
| 1074 | Ga0070707_100001249 | |||
| 1075 | Ga0070707_100003076 | |||
| 1076 | Ga0070707_100005280 | |||
| 1077 | Ga0070707_100012369 | |||
| 1078 | Ga0070707_100056602 | |||
| 1079 | Ga0070707_100100560 | |||
| 1080 | Ga0070707_100227186 | |||
| 1081 | Ga0070707_100248012 | |||
| 1082 | Ga0070698_100000013 | |||
| 1083 | Ga0070698_100002204 | |||
| 1084 | Ga0070698_100009265 | |||
| 1085 | Ga0070698_100009780 | |||
| 1086 | Ga0070698_100010926 | |||
| 1087 | Ga0070698_100016085 | |||
| 1088 | Ga0070698_100025636 | |||
| 1089 | Ga0070698_100031009 | |||
| 1090 | Ga0070698_100069327 | |||
| 1091 | Ga0070698_100104395 | |||
| 1092 | Ga0070699_100001713 | |||
| 1093 | Ga0070699_100020728 | |||
| 1094 | Ga0070699_100034432 | |||
| 1095 | Ga0070679_100079829 | |||
| 1096 | Ga0070679_100304959 | |||
| 1097 | Ga0070684_100070799 | |||
| 1098 | Ga0070697_100003247 | |||
| 1099 | Ga0070697_100041739 | |||
| 1100 | Ga0070697_100192188 | |||
| 1101 | Ga0070697_100209838 | |||
| 1102 | Ga0070686_100206095 | |||
| 1103 | Ga0070695_100014384 | |||
| 1104 | Ga0070696_100000771 | |||
| 1105 | Ga0070696_100035391 | |||
| 1106 | Ga0070696_100046225 | |||
| 1107 | Ga0070693_100340476 | |||
| 1108 | Ga0070665_100007588 | |||
| 1109 | Ga0070664_100241291 | |||
| 1110 | Ga0068857_100080817 | |||
| 1111 | Ga0068854_100127389 | |||
| 1112 | Ga0068856_100044842 | |||
| 1113 | Ga0068856_100052050 | |||
| 1114 | Ga0068856_100136980 | |||
| 1115 | Ga0070702_100004766 | |||
| 1116 | Ga0068852_100005686 | |||
| 1117 | Ga0068859_100059451 | |||
| 1118 | Ga0068859_100358782 | |||
| 1119 | Ga0068859_100359565 | |||
| 1120 | Ga0068864_100042320 | |||
| 1121 | Ga0068861_100210450 | |||
| 1122 | Ga0068863_100003224 | |||
| 1123 | Ga0068863_100030365 | |||
| 1124 | Ga0068858_100086267 | |||
| 1125 | Ga0068858_100091945 | |||
| 1126 | Ga0068858_100323981 | |||
| 1127 | Ga0068860_100390729 | |||
| 1128 | Ga0068862_100230634 | |||
| 1129 | Ga0081455_10012980 | |||
| 1130 | Ga0081540_1001190 | |||
| 1131 | Ga0070717_10003955 | |||
| 1132 | Ga0070717_10016529 | |||
| 1133 | Ga0070717_10022951 | |||
| 1134 | Ga0070717_10023037 | |||
| 1135 | Ga0070717_10023164 | |||
| 1136 | Ga0070717_10034725 | |||
| 1137 | Ga0070717_10059391 | |||
| 1138 | Ga0070717_10097677 | |||
| 1139 | Ga0070717_10114193 | |||
| 1140 | Ga0070717_10136410 | |||
| 1141 | Ga0070717_10151329 | |||
| 1142 | Ga0070717_10232254 | |||
| 1143 | Ga0075365_10053204 | |||
| 1144 | Ga0075368_10026267 | |||
| 1145 | Ga0075363_100002499 | |||
| 1146 | Ga0075363_100019518 | |||
| 1147 | Ga0075363_100030927 | |||
| 1148 | Ga0075364_10004881 | |||
| 1149 | Ga0075364_10077088 | |||
| 1150 | Ga0075364_10120586 | |||
| 1151 | Ga0070715_10036193 | |||
| 1152 | Ga0070715_10050123 | |||
| 1153 | Ga0070715_10051996 | |||
| 1154 | Ga0070716_100064061 | |||
| 1155 | Ga0070716_100094245 | |||
| 1156 | Ga0070712_100001201 | |||
| 1157 | Ga0070712_100007373 | |||
| 1158 | Ga0070712_100015306 | |||
| 1159 | Ga0070712_100021738 | |||
| 1160 | Ga0070712_100040505 | |||
| 1161 | Ga0070712_100052821 | |||
| 1162 | Ga0070712_100085619 | |||
| 1163 | Ga0070712_100209151 | |||
| 1164 | Ga0070712_100230914 | |||
| 1165 | Ga0075362_10029091 | |||
| 1166 | Ga0075370_10003064 | |||
| 1167 | Ga0075370_10017806 | |||
| 1168 | Ga0068871_100043860 | |||
| 1169 | Ga0068871_100065625 | |||
| 1170 | Ga0075428_100000550 | |||
| 1171 | Ga0075428_100122267 | |||
| 1172 | Ga0075428_100165936 | |||
| 1173 | Ga0075430_100002143 | |||
| 1174 | Ga0075434_100032282 | |||
| 1175 | Ga0075434_100056501 | |||
| 1176 | Ga0075429_100015835 | |||
| 1177 | Ga0075436_100020862 | |||
| 1178 | Ga0075436_100042357 | |||
| 1179 | Ga0075436_100206092 | |||
| 1180 | Ga0097620_100059443 | |||
| 1181 | Ga0097620_100358777 | |||
| 1182 | Ga0097620_100359553 | |||
| 1183 | Ga0075435_100005579 | |||
| 1184 | Ga0075435_100121226 | |||
| 1185 | Ga0075435_100275625 | |||
| 1186 | Ga0099795_10108310 | |||
| 1187 | Ga0111539_10042869 | |||
| 1188 | Ga0111539_10267592 | |||
| 1189 | Ga0105245_10025841 | |||
| 1190 | Ga0105247_10004677 | |||
| 1191 | Ga0114129_10000517 | |||
| 1192 | Ga0114129_10203201 | |||
| 1193 | Ga0105243_10024812 | |||
| 1194 | Ga0105243_10060520 | |||
| 1195 | Ga0105237_10003987 | |||
| 1196 | Ga0105237_10176771 | |||
| 1197 | Ga0105238_10106918 | |||
| 1198 | Ga0105249_10034058 | |||
| 1199 | Ga0105239_10003624 | |||
| 1200 | Ga0105239_10145336 | |||
| 1201 | Ga0105246_10036887 | |||
| 1202 | Ga0157340_1000852 | |||
| 1203 | Ga0157342_1001348 | |||
| 1204 | Ga0157371_10011020 | |||
| 1205 | Ga0157370_10014854 | |||
| 1206 | Ga0157370_10261495 | |||
| 1207 | Ga0157370_10364576 | |||
| 1208 | Ga0157369_10019798 | |||
| 1209 | Ga0157374_10115253 | |||
| 1210 | Ga0163162_10106884 | |||
| 1211 | Ga0163162_10314551 | |||
| 1212 | Ga0163163_10012828 | |||
| 1213 | Ga0163163_10318820 | |||
| 1214 | Ga0157377_10004816 | |||
| 1215 | Ga0157379_10023428 | |||
| 1216 | Ga0206349_1282006 | |||
| 1217 | Ga0206351_10133754 | |||
| 1218 | Ga0206354_11275327 | |||
| 1219 | Ga0206354_11425287 | |||
| 1220 | Ga0206353_10577580 | |||
| 1221 | Ga0213876_10003327 | |||
| 1222 | Ga0213875_10000292 | |||
| 1223 | Ga0213875_10008633 | |||
| 1224 | Ga0213875_10023859 | |||
| 1225 | Ga0213875_10085224 | |||
| 1226 | Ga0224712_10027138 | |||
| 1227 | Ga0224712_10031915 | |||
| 1228 | Ga0224572_1005598 | |||
| 1229 | Ga0209051_1015347 | |||
| 1230 | Ga0207692_10001325 | |||
| 1231 | Ga0207692_10005780 | |||
| 1232 | Ga0207692_10010116 | |||
| 1233 | Ga0207692_10011629 | |||
| 1234 | Ga0207692_10025048 | |||
| 1235 | Ga0207692_10125714 | |||
| 1236 | Ga0207642_10019344 | |||
| 1237 | Ga0207710_10002600 | |||
| 1238 | Ga0207688_10017033 | |||
| 1239 | Ga0207688_10058959 | |||
| 1240 | Ga0207685_10000628 | |||
| 1241 | Ga0207685_10003965 | |||
| 1242 | Ga0207699_10000282 | |||
| 1243 | Ga0207699_10000772 | |||
| 1244 | Ga0207699_10004375 | |||
| 1245 | Ga0207699_10026845 | |||
| 1246 | Ga0207699_10046759 | |||
| 1247 | Ga0207699_10072859 | |||
| 1248 | Ga0207643_10016456 | |||
| 1249 | Ga0207705_10054606 | |||
| 1250 | Ga0207684_10000569 | |||
| 1251 | Ga0207684_10001052 | |||
| 1252 | Ga0207684_10003988 | |||
| 1253 | Ga0207684_10011066 | |||
| 1254 | Ga0207684_10012727 | |||
| 1255 | Ga0207684_10015244 | |||
| 1256 | Ga0207684_10057037 | |||
| 1257 | Ga0207684_10220148 | |||
| 1258 | Ga0207684_10224381 | |||
| 1259 | Ga0207684_10255658 | |||
| 1260 | Ga0207707_10253218 | |||
| 1261 | Ga0207695_10234537 | |||
| 1262 | Ga0207671_10064503 | |||
| 1263 | Ga0207693_10002607 | |||
| 1264 | Ga0207693_10037179 | |||
| 1265 | Ga0207693_10039017 | |||
| 1266 | Ga0207693_10043294 | |||
| 1267 | Ga0207693_10051024 | |||
| 1268 | Ga0207693_10107284 | |||
| 1269 | Ga0207663_10009350 | |||
| 1270 | Ga0207663_10044861 | |||
| 1271 | Ga0207663_10102011 | |||
| 1272 | Ga0207663_10396752 | |||
| 1273 | Ga0207662_10039259 | |||
| 1274 | Ga0207657_10017194 | |||
| 1275 | Ga0207657_10270461 | |||
| 1276 | Ga0207652_10022367 | |||
| 1277 | Ga0207646_10000193 | |||
| 1278 | Ga0207646_10002442 | |||
| 1279 | Ga0207646_10009983 | |||
| 1280 | Ga0207646_10015645 | |||
| 1281 | Ga0207646_10017226 | |||
| 1282 | Ga0207646_10018514 | |||
| 1283 | Ga0207646_10046167 | |||
| 1284 | Ga0207646_10046201 | |||
| 1285 | Ga0207646_10081727 | |||
| 1286 | Ga0207646_10111812 | |||
| 1287 | Ga0207646_10242460 | |||
| 1288 | Ga0207700_10000402 | |||
| 1289 | Ga0207700_10000617 | |||
| 1290 | Ga0207700_10006063 | |||
| 1291 | Ga0207700_10013522 | |||
| 1292 | Ga0207700_10135394 | |||
| 1293 | Ga0207700_10217631 | |||
| 1294 | Ga0207700_10276759 | |||
| 1295 | Ga0207664_10000500 | |||
| 1296 | Ga0207664_10001508 | |||
| 1297 | Ga0207664_10004947 | |||
| 1298 | Ga0207664_10011349 | |||
| 1299 | Ga0207664_10012335 | |||
| 1300 | Ga0207664_10030848 | |||
| 1301 | Ga0207664_10070233 | |||
| 1302 | Ga0207664_10097741 | |||
| 1303 | Ga0207664_10120376 | |||
| 1304 | Ga0207664_10137621 | |||
| 1305 | Ga0207664_10332609 | |||
| 1306 | Ga0207644_10019033 | |||
| 1307 | Ga0207706_10022715 | |||
| 1308 | Ga0207706_10089555 | |||
| 1309 | Ga0207686_10018200 | |||
| 1310 | Ga0207709_10123245 | |||
| 1311 | Ga0207665_10001073 | |||
| 1312 | Ga0207665_10024965 | |||
| 1313 | Ga0207665_10027731 | |||
| 1314 | Ga0207691_10032411 | |||
| 1315 | Ga0207689_10012904 | |||
| 1316 | Ga0207661_10005201 | |||
| 1317 | Ga0207661_10117238 | |||
| 1318 | Ga0207661_10265465 | |||
| 1319 | Ga0207661_10318757 | |||
| 1320 | Ga0207679_10128966 | |||
| 1321 | Ga0207651_10155115 | |||
| 1322 | Ga0207668_10023324 | |||
| 1323 | Ga0207668_10113067 | |||
| 1324 | Ga0207658_10084089 | |||
| 1325 | Ga0207677_10045492 | |||
| 1326 | Ga0207703_10136815 | |||
| 1327 | Ga0207639_10152878 | |||
| 1328 | Ga0207678_10000552 | |||
| 1329 | Ga0207678_10012122 | |||
| 1330 | Ga0207708_10016973 | |||
| 1331 | Ga0207702_10192351 | |||
| 1332 | Ga0207702_10245455 | |||
| 1333 | Ga0207702_10487469 | |||
| 1334 | Ga0207641_10002132 | |||
| 1335 | Ga0207641_10040438 | |||
| 1336 | Ga0207641_10091403 | |||
| 1337 | Ga0207641_10243738 | |||
| 1338 | Ga0207641_10272842 | |||
| 1339 | Ga0207648_10069074 | |||
| 1340 | Ga0207676_10203342 | |||
| 1341 | Ga0207674_10004442 | |||
| 1342 | Ga0207674_10195303 | |||
| 1343 | Ga0207675_100022004 | |||
| 1344 | Ga0207675_100033345 | |||
| 1345 | Ga0207683_10002778 | |||
| 1346 | Ga0207683_10368872 | |||
| 1347 | Ga0207428_10039743 | |||
| 1348 | Ga0268266_10012597 | |||
| 1349 | Ga0268264_10004106 | |||
| 1350 | Ga0265337_1000029 | |||
| 1351 | Ga0265326_10002030 | |||
| 1352 | Ga0265319_1005636 | |||
| 1353 | Ga0265334_10001137 | |||
| 1354 | Ga0265318_10069542 | |||
| 1355 | Ga0265323_10014236 | |||
| 1356 | Ga0265336_10020254 | |||
| 1357 | Ga0265338_10000175 | |||
| 1358 | Ga0265338_10000436 | |||
| 1359 | Ga0265338_10004964 | |||
| 1360 | Ga0265338_10005981 | |||
| 1361 | Ga0265324_10005049 | |||
| 1362 | Ga0316177_1003448 | |||
| 1363 | Ga0316176_1024211 | |||
| 1364 | Ga0314311_1157289 | |||
| 1365 | Ga0316180_1036232 | |||
| 1366 | Ga0265332_10048359 | |||
| 1367 | Ga0265320_10005394 | |||
| 1368 | Ga0265325_10005263 | |||
| 1369 | Ga0265340_10003762 | |||
| 1370 | Ga0265339_10008916 | |||
| 1371 | Ga0265327_10000246 | |||
| 1372 | Ga0265316_10012850 | |||
| 1373 | Ga0307509_10053096 | |||
| 1374 | Ga0307408_100156669 | |||
| 1375 | Ga0265313_10006156 | |||
| 1376 | Ga0265314_10045687 | |||
| 1377 | Ga0265342_10056556 | |||
| 1378 | Ga0316578_10053577 | |||
| 1379 | Ga0316214_1005685 | |||
| 1380 | Ga0373948_0003623 | |||
| 1381 | Ga0373926_0000298 | |||
| 1382 | Ga0373926_0001951 | |||
| 1383 | Ga0373926_0053127 | |||
| 1384 | Ga0373934_0000127 | |||
| 1385 | Ga0373934_0000666 | |||
| 1386 | Ga0373934_0027350 | |||
| 1387 | Ga0373934_0041259 | |||
| 1388 | Ga0373934_0060239 | |||
| 1389 | Ga0373940_0004432 | |||
| 1390 | Ga0373940_0007303 | |||
| 1391 | Ga0373949_0008783 | |||
| 1392 | Ga0373923_0000778 | |||
| 1393 | Ga0373923_0023180 | |||
| 1394 | Ga0373923_0043236 | |||
| 1395 | Ga0373923_0058186 | |||
| 1396 | Ga0373923_0082047 | |||
| 1397 | Ga0373932_0027270 | |||
| 1398 | Ga0373936_0000200 | |||
| 1399 | Ga0373936_0003669 | |||
| 1400 | Ga0373936_0005680 | |||
| 1401 | Ga0373939_0084863 | |||
| 1402 | Ga0373941_0056713 | |||
| 1403 | Ga0373945_0000615 | |||
| 1404 | Ga0373945_0022029 | |||
| 1405 | Ga0373953_0001228 | |||
| 1406 | Ga0373953_0001345 | |||
| 1407 | Ga0373953_0005883 | |||
| 1408 | Ga0373953_0010326 | |||
| 1409 | Ga0373953_0023360 | |||
| 1410 | Ga0373953_0116948 | |||
| 1411 | Ga0373954_0004112 | |||
| 1412 | Ga0373954_0070300 | |||
| 1413 | Ga0373954_0105597 | |||
| 1414 | Ga0373954_0109196 | |||
| 1415 | Ga0373954_0198131 | |||
| 1416 | Ga0373956_0005048 | |||
| 1417 | Ga0373956_0007016 | |||
| 1418 | Ga0373956_0015390 | |||
| 1419 | Ga0373956_0018019 | |||
| 1420 | Ga0373956_0023777 | |||
| 1421 | Ga0373957_0000382 | |||
| 1422 | Ga0373957_0001217 | |||
| 1423 | Ga0373957_0005940 | |||
| 1424 | Ga0373957_0018173 | |||
| 1425 | Ga0373957_0028488 | |||
| 1426 | Ga0373943_0001122 | |||
| 1427 | Ga0373943_0005113 | |||
| 1428 | Ga0373943_0028916 | |||
| 1429 | Ga0373943_0153787 | |||
| 1430 | Ga0373943_0193654 | |||
| 1431 | Ga0373946_0000133 | |||
| 1432 | Ga0373946_0000657 | |||
| 1433 | Ga0373946_0022631 | |||
| 1434 | Ga0373955_0000104 | |||
| 1435 | Ga0373955_0002558 | |||
| 1436 | Ga0373955_0003003 | |||
| 1437 | Ga0373955_0019613 | |||
| 1438 | Ga0373955_0021614 | |||
| 1439 | Ga0373955_0037185 | |||
| 1440 | Ga0373942_0014022 | |||
| 1441 | Ga0373961_0021412 | |||
| 1442 | Ga0373962_0024411 | |||
| 1443 | Ga0373924_0000089 | |||
| 1444 | Ga0373924_0000461 | |||
| 1445 | Ga0373924_0018443 | |||
| 1446 | Ga0373924_0060119 | |||
| 1447 | Ga0373924_0072630 | |||
| 1448 | Ga0373924_0121781 | |||
| 1449 | Ga0373931_0012604 | |||
| 1450 | Ga0373935_0001924 | |||
| 1451 | Ga0373935_0018839 | |||
| 1452 | Ga0373935_0022142 | |||
| 1453 | Ga0373935_0032679 | |||
| 1454 | Ga0373935_0054497 | |||
| 1455 | Ga0373935_0076685 | |||
| 1456 | Ga0373935_0076706 | |||
| 1457 | Ga0373927_0004795 | |||
| 1458 | Ga0373927_0022395 | |||
| 1459 | Ga0373927_0100916 | |||
| 1460 | Ga0373933_0000344 | |||
| 1461 | Ga0373933_0008889 | |||
| 1462 | Ga0373933_0013645 | |||
| 1463 | Ga0373933_0022514 | |||
| 1464 | Ga0373933_0032943 | |||
| 1465 | Ga0373933_0038674 | |||
| 1466 | Ga0373933_0061357 | |||
| 1467 | Ga0373947_0000001 | |||
| 1468 | Ga0373947_0000713 | |||
| 1469 | Ga0373947_0002054 | |||
| 1470 | Ga0373947_0052877 | |||
| 1471 | Ga0373947_0056245 | |||
| 1472 | Ga0373947_0220274 | |||
| 1473 | Ga0373937_0000029 | |||
| 1474 | Ga0373937_0001321 | |||
| 1475 | Ga0373937_0019707 | |||
| 1476 | Ga0373937_0023604 | |||
| 1477 | Ga0373937_0053453 | |||
| 1478 | Ga0373937_0109196 | |||
| 1479 | Ga0373937_0122863 | |||
| 1480 | Ga0373937_0138862 | |||
| 1481 | Ga0373937_0142425 | |||
| 1482 | Ga0373937_0169624 | |||
| 1483 | Ga0372808_005845 | |||
| 1484 | Ga0373925_0000051 | |||
| 1485 | Ga0373925_0000746 | |||
| 1486 | Ga0373925_0001818 | |||
| 1487 | Ga0373925_0012835 | |||
| 1488 | Ga0373925_0044607 | |||
| 1489 | Ga0373925_0054461 | |||
| 1490 | Ga0373925_0066392 | |||
| 1491 | Ga0373925_0089925 | |||
| 1492 | Ga0373925_0166099 | |||
| 1493 | Ga0395900_0447085 | |||
| 1494 | Ga0436364_0022484 | |||
| 1495 | Ga0436364_0038371 | |||
| 1496 | Ga0436364_0207895 | |||
| 1497 | Ga0436364_0261777 | |||
| 1498 | Ga0436364_0607771 | |||
| 1499 | Ga0436364_0653920 | |||
| 1500 | Ga0436364_1492889 | |||
| 1501 | Ga0436365_0469598 | |||
| 1502 | Ga0436365_0795808 | |||
| 1503 | Ga0436365_1139118 | |||
| 1504 | Ga0436365_1324307 | |||
| 1505 | Ga0436365_1937384 | |||
| 1506 | Ga0436360_0620934 | |||
| 1507 | Ga0436363_0275598 | |||
| 1508 | Ga0436363_0802797 | |||
| 1509 | Ga0436363_0915299 | |||
| 1510 | Ga0466972_0002299 | |||
| 1511 | Ga0466972_0005017 | |||
| 1512 | Ga0466972_0011314 | |||
| 1513 | Ga0466972_0070602 | |||
| 1514 | Ga0466965_0007426 | |||
| 1515 | Ga0466965_0012306 | |||
| 1516 | Ga0466965_0015451 | |||
| 1517 | Ga0466966_0007826 | |||
| 1518 | Ga0466966_0118455 | |||
| 1519 | Ga0466961_0009319 | |||
| 1520 | Ga0466961_0269615 | |||
| 1521 | Ga0466963_0009920 | |||
| 1522 | Ga0466963_0028403 | |||
| 1523 | Ga0466963_0034847 | |||
| 1524 | Ga0466963_0082914 | |||
| 1525 | Ga0466963_0158614 | |||
| 1526 | Ga0466963_0223201 | |||
| 1527 | Ga0466971_0036024 | |||
| 1528 | Ga0466968_0000520 | |||
| 1529 | Ga0466970_0015442 | |||
| 1530 | Ga0466970_0018922 | |||
| 1531 | Ga0466957_0044411 | |||
| 1532 | Ga0466957_0110955 | |||
| 1533 | Ga0466957_0301196 | |||
| 1534 | Ga0466960_0001803 | |||
| 1535 | Ga0466960_0002210 | |||
| 1536 | Ga0466960_0005461 | |||
| 1537 | Ga0466960_0007239 | |||
| 1538 | Ga0466959_0001523 | |||
| 1539 | Ga0466959_0128134 | |||
| 1540 | Ga0466958_0012622 | |||
| 1541 | Ga0466958_0079049 | |||
| 1542 | Ga0466958_0123415 | |||
| 1543 | Ga0466958_0210483 | |||
| 1544 | Ga0466967_0026207 | |||
| 1545 | Ga0466967_0041230 | |||
| 1546 | Ga0466967_0060504 | |||
| 1547 | Ga0466967_0067276 | |||
| 1548 | Ga0466967_0107709 | |||
| 1549 | Ga0466967_0108943 | |||
| 1550 | Ga0466967_0267124 | |||
| 1551 | Ga0466967_0281218 | |||
| 1552 | Ga0466967_0343048 | |||
| 1553 | Ga0495592_0000040 | |||
| 1554 | Ga0495592_0004066 | |||
| 1555 | Ga0495592_0004607 | |||
| 1556 | Ga0495592_0014414 | |||
| 1557 | Ga0495592_0026105 | |||
| 1558 | Ga0495592_0174242 | |||
| 1559 | Ga0495592_0258768 | |||
| 1560 | Ga0495603_0003281 | |||
| 1561 | Ga0495629_0009622 | |||
| 1562 | Ga0495629_0016375 | |||
| 1563 | Ga0495629_0020486 | |||
| 1564 | Ga0495629_0209935 | |||
| 1565 | Ga0495641_0002661 | |||
| 1566 | Ga0495641_0008226 | |||
| 1567 | Ga0495641_0023583 | |||
| 1568 | Ga0495651_0000017 | |||
| 1569 | Ga0495651_0004720 | |||
| 1570 | Ga0495651_0008205 | |||
| 1571 | Ga0495651_0011586 | |||
| 1572 | Ga0495651_0043565 | |||
| 1573 | Ga0495651_0077846 | |||
| 1574 | Ga0495651_0299850 | |||
| 1575 | Ga0495653_0002780 | |||
| 1576 | Ga0495653_0005046 | |||
| 1577 | Ga0495653_0005317 | |||
| 1578 | Ga0495653_0006639 | |||
| 1579 | Ga0495653_0010190 | |||
| 1580 | Ga0495653_0104450 | |||
| 1581 | Ga0495653_0193363 | |||
| 1582 | Ga0495650_0067876 | |||
| 1583 | Ga0495580_0001230 | |||
| 1584 | Ga0495580_0172776 | |||
| 1585 | Ga0495582_0000867 | |||
| 1586 | Ga0495582_0115017 | |||
| 1587 | Ga0495639_0003679 | |||
| 1588 | Ga0495639_0113780 | |||
| 1589 | Ga0495662_0000668 | |||
| 1590 | Ga0495662_0018037 | |||
| 1591 | Ga0495662_0024483 | |||
| 1592 | Ga0495662_0034250 | |||
| 1593 | Ga0495662_0059792 | |||
| 1594 | Ga0495664_0004823 | |||
| 1595 | Ga0495664_0005990 | |||
| 1596 | Ga0495664_0020630 | |||
| 1597 | Ga0495664_0046273 | |||
| 1598 | Ga0495664_0068699 | |||
| 1599 | Ga0495664_0074885 | |||
| 1600 | Ga0495664_0154613 | |||
| 1601 | Ga0495606_0033078 | |||
| 1602 | Ga0495608_0000415 | |||
| 1603 | Ga0495608_0006208 | |||
| 1604 | Ga0495608_0008989 | |||
| 1605 | Ga0495608_0021664 | |||
| 1606 | Ga0495608_0050356 | |||
| 1607 | Ga0495618_0002727 | |||
| 1608 | Ga0495618_0012852 | |||
| 1609 | Ga0495618_0026176 | |||
| 1610 | Ga0495618_0047569 | |||
| 1611 | Ga0495618_0109903 | |||
| 1612 | Ga0495628_0000756 | |||
| 1613 | Ga0495628_0009420 | |||
| 1614 | Ga0495628_0020189 | |||
| 1615 | Ga0495628_0059312 | |||
| 1616 | Ga0495628_0124644 | |||
| 1617 | Ga0495628_0232791 | |||
| 1618 | Ga0495630_0001078 | |||
| 1619 | Ga0495630_0033094 | |||
| 1620 | Ga0495630_0071256 | |||
| 1621 | Ga0495630_0120944 | |||
| 1622 | Ga0495666_0003716 | |||
| 1623 | Ga0495666_0060684 | |||
| 1624 | Ga0495666_0072473 | |||
| 1625 | Ga0495652_0003051 | |||
| 1626 | Ga0495652_0010386 | |||
| 1627 | Ga0495652_0058652 | |||
| 1628 | Ga0495652_0064690 | |||
| 1629 | Ga0495652_0149268 | |||
| 1630 | Ga0495652_0173913 | |||
| 1631 | Ga0495652_0177097 | |||
| 1632 | Ga0495665_0000134 | |||
| 1633 | Ga0495665_0009177 | |||
| 1634 | Ga0495665_0011365 | |||
| 1635 | Ga0495640_0009227 | |||
| 1636 | Ga0495640_0029695 | |||
| 1637 | Ga0495640_0198796 | |||
| 1638 | Ga0495586_0002971 | |||
| 1639 | Ga0495587_0000419 | |||
| 1640 | Ga0495587_0002110 | |||
| 1641 | Ga0495587_0009754 | |||
| 1642 | Ga0495587_0033147 | |||
| 1643 | Ga0495587_0035854 | |||
| 1644 | Ga0495587_0039213 | |||
| 1645 | Ga0495587_0045103 | |||
| 1646 | Ga0495587_0073360 | |||
| 1647 | Ga0495645_0008285 | |||
| 1648 | Ga0495645_0038872 | |||
| 1649 | Ga0495645_0040081 | |||
| 1650 | Ga0495645_0064146 | |||
| 1651 | Ga0495645_0102574 | |||
| 1652 | Ga0495622_0058710 | |||
| 1653 | Ga0495667_0000336 | |||
| 1654 | Ga0495667_0002108 | |||
| 1655 | Ga0495667_0005389 | |||
| 1656 | Ga0495667_0010012 | |||
| 1657 | Ga0495667_0010079 | |||
| 1658 | Ga0495667_0021069 | |||
| 1659 | Ga0495667_0025039 | |||
| 1660 | Ga0495667_0031721 | |||
| 1661 | Ga0495634_0003699 | |||
| 1662 | Ga0495634_0061896 | |||
| 1663 | Ga0495634_0066969 | |||
| 1664 | Ga0495634_0212588 | |||
| 1665 | Ga0495634_0213915 | |||
| 1666 | Ga0495635_0001724 | |||
| 1667 | Ga0495635_0012119 | |||
| 1668 | Ga0495635_0047265 | |||
| 1669 | Ga0495635_0047908 | |||
| 1670 | Ga0495635_0052668 | |||
| 1671 | Ga0495635_0055387 | |||
| 1672 | Ga0495635_0056829 | |||
| 1673 | Ga0495635_0070778 | |||
| 1674 | Ga0495635_0073060 | |||
| 1675 | Ga0495635_0099653 | |||
| 1676 | Ga0495588_0025172 | |||
| 1677 | Ga0495657_0000032 | |||
| 1678 | Ga0495657_0020005 | |||
| 1679 | Ga0495657_0026860 | |||
| 1680 | Ga0495657_0036208 | |||
| 1681 | Ga0495657_0043318 | |||
| 1682 | Ga0495657_0045281 | |||
| 1683 | Ga0495657_0046319 | |||
| 1684 | Ga0495657_0055247 | |||
| 1685 | Ga0495599_0000412 | |||
| 1686 | Ga0495599_0004894 | |||
| 1687 | Ga0495599_0025657 | |||
| 1688 | Ga0495599_0037219 | |||
| 1689 | Ga0495599_0056674 | |||
| 1690 | Ga0495599_0093726 | |||
| 1691 | Ga0495599_0098378 | |||
| 1692 | Ga0495599_0190100 | |||
| 1693 | Ga0495623_0000675 | |||
| 1694 | Ga0495623_0029862 | |||
| 1695 | Ga0495623_0037567 | |||
| 1696 | Ga0495623_0123594 | |||
| 1697 | Ga0495646_0005293 | |||
| 1698 | Ga0495646_0013379 | |||
| 1699 | Ga0495646_0039402 | |||
| 1700 | Ga0495646_0055727 | |||
| 1701 | Ga0495646_0058163 | |||
| 1702 | Ga0495658_0000376 | |||
| 1703 | Ga0495658_0048718 | |||
| 1704 | Ga0495613_0001261 | |||
| 1705 | Ga0495613_0021059 | |||
| 1706 | Ga0495613_0180187 | |||
| 1707 | Ga0495624_0001162 | |||
| 1708 | Ga0495624_0007172 | |||
| 1709 | Ga0495624_0035272 | |||
| 1710 | Ga0495624_0088418 | |||
| 1711 | Ga0495649_0157896 | |||
| 1712 | Ga0495600_0000683 | |||
| 1713 | Ga0495600_0012175 | |||
| 1714 | Ga0495600_0021876 | |||
| 1715 | Ga0495600_0024003 | |||
| 1716 | Ga0495600_0051462 | |||
| 1717 | Ga0495600_0072233 | |||
| 1718 | Ga0495600_0271672 | |||
| 1719 | Ga0495581_0004652 | |||
| 1720 | Ga0495581_0004741 | |||
| 1721 | Ga0495581_0014002 | |||
| 1722 | Ga0495581_0037476 | |||
| 1723 | Ga0495581_0100853 | |||
| 1724 | Ga0495604_0000627 | |||
| 1725 | Ga0495604_0010768 | |||
| 1726 | Ga0495604_0013549 | |||
| 1727 | Ga0495604_0029565 | |||
| 1728 | Ga0495604_0052683 | |||
| 1729 | Ga0495604_0100193 | |||
| 1730 | Ga0495674_0004676 | |||
| 1731 | Ga0495674_0009201 | |||
| 1732 | Ga0495674_0026417 | |||
| 1733 | Ga0495674_0154271 | |||
| 1734 | Ga0495674_0219602 | |||
| 1735 | Ga0495676_0002068 | |||
| 1736 | Ga0495676_0011340 | |||
| 1737 | Ga0495676_0163060 | |||
| 1738 | Ga0495680_0001340 | |||
| 1739 | Ga0495680_0002955 | |||
| 1740 | Ga0495680_0004557 | |||
| 1741 | Ga0495680_0017001 | |||
| 1742 | Ga0495680_0024279 | |||
| 1743 | Ga0495680_0157438 | |||
| 1744 | Ga0495675_0008576 | |||
| 1745 | Ga0495675_0023434 | |||
| 1746 | Ga0495675_0026076 | |||
| 1747 | Ga0495675_0064642 | |||
| 1748 | Ga0495685_010874 | |||
| 1749 | Ga0495684_0002024 | |||
| 1750 | Ga0495684_0002236 | |||
| 1751 | Ga0495684_0009603 | |||
| 1752 | Ga0495684_0010833 | |||
| 1753 | Ga0495684_0020391 | |||
| 1754 | Ga0495684_0027577 | |||
| 1755 | Ga0495684_0058448 | |||
| 1756 | Ga0495684_0114025 | |||
| 1757 | Ga0495684_0211035 | |||
| 1758 | Ga0495686_0023719 | |||
| 1759 | Ga0495593_0002690 | |||
| 1760 | Ga0495593_0007716 | |||
| 1761 | Ga0495593_0012450 | |||
| 1762 | Ga0495593_0041959 | |||
| 1763 | Ga0495602_0001077 | |||
| 1764 | Ga0495602_0030905 | |||
| 1765 | Ga0495602_0040713 | |||
| 1766 | Ga0495602_0045172 | |||
| 1767 | Ga0495602_0060021 | |||
| 1768 | Ga0495602_0156441 | |||
| 1769 | Ga0495614_0009076 | |||
| 1770 | Ga0496100_0001640 | |||
| 1771 | Ga0496100_0082488 | |||
| 1772 | Ga0496100_0198350 | |||
| 1773 | Ga0496101_0000395 | |||
| 1774 | Ga0496101_0093368 | |||
| 1775 | Ga0496101_0133587 | |||
| 1776 | Ga0496102_0000011 | |||
| 1777 | Ga0496102_0000029 | |||
| 1778 | Ga0496102_0000292 | |||
| 1779 | Ga0496102_0049716 | |||
| 1780 | Ga0496102_0078587 | |||
| 1781 | Ga0496102_0166598 | |||
| 1782 | Ga0496102_0224414 | |||
| 1783 | Ga0496103_0000143 | |||
| 1784 | Ga0496103_0000296 | |||
| 1785 | Ga0496103_0000431 | |||
| 1786 | Ga0496103_0037709 | |||
| 1787 | Ga0496103_0062898 | |||
| 1788 | Ga0496104_0008912 | |||
| 1789 | Ga0496105_0006989 | |||
| 1790 | Ga0496105_0027956 | |||
| 1791 | Ga0496106_0002927 | |||
| 1792 | Ga0496106_0189331 | |||
| 1793 | Ga0496107_0005683 | |||
| 1794 | Ga0496107_0055516 | |||
| 1795 | Ga0496108_0131740 | |||
| 1796 | Ga0496108_0131853 | |||
| 1797 | Ga0496109_0068511 | |||
| 1798 | Ga0496109_0072263 | |||
| 1799 | Ga0496109_0156681 | |||
| 1800 | Ga0496110_0016518 | |||
| 1801 | Ga0496110_0043835 | |||
| 1802 | Ga0496110_0053361 | |||
| 1803 | Ga0496110_0091469 | |||
| 1804 | Ga0496110_0102664 | |||
| 1805 | Ga0496111_0016728 | |||
| 1806 | Ga0496111_0026714 | |||
| 1807 | Ga0496112_0034576 | |||
| 1808 | Ga0496112_0122137 | |||
| 1809 | Ga0496113_0011885 | |||
| 1810 | Ga0496113_0017401 | |||
| 1811 | Ga0496113_0130492 | |||
| 1812 | Ga0496113_0305993 | |||
| 1813 | Ga0496114_0003724 | |||
| 1814 | Ga0496114_0276679 | |||
| 1815 | Ga0496114_0345998 | |||
| 1816 | Ga0496115_0082002 | |||
| 1817 | Ga0496115_0084901 | |||
| 1818 | Ga0496116_0000072 | |||
| 1819 | Ga0496116_0000422 | |||
| 1820 | Ga0496117_0000039 | |||
| 1821 | Ga0496117_0000682 | |||
| 1822 | Ga0496118_0000035 | |||
| 1823 | Ga0496118_0000437 | |||
| 1824 | Ga0496118_0000598 | |||
| 1825 | Ga0496119_0000517 | |||
| 1826 | Ga0496119_0002265 | |||
| 1827 | Ga0496119_0039881 | |||
| 1828 | Ga0496119_0060487 | |||
| 1829 | Ga0496119_0143577 | |||
| 1830 | Ga0496120_0000631 | |||
| 1831 | Ga0496120_0038488 | |||
| 1832 | Ga0496121_0002639 | |||
| 1833 | Ga0496121_0132651 | |||
| 1834 | Ga0496122_0021922 | |||
| 1835 | Ga0496123_0009759 | |||
| 1836 | Ga0496126_0000344 | |||
| 1837 | Ga0496126_0000379 | |||
| 1838 | Ga0496126_0002073 | |||
| 1839 | Ga0496126_0002899 | |||
| 1840 | Ga0496126_0005028 | |||
| 1841 | Ga0496126_0053530 | |||
| 1842 | Ga0496126_0198462 | |||
| 1843 | Ga0496126_0253578 | |||
| 1844 | Ga0501031_0000061 | |||
| 1845 | Ga0501032_0000155 | |||
| 1846 | Ga0501032_0075471 | |||
| 1847 | Ga0501032_0107558 | |||
| 1848 | Ga0501033_0000217 | |||
| 1849 | Ga0501034_0001039 | |||
| 1850 | Ga0501034_0122402 | |||
| 1851 | Ga0501034_0168470 | |||
| 1852 | Ga0501036_0002172 | |||
| 1853 | Ga0501036_0047832 | |||
| 1854 | Ga0501037_0026771 | |||
| 1855 | Ga0501037_0058863 | |||
| 1856 | Ga0501038_0000167 | |||
| 1857 | Ga0501039_0000153 | |||
| 1858 | Ga0501042_0101359 | |||
| 1859 | Ga0501043_0000079 | |||
| 1860 | Ga0501043_0001428 | |||
| 1861 | Ga0501043_0072309 | |||
| 1862 | Ga0501046_0008291 | |||
| 1863 | Ga0501047_0000565 | |||
| 1864 | Ga0501047_0010544 | |||
| 1865 | Ga0501047_0017638 | |||
| 1866 | Ga0501047_0084715 | |||
| 1867 | Ga0501047_0179657 | |||
| 1868 | Ga0501047_0277844 | |||
| 1869 | Ga0501048_0000141 | |||
| 1870 | Ga0501048_0008749 | |||
| 1871 | Ga0501067_0004847 | |||
| 1872 | Ga0501069_0000117 | |||
| 1873 | Ga0501069_0012357 | |||
| 1874 | Ga0501069_0244191 | |||
| 1875 | Ga0501070_0000217 | |||
| 1876 | Ga0501070_0001241 | |||
| 1877 | Ga0501070_0024834 | |||
| 1878 | Ga0501070_0125394 | |||
| 1879 | Ga0501070_0413083 | |||
| 1880 | Ga0501071_0025200 | |||
| 1881 | Ga0501073_0006678 | |||
| 1882 | Ga0501073_0032860 | |||
| 1883 | Ga0501074_0000226 | |||
| 1884 | Ga0501074_0003971 | |||
| 1885 | Ga0501080_0000079 | |||
| 1886 | Ga0501080_0001119 | |||
| 1887 | Ga0501080_0033432 | |||
| 1888 | Ga0501035_0000786 | |||
| 1889 | Ga0501035_0015462 | |||
| 1890 | Ga0501044_0001530 | |||
| 1891 | Ga0501044_0022723 | |||
| 1892 | nmdc:mga03n38_1095_c1 | |||
| 1893 | nmdc:mga03n38_11307_c1 | |||
| 1894 | nmdc:mga03n38_8689_c1 | |||
| 1895 | nmdc:mga00v17_12331_c1 | |||
| 1896 | nmdc:mga00v17_7415_c1 | |||
| 1897 | nmdc:mga06z11_9524_c1 | |||
| 1898 | nmdc:mga04h51_19012_c1 | |||
| 1899 | nmdc:mga07m45_172057_c1 | |||
| 1900 | nmdc:mga05p37_174869_c1 | |||
| 1901 | nmdc:mga05p37_357616_c1 | |||
| 1902 | nmdc:mga09592_11839_c1 | |||
| 1903 | nmdc:mga0n895_10593_c1 | |||
| 1904 | nmdc:mga0n895_36156_c1 | |||
| 1905 | nmdc:mga0n895_403209_c1 | |||
| 1906 | nmdc:mga0rr50_145137_c1 | |||
| 1907 | nmdc:mga0rr50_313434_c1 | |||
| 1908 | nmdc:mga0rr50_4657_c1 | |||
| 1909 | nmdc:mga0rr50_80405_c1 | |||
| 1910 | nmdc:mga08x19_36785_c1 | |||
| 1911 | nmdc:mga08x19_9136_c1 | |||
| 1912 | nmdc:mga0a205_173719_c1 | |||
| 1913 | Ga0495601_0001363 | |||
| 1914 | Ga0495601_0022765 | |||
| 1915 | Ga0495601_0031731 | |||
| 1916 | Ga0495612_0001188 | |||
| 1917 | Ga0495612_0006147 | |||
| 1918 | Ga0495612_0021323 | |||
| 1919 | Ga0500635_0005708 | |||
| 1920 | Ga0495595_0067103 | |||
| 1921 | Ga0495619_0000574 | |||
| 1922 | Ga0495619_0027532 | |||
| 1923 | Ga0495619_0040378 | |||
| 1924 | Ga0495619_0111073 | |||
| 1925 | Ga0500643_001870 | |||
| 1926 | Ga0500559_0002620 | |||
| 1927 | Ga0500559_0020901 | |||
| 1928 | Ga0501084_0003565 | |||
| 1929 | Ga0466962_0052625 | |||
| 1930 | 2501943711 | |||
| 1931 | 2515721142 | |||
| 1932 | 2515850619 | |||
| 1933 | 2516084251 | |||
| 1934 | 2623585723 | |||
| 1935 | 2644014053 | |||
| 1936 | 2644174385 | |||
| 1937 | 2644445087 | |||
| 1938 | 2676475169 | |||
| 1939 | 2739602995 | |||
| 1940 | 2808851881 | |||
| 1941 | 2816425648 | |||
| 1942 | 2816505811 | |||
| 1943 | 2817508483 | |||
| 1944 | 2827629898 | |||
| 1945 | 2856743867 | |||
| 1946 | 2856859608 | |||
| 1947 | 2857727926 | |||
| 1948 | 2861528174 | |||
| 1949 | 2867509836 | |||
| 1950 | 2870783043 | |||
| 1951 | 2873319493 | |||
| 1952 | 2883825436 | |||
| 1953 | 2891331119 | |||
| 1954 | 2891400575 | |||
| 1955 | 2891562277 | |||
| 1956 | 2891569693 | |||
| 1957 | 2902797350 | |||
| 1958 | 2905927635 | |||
| 1959 | 2905929192 | |||
| 1960 | 2915363091 | |||
| 1961 | 2917740971 | |||
| 1962 | 3003009313 | |||
| 1963 | 649816316 | |||
| 1964 | 8004022882 | |||
| 1965 | 8004026101 | |||
| 1966 | 8053953147 | |||
| 1967 | 8054476866 | |||
| 1968 | 8055069984 | |||
| 1969 | 8055174623 | |||
| 1970 | 8057571017 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.9189 | 31 | 335 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.9166 | 31 | 335 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.8575 | 31 | 335 |
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.857 | 31 | 335 |
| 6y1x-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8222 | 39 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJS1_27_360_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.98 | 30 | 357 | 3.20.20.70 |
| af_P9WJS1_27_360_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9597 | 30 | 357 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9566 | 28 | 357 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9509 | 28 | 357 | 3.20.20.70 |
| af_P9WJS3_16_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9299 | 30 | 357 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6H1A2P6-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) | 0.994 | 30 | 357 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 GO:1904047 |
| AF-A0A3G8ZJ84-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) | 0.9893 | 22 | 357 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 GO:1904047 |
| AF-A0A7W0ID98-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) | 0.9877 | 27 | 357 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 GO:1904047 |
| AF-A0A2X0IJG0-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) | 0.9855 | 27 | 357 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 GO:1904047 |
| AF-A0A6H1A2P6-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) | 0.985 | 30 | 357 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 GO:1904047 |