F487512

General Info

Members Datasets Scaffolds Average Seq Length
985 384 1970 333

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_013913|Ga0500572_013913_15_1196
Length 393
Sequence MRHHSDDRDALAETAVICVFPQTTRQVARAVTAITLDLVTLVDLGLPTMPGTTPVDNTVPRPDSPLLVDQFGRVARDLRVSLTDRCNLRCTYCMPAEGLDWLPSPELLSDDELIRLLRVAVADLGVTNVRFTGGEPLLRRGLVDIVAATAALRPRPRISMTTNGIGLARRAEALADAGLDRVNVSLDTLRSNRFVEIARRDRLSDVLNGLAAARAAGLSPVKVNAVLLRGVNDDEAAGLLRFCVQNGYHLRFIEQMPLDPQHGWHRASLVTADEILTMLHKEFDLTPSETPRGSAPAERWLVDGGPAQVGVIGSVTRPFCADCDRSRLTADGQMRNCLFSQTETDLRGPLRAGAGDDELAGTWRAGTWTKLAGHRINDAGFAQPIRPMSAIGG

Samples

Sample ID Description Type Environment
1 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
163 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
164 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
165 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 2501939600 Micromonospora sp. L5 Isolate Unclassified
346 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
347 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
348 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
349 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
350 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
351 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
352 2643221679 Angustibacter sp. Root456 Isolate Unclassified
353 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
354 2739367653 Kocuria sp. OV113 Isolate Unclassified
355 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
356 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
357 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
358 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
359 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
360 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
361 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
362 2857727296 Kocuria sp. R-72562 Isolate Unclassified
363 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
364 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
365 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
366 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
367 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
368 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
369 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
370 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
371 2891562705 Microbispora tritici MT50 Isolate Unclassified
372 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
373 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
374 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
375 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
376 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
377 649633069 Micromonospora sp. L5 Isolate Unclassified
378 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
379 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
380 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
381 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
382 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
383 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
384 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0.91
Isolates 4.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 4.87
Rhizosphere 85.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500572_013913 3300053111 Bacteria 2001
2 Ga0006562J51391_1065946 3300003578 Bacteria 1640
3 Ga0070683_100032402 3300005329 Bacteria 4759
4 Ga0070683_100082859 3300005329 Bacteria 3004
5 Ga0070690_100350394 3300005330 Bacteria 1071
6 Ga0068869_100020459 3300005334 Bacteria 4537
7 Ga0068869_100063944 3300005334 Bacteria 2705
8 Ga0070666_10041765 3300005335 Bacteria 3065
9 Ga0070680_100147309 3300005336 Bacteria 1976
10 Ga0070682_100050527 3300005337 Bacteria 2596
11 Ga0070682_100095390 3300005337 Bacteria 1953
12 Ga0068868_100225971 3300005338 Bacteria 1569
13 Ga0068868_100276552 3300005338 Bacteria 1420
14 Ga0070689_100175330 3300005340 Bacteria 1739
15 Ga0070687_100007051 3300005343 Bacteria 4650
16 Ga0070661_100060301 3300005344 Bacteria 2784
17 Ga0070661_100070263 3300005344 Bacteria 2575
18 Ga0070668_100075083 3300005347 Bacteria 2638
19 Ga0070668_100087917 3300005347 Bacteria 2446
20 Ga0070669_100119215 3300005353 Bacteria 2011
21 Ga0070675_100061776 3300005354 Bacteria 3094
22 Ga0070671_100002762 3300005355 Bacteria 13632
23 Ga0070673_100099206 3300005364 Bacteria 2395
24 Ga0070673_100301505 3300005364 Bacteria 1411
25 Ga0070709_10000127 3300005434 Bacteria 50350
26 Ga0070709_10000306 3300005434 Bacteria 31025
27 Ga0070709_10033374 3300005434 Bacteria 3112
28 Ga0070709_10065967 3300005434 Bacteria 2320
29 Ga0070709_10232543 3300005434 Bacteria 1320
30 Ga0070714_100001423 3300005435 Bacteria 17383
31 Ga0070714_100004430 3300005435 Bacteria 10569
32 Ga0070714_100006087 3300005435 Bacteria 9268
33 Ga0070714_100031980 3300005435 Bacteria 4393
34 Ga0070714_100052519 3300005435 Bacteria 3476
35 Ga0070714_100106131 3300005435 Bacteria 2481
36 Ga0070714_100165938 3300005435 Bacteria 2001
37 Ga0070714_100176271 3300005435 Bacteria 1943
38 Ga0070714_100203388 3300005435 Bacteria 1812
39 Ga0070714_100237441 3300005435 Bacteria 1681
40 Ga0070714_100274434 3300005435 Bacteria 1564
41 Ga0070714_100377148 3300005435 Bacteria 1336
42 Ga0070713_100002458 3300005436 Bacteria 12098
43 Ga0070713_100004485 3300005436 Bacteria 9386
44 Ga0070713_100017290 3300005436 Bacteria 5450
45 Ga0070713_100017870 3300005436 Bacteria 5378
46 Ga0070713_100068179 3300005436 Bacteria 2997
47 Ga0070713_100124013 3300005436 Bacteria 2269
48 Ga0070713_100227770 3300005436 Bacteria 1693
49 Ga0070713_100309530 3300005436 Bacteria 1456
50 Ga0070710_10000263 3300005437 Bacteria 25012
51 Ga0070710_10000784 3300005437 Bacteria 15212
52 Ga0070710_10003125 3300005437 Bacteria 7843
53 Ga0070710_10036614 3300005437 Bacteria 2683
54 Ga0070710_10156020 3300005437 Bacteria 1412
55 Ga0070711_100000252 3300005439 Bacteria 27454
56 Ga0070711_100002553 3300005439 Bacteria 10422
57 Ga0070711_100054730 3300005439 Bacteria 2754
58 Ga0070711_100075813 3300005439 Bacteria 2383
59 Ga0070711_100287801 3300005439 Bacteria 1302
60 Ga0070700_100126212 3300005441 Bacteria 1721
61 Ga0070694_100057693 3300005444 Bacteria 2640
62 Ga0070708_100002180 3300005445 Bacteria 15120
63 Ga0070708_100010328 3300005445 Bacteria 7561
64 Ga0070708_100055178 3300005445 Bacteria 3533
65 Ga0070708_100145303 3300005445 Bacteria 2202
66 Ga0070708_100178759 3300005445 Bacteria 1983
67 Ga0070663_100158772 3300005455 Bacteria 1739
68 Ga0070678_100272595 3300005456 Bacteria 1428
69 Ga0070678_100363272 3300005456 Bacteria 1248
70 Ga0070678_100441291 3300005456 Bacteria 1138
71 Ga0070662_100040046 3300005457 Bacteria 3335
72 Ga0070662_100073351 3300005457 Bacteria 2528
73 Ga0070681_10023995 3300005458 Bacteria 6140
74 Ga0070681_10086981 3300005458 Bacteria 3079
75 Ga0070681_10100248 3300005458 Bacteria 2842
76 Ga0070685_10065305 3300005466 Bacteria 2141
77 Ga0070706_100001269 3300005467 Bacteria 26954
78 Ga0070706_100003695 3300005467 Bacteria 14971
79 Ga0070706_100005270 3300005467 Bacteria 12334
80 Ga0070706_100006080 3300005467 Bacteria 11410
81 Ga0070706_100024878 3300005467 Bacteria 5512
82 Ga0070706_100025642 3300005467 Bacteria 5426
83 Ga0070706_100043482 3300005467 Bacteria 4151
84 Ga0070706_100047100 3300005467 Bacteria 3978
85 Ga0070706_100063667 3300005467 Bacteria 3408
86 Ga0070706_100164173 3300005467 Bacteria 2074
87 Ga0070706_100297534 3300005467 Bacteria 1506
88 Ga0070707_100000297 3300005468 Bacteria 48412
89 Ga0070707_100001249 3300005468 Bacteria 24989
90 Ga0070707_100003076 3300005468 Bacteria 15801
91 Ga0070707_100005280 3300005468 Bacteria 12092
92 Ga0070707_100012369 3300005468 Bacteria 7969
93 Ga0070707_100056602 3300005468 Bacteria 3761
94 Ga0070707_100100560 3300005468 Bacteria 2801
95 Ga0070707_100227186 3300005468 Bacteria 1818
96 Ga0070707_100248012 3300005468 Bacteria 1733
97 Ga0070698_100000013 3300005471 Bacteria 114652
98 Ga0070698_100002204 3300005471 Bacteria 21610
99 Ga0070698_100009265 3300005471 Bacteria 10562
100 Ga0070698_100009780 3300005471 Bacteria 10253
101 Ga0070698_100010926 3300005471 Bacteria 9659
102 Ga0070698_100016085 3300005471 Bacteria 7898
103 Ga0070698_100025636 3300005471 Bacteria 6143
104 Ga0070698_100031009 3300005471 Bacteria 5543
105 Ga0070698_100069327 3300005471 Bacteria 3541
106 Ga0070698_100104395 3300005471 Bacteria 2804
107 Ga0070699_100001713 3300005518 Bacteria 19993
108 Ga0070699_100020728 3300005518 Bacteria 5670
109 Ga0070699_100034432 3300005518 Bacteria 4377
110 Ga0070679_100079829 3300005530 Bacteria 3261
111 Ga0070679_100304959 3300005530 Bacteria 1543
112 Ga0070684_100070799 3300005535 Bacteria 3069
113 Ga0070697_100003247 3300005536 Bacteria 12482
114 Ga0070697_100041739 3300005536 Bacteria 3714
115 Ga0070697_100192188 3300005536 Bacteria 1733
116 Ga0070697_100209838 3300005536 Bacteria 1658
117 Ga0070686_100206095 3300005544 Bacteria 1413
118 Ga0070695_100014384 3300005545 Bacteria 4769
119 Ga0070696_100000771 3300005546 Bacteria 20574
120 Ga0070696_100035391 3300005546 Bacteria 3438
121 Ga0070696_100046225 3300005546 Bacteria 3017
122 Ga0070693_100340476 3300005547 Bacteria 1023
123 Ga0070665_100007588 3300005548 Bacteria 11031
124 Ga0070664_100241291 3300005564 Bacteria 1622
125 Ga0068857_100080817 3300005577 Bacteria 2902
126 Ga0068854_100127389 3300005578 Bacteria 1940
127 Ga0068856_100044842 3300005614 Bacteria 4352
128 Ga0068856_100052050 3300005614 Bacteria 4037
129 Ga0068856_100136980 3300005614 Bacteria 2454
130 Ga0070702_100004766 3300005615 Bacteria 6232
131 Ga0068852_100005686 3300005616 Bacteria 8943
132 Ga0068859_100059451 3300005617 Bacteria 3850
133 Ga0068859_100358782 3300005617 Bacteria 1552
134 Ga0068859_100359565 3300005617 Bacteria 1551
135 Ga0068864_100042320 3300005618 Bacteria 3898
136 Ga0068861_100210450 3300005719 Bacteria 1638
137 Ga0068863_100003224 3300005841 Bacteria 16160
138 Ga0068863_100030365 3300005841 Bacteria 5162
139 Ga0068858_100086267 3300005842 Bacteria 2920
140 Ga0068858_100091945 3300005842 Bacteria 2824
141 Ga0068858_100323981 3300005842 Bacteria 1473
142 Ga0068860_100390729 3300005843 Bacteria 1375
143 Ga0068862_100230634 3300005844 Bacteria 1679
144 Ga0081455_10012980 3300005937 Bacteria 8262
145 Ga0081540_1001190 3300005983 Bacteria 22780
146 Ga0070717_10003955 3300006028 Bacteria 10667
147 Ga0070717_10016529 3300006028 Bacteria 5721
148 Ga0070717_10022951 3300006028 Bacteria 4937
149 Ga0070717_10023037 3300006028 Bacteria 4928
150 Ga0070717_10023164 3300006028 Bacteria 4916
151 Ga0070717_10034725 3300006028 Bacteria 4078
152 Ga0070717_10059391 3300006028 Bacteria 3164
153 Ga0070717_10097677 3300006028 Bacteria 2489
154 Ga0070717_10114193 3300006028 Bacteria 2307
155 Ga0070717_10136410 3300006028 Bacteria 2113
156 Ga0070717_10151329 3300006028 Bacteria 2008
157 Ga0070717_10232254 3300006028 Bacteria 1624
158 Ga0075365_10053204 3300006038 Bacteria 2681
159 Ga0075368_10026267 3300006042 Bacteria 2240
160 Ga0075363_100002499 3300006048 Bacteria 7529
161 Ga0075363_100019518 3300006048 Bacteria 3390
162 Ga0075363_100030927 3300006048 Bacteria 2773
163 Ga0075364_10004881 3300006051 Bacteria 7768
164 Ga0075364_10077088 3300006051 Bacteria 2200
165 Ga0075364_10120586 3300006051 Bacteria 1755
166 Ga0070715_10036193 3300006163 Bacteria 2035
167 Ga0070715_10050123 3300006163 Bacteria 1791
168 Ga0070715_10051996 3300006163 Bacteria 1766
169 Ga0070716_100064061 3300006173 Bacteria 2136
170 Ga0070716_100094245 3300006173 Bacteria 1820
171 Ga0070712_100001201 3300006175 Bacteria 15656
172 Ga0070712_100007373 3300006175 Bacteria 6862
173 Ga0070712_100015306 3300006175 Bacteria 4935
174 Ga0070712_100021738 3300006175 Bacteria 4218
175 Ga0070712_100040505 3300006175 Bacteria 3194
176 Ga0070712_100052821 3300006175 Bacteria 2836
177 Ga0070712_100085619 3300006175 Bacteria 2295
178 Ga0070712_100209151 3300006175 Bacteria 1537
179 Ga0070712_100230914 3300006175 Bacteria 1469
180 Ga0075362_10029091 3300006177 Bacteria 2378
181 Ga0075370_10003064 3300006353 Bacteria 7884
182 Ga0075370_10017806 3300006353 Bacteria 3843
183 Ga0068871_100043860 3300006358 Bacteria 3594
184 Ga0068871_100065625 3300006358 Bacteria 2973
185 Ga0075428_100000550 3300006844 Bacteria 38346
186 Ga0075428_100122267 3300006844 Bacteria 2834
187 Ga0075428_100165936 3300006844 Bacteria 2395
188 Ga0075430_100002143 3300006846 Bacteria 16333
189 Ga0075434_100032282 3300006871 Bacteria 5163
190 Ga0075434_100056501 3300006871 Bacteria 3900
191 Ga0075429_100015835 3300006880 Bacteria 6530
192 Ga0075436_100020862 3300006914 Bacteria 4494
193 Ga0075436_100042357 3300006914 Bacteria 3140
194 Ga0075436_100206092 3300006914 Bacteria 1393
195 Ga0097620_100059443 3300006931 Bacteria 3850
196 Ga0097620_100358777 3300006931 Bacteria 1552
197 Ga0097620_100359553 3300006931 Bacteria 1551
198 Ga0075435_100005579 3300007076 Bacteria 8809
199 Ga0075435_100121226 3300007076 Bacteria 2182
200 Ga0075435_100275625 3300007076 Bacteria 1435
201 Ga0099795_10108310 3300007788 Bacteria 1098
202 Ga0111539_10042869 3300009094 Bacteria 5430
203 Ga0111539_10267592 3300009094 Bacteria 1990
204 Ga0105245_10025841 3300009098 Bacteria 5164
205 Ga0105247_10004677 3300009101 Bacteria 8723
206 Ga0114129_10000517 3300009147 Bacteria 47115
207 Ga0114129_10203201 3300009147 Bacteria 2682
208 Ga0105243_10024812 3300009148 Bacteria 4576
209 Ga0105243_10060520 3300009148 Bacteria 3025
210 Ga0105237_10003987 3300009545 Bacteria 17256
211 Ga0105237_10176771 3300009545 Bacteria 2135
212 Ga0105238_10106918 3300009551 Bacteria 2779
213 Ga0105249_10034058 3300009553 Bacteria 4613
214 Ga0105239_10003624 3300010375 Bacteria 18873
215 Ga0105239_10145336 3300010375 Bacteria 2644
216 Ga0105246_10036887 3300011119 Bacteria 3277
217 Ga0157340_1000852 3300012473 Bacteria 1277
218 Ga0157342_1001348 3300012507 Bacteria 1793
219 Ga0157371_10011020 3300013102 Bacteria 7003
220 Ga0157370_10014854 3300013104 Bacteria 7945
221 Ga0157370_10261495 3300013104 Bacteria 1599
222 Ga0157370_10364576 3300013104 Bacteria 1331
223 Ga0157369_10019798 3300013105 Bacteria 7531
224 Ga0157374_10115253 3300013296 Bacteria 2588
225 Ga0163162_10106884 3300013306 Bacteria 2893
226 Ga0163162_10314551 3300013306 Bacteria 1699
227 Ga0163163_10012828 3300014325 Bacteria 7646
228 Ga0163163_10318820 3300014325 Bacteria 1608
229 Ga0157377_10004816 3300014745 Bacteria 6267
230 Ga0157379_10023428 3300014968 Bacteria 5479
231 Ga0206349_1282006 3300020075 Bacteria 1626
232 Ga0206351_10133754 3300020077 Bacteria 1044
233 Ga0206354_11275327 3300020081 Bacteria 1120
234 Ga0206354_11425287 3300020081 Bacteria 1286
235 Ga0206353_10577580 3300020082 Bacteria 1147
236 Ga0213876_10003327 3300021384 Bacteria 9212
237 Ga0213875_10000292 3300021388 Bacteria 48320
238 Ga0213875_10008633 3300021388 Bacteria 5204
239 Ga0213875_10023859 3300021388 Bacteria 2919
240 Ga0213875_10085224 3300021388 Bacteria 1474
241 Ga0224712_10027138 3300022467 Bacteria 2034
242 Ga0224712_10031915 3300022467 Bacteria 1915
243 Ga0224572_1005598 3300024225 Bacteria 2245
244 Ga0209051_1015347 3300025303 Bacteria 3528
245 Ga0207692_10001325 3300025898 Bacteria 9218
246 Ga0207692_10005780 3300025898 Bacteria 4979
247 Ga0207692_10010116 3300025898 Bacteria 3963
248 Ga0207692_10011629 3300025898 Bacteria 3753
249 Ga0207692_10025048 3300025898 Bacteria 2782
250 Ga0207692_10125714 3300025898 Bacteria 1442
251 Ga0207642_10019344 3300025899 Bacteria 2635
252 Ga0207710_10002600 3300025900 Bacteria 8328
253 Ga0207688_10017033 3300025901 Bacteria 3949
254 Ga0207688_10058959 3300025901 Bacteria 2161
255 Ga0207685_10000628 3300025905 Bacteria 6203
256 Ga0207685_10003965 3300025905 Bacteria 3684
257 Ga0207699_10000282 3300025906 Bacteria 27821
258 Ga0207699_10000772 3300025906 Bacteria 15285
259 Ga0207699_10004375 3300025906 Bacteria 6756
260 Ga0207699_10026845 3300025906 Bacteria 3180
261 Ga0207699_10046759 3300025906 Bacteria 2533
262 Ga0207699_10072859 3300025906 Bacteria 2105
263 Ga0207643_10016456 3300025908 Bacteria 4034
264 Ga0207705_10054606 3300025909 Bacteria 2879
265 Ga0207684_10000569 3300025910 Bacteria 44877
266 Ga0207684_10001052 3300025910 Bacteria 30862
267 Ga0207684_10003988 3300025910 Bacteria 14121
268 Ga0207684_10011066 3300025910 Bacteria 7900
269 Ga0207684_10012727 3300025910 Bacteria 7301
270 Ga0207684_10015244 3300025910 Bacteria 6620
271 Ga0207684_10057037 3300025910 Bacteria 3314
272 Ga0207684_10220148 3300025910 Bacteria 1638
273 Ga0207684_10224381 3300025910 Bacteria 1622
274 Ga0207684_10255658 3300025910 Bacteria 1512
275 Ga0207707_10253218 3300025912 Bacteria 1529
276 Ga0207695_10234537 3300025913 Bacteria 1738
277 Ga0207671_10064503 3300025914 Bacteria 2723
278 Ga0207693_10002607 3300025915 Bacteria 15672
279 Ga0207693_10037179 3300025915 Bacteria 3837
280 Ga0207693_10039017 3300025915 Bacteria 3739
281 Ga0207693_10043294 3300025915 Bacteria 3542
282 Ga0207693_10051024 3300025915 Bacteria 3248
283 Ga0207693_10107284 3300025915 Bacteria 2191
284 Ga0207663_10009350 3300025916 Bacteria 5173
285 Ga0207663_10044861 3300025916 Bacteria 2716
286 Ga0207663_10102011 3300025916 Bacteria 1929
287 Ga0207663_10396752 3300025916 Bacteria 1054
288 Ga0207662_10039259 3300025918 Bacteria 2776
289 Ga0207657_10017194 3300025919 Bacteria 6947
290 Ga0207657_10270461 3300025919 Bacteria 1351
291 Ga0207652_10022367 3300025921 Bacteria 5230
292 Ga0207646_10000193 3300025922 Bacteria 83049
293 Ga0207646_10002442 3300025922 Bacteria 21928
294 Ga0207646_10009983 3300025922 Bacteria 9327
295 Ga0207646_10015645 3300025922 Bacteria 7153
296 Ga0207646_10017226 3300025922 Bacteria 6767
297 Ga0207646_10018514 3300025922 Bacteria 6493
298 Ga0207646_10046167 3300025922 Bacteria 3908
299 Ga0207646_10046201 3300025922 Bacteria 3907
300 Ga0207646_10081727 3300025922 Bacteria 2889
301 Ga0207646_10111812 3300025922 Bacteria 2452
302 Ga0207646_10242460 3300025922 Bacteria 1628
303 Ga0207700_10000402 3300025928 Bacteria 25312
304 Ga0207700_10000617 3300025928 Bacteria 20774
305 Ga0207700_10006063 3300025928 Bacteria 7281
306 Ga0207700_10013522 3300025928 Bacteria 5314
307 Ga0207700_10135394 3300025928 Bacteria 2017
308 Ga0207700_10217631 3300025928 Bacteria 1617
309 Ga0207700_10276759 3300025928 Bacteria 1442
310 Ga0207664_10000500 3300025929 Bacteria 27955
311 Ga0207664_10001508 3300025929 Bacteria 15252
312 Ga0207664_10004947 3300025929 Bacteria 9068
313 Ga0207664_10011349 3300025929 Bacteria 6326
314 Ga0207664_10012335 3300025929 Bacteria 6106
315 Ga0207664_10030848 3300025929 Bacteria 4096
316 Ga0207664_10070233 3300025929 Bacteria 2818
317 Ga0207664_10097741 3300025929 Bacteria 2419
318 Ga0207664_10120376 3300025929 Bacteria 2196
319 Ga0207664_10137621 3300025929 Bacteria 2062
320 Ga0207664_10332609 3300025929 Bacteria 1342
321 Ga0207644_10019033 3300025931 Bacteria 4654
322 Ga0207706_10022715 3300025933 Bacteria 5630
323 Ga0207706_10089555 3300025933 Bacteria 2705
324 Ga0207686_10018200 3300025934 Bacteria 3973
325 Ga0207709_10123245 3300025935 Bacteria 1754
326 Ga0207665_10001073 3300025939 Bacteria 18388
327 Ga0207665_10024965 3300025939 Bacteria 3941
328 Ga0207665_10027731 3300025939 Bacteria 3742
329 Ga0207691_10032411 3300025940 Bacteria 4871
330 Ga0207689_10012904 3300025942 Bacteria 7136
331 Ga0207661_10005201 3300025944 Bacteria 9151
332 Ga0207661_10117238 3300025944 Bacteria 2262
333 Ga0207661_10265465 3300025944 Bacteria 1530
334 Ga0207661_10318757 3300025944 Bacteria 1397
335 Ga0207679_10128966 3300025945 Bacteria 2026
336 Ga0207651_10155115 3300025960 Bacteria 1788
337 Ga0207668_10023324 3300025972 Bacteria 3976
338 Ga0207668_10113067 3300025972 Bacteria 2041
339 Ga0207658_10084089 3300025986 Bacteria 2448
340 Ga0207677_10045492 3300026023 Bacteria 2931
341 Ga0207703_10136815 3300026035 Bacteria 2121
342 Ga0207639_10152878 3300026041 Bacteria 1935
343 Ga0207678_10000552 3300026067 Bacteria 34170
344 Ga0207678_10012122 3300026067 Bacteria 7570
345 Ga0207708_10016973 3300026075 Bacteria 5480
346 Ga0207702_10192351 3300026078 Bacteria 1886
347 Ga0207702_10245455 3300026078 Bacteria 1679
348 Ga0207702_10487469 3300026078 Bacteria 1200
349 Ga0207641_10002132 3300026088 Bacteria 18705
350 Ga0207641_10040438 3300026088 Bacteria 3905
351 Ga0207641_10091403 3300026088 Bacteria 2663
352 Ga0207641_10243738 3300026088 Bacteria 1676
353 Ga0207641_10272842 3300026088 Bacteria 1587
354 Ga0207648_10069074 3300026089 Bacteria 3078
355 Ga0207676_10203342 3300026095 Bacteria 1752
356 Ga0207674_10004442 3300026116 Bacteria 16859
357 Ga0207674_10195303 3300026116 Bacteria 1973
358 Ga0207675_100022004 3300026118 Bacteria 5935
359 Ga0207675_100033345 3300026118 Bacteria 4798
360 Ga0207683_10002778 3300026121 Bacteria 15294
361 Ga0207683_10368872 3300026121 Bacteria 1319
362 Ga0207428_10039743 3300027907 Bacteria 3820
363 Ga0268266_10012597 3300028379 Bacteria 7306
364 Ga0268264_10004106 3300028381 Bacteria 12455
365 Ga0265337_1000029 3300028556 Bacteria 66490
366 Ga0265326_10002030 3300028558 Bacteria 6920
367 Ga0265319_1005636 3300028563 Bacteria 5956
368 Ga0265334_10001137 3300028573 Bacteria 12999
369 Ga0265318_10069542 3300028577 Bacteria 1305
370 Ga0265323_10014236 3300028653 Bacteria 3155
371 Ga0265336_10020254 3300028666 Bacteria 2136
372 Ga0265338_10000175 3300028800 Bacteria 118915
373 Ga0265338_10000436 3300028800 Bacteria 75054
374 Ga0265338_10004964 3300028800 Bacteria 17622
375 Ga0265338_10005981 3300028800 Bacteria 15651
376 Ga0265324_10005049 3300029957 Bacteria 5786
377 Ga0316177_1003448 3300030731 Bacteria 1270
378 Ga0316176_1024211 3300030732 Bacteria 2839
379 Ga0314311_1157289 3300030733 Bacteria 3577
380 Ga0316180_1036232 3300030736 Bacteria 3444
381 Ga0265332_10048359 3300031238 Bacteria 1829
382 Ga0265320_10005394 3300031240 Bacteria 8219
383 Ga0265325_10005263 3300031241 Bacteria 8030
384 Ga0265340_10003762 3300031247 Bacteria 8540
385 Ga0265339_10008916 3300031249 Bacteria 6348
386 Ga0265327_10000246 3300031251 Bacteria 107698
387 Ga0265316_10012850 3300031344 Bacteria 7477
388 Ga0307509_10053096 3300031507 Bacteria 4324
389 Ga0307408_100156669 3300031548 Bacteria 1804
390 Ga0265313_10006156 3300031595 Bacteria 8606
391 Ga0265314_10045687 3300031711 Bacteria 3094
392 Ga0265342_10056556 3300031712 Bacteria 2324
393 Ga0316578_10053577 3300031728 Bacteria 2364
394 Ga0316214_1005685 3300033545 Bacteria 1639
395 Ga0373948_0003623 3300034817 Bacteria 2389
396 Ga0373926_0000298 3300035083 Bacteria 12232
397 Ga0373926_0001951 3300035083 Bacteria 6459
398 Ga0373926_0053127 3300035083 Bacteria 1465
399 Ga0373934_0000127 3300035086 Bacteria 27874
400 Ga0373934_0000666 3300035086 Bacteria 12167
401 Ga0373934_0027350 3300035086 Bacteria 2215
402 Ga0373934_0041259 3300035086 Bacteria 1821
403 Ga0373934_0060239 3300035086 Bacteria 1511
404 Ga0373940_0004432 3300035088 Bacteria 2966
405 Ga0373940_0007303 3300035088 Bacteria 2489
406 Ga0373949_0008783 3300035090 Bacteria 2211
407 Ga0373923_0000778 3300035111 Bacteria 8296
408 Ga0373923_0023180 3300035111 Bacteria 2440
409 Ga0373923_0043236 3300035111 Bacteria 1864
410 Ga0373923_0058186 3300035111 Bacteria 1636
411 Ga0373923_0082047 3300035111 Bacteria 1400
412 Ga0373932_0027270 3300035112 Bacteria 1561
413 Ga0373936_0000200 3300035113 Bacteria 19968
414 Ga0373936_0003669 3300035113 Bacteria 5762
415 Ga0373936_0005680 3300035113 Bacteria 4704
416 Ga0373939_0084863 3300035114 Bacteria 1059
417 Ga0373941_0056713 3300035115 Bacteria 1262
418 Ga0373945_0000615 3300035116 Bacteria 10245
419 Ga0373945_0022029 3300035116 Bacteria 2192
420 Ga0373953_0001228 3300035117 Bacteria 7308
421 Ga0373953_0001345 3300035117 Bacteria 7069
422 Ga0373953_0005883 3300035117 Bacteria 4007
423 Ga0373953_0010326 3300035117 Bacteria 3246
424 Ga0373953_0023360 3300035117 Bacteria 2340
425 Ga0373953_0116948 3300035117 Bacteria 1131
426 Ga0373954_0004112 3300035118 Bacteria 6237
427 Ga0373954_0070300 3300035118 Bacteria 1663
428 Ga0373954_0105597 3300035118 Bacteria 1360
429 Ga0373954_0109196 3300035118 Bacteria 1337
430 Ga0373954_0198131 3300035118 Bacteria 986
431 Ga0373956_0005048 3300035119 Bacteria 5288
432 Ga0373956_0007016 3300035119 Bacteria 4528
433 Ga0373956_0015390 3300035119 Bacteria 3202
434 Ga0373956_0018019 3300035119 Bacteria 2987
435 Ga0373956_0023777 3300035119 Bacteria 2633
436 Ga0373957_0000382 3300035120 Bacteria 11207
437 Ga0373957_0001217 3300035120 Bacteria 6870
438 Ga0373957_0005940 3300035120 Bacteria 3818
439 Ga0373957_0018173 3300035120 Bacteria 2458
440 Ga0373957_0028488 3300035120 Bacteria 2035
441 Ga0373943_0001122 3300035170 Bacteria 11970
442 Ga0373943_0005113 3300035170 Bacteria 5904
443 Ga0373943_0028916 3300035170 Bacteria 2615
444 Ga0373943_0153787 3300035170 Bacteria 1248
445 Ga0373943_0193654 3300035170 Bacteria 1122
446 Ga0373946_0000133 3300035171 Bacteria 22295
447 Ga0373946_0000657 3300035171 Bacteria 11584
448 Ga0373946_0022631 3300035171 Bacteria 2448
449 Ga0373955_0000104 3300035172 Bacteria 33710
450 Ga0373955_0002558 3300035172 Bacteria 7956
451 Ga0373955_0003003 3300035172 Bacteria 7392
452 Ga0373955_0019613 3300035172 Bacteria 3383
453 Ga0373955_0021614 3300035172 Bacteria 3251
454 Ga0373955_0037185 3300035172 Bacteria 2587
455 Ga0373942_0014022 3300035207 Bacteria 1934
456 Ga0373961_0021412 3300035241 Bacteria 1719
457 Ga0373962_0024411 3300035242 Bacteria 1616
458 Ga0373924_0000089 3300035410 Bacteria 25257
459 Ga0373924_0000461 3300035410 Bacteria 12502
460 Ga0373924_0018443 3300035410 Bacteria 2688
461 Ga0373924_0060119 3300035410 Bacteria 1588
462 Ga0373924_0072630 3300035410 Bacteria 1453
463 Ga0373924_0121781 3300035410 Bacteria 1132
464 Ga0373931_0012604 3300035691 Bacteria 4099
465 Ga0373935_0001924 3300035692 Bacteria 11679
466 Ga0373935_0018839 3300035692 Bacteria 4206
467 Ga0373935_0022142 3300035692 Bacteria 3894
468 Ga0373935_0032679 3300035692 Bacteria 3233
469 Ga0373935_0054497 3300035692 Bacteria 2546
470 Ga0373935_0076685 3300035692 Bacteria 2165
471 Ga0373935_0076706 3300035692 Bacteria 2165
472 Ga0373927_0004795 3300035695 Bacteria 9410
473 Ga0373927_0022395 3300035695 Bacteria 4139
474 Ga0373927_0100916 3300035695 Bacteria 1877
475 Ga0373933_0000344 3300035724 Bacteria 29733
476 Ga0373933_0008889 3300035724 Bacteria 5477
477 Ga0373933_0013645 3300035724 Bacteria 4505
478 Ga0373933_0022514 3300035724 Bacteria 3589
479 Ga0373933_0032943 3300035724 Bacteria 3012
480 Ga0373933_0038674 3300035724 Bacteria 2803
481 Ga0373933_0061357 3300035724 Bacteria 2268
482 Ga0373947_0000001 3300035725 Bacteria 510932
483 Ga0373947_0000713 3300035725 Bacteria 19785
484 Ga0373947_0002054 3300035725 Bacteria 12280
485 Ga0373947_0052877 3300035725 Bacteria 2447
486 Ga0373947_0056245 3300035725 Bacteria 2378
487 Ga0373947_0220274 3300035725 Bacteria 1247
488 Ga0373937_0000029 3300036401 Bacteria 123547
489 Ga0373937_0001321 3300036401 Bacteria 20742
490 Ga0373937_0019707 3300036401 Bacteria 6041
491 Ga0373937_0023604 3300036401 Bacteria 5540
492 Ga0373937_0053453 3300036401 Bacteria 3705
493 Ga0373937_0109196 3300036401 Bacteria 2572
494 Ga0373937_0122863 3300036401 Bacteria 2420
495 Ga0373937_0138862 3300036401 Bacteria 2273
496 Ga0373937_0142425 3300036401 Bacteria 2243
497 Ga0373937_0169624 3300036401 Bacteria 2047
498 Ga0372808_005845 3300036459 Bacteria 1638
499 Ga0373925_0000051 3300037068 Bacteria 127667
500 Ga0373925_0000746 3300037068 Bacteria 29863
501 Ga0373925_0001818 3300037068 Bacteria 17815
502 Ga0373925_0012835 3300037068 Bacteria 6068
503 Ga0373925_0044607 3300037068 Bacteria 3292
504 Ga0373925_0054461 3300037068 Bacteria 2992
505 Ga0373925_0066392 3300037068 Bacteria 2719
506 Ga0373925_0089925 3300037068 Bacteria 2346
507 Ga0373925_0166099 3300037068 Bacteria 1740
508 Ga0395900_0447085 3300037418 Bacteria 1249
509 Ga0436364_0022484 3300037853 Bacteria 2383
510 Ga0436364_0038371 3300037853 Bacteria 3473
511 Ga0436364_0207895 3300037853 Bacteria 5819
512 Ga0436364_0261777 3300037853 Bacteria 1644
513 Ga0436364_0607771 3300037853 Bacteria 6782
514 Ga0436364_0653920 3300037853 Bacteria 6896
515 Ga0436364_1492889 3300037853 Bacteria 100509
516 Ga0436365_0469598 3300039437 Bacteria 28546
517 Ga0436365_0795808 3300039437 Bacteria 5670
518 Ga0436365_1139118 3300039437 Bacteria 3258
519 Ga0436365_1324307 3300039437 Bacteria 6333
520 Ga0436365_1937384 3300039437 Bacteria 8653
521 Ga0436360_0620934 3300039438 Bacteria 1738
522 Ga0436363_0275598 3300039450 Bacteria 1372
523 Ga0436363_0802797 3300039450 Bacteria 1109
524 Ga0436363_0915299 3300039450 Bacteria 2839
525 Ga0466972_0002299 3300044658 Bacteria 9397
526 Ga0466972_0005017 3300044658 Bacteria 6634
527 Ga0466972_0011314 3300044658 Bacteria 4477
528 Ga0466972_0070602 3300044658 Bacteria 1666
529 Ga0466965_0007426 3300044683 Bacteria 5031
530 Ga0466965_0012306 3300044683 Bacteria 4022
531 Ga0466965_0015451 3300044683 Bacteria 3627
532 Ga0466966_0007826 3300044684 Bacteria 7074
533 Ga0466966_0118455 3300044684 Bacteria 1628
534 Ga0466961_0009319 3300044693 Bacteria 6253
535 Ga0466961_0269615 3300044693 Bacteria 1043
536 Ga0466963_0009920 3300044694 Bacteria 5751
537 Ga0466963_0028403 3300044694 Bacteria 3591
538 Ga0466963_0034847 3300044694 Bacteria 3277
539 Ga0466963_0082914 3300044694 Bacteria 2174
540 Ga0466963_0158614 3300044694 Bacteria 1574
541 Ga0466963_0223201 3300044694 Bacteria 1320
542 Ga0466971_0036024 3300044719 Bacteria 2219
543 Ga0466968_0000520 3300044735 Bacteria 13079
544 Ga0466970_0015442 3300044765 Bacteria 3926
545 Ga0466970_0018922 3300044765 Bacteria 3567
546 Ga0466957_0044411 3300044842 Bacteria 2692
547 Ga0466957_0110955 3300044842 Bacteria 1739
548 Ga0466957_0301196 3300044842 Bacteria 1077
549 Ga0466960_0001803 3300044901 Bacteria 7860
550 Ga0466960_0002210 3300044901 Bacteria 7264
551 Ga0466960_0005461 3300044901 Bacteria 5038
552 Ga0466960_0007239 3300044901 Bacteria 4494
553 Ga0466959_0001523 3300045049 Bacteria 14229
554 Ga0466959_0128134 3300045049 Bacteria 1800
555 Ga0466958_0012622 3300045836 Bacteria 4788
556 Ga0466958_0079049 3300045836 Bacteria 2022
557 Ga0466958_0123415 3300045836 Bacteria 1623
558 Ga0466958_0210483 3300045836 Bacteria 1239
559 Ga0466967_0026207 3300045976 Bacteria 4824
560 Ga0466967_0041230 3300045976 Bacteria 3979
561 Ga0466967_0060504 3300045976 Bacteria 3356
562 Ga0466967_0067276 3300045976 Bacteria 3195
563 Ga0466967_0107709 3300045976 Bacteria 2556
564 Ga0466967_0108943 3300045976 Bacteria 2542
565 Ga0466967_0267124 3300045976 Bacteria 1638
566 Ga0466967_0281218 3300045976 Bacteria 1597
567 Ga0466967_0343048 3300045976 Bacteria 1445
568 Ga0495592_0000040 3300046454 Bacteria 123599
569 Ga0495592_0004066 3300046454 Bacteria 10636
570 Ga0495592_0004607 3300046454 Bacteria 10097
571 Ga0495592_0014414 3300046454 Bacteria 6000
572 Ga0495592_0026105 3300046454 Bacteria 4431
573 Ga0495592_0174242 3300046454 Bacteria 1471
574 Ga0495592_0258768 3300046454 Bacteria 1147
575 Ga0495603_0003281 3300046455 Bacteria 9636
576 Ga0495629_0009622 3300046459 Bacteria 7059
577 Ga0495629_0016375 3300046459 Bacteria 5321
578 Ga0495629_0020486 3300046459 Bacteria 4721
579 Ga0495629_0209935 3300046459 Bacteria 1345
580 Ga0495641_0002661 3300046461 Bacteria 13935
581 Ga0495641_0008226 3300046461 Bacteria 6391
582 Ga0495641_0023583 3300046461 Bacteria 3053
583 Ga0495651_0000017 3300046462 Bacteria 124010
584 Ga0495651_0004720 3300046462 Bacteria 10429
585 Ga0495651_0008205 3300046462 Bacteria 8005
586 Ga0495651_0011586 3300046462 Bacteria 6774
587 Ga0495651_0043565 3300046462 Bacteria 3481
588 Ga0495651_0077846 3300046462 Bacteria 2509
589 Ga0495651_0299850 3300046462 Bacteria 1078
590 Ga0495653_0002780 3300046463 Bacteria 13960
591 Ga0495653_0005046 3300046463 Bacteria 10714
592 Ga0495653_0005317 3300046463 Bacteria 10474
593 Ga0495653_0006639 3300046463 Bacteria 9496
594 Ga0495653_0010190 3300046463 Bacteria 7691
595 Ga0495653_0104450 3300046463 Bacteria 2047
596 Ga0495653_0193363 3300046463 Bacteria 1386
597 Ga0495650_0067876 3300046471 Bacteria 1408
598 Ga0495580_0001230 3300046472 Bacteria 22588
599 Ga0495580_0172776 3300046472 Bacteria 1493
600 Ga0495582_0000867 3300046473 Bacteria 16771
601 Ga0495582_0115017 3300046473 Bacteria 1512
602 Ga0495639_0003679 3300046475 Bacteria 6602
603 Ga0495639_0113780 3300046475 Bacteria 1286
604 Ga0495662_0000668 3300046476 Bacteria 16177
605 Ga0495662_0018037 3300046476 Bacteria 3415
606 Ga0495662_0024483 3300046476 Bacteria 2913
607 Ga0495662_0034250 3300046476 Bacteria 2452
608 Ga0495662_0059792 3300046476 Bacteria 1840
609 Ga0495664_0004823 3300046477 Bacteria 7372
610 Ga0495664_0005990 3300046477 Bacteria 6701
611 Ga0495664_0020630 3300046477 Bacteria 3801
612 Ga0495664_0046273 3300046477 Bacteria 2581
613 Ga0495664_0068699 3300046477 Bacteria 2114
614 Ga0495664_0074885 3300046477 Bacteria 2025
615 Ga0495664_0154613 3300046477 Bacteria 1391
616 Ga0495606_0033078 3300046507 Bacteria 3572
617 Ga0495608_0000415 3300046511 Bacteria 29826
618 Ga0495608_0006208 3300046511 Bacteria 8482
619 Ga0495608_0008989 3300046511 Bacteria 6985
620 Ga0495608_0021664 3300046511 Bacteria 4411
621 Ga0495608_0050356 3300046511 Bacteria 2763
622 Ga0495618_0002727 3300046514 Bacteria 11250
623 Ga0495618_0012852 3300046514 Bacteria 5088
624 Ga0495618_0026176 3300046514 Bacteria 3624
625 Ga0495618_0047569 3300046514 Bacteria 2707
626 Ga0495618_0109903 3300046514 Bacteria 1765
627 Ga0495628_0000756 3300046516 Bacteria 29861
628 Ga0495628_0009420 3300046516 Bacteria 8335
629 Ga0495628_0020189 3300046516 Bacteria 5498
630 Ga0495628_0059312 3300046516 Bacteria 3005
631 Ga0495628_0124644 3300046516 Bacteria 1974
632 Ga0495628_0232791 3300046516 Bacteria 1380
633 Ga0495630_0001078 3300046517 Bacteria 18805
634 Ga0495630_0033094 3300046517 Bacteria 3854
635 Ga0495630_0071256 3300046517 Bacteria 2615
636 Ga0495630_0120944 3300046517 Bacteria 1986
637 Ga0495666_0003716 3300046526 Bacteria 7712
638 Ga0495666_0060684 3300046526 Bacteria 1807
639 Ga0495666_0072473 3300046526 Bacteria 1636
640 Ga0495652_0003051 3300046529 Bacteria 16790
641 Ga0495652_0010386 3300046529 Bacteria 8439
642 Ga0495652_0058652 3300046529 Bacteria 3258
643 Ga0495652_0064690 3300046529 Bacteria 3075
644 Ga0495652_0149268 3300046529 Bacteria 1828
645 Ga0495652_0173913 3300046529 Bacteria 1659
646 Ga0495652_0177097 3300046529 Bacteria 1640
647 Ga0495665_0000134 3300046531 Bacteria 35684
648 Ga0495665_0009177 3300046531 Bacteria 5360
649 Ga0495665_0011365 3300046531 Bacteria 4819
650 Ga0495640_0009227 3300046533 Bacteria 7694
651 Ga0495640_0029695 3300046533 Bacteria 3921
652 Ga0495640_0198796 3300046533 Bacteria 1271
653 Ga0495586_0002971 3300046535 Bacteria 9137
654 Ga0495587_0000419 3300046536 Bacteria 29862
655 Ga0495587_0002110 3300046536 Bacteria 13289
656 Ga0495587_0009754 3300046536 Bacteria 6138
657 Ga0495587_0033147 3300046536 Bacteria 3119
658 Ga0495587_0035854 3300046536 Bacteria 2987
659 Ga0495587_0039213 3300046536 Bacteria 2836
660 Ga0495587_0045103 3300046536 Bacteria 2621
661 Ga0495587_0073360 3300046536 Bacteria 1988
662 Ga0495645_0008285 3300046543 Bacteria 7253
663 Ga0495645_0038872 3300046543 Bacteria 3470
664 Ga0495645_0040081 3300046543 Bacteria 3416
665 Ga0495645_0064146 3300046543 Bacteria 2658
666 Ga0495645_0102574 3300046543 Bacteria 2033
667 Ga0495622_0058710 3300046557 Bacteria 1782
668 Ga0495667_0000336 3300046559 Bacteria 29840
669 Ga0495667_0002108 3300046559 Bacteria 13223
670 Ga0495667_0005389 3300046559 Bacteria 8650
671 Ga0495667_0010012 3300046559 Bacteria 6420
672 Ga0495667_0010079 3300046559 Bacteria 6399
673 Ga0495667_0021069 3300046559 Bacteria 4397
674 Ga0495667_0025039 3300046559 Bacteria 4022
675 Ga0495667_0031721 3300046559 Bacteria 3543
676 Ga0495634_0003699 3300046642 Bacteria 12194
677 Ga0495634_0061896 3300046642 Bacteria 2486
678 Ga0495634_0066969 3300046642 Bacteria 2376
679 Ga0495634_0212588 3300046642 Bacteria 1196
680 Ga0495634_0213915 3300046642 Bacteria 1192
681 Ga0495635_0001724 3300046663 Bacteria 14720
682 Ga0495635_0012119 3300046663 Bacteria 6045
683 Ga0495635_0047265 3300046663 Bacteria 2968
684 Ga0495635_0047908 3300046663 Bacteria 2946
685 Ga0495635_0052668 3300046663 Bacteria 2803
686 Ga0495635_0055387 3300046663 Bacteria 2731
687 Ga0495635_0056829 3300046663 Bacteria 2693
688 Ga0495635_0070778 3300046663 Bacteria 2391
689 Ga0495635_0073060 3300046663 Bacteria 2349
690 Ga0495635_0099653 3300046663 Bacteria 1986
691 Ga0495588_0025172 3300046674 Bacteria 2963
692 Ga0495657_0000032 3300046675 Bacteria 123599
693 Ga0495657_0020005 3300046675 Bacteria 4820
694 Ga0495657_0026860 3300046675 Bacteria 4071
695 Ga0495657_0036208 3300046675 Bacteria 3412
696 Ga0495657_0043318 3300046675 Bacteria 3070
697 Ga0495657_0045281 3300046675 Bacteria 2986
698 Ga0495657_0046319 3300046675 Bacteria 2945
699 Ga0495657_0055247 3300046675 Bacteria 2649
700 Ga0495599_0000412 3300046678 Bacteria 24414
701 Ga0495599_0004894 3300046678 Bacteria 7964
702 Ga0495599_0025657 3300046678 Bacteria 3690
703 Ga0495599_0037219 3300046678 Bacteria 3057
704 Ga0495599_0056674 3300046678 Bacteria 2452
705 Ga0495599_0093726 3300046678 Bacteria 1873
706 Ga0495599_0098378 3300046678 Bacteria 1823
707 Ga0495599_0190100 3300046678 Bacteria 1263
708 Ga0495623_0000675 3300046679 Bacteria 22673
709 Ga0495623_0029862 3300046679 Bacteria 3507
710 Ga0495623_0037567 3300046679 Bacteria 3098
711 Ga0495623_0123594 3300046679 Bacteria 1555
712 Ga0495646_0005293 3300046680 Bacteria 8145
713 Ga0495646_0013379 3300046680 Bacteria 5215
714 Ga0495646_0039402 3300046680 Bacteria 2913
715 Ga0495646_0055727 3300046680 Bacteria 2372
716 Ga0495646_0058163 3300046680 Bacteria 2311
717 Ga0495658_0000376 3300046683 Bacteria 25075
718 Ga0495658_0048718 3300046683 Bacteria 2390
719 Ga0495613_0001261 3300046689 Bacteria 19288
720 Ga0495613_0021059 3300046689 Bacteria 4860
721 Ga0495613_0180187 3300046689 Bacteria 1496
722 Ga0495624_0001162 3300046690 Bacteria 20865
723 Ga0495624_0007172 3300046690 Bacteria 7845
724 Ga0495624_0035272 3300046690 Bacteria 3230
725 Ga0495624_0088418 3300046690 Bacteria 1913
726 Ga0495649_0157896 3300046694 Bacteria 1190
727 Ga0495600_0000683 3300046809 Bacteria 17720
728 Ga0495600_0012175 3300046809 Bacteria 5373
729 Ga0495600_0021876 3300046809 Bacteria 4100
730 Ga0495600_0024003 3300046809 Bacteria 3926
731 Ga0495600_0051462 3300046809 Bacteria 2688
732 Ga0495600_0072233 3300046809 Bacteria 2254
733 Ga0495600_0271672 3300046809 Bacteria 1075
734 Ga0495581_0004652 3300047315 Bacteria 7922
735 Ga0495581_0004741 3300047315 Bacteria 7850
736 Ga0495581_0014002 3300047315 Bacteria 4652
737 Ga0495581_0037476 3300047315 Bacteria 2806
738 Ga0495581_0100853 3300047315 Bacteria 1677
739 Ga0495604_0000627 3300047317 Bacteria 30411
740 Ga0495604_0010768 3300047317 Bacteria 7261
741 Ga0495604_0013549 3300047317 Bacteria 6502
742 Ga0495604_0029565 3300047317 Bacteria 4359
743 Ga0495604_0052683 3300047317 Bacteria 3149
744 Ga0495604_0100193 3300047317 Bacteria 2130
745 Ga0495674_0004676 3300047319 Bacteria 13159
746 Ga0495674_0009201 3300047319 Bacteria 9386
747 Ga0495674_0026417 3300047319 Bacteria 5312
748 Ga0495674_0154271 3300047319 Bacteria 1924
749 Ga0495674_0219602 3300047319 Bacteria 1572
750 Ga0495676_0002068 3300047321 Bacteria 17662
751 Ga0495676_0011340 3300047321 Bacteria 8046
752 Ga0495676_0163060 3300047321 Bacteria 1575
753 Ga0495680_0001340 3300047322 Bacteria 26770
754 Ga0495680_0002955 3300047322 Bacteria 17013
755 Ga0495680_0004557 3300047322 Bacteria 13236
756 Ga0495680_0017001 3300047322 Bacteria 6226
757 Ga0495680_0024279 3300047322 Bacteria 5030
758 Ga0495680_0157438 3300047322 Bacteria 1651
759 Ga0495675_0008576 3300047444 Bacteria 6336
760 Ga0495675_0023434 3300047444 Bacteria 3933
761 Ga0495675_0026076 3300047444 Bacteria 3725
762 Ga0495675_0064642 3300047444 Bacteria 2314
763 Ga0495685_010874 3300047447 Bacteria 3058
764 Ga0495684_0002024 3300047471 Bacteria 16305
765 Ga0495684_0002236 3300047471 Bacteria 15508
766 Ga0495684_0009603 3300047471 Bacteria 7459
767 Ga0495684_0010833 3300047471 Bacteria 7050
768 Ga0495684_0020391 3300047471 Bacteria 5108
769 Ga0495684_0027577 3300047471 Bacteria 4360
770 Ga0495684_0058448 3300047471 Bacteria 2937
771 Ga0495684_0114025 3300047471 Bacteria 2038
772 Ga0495684_0211035 3300047471 Bacteria 1427
773 Ga0495686_0023719 3300047472 Bacteria 4041
774 Ga0495593_0002690 3300047673 Bacteria 10696
775 Ga0495593_0007716 3300047673 Bacteria 6277
776 Ga0495593_0012450 3300047673 Bacteria 4862
777 Ga0495593_0041959 3300047673 Bacteria 2457
778 Ga0495602_0001077 3300048088 Bacteria 26795
779 Ga0495602_0030905 3300048088 Bacteria 5070
780 Ga0495602_0040713 3300048088 Bacteria 4255
781 Ga0495602_0045172 3300048088 Bacteria 3988
782 Ga0495602_0060021 3300048088 Bacteria 3317
783 Ga0495602_0156441 3300048088 Bacteria 1784
784 Ga0495614_0009076 3300048089 Bacteria 4406
785 Ga0496100_0001640 3300048903 Bacteria 11082
786 Ga0496100_0082488 3300048903 Bacteria 2174
787 Ga0496100_0198350 3300048903 Bacteria 1461
788 Ga0496101_0000395 3300048904 Bacteria 28467
789 Ga0496101_0093368 3300048904 Bacteria 2241
790 Ga0496101_0133587 3300048904 Bacteria 1886
791 Ga0496102_0000011 3300048905 Bacteria 321716
792 Ga0496102_0000029 3300048905 Bacteria 222195
793 Ga0496102_0000292 3300048905 Bacteria 64203
794 Ga0496102_0049716 3300048905 Bacteria 3815
795 Ga0496102_0078587 3300048905 Bacteria 3037
796 Ga0496102_0166598 3300048905 Bacteria 2073
797 Ga0496102_0224414 3300048905 Bacteria 1771
798 Ga0496103_0000143 3300048906 Bacteria 74753
799 Ga0496103_0000296 3300048906 Bacteria 45922
800 Ga0496103_0000431 3300048906 Bacteria 36468
801 Ga0496103_0037709 3300048906 Bacteria 2962
802 Ga0496103_0062898 3300048906 Bacteria 2311
803 Ga0496104_0008912 3300048907 Bacteria 8915
804 Ga0496105_0006989 3300048908 Bacteria 8693
805 Ga0496105_0027956 3300048908 Bacteria 4612
806 Ga0496106_0002927 3300048909 Bacteria 12703
807 Ga0496106_0189331 3300048909 Bacteria 1635
808 Ga0496107_0005683 3300048910 Bacteria 8531
809 Ga0496107_0055516 3300048910 Bacteria 2860
810 Ga0496108_0131740 3300048911 Bacteria 2149
811 Ga0496108_0131853 3300048911 Bacteria 2148
812 Ga0496109_0068511 3300048912 Bacteria 3253
813 Ga0496109_0072263 3300048912 Bacteria 3169
814 Ga0496109_0156681 3300048912 Bacteria 2133
815 Ga0496110_0016518 3300048913 Bacteria 6163
816 Ga0496110_0043835 3300048913 Bacteria 3906
817 Ga0496110_0053361 3300048913 Bacteria 3554
818 Ga0496110_0091469 3300048913 Bacteria 2722
819 Ga0496110_0102664 3300048913 Bacteria 2564
820 Ga0496111_0016728 3300048914 Bacteria 5059
821 Ga0496111_0026714 3300048914 Bacteria 4078
822 Ga0496112_0034576 3300048915 Bacteria 4918
823 Ga0496112_0122137 3300048915 Bacteria 2575
824 Ga0496113_0011885 3300048916 Bacteria 5834
825 Ga0496113_0017401 3300048916 Bacteria 4988
826 Ga0496113_0130492 3300048916 Bacteria 1972
827 Ga0496113_0305993 3300048916 Bacteria 1273
828 Ga0496114_0003724 3300048917 Bacteria 11743
829 Ga0496114_0276679 3300048917 Bacteria 1479
830 Ga0496114_0345998 3300048917 Bacteria 1315
831 Ga0496115_0082002 3300048918 Bacteria 2627
832 Ga0496115_0084901 3300048918 Bacteria 2582
833 Ga0496116_0000072 3300048919 Bacteria 238158
834 Ga0496116_0000422 3300048919 Bacteria 59708
835 Ga0496117_0000039 3300048920 Bacteria 322143
836 Ga0496117_0000682 3300048920 Bacteria 54224
837 Ga0496118_0000035 3300048921 Bacteria 322143
838 Ga0496118_0000437 3300048921 Bacteria 69069
839 Ga0496118_0000598 3300048921 Bacteria 59753
840 Ga0496119_0000517 3300048922 Bacteria 52595
841 Ga0496119_0002265 3300048922 Bacteria 21391
842 Ga0496119_0039881 3300048922 Bacteria 3013
843 Ga0496119_0060487 3300048922 Bacteria 2267
844 Ga0496119_0143577 3300048922 Bacteria 1286
845 Ga0496120_0000631 3300048923 Bacteria 52495
846 Ga0496120_0038488 3300048923 Bacteria 2828
847 Ga0496121_0002639 3300048924 Bacteria 26992
848 Ga0496121_0132651 3300048924 Bacteria 1861
849 Ga0496122_0021922 3300048925 Bacteria 5696
850 Ga0496123_0009759 3300048926 Bacteria 8584
851 Ga0496126_0000344 3300048929 Bacteria 97456
852 Ga0496126_0000379 3300048929 Bacteria 92123
853 Ga0496126_0002073 3300048929 Bacteria 28106
854 Ga0496126_0002899 3300048929 Bacteria 22357
855 Ga0496126_0005028 3300048929 Bacteria 15383
856 Ga0496126_0053530 3300048929 Bacteria 3661
857 Ga0496126_0198462 3300048929 Bacteria 1695
858 Ga0496126_0253578 3300048929 Bacteria 1465
859 Ga0501031_0000061 3300049568 Bacteria 58363
860 Ga0501032_0000155 3300049569 Bacteria 55506
861 Ga0501032_0075471 3300049569 Bacteria 2245
862 Ga0501032_0107558 3300049569 Bacteria 1847
863 Ga0501033_0000217 3300049570 Bacteria 55235
864 Ga0501034_0001039 3300049571 Bacteria 39597
865 Ga0501034_0122402 3300049571 Bacteria 2587
866 Ga0501034_0168470 3300049571 Bacteria 2158
867 Ga0501036_0002172 3300049572 Bacteria 15309
868 Ga0501036_0047832 3300049572 Bacteria 3621
869 Ga0501037_0026771 3300049573 Bacteria 4261
870 Ga0501037_0058863 3300049573 Bacteria 2803
871 Ga0501038_0000167 3300049574 Bacteria 55508
872 Ga0501039_0000153 3300049575 Bacteria 47341
873 Ga0501042_0101359 3300049578 Bacteria 2070
874 Ga0501043_0000079 3300049579 Bacteria 85383
875 Ga0501043_0001428 3300049579 Bacteria 20870
876 Ga0501043_0072309 3300049579 Bacteria 2709
877 Ga0501046_0008291 3300049580 Bacteria 9072
878 Ga0501047_0000565 3300049581 Bacteria 39569
879 Ga0501047_0010544 3300049581 Bacteria 8739
880 Ga0501047_0017638 3300049581 Bacteria 6840
881 Ga0501047_0084715 3300049581 Bacteria 3046
882 Ga0501047_0179657 3300049581 Bacteria 1983
883 Ga0501047_0277844 3300049581 Bacteria 1520
884 Ga0501048_0000141 3300049582 Bacteria 43576
885 Ga0501048_0008749 3300049582 Bacteria 7628
886 Ga0501067_0004847 3300049583 Bacteria 7465
887 Ga0501069_0000117 3300049585 Bacteria 35159
888 Ga0501069_0012357 3300049585 Bacteria 4539
889 Ga0501069_0244191 3300049585 Bacteria 1047
890 Ga0501070_0000217 3300049586 Bacteria 54554
891 Ga0501070_0001241 3300049586 Bacteria 22855
892 Ga0501070_0024834 3300049586 Bacteria 5025
893 Ga0501070_0125394 3300049586 Bacteria 2122
894 Ga0501070_0413083 3300049586 Bacteria 1090
895 Ga0501071_0025200 3300049587 Bacteria 4165
896 Ga0501073_0006678 3300049589 Bacteria 8591
897 Ga0501073_0032860 3300049589 Bacteria 3698
898 Ga0501074_0000226 3300049590 Bacteria 31303
899 Ga0501074_0003971 3300049590 Bacteria 10542
900 Ga0501080_0000079 3300049742 Bacteria 65752
901 Ga0501080_0001119 3300049742 Bacteria 22084
902 Ga0501080_0033432 3300049742 Bacteria 4799
903 Ga0501035_0000786 3300049822 Bacteria 33990
904 Ga0501035_0015462 3300049822 Bacteria 7039
905 Ga0501044_0001530 3300049823 Bacteria 27125
906 Ga0501044_0022723 3300049823 Bacteria 6678
907 nmdc:mga03n38_1095_c1 3300050490 Bacteria 7478
908 nmdc:mga03n38_11307_c1 3300050490 Bacteria 3320
909 nmdc:mga03n38_8689_c1 3300050490 Bacteria 3658
910 nmdc:mga00v17_12331_c1 3300050491 Bacteria 4715
911 nmdc:mga00v17_7415_c1 3300050491 Bacteria 5852
912 nmdc:mga06z11_9524_c1 3300050494 Bacteria 4097
913 nmdc:mga04h51_19012_c1 3300050495 Bacteria 2032
914 nmdc:mga07m45_172057_c1 3300050496 Bacteria 1259
915 nmdc:mga05p37_174869_c1 3300050507 Bacteria 2616
916 nmdc:mga05p37_357616_c1 3300050507 Bacteria 1718
917 nmdc:mga09592_11839_c1 3300050508 Bacteria 7095
918 nmdc:mga0n895_10593_c1 3300050512 Bacteria 8160
919 nmdc:mga0n895_36156_c1 3300050512 Bacteria 4768
920 nmdc:mga0n895_403209_c1 3300050512 Bacteria 1383
921 nmdc:mga0rr50_145137_c1 3300050513 Bacteria 1913
922 nmdc:mga0rr50_313434_c1 3300050513 Bacteria 1314
923 nmdc:mga0rr50_4657_c1 3300050513 Bacteria 8084
924 nmdc:mga0rr50_80405_c1 3300050513 Bacteria 2513
925 nmdc:mga08x19_36785_c1 3300050514 Bacteria 3102
926 nmdc:mga08x19_9136_c1 3300050514 Bacteria 5919
927 nmdc:mga0a205_173719_c1 3300050515 Bacteria 2051
928 Ga0495601_0001363 3300053077 Bacteria 13436
929 Ga0495601_0022765 3300053077 Bacteria 3850
930 Ga0495601_0031731 3300053077 Bacteria 3284
931 Ga0495612_0001188 3300053078 Bacteria 10722
932 Ga0495612_0006147 3300053078 Bacteria 4941
933 Ga0495612_0021323 3300053078 Bacteria 2599
934 Ga0500635_0005708 3300053080 Bacteria 3285
935 Ga0495595_0067103 3300053084 Bacteria 1690
936 Ga0495619_0000574 3300053085 Bacteria 24419
937 Ga0495619_0027532 3300053085 Bacteria 3661
938 Ga0495619_0040378 3300053085 Bacteria 3051
939 Ga0495619_0111073 3300053085 Bacteria 1873
940 Ga0500643_001870 3300053087 Bacteria 11463
941 Ga0500559_0002620 3300053136 Bacteria 9186
942 Ga0500559_0020901 3300053136 Bacteria 2770
943 Ga0501084_0003565 3300054114 Bacteria 12634
944 Ga0466962_0052625 3300061719 Bacteria 1946
945 2501943711 2501939600 Bacteria 6907073
946 2515721142 2515154129 Bacteria 5584369
947 2515850619 2515154155 Bacteria 7985436
948 2516084251 2515154202 Bacteria 5471270
949 2623585723 2622736626 Bacteria 7181580
950 2644014053 2643221601 Bacteria 7493239
951 2644174385 2643221631 Bacteria 8168043
952 2644445087 2643221679 Bacteria 3839507
953 2676475169 2675903058 Bacteria 6822861
954 2739602995 2739367653 Bacteria 2780952
955 2808851881 2808606360 Bacteria 4404006
956 2816425648 2816332119 Bacteria 8120218
957 2816505811 2816332139 Bacteria 9138787
958 2817508483 2816332305 Bacteria 2697803
959 2827629898 2827628540 Bacteria 6858585
960 2856743867 2856741275 Bacteria 8096094
961 2856859608 2856858025 Bacteria 7255264
962 2857727926 2857727296 Bacteria 2745552
963 2861528174 2861520306 Bacteria 8348283
964 2867509836 2867507094 Bacteria 6506033
965 2870783043 2870782633 Bacteria 9624083
966 2873319493 2873314349 Bacteria 8512634
967 2883825436 2883821847 Bacteria 5121194
968 2891331119 2891326441 Bacteria 6439512
969 2891400575 2891395885 Bacteria 9251614
970 2891562277 2891554331 Bacteria 8812224
971 2891569693 2891562705 Bacteria 8039471
972 2902797350 2902792274 Bacteria 7270173
973 2905927635 2905926851 Bacteria 4423176
974 2905929192 2905926851 Bacteria 4423176
975 2915363091 2915358134 Bacteria 6050864
976 2917740971 2917736166 Bacteria 9690793
977 3003009313 3002998708 Bacteria 11715108
978 649816316 649633069 Bacteria 6962533
979 8004022882 8004021418 Bacteria 4313954
980 8004026101 8004025490 Bacteria 4327753
981 8053953147 8053945823 Bacteria 8962862
982 8054476866 8054472261 Bacteria 7464355
983 8055069984 8055066027 Bacteria 9479577
984 8055174623 8055172936 Bacteria 9305943
985 8057571017 8057568493 Bacteria 7221719
986 Ga0500572_013913
987 Ga0006562J51391_1065946
988 Ga0070683_100032402
989 Ga0070683_100082859
990 Ga0070690_100350394
991 Ga0068869_100020459
992 Ga0068869_100063944
993 Ga0070666_10041765
994 Ga0070680_100147309
995 Ga0070682_100050527
996 Ga0070682_100095390
997 Ga0068868_100225971
998 Ga0068868_100276552
999 Ga0070689_100175330
1000 Ga0070687_100007051
1001 Ga0070661_100060301
1002 Ga0070661_100070263
1003 Ga0070668_100075083
1004 Ga0070668_100087917
1005 Ga0070669_100119215
1006 Ga0070675_100061776
1007 Ga0070671_100002762
1008 Ga0070673_100099206
1009 Ga0070673_100301505
1010 Ga0070709_10000127
1011 Ga0070709_10000306
1012 Ga0070709_10033374
1013 Ga0070709_10065967
1014 Ga0070709_10232543
1015 Ga0070714_100001423
1016 Ga0070714_100004430
1017 Ga0070714_100006087
1018 Ga0070714_100031980
1019 Ga0070714_100052519
1020 Ga0070714_100106131
1021 Ga0070714_100165938
1022 Ga0070714_100176271
1023 Ga0070714_100203388
1024 Ga0070714_100237441
1025 Ga0070714_100274434
1026 Ga0070714_100377148
1027 Ga0070713_100002458
1028 Ga0070713_100004485
1029 Ga0070713_100017290
1030 Ga0070713_100017870
1031 Ga0070713_100068179
1032 Ga0070713_100124013
1033 Ga0070713_100227770
1034 Ga0070713_100309530
1035 Ga0070710_10000263
1036 Ga0070710_10000784
1037 Ga0070710_10003125
1038 Ga0070710_10036614
1039 Ga0070710_10156020
1040 Ga0070711_100000252
1041 Ga0070711_100002553
1042 Ga0070711_100054730
1043 Ga0070711_100075813
1044 Ga0070711_100287801
1045 Ga0070700_100126212
1046 Ga0070694_100057693
1047 Ga0070708_100002180
1048 Ga0070708_100010328
1049 Ga0070708_100055178
1050 Ga0070708_100145303
1051 Ga0070708_100178759
1052 Ga0070663_100158772
1053 Ga0070678_100272595
1054 Ga0070678_100363272
1055 Ga0070678_100441291
1056 Ga0070662_100040046
1057 Ga0070662_100073351
1058 Ga0070681_10023995
1059 Ga0070681_10086981
1060 Ga0070681_10100248
1061 Ga0070685_10065305
1062 Ga0070706_100001269
1063 Ga0070706_100003695
1064 Ga0070706_100005270
1065 Ga0070706_100006080
1066 Ga0070706_100024878
1067 Ga0070706_100025642
1068 Ga0070706_100043482
1069 Ga0070706_100047100
1070 Ga0070706_100063667
1071 Ga0070706_100164173
1072 Ga0070706_100297534
1073 Ga0070707_100000297
1074 Ga0070707_100001249
1075 Ga0070707_100003076
1076 Ga0070707_100005280
1077 Ga0070707_100012369
1078 Ga0070707_100056602
1079 Ga0070707_100100560
1080 Ga0070707_100227186
1081 Ga0070707_100248012
1082 Ga0070698_100000013
1083 Ga0070698_100002204
1084 Ga0070698_100009265
1085 Ga0070698_100009780
1086 Ga0070698_100010926
1087 Ga0070698_100016085
1088 Ga0070698_100025636
1089 Ga0070698_100031009
1090 Ga0070698_100069327
1091 Ga0070698_100104395
1092 Ga0070699_100001713
1093 Ga0070699_100020728
1094 Ga0070699_100034432
1095 Ga0070679_100079829
1096 Ga0070679_100304959
1097 Ga0070684_100070799
1098 Ga0070697_100003247
1099 Ga0070697_100041739
1100 Ga0070697_100192188
1101 Ga0070697_100209838
1102 Ga0070686_100206095
1103 Ga0070695_100014384
1104 Ga0070696_100000771
1105 Ga0070696_100035391
1106 Ga0070696_100046225
1107 Ga0070693_100340476
1108 Ga0070665_100007588
1109 Ga0070664_100241291
1110 Ga0068857_100080817
1111 Ga0068854_100127389
1112 Ga0068856_100044842
1113 Ga0068856_100052050
1114 Ga0068856_100136980
1115 Ga0070702_100004766
1116 Ga0068852_100005686
1117 Ga0068859_100059451
1118 Ga0068859_100358782
1119 Ga0068859_100359565
1120 Ga0068864_100042320
1121 Ga0068861_100210450
1122 Ga0068863_100003224
1123 Ga0068863_100030365
1124 Ga0068858_100086267
1125 Ga0068858_100091945
1126 Ga0068858_100323981
1127 Ga0068860_100390729
1128 Ga0068862_100230634
1129 Ga0081455_10012980
1130 Ga0081540_1001190
1131 Ga0070717_10003955
1132 Ga0070717_10016529
1133 Ga0070717_10022951
1134 Ga0070717_10023037
1135 Ga0070717_10023164
1136 Ga0070717_10034725
1137 Ga0070717_10059391
1138 Ga0070717_10097677
1139 Ga0070717_10114193
1140 Ga0070717_10136410
1141 Ga0070717_10151329
1142 Ga0070717_10232254
1143 Ga0075365_10053204
1144 Ga0075368_10026267
1145 Ga0075363_100002499
1146 Ga0075363_100019518
1147 Ga0075363_100030927
1148 Ga0075364_10004881
1149 Ga0075364_10077088
1150 Ga0075364_10120586
1151 Ga0070715_10036193
1152 Ga0070715_10050123
1153 Ga0070715_10051996
1154 Ga0070716_100064061
1155 Ga0070716_100094245
1156 Ga0070712_100001201
1157 Ga0070712_100007373
1158 Ga0070712_100015306
1159 Ga0070712_100021738
1160 Ga0070712_100040505
1161 Ga0070712_100052821
1162 Ga0070712_100085619
1163 Ga0070712_100209151
1164 Ga0070712_100230914
1165 Ga0075362_10029091
1166 Ga0075370_10003064
1167 Ga0075370_10017806
1168 Ga0068871_100043860
1169 Ga0068871_100065625
1170 Ga0075428_100000550
1171 Ga0075428_100122267
1172 Ga0075428_100165936
1173 Ga0075430_100002143
1174 Ga0075434_100032282
1175 Ga0075434_100056501
1176 Ga0075429_100015835
1177 Ga0075436_100020862
1178 Ga0075436_100042357
1179 Ga0075436_100206092
1180 Ga0097620_100059443
1181 Ga0097620_100358777
1182 Ga0097620_100359553
1183 Ga0075435_100005579
1184 Ga0075435_100121226
1185 Ga0075435_100275625
1186 Ga0099795_10108310
1187 Ga0111539_10042869
1188 Ga0111539_10267592
1189 Ga0105245_10025841
1190 Ga0105247_10004677
1191 Ga0114129_10000517
1192 Ga0114129_10203201
1193 Ga0105243_10024812
1194 Ga0105243_10060520
1195 Ga0105237_10003987
1196 Ga0105237_10176771
1197 Ga0105238_10106918
1198 Ga0105249_10034058
1199 Ga0105239_10003624
1200 Ga0105239_10145336
1201 Ga0105246_10036887
1202 Ga0157340_1000852
1203 Ga0157342_1001348
1204 Ga0157371_10011020
1205 Ga0157370_10014854
1206 Ga0157370_10261495
1207 Ga0157370_10364576
1208 Ga0157369_10019798
1209 Ga0157374_10115253
1210 Ga0163162_10106884
1211 Ga0163162_10314551
1212 Ga0163163_10012828
1213 Ga0163163_10318820
1214 Ga0157377_10004816
1215 Ga0157379_10023428
1216 Ga0206349_1282006
1217 Ga0206351_10133754
1218 Ga0206354_11275327
1219 Ga0206354_11425287
1220 Ga0206353_10577580
1221 Ga0213876_10003327
1222 Ga0213875_10000292
1223 Ga0213875_10008633
1224 Ga0213875_10023859
1225 Ga0213875_10085224
1226 Ga0224712_10027138
1227 Ga0224712_10031915
1228 Ga0224572_1005598
1229 Ga0209051_1015347
1230 Ga0207692_10001325
1231 Ga0207692_10005780
1232 Ga0207692_10010116
1233 Ga0207692_10011629
1234 Ga0207692_10025048
1235 Ga0207692_10125714
1236 Ga0207642_10019344
1237 Ga0207710_10002600
1238 Ga0207688_10017033
1239 Ga0207688_10058959
1240 Ga0207685_10000628
1241 Ga0207685_10003965
1242 Ga0207699_10000282
1243 Ga0207699_10000772
1244 Ga0207699_10004375
1245 Ga0207699_10026845
1246 Ga0207699_10046759
1247 Ga0207699_10072859
1248 Ga0207643_10016456
1249 Ga0207705_10054606
1250 Ga0207684_10000569
1251 Ga0207684_10001052
1252 Ga0207684_10003988
1253 Ga0207684_10011066
1254 Ga0207684_10012727
1255 Ga0207684_10015244
1256 Ga0207684_10057037
1257 Ga0207684_10220148
1258 Ga0207684_10224381
1259 Ga0207684_10255658
1260 Ga0207707_10253218
1261 Ga0207695_10234537
1262 Ga0207671_10064503
1263 Ga0207693_10002607
1264 Ga0207693_10037179
1265 Ga0207693_10039017
1266 Ga0207693_10043294
1267 Ga0207693_10051024
1268 Ga0207693_10107284
1269 Ga0207663_10009350
1270 Ga0207663_10044861
1271 Ga0207663_10102011
1272 Ga0207663_10396752
1273 Ga0207662_10039259
1274 Ga0207657_10017194
1275 Ga0207657_10270461
1276 Ga0207652_10022367
1277 Ga0207646_10000193
1278 Ga0207646_10002442
1279 Ga0207646_10009983
1280 Ga0207646_10015645
1281 Ga0207646_10017226
1282 Ga0207646_10018514
1283 Ga0207646_10046167
1284 Ga0207646_10046201
1285 Ga0207646_10081727
1286 Ga0207646_10111812
1287 Ga0207646_10242460
1288 Ga0207700_10000402
1289 Ga0207700_10000617
1290 Ga0207700_10006063
1291 Ga0207700_10013522
1292 Ga0207700_10135394
1293 Ga0207700_10217631
1294 Ga0207700_10276759
1295 Ga0207664_10000500
1296 Ga0207664_10001508
1297 Ga0207664_10004947
1298 Ga0207664_10011349
1299 Ga0207664_10012335
1300 Ga0207664_10030848
1301 Ga0207664_10070233
1302 Ga0207664_10097741
1303 Ga0207664_10120376
1304 Ga0207664_10137621
1305 Ga0207664_10332609
1306 Ga0207644_10019033
1307 Ga0207706_10022715
1308 Ga0207706_10089555
1309 Ga0207686_10018200
1310 Ga0207709_10123245
1311 Ga0207665_10001073
1312 Ga0207665_10024965
1313 Ga0207665_10027731
1314 Ga0207691_10032411
1315 Ga0207689_10012904
1316 Ga0207661_10005201
1317 Ga0207661_10117238
1318 Ga0207661_10265465
1319 Ga0207661_10318757
1320 Ga0207679_10128966
1321 Ga0207651_10155115
1322 Ga0207668_10023324
1323 Ga0207668_10113067
1324 Ga0207658_10084089
1325 Ga0207677_10045492
1326 Ga0207703_10136815
1327 Ga0207639_10152878
1328 Ga0207678_10000552
1329 Ga0207678_10012122
1330 Ga0207708_10016973
1331 Ga0207702_10192351
1332 Ga0207702_10245455
1333 Ga0207702_10487469
1334 Ga0207641_10002132
1335 Ga0207641_10040438
1336 Ga0207641_10091403
1337 Ga0207641_10243738
1338 Ga0207641_10272842
1339 Ga0207648_10069074
1340 Ga0207676_10203342
1341 Ga0207674_10004442
1342 Ga0207674_10195303
1343 Ga0207675_100022004
1344 Ga0207675_100033345
1345 Ga0207683_10002778
1346 Ga0207683_10368872
1347 Ga0207428_10039743
1348 Ga0268266_10012597
1349 Ga0268264_10004106
1350 Ga0265337_1000029
1351 Ga0265326_10002030
1352 Ga0265319_1005636
1353 Ga0265334_10001137
1354 Ga0265318_10069542
1355 Ga0265323_10014236
1356 Ga0265336_10020254
1357 Ga0265338_10000175
1358 Ga0265338_10000436
1359 Ga0265338_10004964
1360 Ga0265338_10005981
1361 Ga0265324_10005049
1362 Ga0316177_1003448
1363 Ga0316176_1024211
1364 Ga0314311_1157289
1365 Ga0316180_1036232
1366 Ga0265332_10048359
1367 Ga0265320_10005394
1368 Ga0265325_10005263
1369 Ga0265340_10003762
1370 Ga0265339_10008916
1371 Ga0265327_10000246
1372 Ga0265316_10012850
1373 Ga0307509_10053096
1374 Ga0307408_100156669
1375 Ga0265313_10006156
1376 Ga0265314_10045687
1377 Ga0265342_10056556
1378 Ga0316578_10053577
1379 Ga0316214_1005685
1380 Ga0373948_0003623
1381 Ga0373926_0000298
1382 Ga0373926_0001951
1383 Ga0373926_0053127
1384 Ga0373934_0000127
1385 Ga0373934_0000666
1386 Ga0373934_0027350
1387 Ga0373934_0041259
1388 Ga0373934_0060239
1389 Ga0373940_0004432
1390 Ga0373940_0007303
1391 Ga0373949_0008783
1392 Ga0373923_0000778
1393 Ga0373923_0023180
1394 Ga0373923_0043236
1395 Ga0373923_0058186
1396 Ga0373923_0082047
1397 Ga0373932_0027270
1398 Ga0373936_0000200
1399 Ga0373936_0003669
1400 Ga0373936_0005680
1401 Ga0373939_0084863
1402 Ga0373941_0056713
1403 Ga0373945_0000615
1404 Ga0373945_0022029
1405 Ga0373953_0001228
1406 Ga0373953_0001345
1407 Ga0373953_0005883
1408 Ga0373953_0010326
1409 Ga0373953_0023360
1410 Ga0373953_0116948
1411 Ga0373954_0004112
1412 Ga0373954_0070300
1413 Ga0373954_0105597
1414 Ga0373954_0109196
1415 Ga0373954_0198131
1416 Ga0373956_0005048
1417 Ga0373956_0007016
1418 Ga0373956_0015390
1419 Ga0373956_0018019
1420 Ga0373956_0023777
1421 Ga0373957_0000382
1422 Ga0373957_0001217
1423 Ga0373957_0005940
1424 Ga0373957_0018173
1425 Ga0373957_0028488
1426 Ga0373943_0001122
1427 Ga0373943_0005113
1428 Ga0373943_0028916
1429 Ga0373943_0153787
1430 Ga0373943_0193654
1431 Ga0373946_0000133
1432 Ga0373946_0000657
1433 Ga0373946_0022631
1434 Ga0373955_0000104
1435 Ga0373955_0002558
1436 Ga0373955_0003003
1437 Ga0373955_0019613
1438 Ga0373955_0021614
1439 Ga0373955_0037185
1440 Ga0373942_0014022
1441 Ga0373961_0021412
1442 Ga0373962_0024411
1443 Ga0373924_0000089
1444 Ga0373924_0000461
1445 Ga0373924_0018443
1446 Ga0373924_0060119
1447 Ga0373924_0072630
1448 Ga0373924_0121781
1449 Ga0373931_0012604
1450 Ga0373935_0001924
1451 Ga0373935_0018839
1452 Ga0373935_0022142
1453 Ga0373935_0032679
1454 Ga0373935_0054497
1455 Ga0373935_0076685
1456 Ga0373935_0076706
1457 Ga0373927_0004795
1458 Ga0373927_0022395
1459 Ga0373927_0100916
1460 Ga0373933_0000344
1461 Ga0373933_0008889
1462 Ga0373933_0013645
1463 Ga0373933_0022514
1464 Ga0373933_0032943
1465 Ga0373933_0038674
1466 Ga0373933_0061357
1467 Ga0373947_0000001
1468 Ga0373947_0000713
1469 Ga0373947_0002054
1470 Ga0373947_0052877
1471 Ga0373947_0056245
1472 Ga0373947_0220274
1473 Ga0373937_0000029
1474 Ga0373937_0001321
1475 Ga0373937_0019707
1476 Ga0373937_0023604
1477 Ga0373937_0053453
1478 Ga0373937_0109196
1479 Ga0373937_0122863
1480 Ga0373937_0138862
1481 Ga0373937_0142425
1482 Ga0373937_0169624
1483 Ga0372808_005845
1484 Ga0373925_0000051
1485 Ga0373925_0000746
1486 Ga0373925_0001818
1487 Ga0373925_0012835
1488 Ga0373925_0044607
1489 Ga0373925_0054461
1490 Ga0373925_0066392
1491 Ga0373925_0089925
1492 Ga0373925_0166099
1493 Ga0395900_0447085
1494 Ga0436364_0022484
1495 Ga0436364_0038371
1496 Ga0436364_0207895
1497 Ga0436364_0261777
1498 Ga0436364_0607771
1499 Ga0436364_0653920
1500 Ga0436364_1492889
1501 Ga0436365_0469598
1502 Ga0436365_0795808
1503 Ga0436365_1139118
1504 Ga0436365_1324307
1505 Ga0436365_1937384
1506 Ga0436360_0620934
1507 Ga0436363_0275598
1508 Ga0436363_0802797
1509 Ga0436363_0915299
1510 Ga0466972_0002299
1511 Ga0466972_0005017
1512 Ga0466972_0011314
1513 Ga0466972_0070602
1514 Ga0466965_0007426
1515 Ga0466965_0012306
1516 Ga0466965_0015451
1517 Ga0466966_0007826
1518 Ga0466966_0118455
1519 Ga0466961_0009319
1520 Ga0466961_0269615
1521 Ga0466963_0009920
1522 Ga0466963_0028403
1523 Ga0466963_0034847
1524 Ga0466963_0082914
1525 Ga0466963_0158614
1526 Ga0466963_0223201
1527 Ga0466971_0036024
1528 Ga0466968_0000520
1529 Ga0466970_0015442
1530 Ga0466970_0018922
1531 Ga0466957_0044411
1532 Ga0466957_0110955
1533 Ga0466957_0301196
1534 Ga0466960_0001803
1535 Ga0466960_0002210
1536 Ga0466960_0005461
1537 Ga0466960_0007239
1538 Ga0466959_0001523
1539 Ga0466959_0128134
1540 Ga0466958_0012622
1541 Ga0466958_0079049
1542 Ga0466958_0123415
1543 Ga0466958_0210483
1544 Ga0466967_0026207
1545 Ga0466967_0041230
1546 Ga0466967_0060504
1547 Ga0466967_0067276
1548 Ga0466967_0107709
1549 Ga0466967_0108943
1550 Ga0466967_0267124
1551 Ga0466967_0281218
1552 Ga0466967_0343048
1553 Ga0495592_0000040
1554 Ga0495592_0004066
1555 Ga0495592_0004607
1556 Ga0495592_0014414
1557 Ga0495592_0026105
1558 Ga0495592_0174242
1559 Ga0495592_0258768
1560 Ga0495603_0003281
1561 Ga0495629_0009622
1562 Ga0495629_0016375
1563 Ga0495629_0020486
1564 Ga0495629_0209935
1565 Ga0495641_0002661
1566 Ga0495641_0008226
1567 Ga0495641_0023583
1568 Ga0495651_0000017
1569 Ga0495651_0004720
1570 Ga0495651_0008205
1571 Ga0495651_0011586
1572 Ga0495651_0043565
1573 Ga0495651_0077846
1574 Ga0495651_0299850
1575 Ga0495653_0002780
1576 Ga0495653_0005046
1577 Ga0495653_0005317
1578 Ga0495653_0006639
1579 Ga0495653_0010190
1580 Ga0495653_0104450
1581 Ga0495653_0193363
1582 Ga0495650_0067876
1583 Ga0495580_0001230
1584 Ga0495580_0172776
1585 Ga0495582_0000867
1586 Ga0495582_0115017
1587 Ga0495639_0003679
1588 Ga0495639_0113780
1589 Ga0495662_0000668
1590 Ga0495662_0018037
1591 Ga0495662_0024483
1592 Ga0495662_0034250
1593 Ga0495662_0059792
1594 Ga0495664_0004823
1595 Ga0495664_0005990
1596 Ga0495664_0020630
1597 Ga0495664_0046273
1598 Ga0495664_0068699
1599 Ga0495664_0074885
1600 Ga0495664_0154613
1601 Ga0495606_0033078
1602 Ga0495608_0000415
1603 Ga0495608_0006208
1604 Ga0495608_0008989
1605 Ga0495608_0021664
1606 Ga0495608_0050356
1607 Ga0495618_0002727
1608 Ga0495618_0012852
1609 Ga0495618_0026176
1610 Ga0495618_0047569
1611 Ga0495618_0109903
1612 Ga0495628_0000756
1613 Ga0495628_0009420
1614 Ga0495628_0020189
1615 Ga0495628_0059312
1616 Ga0495628_0124644
1617 Ga0495628_0232791
1618 Ga0495630_0001078
1619 Ga0495630_0033094
1620 Ga0495630_0071256
1621 Ga0495630_0120944
1622 Ga0495666_0003716
1623 Ga0495666_0060684
1624 Ga0495666_0072473
1625 Ga0495652_0003051
1626 Ga0495652_0010386
1627 Ga0495652_0058652
1628 Ga0495652_0064690
1629 Ga0495652_0149268
1630 Ga0495652_0173913
1631 Ga0495652_0177097
1632 Ga0495665_0000134
1633 Ga0495665_0009177
1634 Ga0495665_0011365
1635 Ga0495640_0009227
1636 Ga0495640_0029695
1637 Ga0495640_0198796
1638 Ga0495586_0002971
1639 Ga0495587_0000419
1640 Ga0495587_0002110
1641 Ga0495587_0009754
1642 Ga0495587_0033147
1643 Ga0495587_0035854
1644 Ga0495587_0039213
1645 Ga0495587_0045103
1646 Ga0495587_0073360
1647 Ga0495645_0008285
1648 Ga0495645_0038872
1649 Ga0495645_0040081
1650 Ga0495645_0064146
1651 Ga0495645_0102574
1652 Ga0495622_0058710
1653 Ga0495667_0000336
1654 Ga0495667_0002108
1655 Ga0495667_0005389
1656 Ga0495667_0010012
1657 Ga0495667_0010079
1658 Ga0495667_0021069
1659 Ga0495667_0025039
1660 Ga0495667_0031721
1661 Ga0495634_0003699
1662 Ga0495634_0061896
1663 Ga0495634_0066969
1664 Ga0495634_0212588
1665 Ga0495634_0213915
1666 Ga0495635_0001724
1667 Ga0495635_0012119
1668 Ga0495635_0047265
1669 Ga0495635_0047908
1670 Ga0495635_0052668
1671 Ga0495635_0055387
1672 Ga0495635_0056829
1673 Ga0495635_0070778
1674 Ga0495635_0073060
1675 Ga0495635_0099653
1676 Ga0495588_0025172
1677 Ga0495657_0000032
1678 Ga0495657_0020005
1679 Ga0495657_0026860
1680 Ga0495657_0036208
1681 Ga0495657_0043318
1682 Ga0495657_0045281
1683 Ga0495657_0046319
1684 Ga0495657_0055247
1685 Ga0495599_0000412
1686 Ga0495599_0004894
1687 Ga0495599_0025657
1688 Ga0495599_0037219
1689 Ga0495599_0056674
1690 Ga0495599_0093726
1691 Ga0495599_0098378
1692 Ga0495599_0190100
1693 Ga0495623_0000675
1694 Ga0495623_0029862
1695 Ga0495623_0037567
1696 Ga0495623_0123594
1697 Ga0495646_0005293
1698 Ga0495646_0013379
1699 Ga0495646_0039402
1700 Ga0495646_0055727
1701 Ga0495646_0058163
1702 Ga0495658_0000376
1703 Ga0495658_0048718
1704 Ga0495613_0001261
1705 Ga0495613_0021059
1706 Ga0495613_0180187
1707 Ga0495624_0001162
1708 Ga0495624_0007172
1709 Ga0495624_0035272
1710 Ga0495624_0088418
1711 Ga0495649_0157896
1712 Ga0495600_0000683
1713 Ga0495600_0012175
1714 Ga0495600_0021876
1715 Ga0495600_0024003
1716 Ga0495600_0051462
1717 Ga0495600_0072233
1718 Ga0495600_0271672
1719 Ga0495581_0004652
1720 Ga0495581_0004741
1721 Ga0495581_0014002
1722 Ga0495581_0037476
1723 Ga0495581_0100853
1724 Ga0495604_0000627
1725 Ga0495604_0010768
1726 Ga0495604_0013549
1727 Ga0495604_0029565
1728 Ga0495604_0052683
1729 Ga0495604_0100193
1730 Ga0495674_0004676
1731 Ga0495674_0009201
1732 Ga0495674_0026417
1733 Ga0495674_0154271
1734 Ga0495674_0219602
1735 Ga0495676_0002068
1736 Ga0495676_0011340
1737 Ga0495676_0163060
1738 Ga0495680_0001340
1739 Ga0495680_0002955
1740 Ga0495680_0004557
1741 Ga0495680_0017001
1742 Ga0495680_0024279
1743 Ga0495680_0157438
1744 Ga0495675_0008576
1745 Ga0495675_0023434
1746 Ga0495675_0026076
1747 Ga0495675_0064642
1748 Ga0495685_010874
1749 Ga0495684_0002024
1750 Ga0495684_0002236
1751 Ga0495684_0009603
1752 Ga0495684_0010833
1753 Ga0495684_0020391
1754 Ga0495684_0027577
1755 Ga0495684_0058448
1756 Ga0495684_0114025
1757 Ga0495684_0211035
1758 Ga0495686_0023719
1759 Ga0495593_0002690
1760 Ga0495593_0007716
1761 Ga0495593_0012450
1762 Ga0495593_0041959
1763 Ga0495602_0001077
1764 Ga0495602_0030905
1765 Ga0495602_0040713
1766 Ga0495602_0045172
1767 Ga0495602_0060021
1768 Ga0495602_0156441
1769 Ga0495614_0009076
1770 Ga0496100_0001640
1771 Ga0496100_0082488
1772 Ga0496100_0198350
1773 Ga0496101_0000395
1774 Ga0496101_0093368
1775 Ga0496101_0133587
1776 Ga0496102_0000011
1777 Ga0496102_0000029
1778 Ga0496102_0000292
1779 Ga0496102_0049716
1780 Ga0496102_0078587
1781 Ga0496102_0166598
1782 Ga0496102_0224414
1783 Ga0496103_0000143
1784 Ga0496103_0000296
1785 Ga0496103_0000431
1786 Ga0496103_0037709
1787 Ga0496103_0062898
1788 Ga0496104_0008912
1789 Ga0496105_0006989
1790 Ga0496105_0027956
1791 Ga0496106_0002927
1792 Ga0496106_0189331
1793 Ga0496107_0005683
1794 Ga0496107_0055516
1795 Ga0496108_0131740
1796 Ga0496108_0131853
1797 Ga0496109_0068511
1798 Ga0496109_0072263
1799 Ga0496109_0156681
1800 Ga0496110_0016518
1801 Ga0496110_0043835
1802 Ga0496110_0053361
1803 Ga0496110_0091469
1804 Ga0496110_0102664
1805 Ga0496111_0016728
1806 Ga0496111_0026714
1807 Ga0496112_0034576
1808 Ga0496112_0122137
1809 Ga0496113_0011885
1810 Ga0496113_0017401
1811 Ga0496113_0130492
1812 Ga0496113_0305993
1813 Ga0496114_0003724
1814 Ga0496114_0276679
1815 Ga0496114_0345998
1816 Ga0496115_0082002
1817 Ga0496115_0084901
1818 Ga0496116_0000072
1819 Ga0496116_0000422
1820 Ga0496117_0000039
1821 Ga0496117_0000682
1822 Ga0496118_0000035
1823 Ga0496118_0000437
1824 Ga0496118_0000598
1825 Ga0496119_0000517
1826 Ga0496119_0002265
1827 Ga0496119_0039881
1828 Ga0496119_0060487
1829 Ga0496119_0143577
1830 Ga0496120_0000631
1831 Ga0496120_0038488
1832 Ga0496121_0002639
1833 Ga0496121_0132651
1834 Ga0496122_0021922
1835 Ga0496123_0009759
1836 Ga0496126_0000344
1837 Ga0496126_0000379
1838 Ga0496126_0002073
1839 Ga0496126_0002899
1840 Ga0496126_0005028
1841 Ga0496126_0053530
1842 Ga0496126_0198462
1843 Ga0496126_0253578
1844 Ga0501031_0000061
1845 Ga0501032_0000155
1846 Ga0501032_0075471
1847 Ga0501032_0107558
1848 Ga0501033_0000217
1849 Ga0501034_0001039
1850 Ga0501034_0122402
1851 Ga0501034_0168470
1852 Ga0501036_0002172
1853 Ga0501036_0047832
1854 Ga0501037_0026771
1855 Ga0501037_0058863
1856 Ga0501038_0000167
1857 Ga0501039_0000153
1858 Ga0501042_0101359
1859 Ga0501043_0000079
1860 Ga0501043_0001428
1861 Ga0501043_0072309
1862 Ga0501046_0008291
1863 Ga0501047_0000565
1864 Ga0501047_0010544
1865 Ga0501047_0017638
1866 Ga0501047_0084715
1867 Ga0501047_0179657
1868 Ga0501047_0277844
1869 Ga0501048_0000141
1870 Ga0501048_0008749
1871 Ga0501067_0004847
1872 Ga0501069_0000117
1873 Ga0501069_0012357
1874 Ga0501069_0244191
1875 Ga0501070_0000217
1876 Ga0501070_0001241
1877 Ga0501070_0024834
1878 Ga0501070_0125394
1879 Ga0501070_0413083
1880 Ga0501071_0025200
1881 Ga0501073_0006678
1882 Ga0501073_0032860
1883 Ga0501074_0000226
1884 Ga0501074_0003971
1885 Ga0501080_0000079
1886 Ga0501080_0001119
1887 Ga0501080_0033432
1888 Ga0501035_0000786
1889 Ga0501035_0015462
1890 Ga0501044_0001530
1891 Ga0501044_0022723
1892 nmdc:mga03n38_1095_c1
1893 nmdc:mga03n38_11307_c1
1894 nmdc:mga03n38_8689_c1
1895 nmdc:mga00v17_12331_c1
1896 nmdc:mga00v17_7415_c1
1897 nmdc:mga06z11_9524_c1
1898 nmdc:mga04h51_19012_c1
1899 nmdc:mga07m45_172057_c1
1900 nmdc:mga05p37_174869_c1
1901 nmdc:mga05p37_357616_c1
1902 nmdc:mga09592_11839_c1
1903 nmdc:mga0n895_10593_c1
1904 nmdc:mga0n895_36156_c1
1905 nmdc:mga0n895_403209_c1
1906 nmdc:mga0rr50_145137_c1
1907 nmdc:mga0rr50_313434_c1
1908 nmdc:mga0rr50_4657_c1
1909 nmdc:mga0rr50_80405_c1
1910 nmdc:mga08x19_36785_c1
1911 nmdc:mga08x19_9136_c1
1912 nmdc:mga0a205_173719_c1
1913 Ga0495601_0001363
1914 Ga0495601_0022765
1915 Ga0495601_0031731
1916 Ga0495612_0001188
1917 Ga0495612_0006147
1918 Ga0495612_0021323
1919 Ga0500635_0005708
1920 Ga0495595_0067103
1921 Ga0495619_0000574
1922 Ga0495619_0027532
1923 Ga0495619_0040378
1924 Ga0495619_0111073
1925 Ga0500643_001870
1926 Ga0500559_0002620
1927 Ga0500559_0020901
1928 Ga0501084_0003565
1929 Ga0466962_0052625
1930 2501943711
1931 2515721142
1932 2515850619
1933 2516084251
1934 2623585723
1935 2644014053
1936 2644174385
1937 2644445087
1938 2676475169
1939 2739602995
1940 2808851881
1941 2816425648
1942 2816505811
1943 2817508483
1944 2827629898
1945 2856743867
1946 2856859608
1947 2857727926
1948 2861528174
1949 2867509836
1950 2870783043
1951 2873319493
1952 2883825436
1953 2891331119
1954 2891400575
1955 2891562277
1956 2891569693
1957 2902797350
1958 2905927635
1959 2905929192
1960 2915363091
1961 2917740971
1962 3003009313
1963 649816316
1964 8004022882
1965 8004026101
1966 8053953147
1967 8054476866
1968 8055069984
1969 8055174623
1970 8057571017

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

80

243

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

248

376

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9189 31 335
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9166 31 335
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8575 31 335
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.857 31 335
6y1x-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8222 39 245
ID Description Score Start End Superfamily
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 30 357 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9597 30 357 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9566 28 357 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9509 28 357 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9299 30 357 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6H1A2P6-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.994 30 357 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A3G8ZJ84-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9893 22 357 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A7W0ID98-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9877 27 357 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2X0IJG0-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9855 27 357 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A6H1A2P6-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.985 30 357 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047

Map